Students' Understanding of Stern Gerlach Experiment
International Nuclear Information System (INIS)
Zhu Guangtian; Singh, Chandralekha
2009-01-01
The Stern Gerlach experiment has played a central role in the discovery of spin angular momentum and it has also played a pivotal role in elucidating foundational issues in quantum mechanics. Here, we discuss investigation of students' difficulties related to the Stern Gerlach experiment by giving written tests and interviewing advanced undergraduate and graduate students in quantum mechanics. We also discuss preliminary data that suggest that the Quantum Interactive Learning Tutorial (QuILT) related to the Stern Gerlach experiment is helpful in improving students' understanding of these concepts.
Stern-Gerlach experiment, electron spin and intermediate quantum mechanics
Energy Technology Data Exchange (ETDEWEB)
Mackintosh, A.R. (Copenhagen Univ. (Denmark). H.C. Oersted Inst.)
1983-01-01
The paper deals with the theory of electron spin. The Stern-Gerlach experiment, the anticommutation relations and the properties of spin operators are discussed. The Pauli theory, Dirac transformation theory, the double Stern-Gerlach experiment, the EPR paradox and Bell's inequality are also covered.
The Stern-Gerlach experiment, electron spin and intermediate quantum mechanics
International Nuclear Information System (INIS)
Mackintosh, A.R.
1983-01-01
The paper deals with the theory of electron spin. The Stern-Gerlach experiment, the anticommutation relations and the properties of spin operators are discussed. The Pauli theory, Dirac transformation theory, the double Stern-Gerlach experiment, the EPR paradox and Bell's inequality are also covered. (U.K.)
Stern-Gerlach Experiments and Complex Numbers in Quantum Physics
Sivakumar, S.
2012-01-01
It is often stated that complex numbers are essential in quantum theory. In this article, the need for complex numbers in quantum theory is motivated using the results of tandem Stern-Gerlach experiments
Spin state determination using Stern-Gerlach device
International Nuclear Information System (INIS)
Shirokov, M.I.
1996-01-01
The well-known Stern-Gerlach device is proposed here for determination of a particle spin state instead of using it for measurement of spin observables. It is shown that measurement of particle momentum distributions (before and after the action of the device magnetic field) allows one to determine the particle initial spin state in the case of an arbitrary spin value. It is demonstrated that one cannot use for this purpose the usual treatment of the Stern-Gerlach experiment based on the entanglement of spin and spatial states. 11 refs
A modified Stern-Gerlach experiment using a quantum two-state magnetic field
Daghigh, Ramin G.; Green, Michael D.; West, Christopher J.
2018-06-01
The Stern-Gerlach experiment has played an important role in our understanding of quantum behavior. We propose and analyze a modified version of this experiment where the magnetic field of the detector is in a quantum superposition, which may be experimentally realized using a superconducting flux qubit. We show that if incident spin-1/2 particles couple with the two-state magnetic field, a discrete target distribution results that resembles the distribution in the classical Stern-Gerlach experiment. As an application of the general result, we compute the distribution for a Gaussian waveform of the incident fermion. This analysis allows us to demonstrate theoretically: (1) the quantization of the intrinsic angular momentum of a spin-1/2 particle, and (2) a correlation between EPR pairs leading to nonlocality, without necessarily collapsing the particle's spin wavefunction.
All-Optical Stern-Gerlach Effect
Karnieli, Aviv; Arie, Ady
2018-01-01
We introduce a novel formalism in which the paraxial coupled wave equations of the nonlinear optical sum-frequency generation process are shown to be equivalent to the Pauli equation describing the dynamics of a spin-1 /2 particle in a spatially varying magnetic field. This interpretation gives rise to a new classical state of paraxial light, described by a mutual beam comprising of two frequencies. As a straightforward application, we propose the existence of an all-optical Stern-Gerlach effect, where an idler beam is deflected by a gradient in the nonlinear coupling, into two mutual beams of the idler and signal waves (equivalent to oppositely oriented spinors), propagating in two discrete directions. The Stern-Gerlach deflection angle and the intensity pattern in the far field are then obtained analytically, in terms of the parameters of the original optical system, laying the grounds for future experimental realizations.
Stern-Gerlach interaction in fermion beams
International Nuclear Information System (INIS)
Cameron, P.; Luccio, A.U.; MacKay, W.W.; Conte, M.; Ferro, M.; Gemme, G.; Palazzi, M.; Parodi, R.; Pusterla, M.
2001-01-01
The Stern-Gerlach interaction, between a moving charged particle endowed with a magnetic moment and a radio-frequency e.m. field, is studied by means of a semi-classical approach. Theoretical results are presented, and a possible experimental check of this theory is discussed
Stern-Gerlach effect without magnetic-field gradient
International Nuclear Information System (INIS)
Zimmer, O.; Felber, J.; Schaerpf, O.
2001-01-01
The Stern-Gerlach effect is the well-known spin-dependent splitting of a neutral particle beam by a magnetic-field gradient. Guided by the pseudomagnetic analogy, we performed a similar experiment where no magnetic-field gradient is involved. The effect is due to the spin-dependence of neutron scattering from polarised nuclei, i.e. caused by the strong interaction between neutrons and nuclei. The beam splitting is proportional to the nuclear polarisation and to the spin-dependent part of the neutron scattering length. Thus it can be used to measure one of both quantities. (orig.)
Observation of the continuous stern-gerlach effect on an electron bound in an atomic Ion
Hermanspahn; Haffner; Kluge; Quint; Stahl; Verdu; Werth
2000-01-17
We report on the first observation of the continuous Stern-Gerlach effect on an electron bound in an atomic ion. The measurement was performed on a single hydrogenlike ion ( 12C5+) in a Penning trap. The measured g factor of the bound electron, g = 2.001 042(2), is in excellent agreement with the theoretical value, confirming the relativistic correction at a level of 0.1%. This proves the possibility of g-factor determinations on atomic ions to high precision by using the continuous Stern-Gerlach effect. The result demonstrates the feasibility of conducting experiments on single heavy highly charged ions to test quantum electrodynamics in the strong electric field of the nucleus.
Microscopic Stern-Gerlach effect and spin-orbit pendulum
International Nuclear Information System (INIS)
Rozmej, P.; Arvieu, R.
1996-01-01
The motion of a particle with spin in spherical harmonic oscillator potential with spin-orbit interaction is discussed. The attention is focused on the spatial motion of wave packets. The particular case of wave packets moving along the circular orbits for which the most transparent and pedagogical description is possible is considered. The splitting of the wave packets into two components moving differently along classical orbits reflects a strong analogy with the Stern-Gerlach experiment. The periodic transfer of average angular momentum between spin and orbital subspaces accompanying this time evolution is called the spin-orbit pendulum. (author). 6 refs, 3 figs
Construction of exact solutions for the Stern-Gerlach effect
International Nuclear Information System (INIS)
Diaz Bulnes, J.; Oliveira, I.S.
2001-01-01
We obtain exact solutions for the Schroedinger-Pauli matrix equation for a neutral particle of spin 1/2 in a magnetic field with a field gradient. The analytical wave functions are written on the symmetry plane Y = 0, which contains the incident and splitted beams, in terms of the Airy functions. The time-evolution of the probability, |Ψ+| 2 and |Ψ-| 2 , and the eigenenergies are calculated. The include a small contribution from the field gradient, α, proportional to (α ℎ) 2/3 , which amount to equal energy displacements on both magnetic levels. The results are generalized for spin S = 3/2, and in this case we found that the m = ±1/2 and m = ±3/2 magnetic sublevels are unequally splitted by the field gradient, being the difference in energy of the order 0.4 MHz. Replacing real experimental parameters we obtained a spatial splitting of the spin up and spin down states of the order Δz ≅4 mm, in accordance to a real Stern-Gerlach experiment. (author)
International Nuclear Information System (INIS)
Trimeche, Azer
2013-01-01
This work focuses on the study and implementation of a new technique of deceleration of a supersonic beam of paramagnetic particles using a co-moving progressive wave of magnetic field. This technique relies on a method of slowing based on Stern-Gerlach forces acting on a paramagnetic system in motion in the presence of a co-propagating magnetic field. This highly innovative approach has the advantage of being applicable to a wide range of species and opens up new opportunities. A suitable theoretical approach is followed, that allows for a direct link between theory, programming of experimental parameters, and experimental results in a systematic, rational and predictive manner. The understanding and control of the dynamics of trapping at a given speed, acceleration and deceleration require decoupling between the transverse and longitudinal effects of the wave. These effects are clearly visible when the added uniform magnetic field limits the transverse effects of the progressive wave of magnetic field. The outlooks for the new Zeeman Stern Gerlach decelerator are numerous. Deceleration paramagnetic molecules, free radicals and neutrons are possible. (author) [fr
International Nuclear Information System (INIS)
Arend, Nikolas; Gaehler, Roland; Keller, Thomas; Georgii, Robert; Hils, Thomas; Boeni, Peter
2004-01-01
If a neutron pulse passes through an NRSE flipper coil, the coherent splitting in energy of the spin-up and spin-down states leads to their macroscopic spatial separation, depending on the experimental parameters (longitudinal Stern-Gerlach effect). We furthermore present a discussion about the effects measurability and propose two possible setups
Energy Technology Data Exchange (ETDEWEB)
Arend, Nikolas; Gaehler, Roland; Keller, Thomas; Georgii, Robert; Hils, Thomas; Boeni, Peter
2004-06-21
If a neutron pulse passes through an NRSE flipper coil, the coherent splitting in energy of the spin-up and spin-down states leads to their macroscopic spatial separation, depending on the experimental parameters (longitudinal Stern-Gerlach effect). We furthermore present a discussion about the effects measurability and propose two possible setups.
International Nuclear Information System (INIS)
Hertenberger, R.; Eisermann, Y.; Metz, A.; Schiemenz, P.; Graw, G.
2001-01-01
The 14 year old Lamb-Shift hydrogen source of the Munich Tandem laboratory is presently replaced by a newly developed Stern-Gerlach type atomic beam source (ABS) with electron-cyclotron-resonance (ECR) ionization and subsequent double charge exchange in a supersonic cesium vapor jet target. The atomic beam source provides an intensity of 6.4*10 16 atoms/sec of polarized hydrogen and of about 5*10 16 atoms/sec of polarized deuterium. Beam intensities larger than 100 μA were observed for positive H-vector + and D-vector + ion beams after ECR ionization and intensities larger than 10 μA for negative D-vector - ion beams in three magnetic substates
Consideration of possible mass and velocity corrections to magnetic cluster experiments
International Nuclear Information System (INIS)
Liu, Z.Y.; Dowben, P.A.; Popov, A.P.; Pappas, David P.
2003-01-01
Gadolinium occurs, in natural abundance, as several isotopes. The possible combinations of different gadolinium isotopes dictates that even for a fixed number of atoms in the cluster, clusters of gadolinium atoms will exhibit a range of masses. This and the expected consequence of the translation energy distributions are explored as possible corrections to Stern-Gerlach cluster beam-deflection experiments. Upon closer inspection of the experimental data, we find that the translation energy plus the vibrational temperature distribution may be inhomogeneous. This could be the origin of a long tail to high deflections in the experimental deflection profiles, at low cluster temperatures, in the magnetic cluster Stern-Gerlach experiments
Stern-Center Potsdam; Stern-Center Potsdam
Energy Technology Data Exchange (ETDEWEB)
Anon.
1999-07-01
The ''Stern-Center Potsdam'' is a star-shaped shopping mall in the city center. [German] Das Stern-Center in Potsdam bietet als Einkaufszentrum vor den Toren Berlins Platz fuer eine Vielzahl von Geschaeften. Die sternfoermige Gebaeudestruktur des Centers bildet den Mittelpunkt des Stadtviertels 'Am Stern'. (orig.)
Gouy Phase Radial Mode Sorter for Light: Concepts and Experiments.
Gu, Xuemei; Krenn, Mario; Erhard, Manuel; Zeilinger, Anton
2018-03-09
We present an in principle lossless sorter for radial modes of light, using accumulated Gouy phases. The experimental setups have been found by a computer algorithm, and can be intuitively understood in a geometric way. Together with the ability to sort angular-momentum modes, we now have access to the complete two-dimensional transverse plane of light. The device can readily be used in multiplexing classical information. On a quantum level, it is an analog of the Stern-Gerlach experiment-significant for the discussion of fundamental concepts in quantum physics. As such, it can be applied in high-dimensional and multiphotonic quantum experiments.
Procamacolahnus tubifer Gerlach, 1953, Procamacolaimus ...
African Journals Online (AJOL)
1988-01-25
Jan 25, 1988 ... c': tail length divided by anal body width. V: distance of vulva from ant. end as a percentage of body length. Procamacolaimus tubifer Gerlach, 1953 (Figure 1,. A-H). (. This is a redescription of P. tubiter. Three males and one female are recorded - all from Cape Receife Beach at depths of between 15-90 em, ...
Quantum theory as the most robust description of reproducible experiments
International Nuclear Information System (INIS)
De Raedt, Hans; Katsnelson, Mikhail I.; Michielsen, Kristel
2014-01-01
It is shown that the basic equations of quantum theory can be obtained from a straightforward application of logical inference to experiments for which there is uncertainty about individual events and for which the frequencies of the observed events are robust with respect to small changes in the conditions under which the experiments are carried out. - Highlights: • It is shown that logical inference, that is, inductive reasoning, provides a rational explanation for the success of quantum theory. • The Schrödinger equation is obtained through logical inference applied to robust experiments. • The singlet and triplet states follow from logical inference applied to the Einstein-Podolsky-Rosen-Bohm experiment. • Robustness also leads to the quantum theoretical description of the Stern-Gerlach experiment
Quantum theory as the most robust description of reproducible experiments
Energy Technology Data Exchange (ETDEWEB)
De Raedt, Hans, E-mail: h.a.de.raedt@rug.nl [Department of Applied Physics, Zernike Institute for Advanced Materials, University of Groningen, Nijenborgh 4, NL-9747AG Groningen (Netherlands); Katsnelson, Mikhail I., E-mail: M.Katsnelson@science.ru.nl [Radboud University Nijmegen, Institute for Molecules and Materials, Heyendaalseweg 135, NL-6525AJ Nijmegen (Netherlands); Michielsen, Kristel, E-mail: k.michielsen@fz-juelich.de [Institute for Advanced Simulation, Jülich Supercomputing Centre, Forschungszentrum Jülich, D-52425 Jülich (Germany); RWTH Aachen University, D-52056 Aachen (Germany)
2014-08-15
It is shown that the basic equations of quantum theory can be obtained from a straightforward application of logical inference to experiments for which there is uncertainty about individual events and for which the frequencies of the observed events are robust with respect to small changes in the conditions under which the experiments are carried out. - Highlights: • It is shown that logical inference, that is, inductive reasoning, provides a rational explanation for the success of quantum theory. • The Schrödinger equation is obtained through logical inference applied to robust experiments. • The singlet and triplet states follow from logical inference applied to the Einstein-Podolsky-Rosen-Bohm experiment. • Robustness also leads to the quantum theoretical description of the Stern-Gerlach experiment.
Gouy Phase Radial Mode Sorter for Light: Concepts and Experiments
Gu, Xuemei; Krenn, Mario; Erhard, Manuel; Zeilinger, Anton
2018-03-01
We present an in principle lossless sorter for radial modes of light, using accumulated Gouy phases. The experimental setups have been found by a computer algorithm, and can be intuitively understood in a geometric way. Together with the ability to sort angular-momentum modes, we now have access to the complete two-dimensional transverse plane of light. The device can readily be used in multiplexing classical information. On a quantum level, it is an analog of the Stern-Gerlach experiment—significant for the discussion of fundamental concepts in quantum physics. As such, it can be applied in high-dimensional and multiphotonic quantum experiments.
Energy Technology Data Exchange (ETDEWEB)
Huber, Josef Georg
2014-12-15
Walther Gerlach (1889-1979) was born in Wiesbaden-Biebrich and studied physics at the Eberhard-Karls-Universitaet in Tuebingen, where he did his doctorate in February 1912. In this work, there is no room for a complete biography either as it would exceed the scope of this thesis. It is restricted to the first part of his life, which is treated in detail. The aim of this thesis is to understand Walther Gerlach's development into a successful physicist, to find out what influenced him and to identify his achievements during this period until 1925. To gain a greater insight into his personal development the circumstances in his family as well as the conditions regarding his education in school and university will be investigated. His way of dealing with friends and colleagues is analyzed and his approaches to physical problems discussed. The personality of the physicist Gerlach rather emerges from the sum of details observed and examples quoted. However, some events in his life can be named, which show that his achievements did not happen by chance but are connected to his career. This thesis ends more or less with the beginning of the year 1925, when Gerlach accepted the chair for physics in Tuebingen.
Quantum principles and particles
Wilcox, Walter
2012-01-01
QUANTUM PRINCIPLESPerspective and PrinciplesPrelude to Quantum MechanicsStern-Gerlach Experiment Idealized Stern-Gerlach ResultsClassical Model AttemptsWave Functions for Two Physical-Outcome CaseProcess Diagrams, Operators, and Completeness Further Properties of Operators/ModulationOperator ReformulationOperator RotationBra-Ket Notation/Basis StatesTransition AmplitudesThree-Magnet Setup Example-CoherenceHermitian ConjugationUnitary OperatorsA Very Special OperatorMatrix RepresentationsMatrix Wave Function RecoveryExpectation ValuesWrap Up ProblemsFree Particles in One DimensionPhotoelectric EffectCompton EffectUncertainty Relation for PhotonsStability of Ground StatesBohr ModelFourier Transform and Uncertainty RelationsSchrödinger EquationSchrödinger Equation ExampleDirac Delta FunctionsWave Functions and ProbabilityProbability CurrentTime Separable SolutionsCompleteness for Particle StatesParticle Operator PropertiesOperator RulesTime Evolution and Expectation ValuesWrap-UpProblemsSome One-Dimensional So...
Quantum theory as plausible reasoning applied to data obtained by robust experiments.
De Raedt, H; Katsnelson, M I; Michielsen, K
2016-05-28
We review recent work that employs the framework of logical inference to establish a bridge between data gathered through experiments and their objective description in terms of human-made concepts. It is shown that logical inference applied to experiments for which the observed events are independent and for which the frequency distribution of these events is robust with respect to small changes of the conditions under which the experiments are carried out yields, without introducing any concept of quantum theory, the quantum theoretical description in terms of the Schrödinger or the Pauli equation, the Stern-Gerlach or Einstein-Podolsky-Rosen-Bohm experiments. The extraordinary descriptive power of quantum theory then follows from the fact that it is plausible reasoning, that is common sense, applied to reproducible and robust experimental data. © 2016 The Author(s).
Spin-orbit induced electronic spin separation in semiconductor nanostructures.
Kohda, Makoto; Nakamura, Shuji; Nishihara, Yoshitaka; Kobayashi, Kensuke; Ono, Teruo; Ohe, Jun-ichiro; Tokura, Yasuhiro; Mineno, Taiki; Nitta, Junsaku
2012-01-01
The demonstration of quantized spin splitting by Stern and Gerlach is one of the most important experiments in modern physics. Their discovery was the precursor of recent developments in spin-based technologies. Although electrical spin separation of charged particles is fundamental in spintronics, in non-uniform magnetic fields it has been difficult to separate the spin states of charged particles due to the Lorentz force, as well as to the insufficient and uncontrollable field gradients. Here we demonstrate electronic spin separation in a semiconductor nanostructure. To avoid the Lorentz force, which is inevitably induced when an external magnetic field is applied, we utilized the effective non-uniform magnetic field which originates from the Rashba spin-orbit interaction in an InGaAs-based heterostructure. Using a Stern-Gerlach-inspired mechanism, together with a quantum point contact, we obtained field gradients of 10(8) T m(-1) resulting in a highly polarized spin current.
Walther Gerlach (1889-1979) and his way to the successful experimental physicist until around 1925
International Nuclear Information System (INIS)
Huber, Josef Georg
2014-01-01
Walther Gerlach (1889-1979) was born in Wiesbaden-Biebrich and studied physics at the Eberhard-Karls-Universitaet in Tuebingen, where he did his doctorate in February 1912. In this work, there is no room for a complete biography either as it would exceed the scope of this thesis. It is restricted to the first part of his life, which is treated in detail. The aim of this thesis is to understand Walther Gerlach's development into a successful physicist, to find out what influenced him and to identify his achievements during this period until 1925. To gain a greater insight into his personal development the circumstances in his family as well as the conditions regarding his education in school and university will be investigated. His way of dealing with friends and colleagues is analyzed and his approaches to physical problems discussed. The personality of the physicist Gerlach rather emerges from the sum of details observed and examples quoted. However, some events in his life can be named, which show that his achievements did not happen by chance but are connected to his career. This thesis ends more or less with the beginning of the year 1925, when Gerlach accepted the chair for physics in Tuebingen.
Design and Testing of the MIT-Bates Stern-Gerlach Polarimeter Cavity
Cameron, P; Luccio, A U; MacKay, W W
2005-01-01
Historically, beam polarization measurement has been accomplished by scattering experiments, with the attendant complexity of target and detector installation and operation, and smallness and uncertainty of analyzing powers. The purpose of the present effort is to accomplish fast and accurate polarization measurement not as a scattering experiment, but rather as conventional beam instrumentation, with a resonant cavity pickup. This requires that the coupling of the beam magnetic moment to the pickup be enhanced to bring the signal above the noise floor, and that coupling of the beam charge to the pickup be diminished to reduce the dynamic range problem. We discuss details of cavity design that have been implemented to accomplish these ends. Presently, it is planned to install the cavity in the Bates Ring in early May of this year. Beyond polarimetry, successful polarization measurement will verify the underlying principles, and by pickup/kicker reciprocity will open the serious consideration of the possibilit...
Self-polarization of stored (anti-)protons: Status of the Spin-Splitter experiment at IUCF
International Nuclear Information System (INIS)
Rossmanith, R.
1990-01-01
Several years ago a selfpolarization effect for stored (anti-)protons and ions was investigated theoretically. The effect is based on the well-known Stern-Gerlach effect in gradient fields. The aim of the ongoing measurements at IUCF is to verify experimentally the various assumptions on which this effect is based. The final goal is to demonstrate this new polarization effect. The proposed effect could be a powerful tool to produce polarized stored hadron beams both in the low energy range and at SSC and LHC energies
Quantum reality theory and philosophy
Allday, Jonathan
2009-01-01
PrefaceIntroductionAuthorPart I Our First Quantum Object: Light Some Opening Thoughts A Little Light Reading Lasers and Video Cameras Photons An Interference Experiment with Photons Interference as a Wave Effect Mach-Zehnder with Photons Delayed Choice Summary Endnotes Interlude 1: Another Interference Experiment Particles Electrons The Electron Gun The Stern-Gerlach Experiment Turning Things Round Things Get More Puzzling So, Where Did It Go? What Does It All Mean? Some Indications with Other Particles The Long and the Short of It Summary Endnotes Quantum States Where Are We Now? Describing C
Polarization of antiprotons by the Stern-Gerlach effect
International Nuclear Information System (INIS)
Kewisch, J.; Rossmanith, R.; Onel, Y.; Penzo, A.; Kreiser, H.
1988-01-01
A method to obtain polarized antiprotons in the low energy storage ring LEAR via spatial separation of opposite spin states is described in earlier papers (Y. Onel et al., 1986). We will discuss here in more detail a) the integration of the special magnets (spin splitter) into the LEAR optics and b) some first tracking results of particle and spin motion in these optics. (orig./HSI)
Anatol Stern e Bruno Jasieński [Anatol Stern and Bruno Jasieński
Directory of Open Access Journals (Sweden)
Giovanna Tomassucci
2016-12-01
Full Text Available The Author presents her first Italian translation of Anatol Stern’s article (excerpted from his monograph on Polish Avantgarde Rebelled Poetry. Sketches on Interwar Period Poetry [1964, 2nd issue 1970] about another prominent initiator and ideologist of Polish futurism, Bruno Jasieński. After the Thaw, Stern first contributed to Jasieński’s rehabilitation, publishing his poetry and the novel I burn Paris and writing several essays about his work. The article presented also offers a choice of translated fragments of Jasieński’s poetry, just a few known in Italy, and an artistic profile of Stern.
Molecular beam epitaxy a short history
Orton, J W
2015-01-01
This volume describes the development of molecular beam epitaxy from its origins in the 1960s through to the present day. It begins with a short historical account of other methods of crystal growth, both bulk and epitaxial, to set the subject in context, emphasising the wide range of semiconductor materials employed. This is followed by an introduction to molecular beams and their use in the Stern-Gerlach experiment and the development of the microwave MASER.
STERN-Educational Benefits for the Space Industry
Schuttauf, K.; Stamminger, A.; Lappohn, K.; Ciezki, H.; Kitsche, W.
2015-09-01
STERN, the German word for star, is also an acronym for STudentische Experimental-RaketeN. It is a program to provide students with “hands-on” experience in space systems and research. This name was chosen for two reasons. The first reason was to emphasize the idealistic goals of spaceflight providing students with the opportunity to “reach for the stars”. The second and most important one was that the program offers engineering students a practical chance to experience the scope of aerospace and should motivate them to become a new star in this field. Currently eight German universities are participating in the STERN-program. STERN was initiated in April 2012, by the DLR Space Administration in Bonn and is supported by funds from the German Federal Ministry of Economics and Technology (BMWi). During the project runtime of three years the students should develop and launch their own rocket. There are no limits regarding trajectory, altitude or the propulsion system used (solid fuel, liquid fuel, steam or hybrid). The reason for the “no limits” strategy is to create a new perspective of a problem and encourage new technological ideas. The students shall not be limited in their creativity. Nevertheless the spacecraft should have a telemetry system to transmit key trajectory and housekeeping data back to earth during flight and provide information to the students including the rocket altitude. Moreover the rocket shall reach a velocity of at least Mach 1 . The project requirements are set to show the real world of work to the students. To reach the project goal, the students have to work project-oriented and in teams. In order to teach students engineering and science, as well as to put their technical knowledge to the test as early as possible in their studies, they are integrated into courses at their universities, which already deal with various aspects of rocket technology and space research. As in any development program, the students have to pass
Observation of Spin Flips with a Single Trapped Proton
Ulmer, S.; Blaum, K.; Kracke, H.; Mooser, A.; Quint, W.; Walz, J.
2011-01-01
Spin transitions of an isolated trapped proton are observed for the first time. The spin quantum jumps are detected via the continuous Stern-Gerlach effect which is used in an experiment with a single proton stored in a cryogenic Penning trap. This opens the way for a direct high-precision measurement of the magnetic moment of the proton and a new test of the matter-antimatter symmetry in the baryon sector. This method can also be applied to other light atomic nuclei.
Unambiguous assignment of the ground state of a nearly degenerate cluster
International Nuclear Information System (INIS)
Gutsev, G. L.; Khanna, S. N.; Jena, P.
2000-01-01
A synergistic approach that combines first-principles theory and electron photodetachment experiment is shown to be able to uniquely identify the ground state of a nearly degenerate cluster in the gas phase. Additionally, this approach can complement the Stern-Gerlach technique in determining the magnetic moment of small clusters unambiguously. The method, applied to a Fe 3 cluster, reveals its ground state to have a magnetic moment of 10μ B --in contrast with earlier predictions. (c) 2000 The American Physical Society
The g-factor of the bound electron in hydrogenic ions
International Nuclear Information System (INIS)
Quint, Wolfgang
2001-01-01
We report on the measurement of the g-factor of the electron bound in an atomic ion. A single hydrogenic ion ( 12 C 5+ ) is stored in a Penning trap. The electronic spin state of the ion is monitored via the continuous Stern-Gerlach effect in a quantum non-demolition measurement. Quantum jumps between the two spin states (spin up and spin down) are induced by a microwave field at the spin precession frequency of the bound electron. The g-factor of the bound electron is obtained by varying the microwave frequency and counting the number of spin flips for a fixed time interval. Applications of the continuous Stern-Gerlach effect include high-accuracy tests of bound-state quantum electrodynamics (QED), the measurement of the atomic mass of the electron, the determination of the fine structure constant α, and the measurement of nuclear g-factors
On the Einstein-Stern model of rotational heat capacities
DEFF Research Database (Denmark)
Dahl, Jens Peder
1998-01-01
The Einstein-Stern model for the rotational contribution to the heat capacity of a diatomic gas has recently been resuscitated. In this communication, we show that the apparent success of the model is illusory, because it is based on what has turned out to be an unfortunate comparison with experi...... with experiment. We also take exception to the possibility of assigning any meaning to the rotational zero-point energy introduced by the model. (C) 1998 American Institute of Physics. [S0021-9606(98)02448-9]....
46 CFR 171.100 - Shaft tunnels and stern tubes.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Shaft tunnels and stern tubes. 171.100 Section 171.100... PERTAINING TO VESSELS CARRYING PASSENGERS Additional Subdivision Requirements § 171.100 Shaft tunnels and... passengers on an international voyage. (b) The watertight seal in the bulkhead between the stern tube space...
Did the Stern Review underestimate US and global climate damages?
International Nuclear Information System (INIS)
Ackerman, Frank; Stanton, Elizabeth A.; Hope, Chris; Alberth, Stephane
2009-01-01
The Stern Review received widespread attention for its innovative approach to the economics of climate change when it appeared in 2006, and generated controversies that have continued to this day. One key controversy concerns the magnitude of the expected impacts of climate change. Stern's estimates, based on results from the PAGE2002 model, sounded substantially greater than those produced by many other models, leading several critics to suggest that Stern had inflated his damage figures. We reached the opposite conclusion in a recent application of PAGE2002 in a study of the costs to the US economy of inaction on climate change. This article describes our revisions to the PAGE estimates, and explains our conclusion that the model runs used in the Stern Review may well underestimate US and global damages. Stern's estimates from PAGE2002 implied that mean business-as-usual damages in 2100 would represent just 0.4 percent of GDP for the United States and 2.2 percent of GDP for the world. Our revisions and reinterpretation of the PAGE model imply that climate damages in 2100 could reach 2.6 percent of GDP for the United States and 10.8 percent for the world.
A polarized hydrogen/deuterium atomic beam source for internal target experiments
International Nuclear Information System (INIS)
Szczerba, D.; Buuren, L.D. van; Brand, J.F.J. van den; Bulten, H.J.; Ferro-Luzzi, M.; Klous, S.; Kolster, H.; Lang, J.; Mul, F.; Poolman, H.R.; Simani, M.C.
2000-01-01
A high-brightness hydrogen/deuterium atomic beam source is presented. The apparatus, previously used in electron scattering experiments with tensor-polarized deuterium (Ferro-Luzzi et al., Phys. Rev. Lett. 77 (1996) 2630; van den Brand et al., Phys. Rev. Lett. 78 (1997) 1235; Zhou et al., Phys. Rev. Lett. 82 (1998) 687; Bouwhuis et al., Phys. Rev. Lett. 82 (1999) 3755), was configured as a source for internal target experiments to measure single- and double-polarization observables, with either polarized hydrogen or vector/tensor polarized deuterium. The atomic beam intensity was enhanced by a factor of ∼2.5 by optimizing the Stern-Gerlach focusing system using high tip-field (∼1.5 T) rare-earth permanent magnets, and by increasing the pumping speed in the beam-formation chamber. Fluxes of (5.9±0.2)x10 16 1 H/s were measured in a diameter 12 mmx122 mm compression tube with its entrance at a distance of 27 cm from the last focusing element. The total output flux amounted to (7.6±0.2)x10 16 1 H/s
Spin–orbit induced electronic spin separation in semiconductor nanostructures
Kohda, Makoto; Nakamura, Shuji; Nishihara, Yoshitaka; Kobayashi, Kensuke; Ono, Teruo; Ohe, Jun-ichiro; Tokura, Yasuhiro; Mineno, Taiki; Nitta, Junsaku
2012-01-01
The demonstration of quantized spin splitting by Stern and Gerlach is one of the most important experiments in modern physics. Their discovery was the precursor of recent developments in spin-based technologies. Although electrical spin separation of charged particles is fundamental in spintronics, in non-uniform magnetic fields it has been difficult to separate the spin states of charged particles due to the Lorentz force, as well as to the insufficient and uncontrollable field gradients. Here we demonstrate electronic spin separation in a semiconductor nanostructure. To avoid the Lorentz force, which is inevitably induced when an external magnetic field is applied, we utilized the effective non-uniform magnetic field which originates from the Rashba spin–orbit interaction in an InGaAs-based heterostructure. Using a Stern–Gerlach-inspired mechanism, together with a quantum point contact, we obtained field gradients of 108 T m−1 resulting in a highly polarized spin current. PMID:23011136
The stern review: A deconstruction
Tol, R.S.J.; Yohe, G.W.
2009-01-01
Using a simple model designed for transparency but nonetheless calibrated to support the much-quoted damage estimates of the Stern Review of the Economics of Climate Change, we demonstrate significant sensitivity of those results to assumptions about the pure rate of time preference, the time
International Nuclear Information System (INIS)
Benítez Rodríguez, E; Aguilar, L M Arévalo; Martínez, E Piceno
2017-01-01
To the quantum mechanics specialists community it is a well-known fact that the famous original Stern–Gerlach experiment (SGE) produces entanglement between the external degrees of freedom (position) and the internal degree of freedom (spin) of silver atoms. Despite this fact, almost all textbooks on quantum mechanics explain this experiment using a semiclassical approach, where the external degrees of freedom are considered classical variables, the internal degree is treated as a quantum variable, and Newton's second law is used to describe the dynamics. In the literature there are some works that analyze this experiment in its full quantum mechanical form. However, astonishingly, to the best of our knowledge the original experiment, where the initial states of the spin degree of freedom are randomly oriented coming from the oven, has not been analyzed yet in the available textbooks using the Schrödinger equation (to the best of our knowledge there is only one paper that treats this case: Hsu et al (2011 Phys. Rev. A 83 012109)). Therefore, in this contribution we use the time-evolution operator to give a full quantum mechanics analysis of the SGE when the initial state of the internal degree of freedom is completely random, i.e. when it is a statistical mixture. Additionally, as the SGE and the development of quantum mechanics are heavily intermingled, we analyze some features and drawbacks in the current teaching of quantum mechanics. We focus on textbooks that use the SGE as a starting point, based on the fact that most physicist do not use results from physics education research, and comment on traditional pedagogical attitudes in the physics community. (paper)
2014-09-18
between the 5s electron and the silver nucleus. Breit and Rabi [5] described this hyperfine interaction in the context of the Stern-Gerlach...experiment, and Rabi et al. [6] were the first to directly measure nuclear magnetic moments with this beam technique [7]. 1 quantum angular momentum or spin...interaction matrix can be separated into isotropic and anisotropic parts, A( 14N) → A 1 0 0 0 1 0 0 0 1 + P -2 5 0 0 0 -2 5 0 0 0 4 5
Energy Technology Data Exchange (ETDEWEB)
D' Ariano, G M [Quantum Optics and Information Group, INFM Udr Pavia, Dipartimento di Fisica ' Alessandro Volta' and INFM, Via Bassi 6, 27100 Pavia (Italy); Maccone, L [Quantum Optics and Information Group, INFM Udr Pavia, Dipartimento di Fisica ' Alessandro Volta' and INFM, Via Bassi 6, 27100 Pavia (Italy); Paini, M [Quantum Optics and Information Group, INFM Udr Pavia, Dipartimento di Fisica ' Alessandro Volta' and INFM, Via Bassi 6, 27100 Pavia (Italy)
2003-02-01
We propose a tomographic reconstruction scheme for spin states. The experimental set-up, which is a modification of the Stern-Gerlach scheme, can be easily performed with currently available technology. The method is generalized to multiparticle states, analysing the spin-1/2 case for indistinguishable particles. Some Monte Carlo numerical simulations are given to illustrate the technique.
International Nuclear Information System (INIS)
D'Ariano, G M; Maccone, L; Paini, M
2003-01-01
We propose a tomographic reconstruction scheme for spin states. The experimental set-up, which is a modification of the Stern-Gerlach scheme, can be easily performed with currently available technology. The method is generalized to multiparticle states, analysing the spin-1/2 case for indistinguishable particles. Some Monte Carlo numerical simulations are given to illustrate the technique
The Stern Review: A deconstruction
International Nuclear Information System (INIS)
Tol, Richard S.J.; Yohe, Gary W.
2009-01-01
Using a simple model designed for transparency but nonetheless calibrated to support the much-quoted damage estimates of the Stern Review of the Economics of Climate Change, we demonstrate significant sensitivity of those results to assumptions about the pure rate of time preference, the time horizon, and the rates of risk and equity aversion used to compute certainty- and equity-equivalent annuities. Most importantly, we demonstrate enormous sensitivity to presumed constant regional vulnerability and underlying assumptions about adaptive capacity. Manipulation of any of these parameters one at a time across reasonable ranges can diminish damage estimates by as much as 84% or, in the case of extending the time horizon with the Review's low discount rate, increase damage estimates by 900%. We also confirm the usual result that limiting atmospheric concentrations to specific benchmarks above 400 ppm cannot eliminate all damages. Nonetheless, we applaud the Stern Review author team for reconfirming that the climate problem can be approached productively as an economic problem whose solutions can be explored with the tools of decision analysis
The Stern Review: A deconstruction
Energy Technology Data Exchange (ETDEWEB)
Tol, Richard S.J. [Economic and Social Research Institute, Dublin (Ireland); Institute for Environmental Studies, Vrije Universiteit, Amsterdam (Netherlands); Department of Spatial Economics, Vrije Universiteit, Amsterdam (Netherlands); Department of Engineering and Public Policy, Carnegie Mellon University, Pittsburgh, PA (United States)], E-mail: richard.tol@esri.ie; Yohe, Gary W. [Department of Economics, Wesleyan University, Middletown, CT (United States)
2009-03-15
Using a simple model designed for transparency but nonetheless calibrated to support the much-quoted damage estimates of the Stern Review of the Economics of Climate Change, we demonstrate significant sensitivity of those results to assumptions about the pure rate of time preference, the time horizon, and the rates of risk and equity aversion used to compute certainty- and equity-equivalent annuities. Most importantly, we demonstrate enormous sensitivity to presumed constant regional vulnerability and underlying assumptions about adaptive capacity. Manipulation of any of these parameters one at a time across reasonable ranges can diminish damage estimates by as much as 84% or, in the case of extending the time horizon with the Review's low discount rate, increase damage estimates by 900%. We also confirm the usual result that limiting atmospheric concentrations to specific benchmarks above 400 ppm cannot eliminate all damages. Nonetheless, we applaud the Stern Review author team for reconfirming that the climate problem can be approached productively as an economic problem whose solutions can be explored with the tools of decision analysis.
The Stern Review. A deconstruction
Energy Technology Data Exchange (ETDEWEB)
Tol, Richard S.J. [Economic and Social Research Institute, Dublin (Ireland)]|[Institute for Environmental Studies, Vrije Universiteit, Amsterdam (Netherlands)]|[Department of Spatial Economics, Vrije Universiteit, Amsterdam (Netherlands)]|[Department of Engineering and Public Policy, Carnegie Mellon University, Pittsburgh, PA (United States); Yohe, Gary W. [Department of Economics, Wesleyan University, Middletown, CT (United States)
2009-03-15
Using a simple model designed for transparency but nonetheless calibrated to support the much-quoted damage estimates of the Stern Review of the Economics of Climate Change, we demonstrate significant sensitivity of those results to assumptions about the pure rate of time preference, the time horizon, and the rates of risk and equity aversion used to compute certainty- and equity-equivalent annuities. Most importantly, we demonstrate enormous sensitivity to presumed constant regional vulnerability and underlying assumptions about adaptive capacity. Manipulation of any of these parameters one at a time across reasonable ranges can diminish damage estimates by as much as 84% or, in the case of extending the time horizon with the Review's low discount rate, increase damage estimates by 900%. We also confirm the usual result that limiting atmospheric concentrations to specific benchmarks above 400 ppm cannot eliminate all damages. Nonetheless, we applaud the Stern Review author team for reconfirming that the climate problem can be approached productively as an economic problem whose solutions can be explored with the tools of decision analysis. (author)
Effects of stern-foil submerged elevation on the lift and drag of a hydrofoil craft
Suastika, K.; Apriansyah
2018-03-01
Effects of the stern-foil submerged elevation on the lift and drag of a hydrofoil craft are studied by using computational fluid dynamics (CFD) and by considering three alternative stern-foil submerged elevations. The submerged elevation of the front foil is kept constant in all the alternatives. From among the alternatives, the deepest stern-foil placement results in the highest stern-foil lift with the highest foil’s lift-to-drag ratio. However, considering the lift-to-drag ratio of the whole foil-strut-hull system, the shallowest stern-foil placement results in the highest lift-to-drag ratio. The struts and the foil’s submerged elevation significantly affects the drag of the whole foil-strut-hull system.
Chrismianto, D.; Tuswan; Manik, P.
2018-03-01
In this study, the stern tunnel to improve the efficiency of ship propulsion system is analysed. Stern tunnels installed on the two sides of the ship stern. Analysis of ship resistance and wake friction of the ship using CFD are carried out. The stern tunnel height (Hw) and length (L) are implemented to find the better stern tunnel form of the ship. The result of analysis showed that model has a high stern tunnels (Hw) of 1,444 m or additional high stern tunnels ratio of 16% and stern long tunnels (L) about 7 m is a model that has the smallest resistance about 1.1137 N or able to make reduction of resistance amount 11.2582%. While, the model with the addition of height of 0.2 m and a length of 9 m of stern tunnel is a model that has the better advanced speed about 4,927% in increase, and better wake friction about 30.4% in reduce.
Sources of polarized ions and atoms
International Nuclear Information System (INIS)
Cornelius, W.D.
1988-01-01
In this presentation we discuss methods of producing large quantities of polarized atoms and ions (Stern-Gerlach separation, optical pumping, and spin-exchange) as well as experimental methods of measuring the degree of polarization of atomic systems. The usefulness of polarized atoms in probing the microscopic magnetic surface properties of materials will also be discussed. 39 refs., 5 figs., 2 tabs
THE STERN PROJECT–HANDS ON ROCKETS SCIENCE FOR UNIVERSITY STUDENT
Schüttauf, Katharina; Stamminger, Andreas; Lappöhn, Karsten
2017-01-01
In April 2012, the German Aerospace Center DLR initiated a sponsorship program for university students to develop, build and launch their own rockets over a period of three years. The program designation STERN was abbreviated from the German “STudentische Experimental-RaketeN”, which translates to Student- Experimental-Rockets. The primary goal of the STERN program is to inspire students in the subject of space transportation through hands-on activities within a pro...
Simulation turbulenter Konvektion in Supernova-Explosionen massereicher Sterne.
Janka, H.-T.; Müller, E.; Ruffert, M.
Contents: 1. Das Projekt: Numerische Simulation von Typ-II-Supernovae. 2. Die numerischen Verfahren. 3. Die Visualisierung von dreidimensionalen Datensätzen. 4. Die Ergebnisse: Einblick in explodierende Sterne.
A Geometrical Approach to Bell's Theorem
Rubincam, David Parry
2000-01-01
Bell's theorem can be proved through simple geometrical reasoning, without the need for the Psi function, probability distributions, or calculus. The proof is based on N. David Mermin's explication of the Einstein-Podolsky-Rosen-Bohm experiment, which involves Stern-Gerlach detectors which flash red or green lights when detecting spin-up or spin-down. The statistics of local hidden variable theories for this experiment can be arranged in colored strips from which simple inequalities can be deduced. These inequalities lead to a demonstration of Bell's theorem. Moreover, all local hidden variable theories can be graphed in such a way as to enclose their statistics in a pyramid, with the quantum-mechanical result lying a finite distance beneath the base of the pyramid.
Transaktionsgegenstand: Schweizer 5 Sterne Hotellerie
Kullmann, Patrick; Schegg, Roland
2012-01-01
Internationale Untersuchungen belegen, dass die Hotellerie im Jahr 2011 deutlich mehr Akquisitionen und Fusionen aufwies als im Jahr 2010. Auch die Schweizer 5 Sterne Hotellerie zählte in den letzten Jahren diverse Transaktionen, nicht zuletzt deshalb, weil schon heute eine Vielzahl in- und ausländischer Investoren Hotels besitzen, um diese nach erreichtem Wertzuwachs wieder zu veräussern. Dieser Artikel soll sowohl potentiellen Hotelinvestoren als auch der Geschäftsführung von Hotels zur Ori...
Stern-judging: A simple, successful norm which promotes cooperation under indirect reciprocity.
Pacheco, Jorge M; Santos, Francisco C; Chalub, Fabio A C C
2006-12-29
We study the evolution of cooperation under indirect reciprocity, believed to constitute the biological basis of morality. We employ an evolutionary game theoretical model of multilevel selection, and show that natural selection and mutation lead to the emergence of a robust and simple social norm, which we call stern-judging. Under stern-judging, helping a good individual or refusing help to a bad individual leads to a good reputation, whereas refusing help to a good individual or helping a bad one leads to a bad reputation. Similarly for tit-for-tat and win-stay-lose-shift, the simplest ubiquitous strategies in direct reciprocity, the lack of ambiguity of stern-judging, where implacable punishment is compensated by prompt forgiving, supports the idea that simplicity is often associated with evolutionary success.
Stern-judging: A simple, successful norm which promotes cooperation under indirect reciprocity.
Directory of Open Access Journals (Sweden)
Jorge M Pacheco
2006-12-01
Full Text Available We study the evolution of cooperation under indirect reciprocity, believed to constitute the biological basis of morality. We employ an evolutionary game theoretical model of multilevel selection, and show that natural selection and mutation lead to the emergence of a robust and simple social norm, which we call stern-judging. Under stern-judging, helping a good individual or refusing help to a bad individual leads to a good reputation, whereas refusing help to a good individual or helping a bad one leads to a bad reputation. Similarly for tit-for-tat and win-stay-lose-shift, the simplest ubiquitous strategies in direct reciprocity, the lack of ambiguity of stern-judging, where implacable punishment is compensated by prompt forgiving, supports the idea that simplicity is often associated with evolutionary success.
Influence of Stern Shaft Inclination on the Cooling Performance of Water-Lubricated Bearing
Directory of Open Access Journals (Sweden)
Zou Li
2016-01-01
Full Text Available The water film model of the marine water-lubricated stern bearing was established by FLUENT. The influence law of water flow rate on the cooling performance of water-lubricated bearing was studied in consideration of the stern shaft inclination. It will be helpful to improve the performance of marine water-lubricated stern bearing and both security and reliability of propulsion system. The simulation results show that the increase of cooling water flow rate in a certain range can effectively reduce bearing temperature. The bearing temperature rises sharply with thinning of water film thickness which is caused by the increase of inclination angle. Larger inclination angle can deteriorate the operating reliability of bearing.
Magnetism of iron, cobalt and nickel clusters studied in molecular beams
International Nuclear Information System (INIS)
Billas, I.
1995-01-01
The magnetic properties of iron, cobalt and nickel clusters in a molecular beam have been studied in a magnetic Stern-Gerlach deflection experiment. The molecular beam apparatus consists of a laser vaporization cluster source with high intensity and stability and a high-resolution time-of-flight mass spectrometer for the deflection measurements. Several novel experimental features have been developed in this work, like a nozzle which can be heated up to 1000 K and a chopper to measure the dwell times of the clusters in the source and their corresponding velocities. These new developments have allowed the measurement and the control of the temperature of the free clusters. The Stern-Gerlach deflection experiments have been performed on Fe, Co and Ni clusters in the mass range from 20 to 700 atoms. All clusters show single-sided deflection toward increasing field. This observation indicates that a spin relaxation process occurs within the isolated clusters. The participation of both the cluster rotational and vibrational degrees of freedom to the spin relaxation has been experimentally demonstrated. The cluster magnetization has been determined as a function of applied magnetic field B and as a function of dwell times of the clusters in the source before the supersonic expansion into vacuum. Superparamagnetic behavior has been observed when the cluster rotational speed is much larger than the Larmor frequency of the cluster magnetic moment μ in the field B. In particular, for μB<< kT, the cluster magnetization depends on B/T. For lower rotational speeds, reduced values of the magnetization have been observed. The magnetic moments of the superparamagnetic Fe, Co and Ni clusters have been measured as a) a function of cluster size N at low temperature and b) as a function of cluster temperature T for various size ranges. (author) figs., tabs., refs
Recent developments in laser-driven polarized sources
International Nuclear Information System (INIS)
Young, L.; Coulter, K.P.; Holt, R.J.; Kinney, E.R.; Kowalczyk, R.S.; Potterveld, D.H.; Zghiche, A.
1990-01-01
Recent progress in the performance of laser-driven sources of polarized hydrogen and deuterium is described. The current status of the prototype source, I = 2.5 x 10 17 s -1 , polarization = 0.29 (including atomic fraction), is comparable to classical Stern-Gerlach sources. A scheme to improve source performance by approximately an order of magnitude, using a combination of optical-pumping spin-exchange and RF transitions, is outlined. 8 refs., 2 figs., 1 tab
Internationalization of Brazilian brands of luxury: a case study of the H. Stern jewelry
Directory of Open Access Journals (Sweden)
José Coelho de Andrade Albino
2009-03-01
Full Text Available This case study analyses the issues concerning the management of global luxury brands, specially those originated from third world countries, such as Brazil. In order to perform this research, the case study approach has been chosen, having as empirical object the Brazilian jewelry H. Stern. The study is based on bibliographical research as well as interviews with the company’s managers; technical visits to H. Stern’s headquarters and main stores, documental research and discourse analysis of the jewelry’s national and international advertisements compared to its competitors. The results found indicate that H. Stern has followed the Uppsala School´s assumptions in order to promote it´s internationalization. H. Stern branding practices can be considered a transition between the first and the second wave of branding, according to Antorini and Schultz (2005 classification. Related to the luxury brand managing model developed by Beverland (2004, it can be affirmed that H. Stern manages it´s brand in a global context, in a consistent and integrated way.
Contingency and its consequences in Tristram Shandy by Laurence Sterne
Directory of Open Access Journals (Sweden)
Tomasz Umerle
2010-06-01
Full Text Available My paper proposes a new approach to the famous novel by Laurence Sterne Tristram Shandy. In my reading of this work I use the category of contingency which I define by referring to the German philosopher Odo Marquard and literary theories of a monographer of the contigency in literature and film Rafał Koschany. These are the basic inspirations for reflections on Tristram as a character, and simultaneously, narrator in the novel. In my view contingency manifests itself in Sterne's work in a two-fold manner it affects Tristram's life and narration. I will try to focus on the different ways in which these manifestations relate to each other.
Daniel Stern's journey in infant psychiatry: interview by John A. Talbot.
Stern, Daniel
2012-12-01
This interview with Professor Daniel Stern, conducted on February 16, 2012 by Dr. John Talbott, reviews the field of infant psychiatry, the history of which goes back more than 100 years. Sigmund Freud, then Melanie Klein, Anna Freud, Donald Winnicott, and, finally, Margaret Mahler, all psychoanalysts, influenced its development. Direct observation of very young infants and their mothers began in the latter half of the 20th century, and the subsequent course shifted through the influence of developmental psychologists and ethologists. This review concludes with Dr. Stern's predictions and fears about future directions of the field.
Effect of stern hull shape on turning circle of ships
Jaswar, Maimun, A.; Wahid, M. A.; Priyanto, A.; Zamani, Pauzi, Saman
2012-06-01
Many factors such as: stern hull shape, length, draught, trim, propulsion system and external forces affecting the drift angle influence rate of turn and size of turning circle of ships. This paper discusses turning circle characteristics of U and V stern hull shape of Very Large Crude Oil Carrier (VLCC) ships. The ships have same principal dimension such as length, beam, and draught. The turning circle characteristics of the VLCC ships are simulated at 35 degree of rudder angle. In the analysis, firstly, turning circle performance of U-type VLCC ship is simulated. In the simulation, initial ship speed is determined using given power and rpm. Hydrodynamic derivatives coefficients are determined by including effect of fullness of aft run. Using the obtained, speed and hydrodynamic coefficients, force and moment acting on hull, force and moment induced by propeller, force and moment induced by rudder are determined. Finally, ship trajectory, ratio of speed, yaw angle and drift angle are determined. Results of simulation results of the VLCC ship are compared with the experimental one as validation. Using the same method, V-type VLCC is simulated and the simulation results are compared with U-type VLCC ship. Results shows the turning circle of U-type is larger than V-type due to effect stern hul results of simulation are.
Energy Technology Data Exchange (ETDEWEB)
Ogle, Ken J.; Carter, Craig D. [Thordon Bearings Inc., Burlington, Ontario (Canada)], email: keno@thordonbearings.com, email: craigc@thordonbearings.com
2010-07-01
Icebreakers are prone to oil discharges from the stern tube, and lubricants that are biodegradable elsewhere may not be biodegradable enough in the Arctic and have a toxic effect on the food chain. The vulnerable element is the shaft seal, which must leak a small amount to operate in the first place, and ice milling causes very fast shaft movements that increase the leakage. Also, other objects such as fishing lines seriously compromise the operation of the seal. However, there is an alternative-namely the conversion of oil-lubricated bearings to Thordon COMPAC seawater-lubricated bearings. In this operation, white-metal bearings are replaced with Thordon non-metallic bearings; then, seawater is used as the lubrication and cooling medium. The seawater enters the front part of the stern, passes through the front and aft bearing before returning to the sea. This system totally eliminates the risk of polluting the Arctic ecosystem.
STERNE EM MEMÓRIAS PÓSTUMAS DE BRÁS CUBAS E DOM CASMURRO
Directory of Open Access Journals (Sweden)
LUANA FERREIRA DE FREITAS
Full Text Available Este trabalho parte da leitura e análise de The Life and Opinions of Tristram Shandy, Gentleman e A Sentimental Journey, de Laurence Sterne, e de Memórias póstumas de Brás Cubas e Dom Casmurro, de Machado de Assis, para fazer um exame da presença de traços estilísticos do texto machadiano explorados por Sterne 132 anos antes. Para tal, serão consideradas a digressão e a subjetividade dos narradores.
A quantum mechanical analogue of the Stern-Volmer equation
Nitzan, A.; Jortner, J.; Kommandeur, J.; Drent, E.
1971-01-01
We discuss the role of interference effects in intramolecular electronic energy quenching of an excited electrocic state of a large molecule. For a small electronic energy gap the Stern-Volmer relation is obtained in the limit of strong coupling, while in intermediate cases the ( pressure dependent)
The economics of climate change the stern report one year on
International Nuclear Information System (INIS)
Godard, O.
2007-01-01
In this article Olivier Godard, a specialist in environmental issues, looks back at the Stern Report on the economics of climate change, which was commissioned by the British government and published at the fall 2006. Having first recalled the general background to the report with regard to global warming and the lively debate that it generated, Godard sets it in perspective. He starts by describing the overall methodology and the main ideas in the Stern Report: a strong warning (that-without swift and decisive action to deal with the problem, the growth in human activities will cause serious, large-scale upheavals in this century and the next) coupled with an optimistic view (that nothing is inevitable provided that action is indeed swift, decisive and properly co-ordinated internationally, and the cost is relatively moderate). He puts figures to an evaluation of the damage to the environment suggested in various scenarios for the period up to 2200, as well as calculations showing that the feared climate change catastrophe is not unavoidable. He summarizes the policy recommendations offered in the Stern Report, emphasizing in passing that even the toughest policies cannot overcome all the problems. Godard goes on to discuss the key issue in the controversy that divides economists: what level to set the discount rate. He first describes the way this rate is calculated and then shows how the choices involved reflect above all the ethical trade-off with regard to the treatment of future generations and how the hypotheses underlying the economic evaluations of the impacts of climate change are far from being as scientifically objective as they claim to be. The Stern Report, he concludes, will at least have had the merit of bringing greater transparency in this regard and, despite certain limitations, it will have demonstrated the urgent need for co-ordinated action at global level to tackle climate change. (author)
Kumar, Bharat; Crittenden, Scott R
2013-11-01
We demonstrate the ability to measure Stern potential and Debye length in dilute ionic solution with atomic force microscopy. We develop an analytic expression for the second harmonic force component of the capacitive force in an ionic solution from the linearized Poisson-Boltzmann equation. This allows us to calibrate the AFM tip potential and, further, obtain the Stern potential of sample surfaces. In addition, the measured capacitive force is independent of van der Waals and double layer forces, thus providing a more accurate measure of Debye length.
International Nuclear Information System (INIS)
Kumar, Bharat; Crittenden, Scott R
2013-01-01
We demonstrate the ability to measure Stern potential and Debye length in dilute ionic solution with atomic force microscopy. We develop an analytic expression for the second harmonic force component of the capacitive force in an ionic solution from the linearized Poisson–Boltzmann equation. This allows us to calibrate the AFM tip potential and, further, obtain the Stern potential of sample surfaces. In addition, the measured capacitive force is independent of van der Waals and double layer forces, thus providing a more accurate measure of Debye length. (paper)
Generalized uncertainty principle and quantum gravity phenomenology
Bosso, Pasquale
The fundamental physical description of Nature is based on two mutually incompatible theories: Quantum Mechanics and General Relativity. Their unification in a theory of Quantum Gravity (QG) remains one of the main challenges of theoretical physics. Quantum Gravity Phenomenology (QGP) studies QG effects in low-energy systems. The basis of one such phenomenological model is the Generalized Uncertainty Principle (GUP), which is a modified Heisenberg uncertainty relation and predicts a deformed canonical commutator. In this thesis, we compute Planck-scale corrections to angular momentum eigenvalues, the hydrogen atom spectrum, the Stern-Gerlach experiment, and the Clebsch-Gordan coefficients. We then rigorously analyze the GUP-perturbed harmonic oscillator and study new coherent and squeezed states. Furthermore, we introduce a scheme for increasing the sensitivity of optomechanical experiments for testing QG effects. Finally, we suggest future projects that may potentially test QG effects in the laboratory.
Entanglement detection with bounded reference frames
International Nuclear Information System (INIS)
Costa, Fabio; Brukner, Caslav; Harrigan, Nicholas; Rudolph, Terry
2009-01-01
Quantum experiments usually assume the existence of perfect, classical reference frames (RFs), which allow for the specification of measurement settings (e.g. orientation of the Stern-Gerlach magnet in spin measurements) with arbitrary precision. If the RFs are 'bounded' (i.e. quantum systems themselves, having a finite number of degrees of freedom), only limited precision can be attained. Using spin coherent states as bounded RFs, we have found the minimum size needed for them to violate local realism for entangled spin systems. For composite systems of spin 1/2 particles, RFs of very small size are sufficient for the violation; however, to see this violation for macroscopic entangled spins, the size of the RF must be at least quadratically larger than that of the spins. The unavailability of such RFs gives a possible explanation for the non-observance of violation of local realism in everyday experience.
New York University's Stern School of Business: A Centennial Retrospective.
Gitlow, Abraham L.
This volume traces the history of the first hundred years of the Stern School of Business at New York University. Chapter 1 describes the school's original mission and founding. Chapter 2 describes how the school changed and developed as it responded to trends from 1900 to 1950. Chapter 3 explores the school's dramatic decline between 1955 and…
An update on the analysis of the Princeton 19Ne beta asymmetry measurement
Combs, Dustin; Calaprice, Frank; Jones, Gordon; Pattie, Robert; Young, Albert
2013-10-01
We report on the progress of a new analysis of the 1994 19Ne beta asymmetry measurement conducted at Princeton University. In this experiment, a beam of 19Ne atoms were polarized with a Stern-Gerlach magnet and then entered a thin-walled mylar cell through a slit fabricated from a piece of micro channel plate. A pair of Si(Li) detectors at either end of the apparatus were aligned with the direction of spin polarization (one parallel and one anti-parallel to the spin of the 19Ne) and detected positrons from the decays. The difference in the rate in the two detectors was used to calculate the asymmetry. A new analysis procedure has been undertaken using the Monte Carlo package PENELOPE with the goal of determining the systematic uncertainty due to positrons scattering from the face of the detectors causing the incorrect reconstruction of the initial direction of the positron momentum. This was a leading cause of systematic uncertainty in the experiment in 1994.
Kan Daniel Sterns kernebegreber bidrage til en fænomenologisk orienteret musikpsykologi?
DEFF Research Database (Denmark)
Holgersen, Sven-Erik
2007-01-01
Daniel Stern har igennem hele sit forfatterskab været optaget af, hvordan bevidsthed konstitueres i samspillet mellem subjekt og omverden. Han har i stigende grad ladet sig inspirere af fænomenologi, og artiklen diskuterer, hvilke konsekvenser dette har for forståelsen af centrale begreber som...
Directory of Open Access Journals (Sweden)
L.R.F. Alleoni
1994-08-01
Full Text Available Modelos teóricos da dupla camada difusa de Gouy-Chapman e de Stern foram aplicados a um latossolo variação Una ácrico, de Guaira e a dois latossolos roxos ácricos, localizados em Ribeirão Preto e Guaíra, cidades ao norte do Estado de São Paulo, onde solos com caráter ácrico ocupam vasta área nas quais são cultivadas várias culturas de interesse econômico. Na concentração mais elevada do eletrólito suporte (KCl 0,1N, os dados obtidos em laboratório adaptaram-se melhor ao modelo de Stern. Entretanto, nas menores concentrações (KCl 0,01 e 0,001N, correspondentes a valores mais comuns encontrados em solos altamente intemperizados, o modelo de Gouy-Chapman representou melhor a variação da densidade superficial de carga com o potencial elétrico das amostras estudadas.Theoretical models of Gouy-Chapman and Stern, referred to diffuse double layer, were applied to three acric Oxisols, two named dusky red latosol and one Una variant latosol, from the São Paulo State - Brazil. Samples were collected in Ribeirão Preto and Guaira, regions of large occurrence of these soils, supporting many economic crops. In the highest concentration of the electrolyte (KC1 0.1N, the obtained values were better related to the Stern model. On the other hand, in more dilluted solutions (KC1 0.01 and 0.001N, corresponding to more usual ionic strenght of highly weathered soils, the variation of surface charge density of the samples with electric potential was in better agreement with the Gouy-Chapman theory.
Gaensbauer, Theodore J
2016-01-01
Lou Sander and Dan Stern made seminal contributions to our understanding of early child development, particularly in regard to the moment-to-moment intersubjective exchanges and mutual sensitivity that are at the core of the caregiver-infant relationship. Although their own studies focused primarily on the ways in which children's intersubjective experiences of mutual attunement lead to adaptive social relatedness and validate a healthy sense of self, this article focuses on the applicability of their theoretical conceptions to the development of pathological social relations. It explores the premise that the emotional validation derived from recurrent intersubjective experiences of mutual attunement involving negative affects can be as emotionally compelling from the child's standpoint as that derived from positive exchanges. Children's needs to recreate unhealthy, but affectively meaningful, moments with their caregivers can lead to ingrained, automatically operating pathological patterns of social behavior and affective expression that can take on a life of their own and strongly shape the child's subsequent socioemotional functioning. Following an overview of Sander's and Stern's conceptual thinking, developmental research and clinical case material will be utilized to illustrate how their work can enrich our understanding of developmental processes that can contribute to a number of emotion-specific, early relational disturbances. © 2016 Michigan Association for Infant Mental Health.
ASSERT validation against the Stern Laboratories' single-phase pressure drop tests
International Nuclear Information System (INIS)
Waddington, G.M.; Kiteley, J.C.; Carver, M.B.
1995-01-01
This paper describes the preliminary validation of ASSERT-IV against the single-phase pressure drop tests from the 37-element CHF (critical heat flux) experiments conducted at Stern Laboratories, and shows how this study fits into the overall ASSERT validation plan. The effects on the pressure drop of several friction and form loss models are evaluated, including the geometry-based K-factor model. The choice of friction factor has a small effect on the predicted channel pressure drop, compared to the form loss model choice. Using the uniform K-factors of Hameed, the computed pressure drops are in excellent agreement with the experimental results from the nominal pressure tube tests. For future ASSERT applications, either Hameed's uniform K-factors or the geometry-based model using Idelchik's thick-edged orifice equation are recommended, as are the friction factor correlations of Colebrook-White, Selander, and Aly and Groeneveld. More analysis of the geometry-based K-factor model is required. (author). 23 refs., 4 tabs., 9 figs
Magnetic properties of free alkali and transition metal clusters
International Nuclear Information System (INIS)
Heer, W. de; Milani, P.; Chatelain, A.
1991-01-01
The Stern-Gerlach deflections of small alkali clusters (N<6) and iron clusters (10< N<500) show that the paramagnetic alkali clusters always have a nondeflecting component, while the iron clusters always deflect in the high field direction. Both of these effects appear to be related to spin relaxation however in the case of alkali clusters it is shown that they are in fact caused by avoided level crossing in the Zeeman diagram. For alkali clusters the relatively weak couplings cause reduced magnetic moments where levels cross. For iron clusters however the total spin is strongly coupled to the molecular framework. Consequently this coupling is responsible for avoided level crossing which ultimately cause the total energy of the cluster to decrease with increasing magnetic field so that the iron clusters will deflect in one direction when introduced in an inhomogeneous magnetic field. Experiment and theory are discussed for both cases. (orig.)
Determination of the spin polarization of a 4He+ ion beam
International Nuclear Information System (INIS)
Suzuki, T.; Yamauchi, Y.
2008-01-01
It was demonstrated that the spin polarization of a 4 He + ion beam (P He + ) can be determined from the spin dependence of the electron emission in the deexcitation process of spin-polarized He metastable atoms (He*, 2 3 S 1 ) and spin-polarized He + ions on Fe (100) surfaces. On Fe (100) surfaces, both He* and He + deexcite via Auger neutralization, and therefore, the spin asymmetry obtained from spin-polarized He + ion neutralization spectroscopy should be equal to that from spin-polarized metastable He* deexcitation spectroscopy. The spin polarization of He* was obtained from Stern-Gerlach measurements. P He + was finally determined to be 0.19±0.02
Brown, Matthew A; Bossa, Guilherme Volpe; May, Sylvio
2015-10-27
In one of the most commonly used phenomenological descriptions of the electrical double layer, a charged solid surface and a diffuse region of mobile ions are separated from each other by a thin charge-depleted Stern layer. The Stern layer acts as a capacitor that improves the classical Gouy-Chapman model by increasing the magnitude of the surface potential and limiting the maximal counterion concentration. We show that very similar Stern-like properties of the diffuse double layer emerge naturally from adding a nonelectrostatic hydration repulsion to the electrostatic Coulomb potential. The interplay of electrostatic attraction and hydration repulsion of the counterions and the surface leads to the formation of a diffuse counterion layer that remains well separated from the surface. In addition, hydration repulsions between the ions limit and control the maximal ion concentration and widen the width of the diffuse double layer. Our mean-field model, which we express in terms of electrostatic and hydration potentials, is physically consistent and conceptually similar to the classical Gouy-Chapman model. It allows the incorporation of ion specificity, accounts for hydration properties of charged surfaces, and predicts Stern layer properties, which we analyze in terms of the effective size of the hydrated counterions.
Simulation Analysis of Spherical Mechanical Seal Property of Marine Stern Shaft
Zhou Xu Hui; Zou Li
2016-01-01
The finite element model of spherical mechanical seal wasestablished with ANSYS, and the influence of seawater pressure, shaft speed and other factors on the sealing performance was discussed. The study results show that local contact situation of the spherical mechanical seal is in the outside of the seal rings, and both maximum contact pressure and temperature appearat the same position. As sea water pressure and stern shaft rotary speed are increased, the contact pressure and temperature o...
National Research Council Canada - National Science Library
Cusanelli, Dominic S; Chesnakas, Christopher J
2007-01-01
...) and Stock Propeller Powering and Stern Flap Evaluation tests (Series 3. In order to assist in the design of a propeller for the BSS hull, the nominal wakes in the inboard and outboard starboard propeller planes were measured using LDV...
Geometrical charged-particle optics. 2. ed.
International Nuclear Information System (INIS)
Rose, Harald
2013-01-01
Provides a unique theoretical treatment of charged-particle optics. Displays novel unpublished results on several topics. Provides insight into the properties of charged-particle devices. Treats wave optical properties of the electron. Presents the resolution limit of electron microscopes and novel theoretical treatment of the Stern-Gerlach effect. This second edition is an extended version of the first edition of Geometrical Charged-Particle Optics. The updated reference monograph is intended as a guide for researchers and graduate students who are seeking a comprehensive treatment of the design of instruments and beam-guiding systems of charged particles and their propagation in electromagnetic fields. Wave aspects are included in this edition for explaining electron holography, the Aharanov-Bohm effect and the resolution of electron microscopes limited by diffraction. Several methods for calculating the electromagnetic field are presented and procedures are outlined for calculating the properties of systems with arbitrarily curved axis. Detailed methods are presented for designing and optimizing special components such as aberration correctors, spectrometers, energy filters monochromators, ion traps, electron mirrors and cathode lenses. In particular, the optics of rotationally symmetric lenses, quadrupoles, and systems composed of these elements are discussed extensively. Beam properties such as emittance, brightness, transmissivity and the formation of caustics are outlined. Relativistic motion and spin precession of the electron are treated in a covariant way by introducing the Lorentz-invariant universal time and by extending Hamilton's principle from three to four spatial dimensions where the laboratory time is considered as the fourth pseudo-spatial coordinate. Using this procedure and introducing the self action of the electron, its accompanying electromagnetic field and its radiation field are calculated for arbitrary motion. In addition, the Stern-Gerlach
Effect of animal sera on Bacillus anthracis Sterne spore germination and vegetative cell growth.
Bensman, M D; Mackie, R S; Minter, Z A; Gutting, B W
2012-08-01
The aims of this work were to investigate the effects of sera on B. anthracis Sterne germination and growth. Sera examined included human, monkey and rabbit sera, as well as sera from eight other species. Standard dilution plate assay (with and without heat kill) was used as a measure of germination, and spectroscopy was used to measure growth. In addition, a Coulter Counter particle counter was used to monitor germination and growth based on bacterial size. Spores germinated best in foetal bovine and monkey sera, moderately with human sera and showed limited germination in the presence of rabbit or rat sera. Vegetative bacteria grew best in foetal bovine sera and moderately in rabbit sera. Human and monkey sera supported little growth of vegetative bacteria. The data suggested sera can have a significant impact on germination and growth of Sterne bacteria. These data should be considered when conducting in vitro cell culture studies and may aid in interpreting in vivo infection studies. © 2012 The Authors Journal of Applied Microbiology © 2012 The Society for Applied Microbiology.
Directory of Open Access Journals (Sweden)
William Valentine Redmond
2011-01-01
Full Text Available Os humoristas britânicos, especialmente Swift e Sterne são tradicionalmente vistos como escritores que influenciaram a obra de Machado de Assis. Entretanto, foi o crítico Eugenio Gomes que provou, com precisão, a sutileza e o bom gosto que Machado obteve dessa influência. Em uma abordagem contemporânea, torna-se interessante questionar essa idéia de influência e examinar, à luz da intertextualidade, esse contato do humor entre as obras de Machado e as dessas duas grandes figuras da Literatura na Língua Inglesa.The British humourists, especially Swift and Sterne are traditionallyseen as writers who influenced Machado de Assis’ works. However it was the critic Eugenio Gomes who showed with precision the sublety and excellent taste of Machado obtained through this influence. With our contemporary approaches, it becomes interesting to question the idea of influence and examine in the light of intertextuality this contact of humour between the works of Machado and those of these two great figures of Literature in the English Language.
Resolution of the EPR Paradox for Fermion Spin Correlations
Close, Robert
2011-10-01
The EPR paradox addresses the question of whether a physical system can have a definite state independent of its measurement. Bell's Theorem places limits on correlations between local measurements of particles whose properties are established prior to measurement. Experimental violation of Bell's theorem has been regarded as evidence against the existence of a definite state prior to measurement. We model fermions as having a spatial distribution of spin values, so that a Stern-Gerlach device samples the spin distribution differently at different orientations. The computed correlations agree with quantum mechanical predictions and experimental observations. Bell's Theorem is not applicable because for any sampling of angles, different points on the sphere have different density of states.
Numerical Investigation of Resistance Reduction of Fishing Boat by Improving Stern Part
Baso, Suandar
2013-01-01
In recent years, to achieve a goal of reducing greenhouse gas, a fishing boat which is very economical on gas should be needed. Over the last two decades, improvements of bow part in fishing boat have been researched to reduce water resistance. Moreover, stern End Bulb research took place mostly in Japan. No one finds universal knowledge for reducing drag resistance because many fishing boats run with individual catching styles for each fish. It is also difficult to appropriate some technique...
Modeling variable density turbulence in the wake of an air-entraining transom stern
Hendrickson, Kelli; Yue, Dick
2015-11-01
This work presents a priori testing of closure models for the incompressible highly-variable density turbulent (IHVDT) flows in the near wake region of a transom stern. This three-dimensional flow is comprised of convergent corner waves that originate from the body and collide on the ship center plane forming the ``rooster tail'' that then widens to form the divergent wave train. These violent free-surface flows and breaking waves are characterized by significant turbulent mass flux (TMF) at Atwood number At = (ρ2 -ρ1) / (ρ2 +ρ1) ~ 1 for which there is little guidance in turbulence closure modeling for the momentum and scalar transport along the wake. To whit, this work utilizes high-resolution simulations of the near wake of a canonical three-dimensional transom stern using conservative Volume-of-Fluid (cVOF), implicit Large Eddy Simulation (iLES), and Boundary Data Immersion Method (BDIM) to capture the turbulence and large scale air entrainment. Analysis of the simulation results across and along the wake for the TMF budget and turbulent anisotropy provide the physical basis of the development of multiphase turbulence closure models. Performance of isotropic and anisotropic turbulent mass flux closure models will be presented. Sponsored by the Office of Naval Research.
Tomasello y Stern: Dos perspectivas actuales incluyentes del Desarrollo Infantil
Directory of Open Access Journals (Sweden)
Marta Isabel López Giraldo
2011-10-01
Full Text Available The objective of the present article is to illustrate two current perspectives of child development that areinclusive rather than exclusive -Michael Tomasello (cognitive and Daniel Stern (social-subjective-, in the sense that theyintegrate the discoveries of the early skills of the baby -carried out as of 1970-80- to their explanation, without giving upthe particular theoretical paradigm they come from. They recognize these early skills and the fundamental role of the various factors involved in development -the innate, the environmental (social and cultural-, different research methods and thelimitations of a reductionist view. In addition they postulate that the dialog between the different theoretical perspectives isnecessary to achieve a description of the infant as a unit.
Gauvin, Jean-François
2018-03-01
In the early 1960s, a PhD student in physics, Costas Papaliolios, designed a simple—and playful—system of Polaroid polarizer filters with a specific goal in mind: explaining the core principles behind Julian Schwinger's quantum mechanical measurement algebra, developed at Harvard in the late 1940s and based on the Stern-Gerlach experiment confirming the quantization of electron spin. Papaliolios dubbed his invention "quantum toys." This article looks at the origins and function of this amusing pedagogical device, which landed half a century later in the Collection of Historical Scientific Instruments at Harvard University. Rendering the abstract tangible was one of Papaliolios's demonstration tactics in reforming basic teaching of quantum mechanics. This article contends that Papaliolios's motivation in creating the quantum toys came from a renowned endeavor aimed, inter alia, at reforming high-school physics training in the United States: Harvard Project Physics. The pedagogical study of these quantum toys, finally, compels us to revisit the central role playful discovery performs in pedagogy, at all levels of training and in all fields of knowledge.
Quantum physics; Physique quantique
Energy Technology Data Exchange (ETDEWEB)
Basdevant, J.L.; Dalibart, J. [Ecole Polytechnique, 75 - Paris (France)
1997-12-31
This pedagogical book gives an initiation to the principles and practice of quantum mechanics. A large part is devoted to experimental facts and to their analysis: concrete facts, phenomena and applications related to fundamental physics, elementary particles, astrophysics, high-technology, semi-conductors, micro-electronics and lasers. The book is divided in 22 chapters dealing with: quantum phenomena, wave function and Schroedinger equation, physical units and measurements, energy quantification of some simple systems, Hilbert space, Dirac formalism and quantum mechanics postulates, two-state systems and ammonia Maser principle, bands theory and crystals conductibility, commutation of observables, Stern and Gerlach experiment, approximation methods, kinetic momentum in quantum mechanics, first description of atoms, 1/2 spin formalism and magnetic resonance, Lagrangian, Hamiltonian and Lorentz force in quantum mechanics, addition of kinetic momenta and fine and hyper-fine structure of atomic lines, identical particle systems and Pauli principle, qualitative physics and scale of size of some microscopic and macroscopic phenomena, systems evolution, collisions and cross sections, invariance and conservation laws, quantum mechanics and astrophysics, and historical aspects of quantum mechanics. (J.S.) refs.
International Nuclear Information System (INIS)
Basdevant, J.L.; Dalibart, J.
1997-01-01
This pedagogical book gives an initiation to the principles and practice of quantum mechanics. A large part is devoted to experimental facts and to their analysis: concrete facts, phenomena and applications related to fundamental physics, elementary particles, astrophysics, high-technology, semi-conductors, micro-electronics and lasers. The book is divided in 22 chapters dealing with: quantum phenomena, wave function and Schroedinger equation, physical units and measurements, energy quantification of some simple systems, Hilbert space, Dirac formalism and quantum mechanics postulates, two-state systems and ammonia Maser principle, bands theory and crystals conductibility, commutation of observables, Stern and Gerlach experiment, approximation methods, kinetic momentum in quantum mechanics, first description of atoms, 1/2 spin formalism and magnetic resonance, Lagrangian, Hamiltonian and Lorentz force in quantum mechanics, addition of kinetic momenta and fine and hyper-fine structure of atomic lines, identical particle systems and Pauli principle, qualitative physics and scale of size of some microscopic and macroscopic phenomena, systems evolution, collisions and cross sections, invariance and conservation laws, quantum mechanics and astrophysics, and historical aspects of quantum mechanics. (J.S.)
Sparaciari, Carlo; Paris, Matteo G. A.
2013-01-01
We address measurement schemes where certain observables Xk are chosen at random within a set of nondegenerate isospectral observables and then measured on repeated preparations of a physical system. Each observable has a probability zk to be measured, with ∑kzk=1, and the statistics of this generalized measurement is described by a positive operator-valued measure. This kind of scheme is referred to as quantum roulettes, since each observable Xk is chosen at random, e.g., according to the fluctuating value of an external parameter. Here we focus on quantum roulettes for qubits involving the measurements of Pauli matrices, and we explicitly evaluate their canonical Naimark extensions, i.e., their implementation as indirect measurements involving an interaction scheme with a probe system. We thus provide a concrete model to realize the roulette without destroying the signal state, which can be measured again after the measurement or can be transmitted. Finally, we apply our results to the description of Stern-Gerlach-like experiments on a two-level system.
Bandyopadhyay, Supriyo
2008-01-01
The Early History of Spin Spin The Bohr Planetary Model and Space Quantization The Birth of "Spin" The Stern-Gerlach Experiment The Advent of Spintronics The Quantum Mechanics of Spin Pauli Spin Matrices The Pauli Equation and Spinors More on the Pauli Equation Extending the Pauli Equation - the Dirac Equation The Time Independent Dirac Equation Appendix The Bloch Sphere The Spinor and the "Qubit" The Bloch Sphere Concept Evolution of a Spinor Spin-1/2 Particle in a Constant Magnetic Field: Larmor Precession Preparing to Derive the Rabi Formula The Rabi Formula The Density Matrix The Density Matrix Concept: Case of a Pure State Properties of the Density Matrix Pure Versus Mixed State Concept of the Bloch Ball Time Evolution of the Density Matrix: Case of Mixed State The Relaxation Times T1 and T2 and the Bloch Equations Spin Orbit Interaction Spin Orbit Interaction in a Solid Magneto-Electric Sub-Bands in Quantum Confined Structures in the Presence of Spin-Orbit Interaction Dispersion Relations of Spin Resolv...
Weak values in collision theory
de Castro, Leonardo Andreta; Brasil, Carlos Alexandre; Napolitano, Reginaldo de Jesus
2018-05-01
Weak measurements have an increasing number of applications in contemporary quantum mechanics. They were originally described as a weak interaction that slightly entangled the translational degrees of freedom of a particle to its spin, yielding surprising results after post-selection. That description often ignores the kinetic energy of the particle and its movement in three dimensions. Here, we include these elements and re-obtain the weak values within the context of collision theory by two different approaches, and prove that the results are compatible with each other and with the results from the traditional approach. To provide a more complete description, we generalize weak values into weak tensors and use them to provide a more realistic description of the Stern-Gerlach apparatus.
Studies on halogen quenching through the Stern-Volmer plot
International Nuclear Information System (INIS)
Takiue, Makoto; Ishikawa, Hiroaki.
1978-01-01
The quenching effect for halogenated benzenes, methanes and ethanes have been investigated. The halogen quenching was accurately measured using the internal conversion electrons emitted from 113 Sn-sup(113m)In. From the quenching constants determined by the Stern-Volmer plots with respect to various halogen quenchers, the following results have been obtained. (1) The quenching constants increase with the number of halogen substituents, so as linearly in halogenated benzenes and exponentially in halogenated methanes and ethanes. Even the isomers of halogenides have different quenching constants. (2) There is a linearity between logarithm of the quenching constant and a polarographic half-wave reduction potential. (3) Electron excitation provides larger quenching constants than UV excitation for halogenated methanes. Based on these results, the mechanism of halogen quenching have been discussed in connection with the exciplex formation. (auth.)
O'Shea, Thomas T.; Beale, Kristy L. C.; Brucker, Kyle A.; Wyatt, Donald C.; Drazen, David; Fullerton, Anne M.; Fu, Tom C.; Dommermuth, Douglas G.
2010-11-01
Numerical Flow Analysis (NFA) predictions of the flow around a transom-stern hull form are compared to laboratory measurements collected at NSWCCD. The simulations are two-phase, three-dimensional, and unsteady. Each required 1.15 billion grid cells and 200,000 CPU hours to accurately resolve the unsteady flow and obtain a sufficient statistical ensemble size. Two speeds, 7 and 8 knots, are compared. The 7 knots (Fr=Uo /√gLo=0.38) case is a partially wetted transom condition and the 8 knots (Fr=0.43) case is a dry transom condition. The results of a detailed comparison of the mean free surface elevation, surface roughness (RMS), and spectra of the breaking stern-waves, measured by Light Detection And Ranging (LiDAR) and Quantitative Visualization (QViz) sensors, are presented. All of the comparisons showed excellent agreement. The concept of height-function processing is introduced, and the application of this type of processing to the simulation data shows a k-5/3 power law behavior for both the 7 and 8 knot cases. The simulations also showed that a multiphase shear layer forms in the rooster-tail region and that its thickness depends on the Froude number.
The politics of psychiatry and the vicissitudes of faith circa 1950: Karl Stern's psychiatric novel.
Burston, Daniel
2015-01-01
Karl Stern, MD (1906-1975) was the author of The Pillar of Fire (1951) and three nonfiction books on psychiatry, psychoanalysis, and religion. His novel, Through Dooms of Love (1960), written with the assistance of his friend and admirer Graham Greene, covers a number of topics that were to psychiatric theory, treatment, and research at mid-century, and reflects several features of his own personal and professional vicissitudes. © 2015 Wiley Periodicals, Inc.
Rapid and accurate determination of Stern-Volmer quenching constants
International Nuclear Information System (INIS)
Goodpaster, John V.; McGuffin, Victoria L.
1999-01-01
In this work, a novel system has been designed, characterized, and validated for the determination of fluorescence quenching constants. Capillary flow injection methods are used to automate the preparation and mixing of the fluorophore and quencher solutions. Because of the small diameter of the capillary (75-200 μm), fluorescence measurements can be made without corrections for primary and secondary absorbance effects. The fluorescence spectrometer is equipped with a charge-coupled device (CCD) that has a detection limit of 3.0x10 -9 M (2.3 ppb) and a linear dynamic range of 10 5 for integration times of 0.01-10 s. This spectrometer has a 300 nm spectral range with 1 nm resolution, allowing the fluorescence quenching constants to be calculated at single wavelengths or over integrated wavelength ranges. This system was validated by comparison to traditional methods for the determination of Stern-Volmer constants for alternant and nonalternant polycyclic aromatic hydrocarbons with nitromethane and triethylamine. (c) 2000 Society for Applied Spectroscopy
Polarizing matter and antimatter: A new method
International Nuclear Information System (INIS)
Onel, Y.
1992-02-01
Several years ago a self-polarization effect for stored (anti)- protons and ions was investigated theoretically. The effect is based on the well-known Stern-Gerlach effect in gradient fields. The aim of the ongoing measurements at the Indiana University Cyclotron Facility (IUCF) is to verify experimentally the various assumptions on which this effect is based. The final goal is to demonstrate this new polarization effect. The proposed effect could be a powerful tool to produce polarized stored hadron beams both in the low-energy range and at SSC and LHC energies. In this progress report we will describe our progress in three parts: (A) Experimental work at IUCF Cooler Ring; (B) Our extensive computer simulations of the spin stability for the IUCF Cooler Ring; and (C) Theoretical studies
Polarizing matter and antimatter: A new method. Final report
International Nuclear Information System (INIS)
Onel, Y.
1994-12-01
Several years ago a self-polarization effect for stored (anti-)protons and ions was investigated theoretically. The effect is based on the well-known Stern-Gerlach effect in gradient fields. The aim of the ongoing measurements at the Indiana University Cyclotron Facility (IUCF) is to verify experimentally the various assumptions on which this effect is based. The final goal is to demonstrate this new polarization effect. The proposed effect could be a powerful tool to produce polarized stored hadron beams both in the low-energy range and at SSC and LHC energies. In this progress report the authors will describe the progress in three parts: (A) experimental work at IUCF Cooler Ring; (B) the extensive computer simulations of the spin stability for the IUCF Cooler Ring; and (C) theoretical studies
Vangaveti, S; Travesset, A
2014-12-28
We present here a method to separate the Stern and diffuse layer in general systems into two regions that can be analyzed separately. The Stern layer can be described in terms of Bjerrum pairing and the diffuse layer in terms of Poisson-Boltzmann theory (monovalent) or strong coupling theory plus a slowly decaying tail (divalent). We consider three anionic phospholipids: phosphatidyl serine, phosphatidic acid, and phosphatidylinositol(4,5)bisphosphate (PIP2), which we describe within a minimal coarse-grained model as a function of ionic concentration. The case of mixed lipid systems is also considered, which shows a high level of binding cooperativity as a function of PIP2 localization. Implications for existing experimental systems of lipid heterogeneities are also discussed.
Tomasello y Stern: Dos perspectivas actuales incluyentes del Desarrollo Infantil
Directory of Open Access Journals (Sweden)
Mata Isabel López
2011-01-01
Full Text Available El presente artículo tiene como objetivo ilustrar dos perspectivas actuales del desarrollo infantil incluyentes más que excluyentes -Michael Tomasello (cognitivo y Daniel Stern (social-subjetivo-, en cuanto a que integran a su explicación los descubrimientos de las capacidades tempranas del bebé -realizados a partir de 1970/80- y, sin renunciar al paradigma teórico particular del que provienen, reconocen junto a estas competencias tempranas el rol fundamental de los diversos factores intervinientes en el desarrollo -lo innato y lo ambiental (social y cultural-, los diferentes métodos de investigación y las limitaciones de una mirada reduccionista. Además, postulan que se hace necesaria la conversación entre las diferentes perspectivas teóricas, para lograr una descripción del infante como una unidad.
The economics of climate change impacts a la Stern. Novel and nuanced or rhetorically restricted?
International Nuclear Information System (INIS)
Spash, Clive L.
2007-01-01
The Stern report conducts an estimation of Greenhouse Gas control costs weighed against the benefits of avoiding damages at the global scale. As I show, Stern and colleagues are aware of the limits to CBA (cost benefit analysis), although they chose to ignore the considerable literature on the subject, the many contributions by ecological economists, and especially work specific to the enhanced Greenhouse Effect. Various problems are raised or mentioned in the report including: strong uncertainty, incommensurability, plural values, non-utilitarian ethics, rights, distributional inequity, poverty, and treatment of future generations. How then can this report, acknowledging so many of those aspects of climate change that render CBA an unsuitable tool for generating policy recommendations, go ahead to conduct a global CBA and make policy recommendations? I explain how issues are suppressed and sidelined in a careful and methodical manner, with the pretence they have been addressed by 'state of the art' solutions. Meanwhile, the authors maintain allegiance to an economic orthodoxy which perpetuates the dominant political myth that traditional economic growth can be both sustained and answer all our problems. Besides perpetuating myths, this diverts attention away from alternative approaches, away from ethical debates over harming the innocent, the poor and future generations, and away from the fundamental changes needed to tackle the very real and serious problems current economic systems pose for environmental systems. (author)
The economics of climate change impacts a la Stern. Novel and nuanced or rhetorically restricted?
Energy Technology Data Exchange (ETDEWEB)
Spash, Clive L. [CSIRO, Sustainable Ecosystems Division, GPO Box 284, Canberra, ACT 2601 (Australia)
2007-09-15
The Stern report conducts an estimation of Greenhouse Gas control costs weighed against the benefits of avoiding damages at the global scale. As I show, Stern and colleagues are aware of the limits to CBA (cost benefit analysis), although they chose to ignore the considerable literature on the subject, the many contributions by ecological economists, and especially work specific to the enhanced Greenhouse Effect. Various problems are raised or mentioned in the report including: strong uncertainty, incommensurability, plural values, non-utilitarian ethics, rights, distributional inequity, poverty, and treatment of future generations. How then can this report, acknowledging so many of those aspects of climate change that render CBA an unsuitable tool for generating policy recommendations, go ahead to conduct a global CBA and make policy recommendations? I explain how issues are suppressed and sidelined in a careful and methodical manner, with the pretence they have been addressed by 'state of the art' solutions. Meanwhile, the authors maintain allegiance to an economic orthodoxy which perpetuates the dominant political myth that traditional economic growth can be both sustained and answer all our problems. Besides perpetuating myths, this diverts attention away from alternative approaches, away from ethical debates over harming the innocent, the poor and future generations, and away from the fundamental changes needed to tackle the very real and serious problems current economic systems pose for environmental systems. (author)
Directory of Open Access Journals (Sweden)
Mehmet Atlar
2013-06-01
Full Text Available While displacement type Deep-V mono hulls have superior seakeeping behaviour at speed, catamarans typically have modest behaviour in rough seas. It is therefore a logical progression to combine the superior seakeeping performance of a displacement type Deep-V mono-hull with the high-speed benefits of a catamaran to take the advantages of both hull forms. The displacement Deep-V catamaran concept was developed in Newcastle University and Newcastle University's own multi-purpose research vessel, which was launched in 2011, pushed the design envelope still further with the successful adoption of a novel anti-slamming bulbous bow and tunnel stern for improved efficiency. This paper presents the hullform development of this unique vessel to understand the contribution of the novel bow and stern features on the performance of the Deep-V catamaran. The study is also a further validation of the hull resistance by using advanced numerical analysis methods in conjunction with the model test. An assessment of the numerical predictions of the hull resistance is also made against physical model test results and shows a good agreement between them.
INTERNACIONALIZAÇÃO DE MARCAS DE LUXO BRASILEIRAS: UM ESTUDO DE CASO DA JOALHERIA H. STERN
Directory of Open Access Journals (Sweden)
José Coelho de Andrade Albino
2009-01-01
Full Text Available Este estudo analisa os desafios que envolvem a gestão de marcas globais que atuam no campodo luxo, principalmente aquelas com origem em países do terceiro mundo como o Brasil. Paraa realização da pesquisa, adotou-se como estratégia metodológica o estudo de caso único,tendo-se como objeto empírico a joalheria H. Stern. O estudo se baseia em pesquisasbibliográficas; entrevistas em profundidade com os dirigentes da empresa; visitas técnicas àsua sede e principais lojas, pesquisa documental e análise de discurso das campanhasnacionais e internacionais da marca e dos seus principais concorrentes. Concluiu-se, ao finalda pesquisa, que a empresa seguiu os pressupostos da Escola de Uppsala ao promover suainternacionalização, assim como se encontra em fase de transição entre a primeira e segundacorrente do branding, conforme classificação proposta por Schultz, Antorini e Csaba (2005.Já com relação ao modelo de gestão de marcas de luxo desenvolvido por Beverland (2004,pode-se afirmar que a H. Stern gerencia, de forma consistente e integrada, sua marca emcontexto global.
DEFF Research Database (Denmark)
Andersen, Mathias Bækbo; Frey, J.; Bruus, Henrik
2010-01-01
Fundamental understanding of the unique physics at the solid-liquid interface in nanofluidic channels is essential for the advancement of basic scientific knowledge and the development of novel applications for pharmaceuticals, environmental health and safety, energy harvesting and biometrics [1......]. The current models used to describe surface phenomena in nanofluidics can differ by orders of magnitude from experimentally measured values [2]. To mitigate the discrepancies, we hypothesize that the Stern-layer capacitance Cs and the surface equilibrium constants pKa, vary with the composition of the solid...
Development of an experiment for ultrahigh-precision g-factor measurements in a Penning-trap setup
Energy Technology Data Exchange (ETDEWEB)
Alonso Otamendi, J.
2007-07-13
This thesis is concerned with the design and construction of an experimental setup aiming to perform ultrahigh-precision g-factor measurements on a bound electron in highly-charged ions. The g-factor of a particle is a dimensionless constant which determines the strength of its interaction with a magnetic field. In the case of an electron bound to a highly-charged ion, it serves as one of the most stringent tests of bound-state quantum electrodynamics (BS-QED). The measurement is based on a triple-Penning-trap system and the continuous Stern-Gerlach effect. The first part of the thesis is devoted to the current knowledge on magnetic moments and motivates the techniques and experimental setup used during the work described. As a major challenge to overcome, the charge breeding of the ions is dealt with in detail, along with the solution found, based on a field-emission-point array. The tools included allow for the measurement of ionization cross-sections by electron impact. The last part of the thesis is dedicated to the design and operation of the triple-Penning-trap setup and the detection schemes implemented. At present, all the experimental setup for the production of highly-charged ions and the corresponding g-factor measurement is completely finalized, including the control system needed for the first measurement stages, so the ion-creation and charge-breeding processes will be the next steps to be taken. (orig.)
Development of an experiment for ultrahigh-precision g-factor measurements in a Penning-trap setup
International Nuclear Information System (INIS)
Alonso Otamendi, J.
2007-01-01
This thesis is concerned with the design and construction of an experimental setup aiming to perform ultrahigh-precision g-factor measurements on a bound electron in highly-charged ions. The g-factor of a particle is a dimensionless constant which determines the strength of its interaction with a magnetic field. In the case of an electron bound to a highly-charged ion, it serves as one of the most stringent tests of bound-state quantum electrodynamics (BS-QED). The measurement is based on a triple-Penning-trap system and the continuous Stern-Gerlach effect. The first part of the thesis is devoted to the current knowledge on magnetic moments and motivates the techniques and experimental setup used during the work described. As a major challenge to overcome, the charge breeding of the ions is dealt with in detail, along with the solution found, based on a field-emission-point array. The tools included allow for the measurement of ionization cross-sections by electron impact. The last part of the thesis is dedicated to the design and operation of the triple-Penning-trap setup and the detection schemes implemented. At present, all the experimental setup for the production of highly-charged ions and the corresponding g-factor measurement is completely finalized, including the control system needed for the first measurement stages, so the ion-creation and charge-breeding processes will be the next steps to be taken. (orig.)
Quantum Mechanics for Everybody: An autonomous MOOC on EdX for nonscientists
Freericks, James; Cutler, Dylan; Vieira-Barbosa, Lucas
2017-01-01
We have launched a MOOC for nonscientists that teaches quantum mechanics using the Feynman methodology as outlined in his QED book and in a similar book by Daniel Styer. Using a combination of videos, voice-over powerpoint animations, computer simulations and interactive tutorials, we teach the fundamentals of quantum mechanics employing a minimum of math (high school algebra, square roots, and a little trigonometry) but going into detail on a number of complex quantum ideas. We begin with the Stern-Gerlach experiment, including delayed choice and Bell's inequality variants. Then we focus on light developing the quantum theory for partial reflection and diffraction. At this point we demonstrate the complexity of quantum physics by showing how watched and unwatched two-slit experiments behave differently and how quantum particles interfere. The four week course ends with advanced topics in light where we cover the idea of an interaction free measurement, the quantum Zeno effect and indistinguishable particles via the Hong-Ou-Mandel experiment. We hope this MOOC will reach thousands of students interesting in learning quantum mechanics without any dumbing down or the need to learn complex math. It can also be used with undergraduates to help with conceptual understanding. Funded by the National Science Foundation under grants numbered PHY-1620555 and PHY-1314295 and by Georgetown University.
The HERMES polarized hydrogen and deuterium gas target in the HERA electron storage ring
International Nuclear Information System (INIS)
Airapetian, A.; Akopov, N.; Akopov, Z.
2005-01-01
The HERMES hydrogen and deuterium nuclear-polarized gas targets have been in use since 1996 with the polarized electron beam of HERA at DESY to study the spin structure of the nucleon. Polarized atoms from a Stern-Gerlach Atomic Beam Source are injected into a storage cell internal to the HERA electron ring. Atoms diffusing from the center of the storage cell into a side tube are analyzed to determine the atomic fraction and the atomic polarizations. The atoms have a nuclear polarization, the axis of which is defined by an external magnetic holding field. The holding field was longitudinal during 1996-2000, and was changed to transverse in 2001. The design of the target is described, the method for analyzing the target polarization is outlined, and the performance of the target in the various running periods is presented
The HERMES polarized hydrogen and deuterium gas target in the HERA electron storage ring
International Nuclear Information System (INIS)
Airapetian, A.; Akopov, N.; Akopov, Z.; Peking University, Beijing
2004-08-01
The HERMES hydrogen and deuterium nuclear-polarized gas targets have been in use since 1996 with the polarized electron beam of HERA at DESY to study the spin structure of the nucleon. Polarized atoms from a Stern-Gerlach Atomic Beam Source are injected into a storage cell internal to the HERA electron ring. Atoms diffusing from the center of the storage cell into a side tube are analyzed to determine the atomic fraction and the atomic polarizations. The atoms have a nuclear polarization, the axis of which is defined by an external magnetic holding field. The holding field was longitudinal during 1996-2000, and was changed to transverse in 2001. The design of the target is described, the method for analyzing the target polarization is outlined, and the performance of the target in the various running periods is presented. (orig.)
Dietz, Simon; Morton, Alec
2011-01-01
In this article, we compare two high-profile strategic policy reviews undertaken for the U.K. government on environmental risks: radioactive waste management and climate change. These reviews took very different forms, both in terms of analytic approach and deliberation strategy. The Stern Review on the Economics of Climate Change was largely an exercise in expert modeling, building, within a cost-benefit framework, an argument for immediate reductions in carbon emissions. The Committee on Radioactive Waste Management, on the other hand, followed a much more explicitly deliberative and participative process, using multicriteria decision analysis to bring together scientific evidence and stakeholder and public values. In this article, we ask why the two reviews were different, and whether the differences are justified. We conclude that the differences were mainly due to political context, rather than the underpinning science, and as a consequence that, while in our view "fit for purpose," they would both have been stronger had they been less different. Stern's grappling with ethical issues could have been strengthened by a greater degree of public and stakeholder engagement, and the Committee on Radioactive Waste Management's handling of issues of uncertainty could have been strengthened by the explicitly probabilistic framework of Stern. © 2010 Society for Risk Analysis.
Hendrickson, Kelli; Yue, Dick
2016-11-01
This work presents the development and a priori testing of closure models for the incompressible highly-variable density turbulent (IHVDT) flow in the near wake region of a transom stern. This complex, three-dimensional flow includes three regions with distinctly different flow behavior: (i) the convergent corner waves that originate from the body and collide on the ship center plane; (ii) the "rooster tail" that forms from the collision; and (iii) the diverging wave train. The characteristics of these regions involve violent free-surface flows and breaking waves with significant turbulent mass flux (TMF) at Atwood number At = (ρ2 -ρ1) / (ρ2 +ρ1) 1 for which there is little guidance in turbulence closure modeling for the momentum and scalar transport along the wake. Utilizing datasets from high-resolution simulations of the near wake of a canonical three-dimensional transom stern using conservative Volume-of-Fluid (cVOF), implicit Large Eddy Simulation (iLES), and Boundary Data Immersion Method (BDIM), we develop explicit algebraic turbulent mass flux closure models that incorporate the most relevant physical processes. Performance of these models in predicting the turbulent mass flux in all three regions of the wake will be presented. Office of Naval Research.
Ivanov, Dmitri
2003-01-01
Kirjanik A. A. Shahhovski komöödias "Uus Stern" (1805) esitatud "tundliku kangelase" ja "veidriku" teemade intertekstuaalne võrdlus J. B. Knjazhnini komöödiaga "Veidrikud" (1790) ja koomilise ooperiga "Nesthastije ot karetõ" (1779)
Simulation Analysis of Spherical Mechanical Seal Property of Marine Stern Shaft
Directory of Open Access Journals (Sweden)
Zhou Xu Hui
2016-01-01
Full Text Available The finite element model of spherical mechanical seal wasestablished with ANSYS, and the influence of seawater pressure, shaft speed and other factors on the sealing performance was discussed. The study results show that local contact situation of the spherical mechanical seal is in the outside of the seal rings, and both maximum contact pressure and temperature appearat the same position. As sea water pressure and stern shaft rotary speed are increased, the contact pressure and temperature of the spherical seal surface are raised, and when the contact pressure of seal surface is 0, the spherical seal surface forms two zones including contact one and clearance zone. The former is near the outside of the seal ring, the lateris close to the inside of one. These research results are of important theoretical significance and engineering application value for the development of new kinds of mechanical seals, and improvement of both safety and survivability of underwater vehicles.
2015-06-19
decontamination strategies>> Maryline DEFEZ 1, Melissa HUNTER3J Susan WELKOS :~J Christopher COTE3 1 University Grenoble-Alpes, Grenoble, France. 1...inosine hydrolase and alanine racemase to enhance the germination of Bacillus anthracis Sterne spores potential spore decontamination strategies 5a...8217 • Accidentally in Humans • Natural reservoir is soil • Anthrax Disease Cycle: - animals infected by soilborne spores in food and water or bites from certain
Radio-loud magnetars as detectors for axions and axion-like particles
International Nuclear Information System (INIS)
Guendelman, E.I.; Chelouche, D.
2011-01-01
We show that, by studying the arrival times of radio pulses from highly-magnetized transient beamed sources, it may be possible to detect light pseudo-scalar particles, such as axions and axion-like particles, whose existence could have considerable implications for the strong-CP problem of QCD as well as the dark matter problem in cosmology. Specifically, such light bosons may be detected with a much greater sensitivity, over a broad particle mass range, than is currently achievable by terrestrial experiments, and using indirect astrophysical considerations. The observable effect was discussed in Chelouche & Guendelman (2009), and is akin to the Stern-Gerlach experiment: the splitting of a photon beam naturally arises when finite coupling exists between the electro-magnetic field and the axion field. The splitting angle of the light beams linearly depends on the photon wavelength, the size of the magnetized region, and the magnetic field gradient in the transverse direction to the propagation direction of the photons. If radio emission in radio-loud magnetars is beamed and originates in regions with strong magnetic field gradients, then splitting of individual pulses may be detectable. We quantify the effect for a simplified model for magnetars, and search for radio beam splitting in the 2GHz radio light curves of the radio loud magnetar XTEJ1810-197. (author)
Study of the equations of a particle in Non- Relativistic Quantum Mechanics
International Nuclear Information System (INIS)
Miltao, Milton Souza Ribeiro; Silva, Vanessa Santos Teles da
2011-01-01
Full text: The study of group theory is relevant to the treatment of physical problems, in which concepts of invariance and symmetry are important. In the field of Non-Relativistic Quantum Mechanics, we can do algebraic considerations taking into account the principles of symmetry, considering the framework of the study of Galileo transformations, which have characteristics of group. Therefore, we discuss the Stern-Gerlach experiment that had the historical importance of demonstrating that the electron has an intrinsic angular momentum. Through discussion of this experiment, we found that the spin appears in Non-Relativistic Quantum Mechanics as a feature of the algebraic structure underlying any physical theory represented by a group. From these studies, we have algebraic considerations for physical systems in non-relativistic domain, which are described by the Schroedinger and Pauli equations, describing the dynamics of particles of spin zero and 1/2 respectively, taking into account the structure of the transformations Galileo. Due to the operatorial, we represent Galileo's transformations by matrices by choosing an appropriate basis of space-time. Using these arrays, we saw group characteristics associated with these transformations, which we call the Galileo Group. We note the invariance of the Schroedinger and Pauli equations after these changes, as well as the physical state associated with it, which is represented by a radius vector in Hilbert space. (author)
Attraction between two similar particles in an electrolyte: effects of Stern layer absorption
Directory of Open Access Journals (Sweden)
Franck Plouraboué
2010-03-01
Full Text Available When Debye length is comparable or larger than the distance between two identical particles, the overlapping among the particles double-layers can play an important role in their interactions. This paper presents a theoretical analysis of the interaction among two identical particles with overlapped double-layers. We particularly focus on the effect of a Stern electro static condition from linearization of the adsorption isotherm near the isoelectric (neutrality point in order to capture how polyvalent ion condensation affect sand reverses the surface charge. The stationary potential problem is solved within the framework of an asymptotic lubrication approach for a mean-field Poisson-Boltzmann model. Both spherical and cylindrical particles are analyzed. The results are finally discussed in the context of Debye-Hückel (D-H limit and beyond it.Quando o comprimento de Debye é comparável ou maior do que as distâncias entre duas partículas idênticas, a interseção entre as duplas camadas pode desempenhar papel importante na interação entre elas. Este artigo apresenta uma análise teórica da interação entre duas partículas idênticas as quais apresentam interseção entre as camadas duplas. Nós particularmente focamos a análise sobre o efeito da condição eletrostática de Stern a partir da linearização da isoterma de adsorção perto do ponto isoelétrico para capturar como a condensação do íon polivalente afeta e reverte a densidade de carga superficial. O problema que governa o potencial estacionário é resolvido no contexto de uma teoria assintótica de lubrificação para o modelo de Poisson-Boltzmann. O modelo é analisado para partículas cilíndricas e esféricas. Os resultados são finalmente discutidos no contexto do limite de Debye-Hückel e além dele.
Phaswana, P H; Ndumnego, O C; Koehler, S M; Beyer, W; Crafford, J E; van Heerden, H
2017-09-07
The Sterne live spore vaccine (34F2) is the most widely used veterinary vaccine against anthrax in animals. Antibody responses to several antigens of Bacillus anthracis have been described with a large focus on those against protective antigen (PA). The focus of this study was to evaluate the protective humoral immune response induced by the live spore anthrax vaccine in goats. Boer goats vaccinated twice (week 0 and week 12) with the Sterne live spore vaccine and naive goats were used to monitor the anti-PA and toxin neutralizing antibodies at week 4 and week 17 (after the second vaccine dose) post vaccination. A/J mice were passively immunized with different dilutions of sera from immune and naive goats and then challenged with spores of B. anthracis strain 34F2 to determine the protective capacity of the goat sera. The goat anti-PA ELISA titres indicated significant sero-conversion at week 17 after the second doses of vaccine (p = 0.009). Mice receiving undiluted sera from goats given two doses of vaccine (twice immunized) showed the highest protection (86%) with only 20% of mice receiving 1:1000 diluted sera surviving lethal challenge. The in vitro toxin neutralization assay (TNA) titres correlated to protection of passively immunized A/J mice against lethal infection with the vaccine strain Sterne 34F2 spores using immune goat sera up to a 1:10 dilution (r s ≥ 0.522, p = 0.046). This study suggests that the passive mouse protection model could be potentially used to evaluate the protective immune response in livestock animals vaccinated with the current live vaccine and new vaccines.
Kuusk, Priit, 1938-
1999-01-01
30. apr.-7. juunini toimuvast muusikafestivalist Schwetzingenis. D. Ellingtoni 100. sünniaastapäeva tähistamisest maailmas. Valmis Linzi uue ooperimaja planeering. I. Stern juhatas kümnepäevast seminari Kölni Kõrgema Muusikakooli juures. Rahvusvahelise Nüüdismuusika Ühingu (ISCM) iga-aastased maailma muusikapäevad toimuvad 2000. aastal Luksemburgis
Chen, C.; Bolle, L.J.; Boois I.J. de, Ingeborg
2016-01-01
Since 1972, the Demersal Fish Survey (DFS) in the Wadden Sea has been carried out with the RV Stern. Within a few years this vessel will be replaced by another vessel as a result of the current ship replacement policy of Rijkswaterstaat Rijksrederij. It is not yet clear which vessel will replace RV
Energy Technology Data Exchange (ETDEWEB)
Jaing, Crystal [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Vergez, Lisa [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hinckley, Aubree [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thissen, James [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gardner, Shea [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McLoughlin, Kevin [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jackson, Paul [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ellingson, Sally [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Hauser, Loren [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Brettin, Tom [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Fofanov, Viacheslav [Eureka Genomics, Hercules, CA (United States); Koshinsky, Heather [Eureka Genomics, Hercules, CA (United States); Fofanov, Yuriy [Univ. of Houston, TX (United States)
2011-06-21
The objective of this project is to provide DHS a comprehensive evaluation of the current genomic technologies including genotyping, Taqman PCR, multiple locus variable tandem repeat analysis (MLVA), microarray and high-throughput DNA sequencing in the analysis of biothreat agents from complex environmental samples. As the result of a different DHS project, we have selected for and isolated a large number of ciprofloxacin resistant B. anthracis Sterne isolates. These isolates vary in the concentrations of ciprofloxacin that they can tolerate, suggesting multiple mutations in the samples. In collaboration with University of Houston, Eureka Genomics and Oak Ridge National Laboratory, we analyzed the ciprofloxacin resistant B. anthracis Sterne isolates by microarray hybridization, Illumina and Roche 454 sequencing to understand the error rates and sensitivity of the different methods. The report provides an assessment of the results and a complete set of all protocols used and all data generated along with information to interpret the protocols and data sets.
Dehghan, E.; Sanavi Khoshnoud, D.; Naeimi, A. S.
2018-01-01
The spin-resolved electron transport through a triangular network of quantum nanorings is studied in the presence of Rashba spin-orbit interaction (RSOI) and a magnetic flux using quantum waveguide theory. This study illustrates that, by tuning Rashba constant, magnetic flux and incoming electron energy, the triangular network of quantum rings can act as a perfect logical spin-filtering with high efficiency. By changing in the energy of incoming electron, at a proper value of the Rashba constant and magnetic flux, a reverse in the direction of spin can take place in the triangular network of quantum nanorings. Furthermore, the triangular network of quantum nanorings can be designed as a device and shows several simultaneous spintronic properties such as spin-splitter and spin-inverter. This spin-splitting is dependent on the energy of the incoming electron. Additionally, different polarizations can be achieved in the two outgoing leads from an originally incoming spin state that simulates a Stern-Gerlach apparatus.
Relativistic dynamics of point magnetic moment
Rafelski, Johann; Formanek, Martin; Steinmetz, Andrew
2018-01-01
The covariant motion of a classical point particle with magnetic moment in the presence of (external) electromagnetic fields is revisited. We are interested in understanding extensions to the Lorentz force involving point particle magnetic moment (Stern-Gerlach force) and how the spin precession dynamics is modified for consistency. We introduce spin as a classical particle property inherent to Poincaré symmetry of space-time. We propose a covariant formulation of the magnetic force based on a `magnetic' 4-potential and show how the point particle magnetic moment relates to the Amperian (current loop) and Gilbertian (magnetic monopole) descriptions. We show that covariant spin precession lacks a unique form and discuss the connection to g-2 anomaly. We consider the variational action principle and find that a consistent extension of the Lorentz force to include magnetic spin force is not straightforward. We look at non-covariant particle dynamics, and present a short introduction to the dynamics of (neutral) particles hit by a laser pulse of arbitrary shape.
International Nuclear Information System (INIS)
Barber, D.P.; Heinemann, K.; Ripken, G.
1991-05-01
In the following report we begin to reformulate work by Derbenev on the behaviour of coupled quantized spin-orbit motion. To this end we present a classical symplectic treatment of linear and non-linear spin-orbit motion for storage rings using a fully coupled eight-dimensional formalism which generalizes earlier investigations of coupled synchro-betatron oscillations by introducing two additional canonical spin variables which behave, in a small-angle limit, like those already used in linearised spin theory. Thus in addition to the usual x-z-s couplings, both the spin to orbit and orbit to spin coupling are described canonically. Since the spin Hamiltonian can be expanded in a Taylor series in canonical variables, the formalism is convenient for use in 8-dimensional symplectic tracking calculations with the help, for example, of Lie algebra or differential algebra for the study of chaotic spin motion, for construction of spin normal forms and for the study of the effect of Stern-Gerlach forces. (orig.)
Towards complete spectroscopy of 193Os
International Nuclear Information System (INIS)
Eisermann, Y.; Graw, G.; Metz, A.; Hertenberger, R.; Wirth, H.-F.
2002-01-01
Strong evidence for the existence of supersymmetry in atomic nuclei has been found in the quartet of nuclei 194,195 Pt, 195,196 Au. Our attention is now focused a second quartet of nuclei, that is 193,194 Ir, 192,193 Os where the model is applicable. We investigate the heaviest osmium isotope which is accessible in a single neutron transfer reaction: 193 Os. Excitation energies are known from (d,p) and (n,γ) measurements, but there is limited information about quantum numbers, To measure absolute cross-sections and asymmetries of the 192 Os(d(tilde),p) 193 Os reaction we used our facilities at the Munich tandem accelerator. The 22 MeV beam of vector-polarised deuterons was produced by our new Stern-Gerlach-Source. Outgoing protons were analysed by the Q3D magnetic spectrograph and detected with a strip-detector. The target consisted of a metallic foil of 146 μg/cm 2 highly enriched 192 Os (99%). (author)
Energy Technology Data Exchange (ETDEWEB)
Sturm, Sven
2012-09-06
This thesis describes the ultra-precise determination of the g-factor of the electron bound to hydrogenlike {sup 28}Si{sup 13+}. The experiment is based on the simultaneous determination of the cyclotron- and Larmor frequency of a single ion, which is stored in a triple Penning-trap setup. The continuous Stern-Gerlach effect is used to couple the spin of the bound electron to the motional frequencies of the ion via a magnetic bottle, which allows the non-destructive determination of the spin state. To this end, a highly sensitive, cryogenic detection system was developed, which allowed the direct, non-destructive detection of the eigenfrequencies with the required precision. The development of a novel, phase sensitive detection technique finally allowed the determination of the g-factor with a relative accuracy of 4 . 10{sup -11}, which was previously inconceivable. The comparison of the hereby determined value with the value predicted by quantumelectrodynamics (QED) allows the verification of the validity of this fundamental theory under the extreme conditions of the strong binding potential of a highly charged ion. The exact agreement of theory and experiment is an impressive demonstration of the exactness of QED. The experimental possibilities created in this work will allow in the near future not only further tests of theory, but also the determination of the mass of the electron with a precision that exceeds the current literature value by more than an order of magnitude.
International Nuclear Information System (INIS)
Sturm, Sven
2012-01-01
This thesis describes the ultra-precise determination of the g-factor of the electron bound to hydrogenlike 28 Si 13+ . The experiment is based on the simultaneous determination of the cyclotron- and Larmor frequency of a single ion, which is stored in a triple Penning-trap setup. The continuous Stern-Gerlach effect is used to couple the spin of the bound electron to the motional frequencies of the ion via a magnetic bottle, which allows the non-destructive determination of the spin state. To this end, a highly sensitive, cryogenic detection system was developed, which allowed the direct, non-destructive detection of the eigenfrequencies with the required precision. The development of a novel, phase sensitive detection technique finally allowed the determination of the g-factor with a relative accuracy of 4 . 10 -11 , which was previously inconceivable. The comparison of the hereby determined value with the value predicted by quantumelectrodynamics (QED) allows the verification of the validity of this fundamental theory under the extreme conditions of the strong binding potential of a highly charged ion. The exact agreement of theory and experiment is an impressive demonstration of the exactness of QED. The experimental possibilities created in this work will allow in the near future not only further tests of theory, but also the determination of the mass of the electron with a precision that exceeds the current literature value by more than an order of magnitude.
Beetz, Jürgen
2016-01-01
Jürgen Beetz zeigt zuerst den Ursprung der erdachten Geschichten der Physik aus der Steinzeit, denn vieles ist so einfach, dass es schon Steinzeitmenschen hätten verstehen können. Im Anschluss daran untersucht der Autor das Weltall auf seine Bestandteile: Monde, Planeten, Sterne, Galaxien usw. Daraus ergibt sich die Frage nach dessen Struktur und Dynamik: Ist das Universum ewig, endlos, konstant? Nichts davon: Es hat eine Entstehungsgeschichte, es expandiert und verändert sich – zum Teil aus noch ungeklärten Ursachen. Besonderes Augenmerk richtet er auf die Expansion des Weltalls und die sich daraus ergebenden Folgen.
Spin interference of neutrons tunneling through magnetic thin films
International Nuclear Information System (INIS)
Hino, Masahiro; Achiwa, Norio; Tasaki, Seiji; Ebisawa, Toru; Akiyoshi, Tsunekazu; Kawai, Takeshi.
1996-01-01
Larmor precession of a neutron spin is represented as the superposition of the wave functions of the two Stern-Gerlach states ↑ and ↓. A transverse neutron spin echo (NSE) spectrometer can hence be used as a neutron spin interferometer (NSI) by setting a magnetic film, such as iron and permalloy45 (Fe 55 Ni 45 ), thin enough to permit tunneling at an incident angle above and below the critical angle of the total reflection in the Larmor precession field. The NSI can be used to study spin coherent superposition and rotation of the Larmor precession through a magnetic thin film for a tunneling ↑ spin neutron and a non-tunneling ↓ spin neutron and to get the tunneling time using Larmor clock. The NSI experiments were carried out to measure the shifts of NSE signals transmitted through magnetic iron films with thicknesses of 200 and 400 A and those magnetic permalloy45 films with thicknesses of 200 and 400 A, respectively, as a function of the incident angle. Then even in tunneling ↑ spin neutron and non-tunneling ↓ spin neutron, NSE signal was observed. The phase delay was measured in iron and permalloy45 films with thickness of 200 A, and the tunneling time using Larmor clock was estimated to be 4 ± 0.6 x 10 -9 sec. (author)
Directory of Open Access Journals (Sweden)
Pasquale Caponnetto
2013-12-01
Full Text Available La coppia criminale è un fenomeno poco comune nell'ambito dei delitti in quanto la maggior parte dei criminali commette il crimine da solo o coinvolge altri individui solo per caso. Ciò nonostante, la letteratura rivela una serie di coppie criminali che hanno commesso diversi crimini, fino ad arrivare all’omicidio. Alcuni hanno ucciso per denaro, altri per odio, altri ancora per amore, per vendetta, per perversione. Bonnie e Clyde, Olindo e Rosa, Erika e Omar sono espressione di un viaggio nel fenomeno del “crimine di coppia” in cui manifestazioni di follia a due, al di là dell’infatuazione reciproca e della dipendenza psicologica, si svuotano di qualsiasi accezione romantica per concretizzarsi in qualcosa di spaventoso e incontenibile, capace di sfuggire ad ogni tipo di catalogazione e comprensione. Nel presente lavoro, in particolare, si andrà ad analizzare la coppia criminale degli autori della strage di Erba, che verrà esaminata nell’ottica della coscienza intersoggettiva di Stern. Le couple criminel est un phénomène rare puisque la majorité des crimes sont commis par des criminels seuls ou ce n’est que par hasard qu’ils impliquent d’autres personnes. Toutefois, la littérature parle d’une série de couples criminels qui ont commis des différents types de crimes (homicide inclus. Certains d’entre eux tuent pour de l’argent, certains autres à cause de la haine, de l’amour, de la revanche ou de la perversion. Bonnie et Clyde, Olindo et Rosa, Erika et Omar constituent des exemples du phénomène du « crime en couple ». Ce sont des situations de folie à deux qui n’ont aucune acception romantique et qui se traduisent en quelque chose d’horrifiant et d’incontrôlé. Dans cet article, les auteurs vont analyser le couple criminel composé par les responsables du massacre de Erba (Italie du Nord. L’objectif est d’examiner ce couple en utilisant l’approche de la conscience intersubjective de Daniel
Effects of hull form parameters on seakeeping for YTU gulet series with cruiser stern
Directory of Open Access Journals (Sweden)
Cakici Ferdi
2014-09-01
Full Text Available This study aims to identify the relations between seakeeping characteristics and hull form parameters for YTU Gulet series with cruiser stern. Seakeeping analyses are carried out by means of a computer software which is based on the strip theory and statistical short term response prediction method. Multiple regression analysis is used for numerical assessment through a computer software. RMS heave-pitch motions and absolute vertical accelerations on passenger saloon for Sea State 3 at head waves are investigated for this purpose. It is well known that while ship weight and the ratios of main dimensions are the primary factors on ship motions, other hull form parameters (CP, CWP, CVP, etc. are the secondary factors. In this study, to have an idea of geometric properties on ship motions of gulets three different regression models are developed. The obtained outcomes provide practical predictions of seakeeping behavior of gulets with a high level of accuracy that would be useful during the concept design stage
Bizarreness and Emotion Identification in Grete Stern Photomontages: Gender and Age Disparities.
Rosales-Lagarde, Alejandra; Martínez-Alcalá, Claudia Isabel; Pliego-Pastrana, Patricia; Molina-Trinidad, Eva María; Díaz, José-Luis
2017-01-01
Although the International Affective Picture System (IAPS) is used to evaluate emotions (valence, arousal, and dominance evoked by a large set of photographs), bizarre images in works of art have not been assessed with the IAPS procedures. Understood here as strange, non-sense, and absurd mental contents or expressions accompanied by surprise and confusion emotions, bizarreness was assessed after healthy adult volunteers assigned this specified variable to 140 Grete Stern's photomontages overtly intended to illustrate strange, absurd, and non-sensical contents in dream reports. The images were presented to 21 Young Males (YM) and 30 Young Females (YF) who were instructed to use the IAPS Self-Assessment Manikin, along with an additional bizarre-to-normal scale, to evaluate their response to them. The valence and the bizarre-to-normal ratings showed a dissimilar pattern of distribution between genders. Ratings of scales were different, and a greater variation in scales occurred according to gender. When bizarreness was appraised, gender differences became more evident especially for YF, who rated half of the images as bizarre, and with a diminished feeling of control, while the neutral and normal images were deemed more pleased and controlled. Valence, bizarreness, and dominance formed a different component than arousal in both groups. Negative correlations between valence and dominance, and between valence and bizarreness were also found in both groups, plus a positive one for dominance and bizarreness in YF, along with curvilinear relationships among all scales. On a second experiment, 10 photomontages evaluated by YF as bizarre or as normal were administered to 18 Old Males (OM) and 28 Old Females (OF). OF's arousal showed less neutral evaluations than OM's. In OF the bizarre images evoked either more excitation or calmness than in OM. The distribution of the bizarre-to-normal scale was significantly different across the evaluations in YM, YF, OM, and OF. The use
Beyond the Stern Review. Lessons from a risky venture at the limits of the cost-benefit analysis
International Nuclear Information System (INIS)
Hourcade, Jean-Charles; Ambrosi, Philippe; Dumas, Patrice
2009-01-01
This paper argues that debates amongst economists triggered by the Stern Review are partly relevant, focusing on key parameters translating real ethical issues, and partly misplaced in that they do not consider enough other determinants of climate change damages: (1) the specifications of the utility function used for the assessments (preference for the environment, preference for smooth growth paths), (2) the interplay between uncertainty and the sequentiality of the decision, and (3) whether the growth engines behind the integrated assessment models can account for transient disequilibrium and sub-optimality. We derive some suggestions for any future research agenda in integrated assessment modelling, whatever the position of the analysts about the relevance of the intertemporal optimisation framework and the Bayesian approach to uncertainty in the climate affair. (author)
Lim, Jongil; Whitcomb, John; Boyd, James; Varghese, Julian
2007-01-01
A finite element implementation of the transient nonlinear Nernst-Planck-Poisson (NPP) and Nernst-Planck-Poisson-modified Stern (NPPMS) models is presented. The NPPMS model uses multipoint constraints to account for finite ion size, resulting in realistic ion concentrations even at high surface potential. The Poisson-Boltzmann equation is used to provide a limited check of the transient models for low surface potential and dilute bulk solutions. The effects of the surface potential and bulk molarity on the electric potential and ion concentrations as functions of space and time are studied. The ability of the models to predict realistic energy storage capacity is investigated. The predicted energy is much more sensitive to surface potential than to bulk solution molarity.
Periodic magnetic field as a polarized and focusing thermal neutron spectrometer and monochromator
Energy Technology Data Exchange (ETDEWEB)
Cremer, J. T.; Williams, D. L.; Fuller, M. J.; Gary, C. K.; Piestrup, M. A. [Adelphi Technology, Inc., 2003 East Bayshore Rd., Redwood City, California 94063 (United States); Pantell, R. H.; Feinstein, J. [Department of Electrical Engineering, Stanford University, Stanford, California 94305 (United States); Flocchini, R. G.; Boussoufi, M.; Egbert, H. P.; Kloh, M. D.; Walker, R. B. [Davis McClellan Nuclear Radiation Center, University of California, McClellan, California 95652 (United States)
2010-01-15
A novel periodic magnetic field (PMF) optic is shown to act as a prism, lens, and polarizer for neutrons and particles with a magnetic dipole moment. The PMF has a two-dimensional field in the axial direction of neutron propagation. The PMF alternating magnetic field polarity provides strong gradients that cause separation of neutrons by wavelength axially and by spin state transversely. The spin-up neutrons exit the PMF with their magnetic spins aligned parallel to the PMF magnetic field, and are deflected upward and line focus at a fixed vertical height, proportional to the PMF period, at a downstream focal distance that increases with neutron energy. The PMF has no attenuation by absorption or scatter, as with material prisms or crystal monochromators. Embodiments of the PMF include neutron spectrometer or monochromator, and applications include neutron small angle scattering, crystallography, residual stress analysis, cross section measurements, and reflectometry. Presented are theory, experimental results, computer simulation, applications of the PMF, and comparison of its performance to Stern-Gerlach gradient devices and compound material and magnetic refractive prisms.
Continuous Faraday measurement of spin precession without light shifts
Jasperse, M.; Kewming, M. Â. J.; Fischer, S. Â. N.; Pakkiam, P.; Anderson, R. Â. P.; Turner, L. Â. D.
2017-12-01
We describe a dispersive Faraday optical probe of atomic spin which performs a weak measurement of spin projection of a quantum gas continuously for more than one second. To date, focusing bright far-off-resonance probes onto quantum gases has proved invasive due to strong scalar and vector light shifts exerting dipole and Stern-Gerlach forces. We show that tuning the probe near the magic-zero wavelength at 790 nm between the fine-structure doublet of 87Rb cancels the scalar light shift, and careful control of polarization eliminates the vector light shift. Faraday rotations due to each fine-structure line reinforce at this wavelength, enhancing the signal-to-noise ratio for a fixed rate of probe-induced decoherence. Using this minimally invasive spin probe, we perform microscale atomic magnetometry at high temporal resolution. Spectrogram analysis of the Larmor precession signal of a single spinor Bose-Einstein condensate measures a time-varying magnetic field strength with 1 μ G accuracy every 5 ms; or, equivalently, makes more than 200 successive measurements each at 10 pT /√{Hz } sensitivity.
Relativistic dynamics of point magnetic moment
Energy Technology Data Exchange (ETDEWEB)
Rafelski, Johann; Formanek, Martin; Steinmetz, Andrew [The University of Arizona, Department of Physics, Tucson, AZ (United States)
2018-01-15
The covariant motion of a classical point particle with magnetic moment in the presence of (external) electromagnetic fields is revisited. We are interested in understanding extensions to the Lorentz force involving point particle magnetic moment (Stern-Gerlach force) and how the spin precession dynamics is modified for consistency. We introduce spin as a classical particle property inherent to Poincare symmetry of space-time. We propose a covariant formulation of the magnetic force based on a 'magnetic' 4-potential and show how the point particle magnetic moment relates to the Amperian (current loop) and Gilbertian (magnetic monopole) descriptions. We show that covariant spin precession lacks a unique form and discuss the connection to g - 2 anomaly. We consider the variational action principle and find that a consistent extension of the Lorentz force to include magnetic spin force is not straightforward. We look at non-covariant particle dynamics, and present a short introduction to the dynamics of (neutral) particles hit by a laser pulse of arbitrary shape. (orig.)
Periodic magnetic field as a polarized and focusing thermal neutron spectrometer and monochromator.
Cremer, J T; Williams, D L; Fuller, M J; Gary, C K; Piestrup, M A; Pantell, R H; Feinstein, J; Flocchini, R G; Boussoufi, M; Egbert, H P; Kloh, M D; Walker, R B
2010-01-01
A novel periodic magnetic field (PMF) optic is shown to act as a prism, lens, and polarizer for neutrons and particles with a magnetic dipole moment. The PMF has a two-dimensional field in the axial direction of neutron propagation. The PMF alternating magnetic field polarity provides strong gradients that cause separation of neutrons by wavelength axially and by spin state transversely. The spin-up neutrons exit the PMF with their magnetic spins aligned parallel to the PMF magnetic field, and are deflected upward and line focus at a fixed vertical height, proportional to the PMF period, at a downstream focal distance that increases with neutron energy. The PMF has no attenuation by absorption or scatter, as with material prisms or crystal monochromators. Embodiments of the PMF include neutron spectrometer or monochromator, and applications include neutron small angle scattering, crystallography, residual stress analysis, cross section measurements, and reflectometry. Presented are theory, experimental results, computer simulation, applications of the PMF, and comparison of its performance to Stern-Gerlach gradient devices and compound material and magnetic refractive prisms.
The effect of growth medium on B. anthracis Sterne spore carbohydrate content.
Colburn, Heather A; Wunschel, David S; Antolick, Kathryn C; Melville, Angela M; Valentine, Nancy B
2011-06-01
The expressed characteristics of biothreat agents may be impacted by variations in the culture environment, including growth medium formulation. The carbohydrate composition of B. anthracis spores has been well studied, particularly for the exosporium, which is the outermost spore structure. The carbohydrate composition of the exosporium has been demonstrated to be distinct from the vegetative form containing unique monosaccharides. We have investigated the carbohydrate composition of B. anthracis Sterne spores produced using four different medium types formulated with different sources of medium components. The amount of rhamnose, 3-O-methyl rhamnose and galactosamine was found to vary significantly between spores cultured using different medium formulations. The relative abundance of these monosaccharides compared to other monosaccharides such as mannosamine was also found to vary with medium type. Specific medium components were also found to impact the carbohydrate profile. Xylose has not been previously described in B. anthracis spores but was detected at low levels in two media. This may represent residual material from the brewery yeast extract used to formulate these two media. These results illustrate the utility of this method to capture the impact of growth medium on carbohydrate variation in spores. Detecting carbohydrate profiles in B. anthracis evidentiary material may provide useful forensic information on the growth medium used for sporulation. Copyright © 2011 Elsevier B.V. All rights reserved.
Quantum theory as a description of robust experiments: Derivation of the Pauli equation
Energy Technology Data Exchange (ETDEWEB)
De Raedt, Hans [Department of Applied Physics, Zernike Institute for Advanced Materials, University of Groningen, Nijenborgh 4, NL-9747AG Groningen (Netherlands); Katsnelson, Mikhail I.; Donker, Hylke C. [Radboud University Nijmegen, Institute for Molecules and Materials, Heyendaalseweg 135, NL-6525AJ Nijmegen (Netherlands); Michielsen, Kristel, E-mail: k.michielsen@fz-juelich.de [Institute for Advanced Simulation, Jülich Supercomputing Centre, Forschungszentrum Jülich, D-52425 Jülich (Germany); RWTH Aachen University, D-52056 Aachen (Germany)
2015-08-15
It is shown that the Pauli equation and the concept of spin naturally emerge from logical inference applied to experiments on a charged particle under the conditions that (i) space is homogeneous (ii) the observed events are logically independent, and (iii) the observed frequency distributions are robust with respect to small changes in the conditions under which the experiment is carried out. The derivation does not take recourse to concepts of quantum theory and is based on the same principles which have already been shown to lead to e.g. the Schrödinger equation and the probability distributions of pairs of particles in the singlet or triplet state. Application to Stern–Gerlach experiments with chargeless, magnetic particles, provides additional support for the thesis that quantum theory follows from logical inference applied to a well-defined class of experiments. - Highlights: • The Pauli equation is obtained through logical inference applied to robust experiments on a charged particle. • The concept of spin appears as an inference resulting from the treatment of two-valued data. • The same reasoning yields the quantum theoretical description of neutral magnetic particles. • Logical inference provides a framework to establish a bridge between objective knowledge gathered through experiments and their description in terms of concepts.
Nuclear magnetic and electric dipole moments of neon-19
International Nuclear Information System (INIS)
MacArthur, D.W.
1983-01-01
This thesis presents a detailed discussion of a series of experiments designed to measure the magnetic and electric dipole moments of the β-emitting nucleus 19 Ne. The 19 Ne is generated in the reaction 19 F(p,n) 19 Ne and is polarized by a ''stern-Gerlach'' magnet in a rare gas atomic beams machine. The atoms are stored in a cell for many seconds without depolarizing. The parity violating asymmetry in the β angular distribution is used to monitor the nuclear polarization. The polarized atoms are stored in a cell in a uniform magnetic field. The β-asymmetry is monitored by a pair of β-detectors located on either side of the cell. Transitions between the M/sub J/ = +1/2 and M/sub J/ = -1/2 spin states are induced by an rf field generated by a small Helmholtz coil pair surrounding the cell. Nuclear magnetic resonance lines are observed and the magnetic moment of 19 Ne measured to be μ( 19 Ne) = -1.88542(8)μ/sub N/. A new magnet, cell and detectors were designed to give narrow resonance lines. The equipment is described in detail and several resonance line shapes are discussed. The narrowest resonance line achieved with this system was 0.043 Hz FWHM. This width is primarily due to the 19 Ne lifetime. Pulsed NMR lineshapes were also observed. The narrow NMR lines observed in the previous experiment were then used as a probe to look for an electric dipole moment (EDM) in 19 Ne. Any shift in the resonance frequency correlated with changes in an externally applied electric field would be evidence for an EDM. The EDM of the 19 Ne atom was measured to (7.2 +/- 6.2 X 10 -22 e-cm. This experiment and possible improvements are discussed in detail
The economics of climate change - the Stern review
Energy Technology Data Exchange (ETDEWEB)
Stern, N. Sir
2007-01-15
This review was announced by the Chancellor of the Exchequer in July 2005. It was undertaken by Sir Nicholas Stern, Head of the Government Economic Service and Adviser to the Government on the economics of climatic change and development. Having analysed a wide range of evidence on the impact of climate change, the aim of the review was to assess the economics of a low-carbon global economy; the long-term perspective; timescale for action; the choice of policies and institutions and specific lessons for the UK, in the context of its existing climate change goals. Using the results from formal economic models, the review estimates that if we don't act, the overall costs and risks of climate change will be equivalent to losing at least 5% of global GDP each year. If a wider range of risks and impacts is taken into account the estimates of damage could rise to 20% of GDP or more. The first half of the review considers how the evidence on the economic impact of climate, costs and benefits of action to reduce greenhouse gas emissions relates to the conceptual framework described. It covers climate change, including chapters on the science of climate change economics, ethics and discusses how climate change affects people worldwide, the implication of climate change for development, the costs of climate change in developed countries and economic modelling of climate change impacts. Other areas covered in this review include projecting the growth of greenhouse gas emissions, the cost of mitigation and macroeconomic modelling of costs. Adaptation to climate change is of the utmost importance, and whilst it is no longer possible to prevent the climate change that will take place over the next two to three decades it is still possible to protect our societies and economies from its impacts in the future. Promoting international cooperation, the role of adaptation in sustainable development and creating a global price for carbon are also discussed in this review. An
An extension to Galilean relativity gives rise to quantum mechanics framework
Berkovich, Simon
The presented scheme for quantum mechanics appeared from considering Cellular Automaton Universe in view of the hidden energy associated with the property of inertia. Galilean relativity states that all inertial frames are equivalent. Our consideration reveals one seemingly small exception - the original frame of reference for the material formations of the Cellular Automaton infrastructure is not isotropic. This frame of reference has a distinctive direction as long as elementary particles of matter are generated by cellular automaton relocations As a result, Cellular Automaton Universe basically complying with the laws of macrophysics for bulk bodies, could exhibit peculiar characteristics for microphysics.. Why the states of microobjects are described by complex numbers is obscure. The observables are presented by real numbers through corresponding macro manipulations. In the inertial frame with unidirectional anisotropy isolated particles are characterized by two numbers; magnitude of their velocity and inclination angle to motion direction. So, these quantum states are mapped to a complex Hilbert space with zero vector representing bulk bodies. The effect of spin may be associated with the sign of the inclination angle trending separations for Stern-Gerlach output and Paul Principle. Emeritus.
Talking about terrorism: Q and A with Jessica Stern
International Nuclear Information System (INIS)
Stern, J.
2006-01-01
Nuclear terrorism remains a potent threat. We have known for some time that terrorist groups have been seeking weapons of mass destruction. There are various ways that terrorists could use nuclear and other radioactive materials: they could acquire a nuclear weapon from a nuclear State; they could acquire the necessary fissile material and produce a weapon on their own, creating an improvised nuclear device; they could attack a nuclear power plant; or they could create a radiation dispersal device, a so-called dirty bomb. The first possibility would be the most devastating, but it is also probably the least likely. Stealing a bomb would be difficult because of the generally high security of facilities where nuclear weapons are stored. And a State that gave nuclear weapons to terrorists would have to seriously consider the probability that the source of the bomb could be identified, so retaliation against the State would be likely. In this regard, the revelation that terrorist groups were carrying out reconnaissance missions at Russian nuclear-weapon storage sites in 2001 was troubling; but the terrorists' efforts quickly became known to security personnel. The second possibility-the risk that terrorists will acquire nuclear-weapons usable materials-must be taken extremely seriously, especially in light of revelations about meetings between Pakistani nuclear scientists and al Qaeda, and about a clandestine effort to export nuclear technology run by the Khan network. Terrorists' dispersal of radioactive materials - either by attacking a nuclear plant or disseminating those materials with a home-made device-is the most likely scenario. Still, it is important to keep the threat in perspective. Dirty bombs are far more frightening than lethal. The article provides responses of Jessica Stern on questions about how big a threat nuclear terrorism is, how to minimize the risks of nuclear terrorism, the behaviour of states to combat the roots and reach of nuclear terrorism
Understanding colloidal charge renormalization from surface chemistry: Experiment and theory
Gisler, T.; Schulz, S. F.; Borkovec, M.; Sticher, H.; Schurtenberger, P.; D'Aguanno, B.; Klein, R.
1994-12-01
In this paper we report on the charging behavior of latex particles in aqueous suspensions. We use static light scattering and acid-base titrations as complementary techniques to observe both effective and bare particle charges. Acid-base titrations at various ionic strengths provide the pH dependent charging curves. The surface chemical parameters (dissociation constant of the acidic carboxylic groups, total density of ionizable sites and Stern capacitance) are determined from fits of a Stern layer model to the titration data. We find strong evidence that the dissociation of protons is the only specific adsorption process. Effective particle charges are determined by fits of integral equation calculations of the polydisperse static structure factor to the static light scattering data. A generalization of the Poisson-Boltzmann cell model including the dissociation of the acidic surface groups and the autodissociation of water is used to predict effective particle charges from the surface chemical parameters determined by the titration experiments. We find that the light scattering data are best described by a model where a small fraction of the ionizable surface sites are sulfate groups which are completely dissociated at moderate pH. These effective charges are comparable to the predictions by a basic cell model where charge regulation is absent.
The price of change [The Stern Review looks at the economics of climate change
International Nuclear Information System (INIS)
Stern, N.
2007-01-01
The Stern Review on the Economics of Climate Change, commissioned by the UK Treasury, has assessed a wide range of evidence on the impacts of climate change and on the economic costs. And, in its review, has used a number of different techniques to assess costs and risks. From all of these perspectives, the evidence gathered by the Review leads to a simple conclusion: the benefits of strong and early action far outweigh the economic costs of not acting. Climate change will affect the basic elements of life for people around the world - access to water, food production, health, and the environment. Hundreds of millions of people could suffer hunger, water shortages and coastal flooding as the world warms. So prompt and strong action is clearly warranted. Because climate change is a global problem, the response to it must be international. It must be based on a shared vision of long term goals and agreement on frameworks that will accelerate action over the next decade, and it must build on mutually reinforcing approaches at national, regional and international level. The UN Framework Convention on Climate Change and the Kyoto Protocol provide a basis for international co-operation, along with a range of partnerships and other approaches. But more ambitious action is now required around the world
Detection of individual spin transitions of a single proton confined in a cryogenic Penning trap
Energy Technology Data Exchange (ETDEWEB)
Kracke, Holger
2013-02-27
The presented experiment for the determination of the magnetic moment of the proton is based on the measurement of the ratio of cyclotron frequency and Larmor frequency of a single proton confined in a cryogenic double-Penning trap. In the course of this thesis, the simultaneous non-destructive measurement of two of the three eigenfrequencies of the proton in thermal equilibrium with corresponding detection systems was demonstrated, which reduces the measurement time of the cyclotron frequency by a factor of two. Furthermore, this thesis presents the first detection of individual spin transitions of a single proton, which allows for the determination of the Larmor frequency. The continuous Stern-Gerlach effect is utilized to couple the magnetic moment to the axial mode of the trapped proton by means of a magnetic bottle. Thus, a spin flip causes a jump of the axial frequency, which can be measured non-destructively with highly-sensitive detection systems. However, not only the spin momentum is coupled to the axial motion but also the angular momentum. Thus, the main experimental challenge is the elimination of energy fluctuations in the radial modes in order to maintain spin flip resolution. Due to systematic studies on the stability of the axial frequency and a complete revision of the experimental setup, this goal was achieved. The spin state of the proton can be determined with very high fidelity for the very first time. Thus, this thesis represents an important step towards a high-precision determination of the magnetic moment of the proton.
How It's Made - Polarized Proton Beam (444th Brookhaven Lecture)
International Nuclear Information System (INIS)
Zelenski, Anatoli
2008-01-01
Experiments with polarized beams at RHIC will provide fundamental tests of QCD, and the electro-weak interaction reveal the spin structure of the proton. Polarization asymmetries and parity violation are the strong signatures for identification of the fundamental processes, which are otherwise inaccessible. Such experiments require the maximum available luminosity and therefore polarization must be obtained as an extra beam quality without sacrificing intensity. There are proposals to polarize the high-energy proton beam in the storage rings by the Stern-Gerlach effect or spin-filter techniques. But so far, the only practically available option is acceleration of the polarized beam produced in the source and taking care of polarization survival during acceleration and storage. Two major innovations -- the 'Siberian Snake' technique for polarization preservation during acceleration and high current polarized proton sources make spin physics with the high-energy polarized beams feasible. The RHIC is the first high-energy collider, where the 'Siberian Snake' technique allowed of polarized proton beam acceleration up-to 250 GeV energy. The RHIC unique Optically Pumped Polarized Ion Source produces sufficient polarized beam intensity for complete saturation of the RHIC acceptance. This polarization technique is based on spin-transfer collisions between a proton or atomic hydrogen beam of a few keV beam energy and optically pumped alkali metal vapors. From the first proposal and feasibility studies to the operational source this development can be considered as example of successful unification of individual scientists ingenuity, international collaboration and modern technology application for creation of a new polarization technique, which allowed of two-to-three order of magnitude polarized beam intensity increase sufficient for loading the RHIC to its full capacity for polarization studies.
Laser-Free Cold-Atom Gymnastics
Gould, Harvey; Feinberg, Benedict; Munger, Charles T., Jr.; Nishimura, Hiroshi
2017-01-01
We have performed beam transport simulations on ultra cold (2 μK) and cold (130 μK) neutral Cs atoms in the F = M = + 4 (magnetic weak-field seeking) ground state. We use inhomogeneous magnetic fields to focus and accelerate the atoms. Acceleration of neutral atoms by an inhomogeneous magnetic field was demonstrated by Stern and Gerlach in 1922. In the simulations, a two mm diameter cloud of atoms is released to fall under gravity. A magnetic coil focuses the falling atoms. After falling 41 cm, the atoms are reflected in the magnetic fringe field of a solenoid. They return to their starting height, about 0.7 s later, having passed a second time through the focusing coil. The simulations show that > 98 % of ultra cold Cs atoms and > 70 % of cold Cs atoms will survive at least 15 round trips (assuming perfect vacuum). More than 100 simulations were run to optimize coil currents and focusing coil diameter and height. Simulations also show that atoms can be launched into a fountain. An experimental apparatus to test the simulations, is being constructed. This technique may find application in atomic fountain clocks, interferometers, and gravitometers, and may be adaptable for use in microgravity. It may also work with Bose-Einstein condensates of paramagnetic atoms.
A Study on molecular characterization of Razi Bacillus anthracis Sterne 34F2 substrain in Iran
Directory of Open Access Journals (Sweden)
Tadayon, K.
2016-07-01
Full Text Available Anthrax, a zoonotic disease caused by Bacillus anthracis, has affected humans since ancient times. For genomic characterization of Razi B. anthracis Sterne 34F2 substrain, single nucleotide polymorphism (SNP genotyping method developed by Van Erth, variable-number tandem-repeat (VNTR-8 analysis proposed by Keim, and multiple-locus VNTR analysis (MLVA-3 introduced by Levy were employed. In the SNPs typing system, where the nucleotide content of the genome at 13 evolutionary canonical loci was collectively analyzed, the originally South African 34F2 substrain was categorized in the A.Br.001/002 subgroup. In the VNTR-8 analysis, fragments with lengths of 314, 229, 162, 580, 532, 158, and 137 bp were identified at the following loci: vrrA, vrrB1, vrrB2, vrrC1, vrrC2, CG3, and pxO1, respectively. In addition, application of Levy's MLVA-3 genotyping method revealed that the genome of this strain carried 941, 451, and 864 bp fragments at AA03, AJ03, and AA07 loci, respectively. The present findings are undoubtedly helpful in meeting the requirements set by the World Organization for Animal Health (OIE and World Health Organization (WHO for anthrax vaccine manufacturers including Razi Institute. However, further similar studies are required to promote the current epidemiological knowledge of anthrax in Iran.
Role of spinning electrons in paramagnetic phenomena
International Nuclear Information System (INIS)
Bose, D.M.
1986-06-01
An attempt is made to explain paramagnetic phenomena without assuming the orientation of a molecule or ion in a magnetic field. Only the spin angular momentum is assumed to be responsible. A derivative of the Gurie-Langevin law and the magnetic moments of ions are given as a function of the number of electrons in an inner, incomplete shell. An explanation of Gerlach's experiments with iron and nickel vapors is attempted. An explanation of magnetomechanical experiments with ferromagnetic elements is given
A miniature magnetic waveguide for cold atoms
International Nuclear Information System (INIS)
Key, M.G.
2000-09-01
This thesis presents the first demonstration of a guide for cold atoms based on a miniature structure of four current-carrying wires. The four wires are embedded within a hollow silica fibre. Atoms are guided along the centre of a fifth hole on the axis of the fibre by the Stern-Gerlach force. A vapour cell Magneto Optical Trap (MOT), formed 1 cm above the mouth of the waveguide is the source of cold 85 Rb atoms. After cooling the atoms to 25 μK in optical molasses they fall under the influence of gravity through a magnetic funnel into the waveguide. After propagating for 2 cm, the atoms are reflected by the field of a small pinch coil wound around the base of the guide. The atoms then travel back up the fibre and out into the funnel, where they can be imaged either in fluorescence or by recapturing in the MOT. A video sequence of atoms falling into the guide and re-emerging after reflection from the pinch coil graphically illustrates the operation of the guide. The coupling efficiency and transverse temperature of the atoms is measured experimentally and in a Monte-Carlo simulation. We find an optimum coupling efficiency of 12% and we measure the spatial extent of the cloud within the fibre to be of order 100 μm. We find good agreement between experimental data and results from the numerical simulation. We have also been able to observe different thresholds for the reflection of different positive m F levels. In another experiment we are able to trap the atoms in an elongated Ioffe trap for up to two seconds, increasing the distance over which the atoms are guided. We are able to guide the atoms over distances of 40 cm with a loss rate indistinguishable from the free space loss rate. (author)
DEFF Research Database (Denmark)
Bordaberry, Pierre; Gerlach, Christian; Lenoble, Quentin
2016-01-01
Background/Study Context: The objective of this study was to investigate the object recognition deficit in aging. Age-related declines were examined from the presemantic account of category effects (PACE) theory perspective (Gerlach, 2009, Cognition, 111, 281–301). This view assumes that the stru......Background/Study Context: The objective of this study was to investigate the object recognition deficit in aging. Age-related declines were examined from the presemantic account of category effects (PACE) theory perspective (Gerlach, 2009, Cognition, 111, 281–301). This view assumes...... that the structural similarity/dissimilarity inherent in living and nonliving objects, respectively, can account for a wide range of category-specific effects. Methods: In two experiments on object recognition, young (36 participants, 18–27 years) and older (36 participants, 53–69 years) adult participants...... in the selection stage of the PACE theory (visual long-term memory matching) could be responsible for these impairments. Indeed, the older group showed a deficit when this stage was most relevant. This article emphasize on the critical need for taking into account structural component of the stimuli and type...
Dreaming woman: Image, place, and the aesthetics of exile.
Greenspan, Rachel
2017-08-01
Looking closely at an Argentine dream interpretation column published in a popular women's magazine from 1948 to 1951, this article examines the role of the dream image in shaping psychoanalytic discourse on femininity and national identity. The column, 'Psychoanalysis Will Help You,' emerged during Juan Domingo Perón's first presidency, featuring verbal interpretations written under the pen name 'Richard Rest,' as well as surreal photomontages by Grete Stern, a German-born, Bauhaus-trained photographer living in exile since 1936. While the column's Jungian text encourages readers' adaptation to the external reality of their social situation, Stern's droll images emphasize the disjuncture between subject and environment, exposing tensions between the experience of exile and the Peronist mission to consolidate an Argentine national identity. Experimenting formally with European avant-garde techniques, Stern presents femininity and nation as conflictive imaginary configurations. This theme resurfaces at the 2013 Venice Biennale, where Nicola Costantino's multimedia installation Eva - Argentina: A Contemporary Metaphor was exhibited alongside Carl Jung's Red Book. Formal contrasts between Stern's use of photomontage, Costantino's projection technique, and Jung's theory of mandala symbolism indicate the divergent ways in which their artwork posits the therapeutic function of the dream image, as well as the role of aesthetic production in psychoanalytic care. Copyright © 2017 Institute of Psychoanalysis.
2007-08-01
molecular weight forms of ADAMTS13 in plasma, suggesting its cleavage by proteases in addition to decreased synthesis in the liver.71 ADAMTS13... fulminate liver failure and death 101. In our experiments, PAI-1 is increased 2-fold in Sterne challenged mice (days 1-3) and 3-fold in ∆- Sterne...cells is affected by anthrax exposure is novel. AKT is also a regulator of glycogen synthesis via the phosphorylation of glycogen synthase kinase
Directory of Open Access Journals (Sweden)
Sarjito Jokosisworo
2012-04-01
Full Text Available Kapal KM. Kirana I adalah kapal tipe Ro - Ro Passanger Ship yang beroperasi di Pulau Jawa dengan rute pelayaran Pelabuhan Semarang - Sampit yang mampu mengangkut penumpang dan kendaraan dalam jumlah yang relatif banyak. Untuk memudahkan akses keluar masuk kendaraan yang akan diangkut, maka kapal ini dilengkapi dengan sebuah ramp door sistem steel wire rope yang terletak di bagian buritan kapal (stern ramp door. Ramp door akan menerima beban dinamis secara berulang-ulang sehingga mengakibatkan kelelahan material (fatigue. Analisa fatigue konstruksi rampdoor dilakukan dengan menggunakan metode elemen hingga diskrit segitiga plane stress dengan tujuan untuk mendapatkan hasil analisa yang lebih akurat. Pemodelan dilakukan dengan menggunakan program bantu berbasis CAD, sedangkan untuk analisa fatigue menggunakan program berbasis elemen hingga. Analisa yang digunakan adalah analisa beban dinamis dengan amplitudo berubah berdasarkan variasi 4 beban kendaran. Untuk mengetahui letak kondisi paling kritis rampdoor dibagi menjadi 3 bagian dengan mengambil lokasi pnode 180, 140, dan 100. Berdasarkan hasil analisa didapat umur ramp door selama 3186 siklus atau 2 tahun 9 bulan 4 hari dan mempunyai nilai intensitas tegangan patah sebenarnya sebesar 400,713 Mpa.
Energy Technology Data Exchange (ETDEWEB)
Molavi, Mohamad, E-mail: Mo_molavi@yahoo.com [Faculty of Physics, Kharazmi University, Tehran (Iran, Islamic Republic of); Faizabadi, Edris, E-mail: Edris@iust.ac.ir [School of Physics, Iran University of Science and Technology, 16846 Tehran (Iran, Islamic Republic of)
2017-04-15
By using the Green's function formalism, we investigate the effects of single particle energy levels of a quantum dot on the spin-dependent transmission properties through a triple-quantum-dot ring structure. In this structure, one of the quantum dots has been regarded to be non-magnetic and the Rashba spin-orbit interaction is imposed locally on this dot while the two others can be magnetic. The on-site energy of dots, manipulates the interference of the electron spinors that are transmitted to output leads. Our results show that the effects of magnetic dots on spin-dependent transmission properties are the same as the difference of on-site energies of the various dots, which is applicable by a controllable lateral bias voltage externally. Besides, by tuning the parameters such as Rashba spin-orbit interaction, and on-site energy of dots and magnetic flux inside the ring, the structure can be indicated the spin-flip effect and behave as a full spin polarizer or splitter. - Highlights: • The effects of magnetic dots on spin-dependent transmission properties are the same as the difference of on-site energies of the various dots. • In the situation that the QDs have non-zero on-site energies, the system can demonstrate the full spin-polarization. • By tuning the Rashba spin-orbit strength and magnetic flux encountered by the ring the system operates as a Stern-Gerlach apparatus.
International Nuclear Information System (INIS)
Jueptner, G.; Kumpf, H.; Molz, G.; Neunert, B.; Seidl, O.
1976-01-01
This report goes into the reasons for selecting a 'STERN' (star) vessel configuration for accommodating a complete primary circuit including PWR, this involving the grouping of cylindrical pressure vessels of independent design into a star-shaped configuration with the central vessel housing the reactor core in the middle. This arrangement was made possible by application of the DYWIDAG-radial prestressing process generating controlled annular prestressing using existing presses and by an organic coupling of individual vessels. The liner, heat insulating and cooling system required for each vessel comprises a so-called support boiler, i.e. a hot liner not handicapped by the disadvantages of other systems. The support boiler is placed in the and PCV and has flat floor and cover surfaces. Temperature constraints are reduced to specific design requirements by means of radial gap permitting precise adjustment in conjunction with an axial expanding element comprising a multilayer diaphragm which is supported in operation. A detailed description is given of the PCPV, the support boiler and the cover used in the center vessel as well as of their design, the assembly and construction work is described and a summary presented of the quantities and estimated prices involved. Due to the absence of steam raising facilities adapted to meet the star-shaped configuration requirements, a study of satellite vessels was dispensed with, the design of which is in full accord with that of the center vessel. One part of the report is concerned with the calculation of the center vessel. (orig./HP) [de
1979-11-01
Business Aircraft Meeting, Wichita, Kansas, SAE Paper no. 700236, 1970. 6. O.H. Gerlach: " The determination of stability derivatives and performance...Aircraft Meeting, Wichita, Kansas, SAE Paper no. 700236, 1970. 3. O.H. Gerlach: "Analyse van een mogelijke methode voor het meten van prestaties en...00 r4 04 E OC -- 4-E0r- - 2 L 0~ L V) cV-41-v V @E1- D 0 to cJ 0 E4 -- - ’.- 0L041.10 Ma 0 u0 M. 4140 JO r L -. V C) 0->0-L C L C40 co c Cd u u u 0 u
First observation of spin flips with a single proton stored in a cryogenic Penning trap
International Nuclear Information System (INIS)
Ulmer, Stefan
2011-01-01
In this thesis the very first observation of spin transitions of a single proton stored in a cryogenic double-Penning trap is presented. The experimental observation of spin transitions is based on the continuous Stern-Gerlach effect, which couples the spin of the single trapped proton to its axial eigenfrequency, by means of an inhomogeneous magnetic field. A spin transition causes a change of the axial frequency, which can be measured non-destructively. Due to the tiny magnetic moment of the proton, the direct detection of proton spin-flips is an exceeding challenge. To achieve spin-flip resolution, the proton was stored in the largest magnetic field inhomogeneity, which has ever been superimposed to a Penning trap, and its axial frequency was detected non-destructively. Therefore, superconducting detection systems with ultrahigh-sensitivity were developed, allowing the direct observation of the single trapped proton, as well as the high-precision determination of its eigenfrequencies. Based on novel experimental methods, which were developed in the framework of this thesis, the axial frequency of the particle was stabilized to a level, where the observation of single-proton spin-flips is possible, which was demonstrated. This experimental success is one of the most important steps towards the high-precision determination of the magnetic moment of the free proton. With the very first observation of spin transitions with a single trapped proton, a highly exciting perspective opens. All experimental techniques which were developed in this thesis can be directly applied to the antiproton. Thus, the first high-precision measurement of the magnetic moment of the antiproton becomes possible. This will provide a new high-precision test of the matterantimatter symmetry. (orig.)
... Spira Galifianakis Gallagher Galvez-Jimenez Gancher Garnett Garrett Gates Gayton Gaziano Gelb Geleris George Gerber Gerlach Germano ... Donate Donate Online Membership Find an Event Donor Bill of Rights About Dystonia Symptoms & Diagnosis Forms of ...
STRATUL DUBLU ELECTRIC AL MONTMORILONITULUI. II. ANALIZE COMPARATIVE ALE MODELELOR
Directory of Open Access Journals (Sweden)
Vasile RUSU
2017-07-01
Full Text Available A fost analizată relaţia potenţial – distanţa de la suprafaţa solidului în volumul soluţiei în modelul Gouy-Chapman, modelul Stern şi modelul modificat Gouy-Chapman. Modelările efectuate conform modelului Stern pentru H-montmorilonit şi Al-montmorilonit intercalat cu oligomeri de aluminiu evidenţiază particularităţile stratului dublu electric în proximitatea suprafeţei bazale şi a suprafeţei laterale a montmorilonitului. Dinamica potenţialului în volumul soluţiei prin modelul modificat Gouy-Chapman devine identică modelului Stern, în condiţiile atribuirii caracteristicilor stratului compact din modelul Stern.EDL FOR MONTMORILLONITE. II. COMPARATIVE ANALYSIS OF MODELS The relationship potential - the distance from the surface of the solid towards the solution by the Gouy-Chapman model, the Stern model, and the modified Gouy-Chapman model were analyzed. Modeling performed according to the Stern model for H-montmorillonite and pillared Al-montmorillonite highlights the peculiarities of the double electric layer close to the basal and edge surfaces. The potential dynamics in the solution by the modified Gouy-Chapman model becomes identical to the Stern model if the main characteristics of Stern layer are attributed.
Distributed Multi-propulsion Units System
原田, 正志; HARADA, Masashi
2002-01-01
Reduction of the weight of the propulsion system is important in the design of a stratospheric airship. However, it also important to increaseefficiency of the system because available energy generated by solar cells on the hull is quite limited. One solution to increase efficiency of the propulsion system is to use a stern propeller, the propeller mounted on the stern of the hull as shown in Figure 1. Mounted on the stern of the hull, the stern propeller is merged with the boundary layer of ...
O lugar da experiência afetiva na gênese dos processos de subjetivação
Directory of Open Access Journals (Sweden)
Carlos Augusto Peixoto Junior
2011-12-01
Full Text Available Dada a atualidade e a importância dos afetos na gênese dos processos de subjetivação, este artigo tem como objetivo central discutir as teses formuladas por Daniel Stern, autor que vem se dedicando nos últimos anos a observações minuciosas dos processos primários de subjetivação do infante, prestando uma atenção especial ao tema da experiência afetiva. Partindo de uma localização dos afetos em sua teoria, passamos a uma discussão a propósito da forma temporal dos sentimentos no contexto das relações interpessoais, para então analisarmos dois dos principais conceitos formulados por ele, quais sejam, os de afeto de vitalidade e sintonia afetiva. Ao longo desta discussão também serão contemplados outros temas relevantes, tais como as noções de interação afetiva, empatia e comunicação emocional.
Nitrates from Agriculture in Europe : The EC Nitrates Directive and Its Implementation in England
Grossman, M.R.
2000-01-01
The United Nations recently issued a stern warning regarding the excessive use of nitrogen in agriculture: “[W]e are fertilizing the Earth on a global scale and in a largely uncontrolled experiment.” Nitrogen is an essential nutrient for crop production. Excess nitrogen, however, pollutes both
Austria between Utopia and Dystopia in Austrian, German, and American Post-Exile Writings
DEFF Research Database (Denmark)
Ortner, Jessica
2015-01-01
Exile, in the sense of a literal forced transgression of borders due to persecution during the time of the Nazi regime, has fostered a broad range of “post-exile writings” in which the present generation “fictionally recreat[es] the experiences of their elders” (Stern, 1994). These writings can...
International Nuclear Information System (INIS)
Heinemann, K.; Ellison, J.A.
2015-01-01
We return to our study (2001) of invariant spin fields and spin tunes for polarized beams in storage rings but in contrast to the continuous-time treatment in this study, we now employ a discrete-time formalism, beginning with the Poincare maps of the continuous time formalism. We then substantially extend our toolset and generalize the notions of invariant spin field and invariant frame field. We revisit some old theorems and prove several theorems believed to be new. In particular we study two transformation rules, one of them known and the other new, where the former turns out to be an SO(3)-gauge transformation rule. We then apply the theory to the dynamics of spin-1/2 and spin-1 particle bunches and their density matrix functions, describing semiclassically the particle-spin content of bunches. Our approach thus unifies the spin-vector dynamics from the T-BMT equation with the spin-tensor dynamics and other dynamics. This unifying aspect of our approach relates the examples elegantly and uncovers relations between the various underlying dynamical systems in a transparent way. The particle motion is integrable but we now allow for nonlinear particle motion on each torus. Since this work is inspired by notions from the theory of bundles, we also provide insight into the underlying bundle-theoretic aspects of the well-established concepts of invariant spin field, spin tune and invariant frame field. Thus the group theoretical notion is exhibited. Since we neglect, as is usual, the Stern-Gerlach force, the underlying principal bundle is of product form so that we can present the theory in a fashion which does not use bundle theory. Nevertheless we occasionally mention the bundle-theoretic meaning of our concepts and we also mention the similarities with the geometrical approach to Yang-Mills Theory.
Energy Technology Data Exchange (ETDEWEB)
Heinemann, K.; Ellison, J.A. [New Mexico Univ., Albuquerque, NM (United States). Dept. of Mathematics and Statistics; Barber, D.P.; Vogt, M. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)
2015-01-15
We return to our study (2001) of invariant spin fields and spin tunes for polarized beams in storage rings but in contrast to the continuous-time treatment in this study, we now employ a discrete-time formalism, beginning with the Poincare maps of the continuous time formalism. We then substantially extend our toolset and generalize the notions of invariant spin field and invariant frame field. We revisit some old theorems and prove several theorems believed to be new. In particular we study two transformation rules, one of them known and the other new, where the former turns out to be an SO(3)-gauge transformation rule. We then apply the theory to the dynamics of spin-1/2 and spin-1 particle bunches and their density matrix functions, describing semiclassically the particle-spin content of bunches. Our approach thus unifies the spin-vector dynamics from the T-BMT equation with the spin-tensor dynamics and other dynamics. This unifying aspect of our approach relates the examples elegantly and uncovers relations between the various underlying dynamical systems in a transparent way. The particle motion is integrable but we now allow for nonlinear particle motion on each torus. Since this work is inspired by notions from the theory of bundles, we also provide insight into the underlying bundle-theoretic aspects of the well-established concepts of invariant spin field, spin tune and invariant frame field. Thus the group theoretical notion is exhibited. Since we neglect, as is usual, the Stern-Gerlach force, the underlying principal bundle is of product form so that we can present the theory in a fashion which does not use bundle theory. Nevertheless we occasionally mention the bundle-theoretic meaning of our concepts and we also mention the similarities with the geometrical approach to Yang-Mills Theory.
Energy Technology Data Exchange (ETDEWEB)
Quastel, A.; Thiriet, C. [Atomic Energy of Canada Limited, Chalk River, ON (Canada); Lewis, B., E-mail: brent.lewis@uoit.ca [Univ. of Ontario Inst. of Tech., Oshawa, ON (Canada); Corcoran, E., E-mail: emily.corcoran@rmc.ca [Royal Military College of Canada, Kingston, ON (Canada)
2014-07-01
An experimental program funded by the CANDU Owners Group (COG) is studying an out-reactor instrumented defected fuel experiment in Stern Laboratories (Hamilton, Ontario) with guidance from Atomic Energy of Canada Limited (AECL). The objective of this test is to provide experimental data for validation of a mechanistic fuel oxidation model. In this experiment a defected fuel element with UO{sub 2} pellets will be internally heated with an electrical heater element, causing the fuel to crack. By defecting the sheath in-situ the fuel will be exposed to light water coolant near normal reactor operating conditions (pressure 10 MPa and temperature 265-310{sup o}C) causing fuel oxidation, especially near the hotter regions of the fuel in the cracks. The fuel thermal conductivity will change, resulting in a change in the temperature distribution of the fuel element. This paper provides 2D r-θ plane strain solid mechanics models to simulate fuel thermal expansion, where conditions for fuel crack propagation are investigated with the thermal J integral to predict fuel crack stress intensity factors. Finally since fuel crack geometry can affect fuel oxidation this paper shows that the solid mechanics model with pre-set radial cracks can be coupled to a 2D r-θ fuel oxidation model. (author)
Tomasula, P M; Mukhopadhyay, S; Datta, N; Porto-Fett, A; Call, J E; Luchansky, J B; Renye, J; Tunick, M
2011-09-01
High-temperature, short-time pasteurization of milk is ineffective against spore-forming bacteria such as Bacillus anthracis (BA), but is lethal to its vegetative cells. Crossflow microfiltration (MF) using ceramic membranes with a pore size of 1.4 μm has been shown to reject most microorganisms from skim milk; and, in combination with pasteurization, has been shown to extend its shelf life. The objectives of this study were to evaluate MF for its efficiency in removing spores of the attenuated Sterne strain of BA from milk; to evaluate the combined efficiency of MF using a 0.8-μm ceramic membrane, followed by pasteurization (72°C, 18.6s); and to monitor any residual BA in the permeates when stored at temperatures of 4, 10, and 25°C for up to 28 d. In each trial, 95 L of raw skim milk was inoculated with about 6.5 log(10) BA spores/mL of milk. It was then microfiltered in total recycle mode at 50°C using ceramic membranes with pore sizes of either 0.8 μm or 1.4 μm, at crossflow velocity of 6.2 m/s and transmembrane pressure of 127.6 kPa, conditions selected to exploit the selectivity of the membrane. Microfiltration using the 0.8-μm membrane removed 5.91±0.05 log(10) BA spores/mL of milk and the 1.4-μm membrane removed 4.50±0.35 log(10) BA spores/mL of milk. The 0.8-μm membrane showed efficient removal of the native microflora and both membranes showed near complete transmission of the casein proteins. Spore germination was evident in the permeates obtained at 10, 30, and 120 min of MF time (0.8-μm membrane) but when stored at 4 or 10°C, spore levels were decreased to below detection levels (≤0.3 log(10) spores/mL) by d 7 or 3 of storage, respectively. Permeates stored at 25°C showed coagulation and were not evaluated further. Pasteurization of the permeate samples immediately after MF resulted in additional spore germination that was related to the length of MF time. Pasteurized permeates obtained at 10 min of MF and stored at 4 or 10°C showed no
Orna Me: Laurence Sterne’s Open Letter to Literary History
Directory of Open Access Journals (Sweden)
Celia B. Barnes
2016-12-01
Full Text Available This essay considers the curious way Laurence Sterne communicates with and reflects on his literary predecessors, most often Alexander Pope, by writing love letters to women. Focusing primarily on his correspondence with Elizabeth Draper, Barnes contends that, even as Sterne looks back to Pope to guarantee himself a place in literary history, he looks forward to women like Draper to ensure his name will survive. Thus, erotic correspondence becomes an important way of ensuring Sterne’s literary estate, or as he terms it, his “futurity.” “Orna Me”—a phrase that means, roughly, “ornament me” or “set me off,” and that Sterne got from Pope and Swift, who got it from Cicero—allows Sterne to plug in to a literary tradition that privileges collaboration: append something of yours to something of mine. It is this idea of letter-writing as correspondence, a collaborative process between friends or lovers, that unites Sterne to his female correspondent and to literary tradition all at once.
STRATUL DUBLU ELECTRIC AL MONTMORILONITULUI. I. INFLUENŢA INTERCALĂRII CU OLIGOMERI DE ALUMINIU
Directory of Open Access Journals (Sweden)
Vasile RUSU
2017-03-01
Full Text Available A fost dezvoltat criteriul pentru delimitarea caracteristicilor stratului dublu electric în proximitatea suprafeţei bazale şi suprafeţei laterale ale montmorilonitului intercalat cu oligomeri de aluminiu şi au fost determinate caracteristicile stratului dublu electric în modelul Stern. În funcţie de cazul analizat, pentru stratul dublu în proximitatea suprafeţei bazale sau în proximitatea suprafeţei laterale pot fi estimate caracteristicile stratului compact – potenţialul Stern Yd, energia de adsorbţie specifică chimică Ø, densitatea de sarcini sc.EDL FOR MONTMORILLONITE. I. THE INFLUENCE OF Al-PILLARING It was developed the criterion for delimiting of characteristics for electric double layer (EDL close to the basal surface and edge surface of pillared Al-montmorillonite, and the EDL characteristics in the Stern model were determined. Depending on the case, for EDL close to the basal surface or edge surface, the main characteristics of Stern layer can be estimated, i.e. the Stern potential Yd, chemical specific adsorption energy Ø and charge density sc.
Holthuis, L.B.
1956-01-01
In June 1954, during an ecological study of the mangroves near the Research Station of the São Paulo University Oceanographic Institute at Cananeia, about 200 km south of Santos, southern Brazil, Dr. S. Gerlach of the Zoological Institute and Museum of the University of Kiel, Germany, collected some
The Impact of Climate Change on the Balanced-Growth-Equivalent: An Application of FUND
David Anthoff; Richard S. J. Tol
2008-01-01
The Stern Review added balanced growth equivalents (BGE) to the economic climate change research agenda. We first propose rigorous definitions of the BGE for multiple regions and under uncertainty. We show that the change in the BGE is independent of the assumed scenario of per capita income. For comparable welfare economic assumptions as the Stern Review, we calculate lower changes in BGE between a business as usual scenario and one without climate impacts with the model FUND than the Stern ...
Experience using individually supplied heater rods in critical power testing of advanced BWR fuel
Energy Technology Data Exchange (ETDEWEB)
Majed, M.; Morback, G.; Wiman, P. [ABB Atom AB, Vasteras (Sweden)] [and others
1995-09-01
The ABB Atom FRIGG loop located in Vasteras Sweden has during the last six years given a large experience of critical power measurements for BWR fuel designs using indirectly heated rods with individual power supply. The loop was built in the sixties and designed for maximum 100 bar pressure. Testing up to the mid eighties was performed with directly heated rods using a 9 MW, 80 kA power supply. Providing test data to develop critical power correlations for BWR fuel assemblies requires testing with many radial power distributions over the full range of hydraulic conditions. Indirectly heated rods give large advantages for the testing procedure, particularly convenient for variation of individual rod power. A test method being used at Stern Laboratories (formerly Westinghouse Canada) since the early sixties, allows one fuel assembly to simulate all required radial power distributions. This technique requires reliable indirectly heated rods with independently controlled power supplies and uses insulated electric fuel rod simulators with built-in instrumentation. The FRIGG loop was adapted to this system in 1987. A 4MW power supply with 10 individual units was then installed, and has since been used for testing 24 and 25 rod bundles simulating one subbundle of SVEA-96/100 type fuel assemblies. The experience with the system is very good, as being presented, and it is selected also for a planned upgrading of the facility to 15 MW.
DEFF Research Database (Denmark)
Schubart, Rikke
2013-01-01
Review of the movie Jobs (Joshua Michael Stern, 2013), a drama about Steve Jobs, the founder of Apple.......Review of the movie Jobs (Joshua Michael Stern, 2013), a drama about Steve Jobs, the founder of Apple....
Brown, Matthew A.; Abbas, Zareen; Kleibert, Armin; Green, Richard G.; Goel, Alok; May, Sylvio; Squires, Todd M.
2016-01-01
The structure of the electrical double layer has been debated for well over a century, since it mediates colloidal interactions, regulates surface structure, controls reactivity, sets capacitance, and represents the central element of electrochemical supercapacitors. The surface potential of such surfaces generally exceeds the electrokinetic potential, often substantially. Traditionally, a Stern layer of nonspecifically adsorbed ions has been invoked to rationalize the difference between these two potentials; however, the inability to directly measure the surface potential of dispersed systems has rendered quantitative measurements of the Stern layer potential, and other quantities associated with the outer Helmholtz plane, impossible. Here, we use x-ray photoelectron spectroscopy from a liquid microjet to measure the absolute surface potentials of silica nanoparticles dispersed in aqueous electrolytes. We quantitatively determine the impact of specific cations (Li+ , Na+ , K+ , and Cs+ ) in chloride electrolytes on the surface potential, the location of the shear plane, and the capacitance of the Stern layer. We find that the magnitude of the surface potential increases linearly with the hydrated-cation radius. Interpreting our data using the simplest assumptions and most straightforward understanding of Gouy-Chapman-Stern theory reveals a Stern layer whose thickness corresponds to a single layer of water molecules hydrating the silica surface, plus the radius of the hydrated cation. These results subject electrical double-layer theories to direct and falsifiable tests to reveal a physically intuitive and quantitatively verified picture of the Stern layer that is consistent across multiple electrolytes and solution conditions.
Mi, Ran; Hu, Yan-Jun; Fan, Xiao-Yang; Ouyang, Yu; Bai, Ai-Min
2014-01-03
This paper exploring the site-selective binding of jatrorrhizine to human serum albumin (HSA) under physiological conditions (pH=7.4). The investigation was carried out using fluorescence spectroscopy, UV-vis spectroscopy, and molecular modeling. The results of fluorescence quenching and UV-vis absorption spectra experiments indicated the formation of the complex of HSA-jatrorrhizine. Binding parameters calculating from Stern-Volmer method and Scatchard method were calculated at 298, 304 and 310 K, with the corresponding thermodynamic parameters ΔG, ΔH and ΔS as well. Binding parameters calculating from Stern-Volmer method and Scatchard method showed that jatrorrhizine bind to HSA with the binding affinities of the order 10(4) L mol(-1). The thermodynamic parameters studies revealed that the binding was characterized by negative enthalpy and positive entropy changes and the electrostatic interactions play a major role for jatrorrhizine-HSA association. Site marker competitive displacement experiments and molecular modeling calculation demonstrating that jatrorrhizine is mainly located within the hydrophobic pocket of the subdomain IIIA of HSA. Furthermore, the synchronous fluorescence spectra suggested that the association between jatrorrhizine and HSA changed molecular conformation of HSA. Copyright © 2013. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Gabriela Capurro
2011-07-01
Full Text Available This study aims to assess the impact of the Unique Minds Program (Stern, 1999 in schoolchildren diagnosed with learning disabilities (LD and their families, whom consulted the Santo Tomas University´s Psychological Service Center in Santiago - Chile, with regards to the following variables: self-esteem, depressive symptoms and family operation. The ages of the children – that are of the middle socio-economic level, fluctuated between eight and twelve years old. For the pre and post-tests, a pre-experimental design was used with one group. For data collection and analysis a mixed method was used, with the application of the following instruments: the Family Adaptability and Cohesion Scale (A-FACES III, the Child Depression Inventory (CDI, the Piers-Harris Children´s Self-Concept Scale, a Socio-demographic Survey and an assessment for each session. The results did not return any significant statistical differences regarding the variables. However, qualitative differences of the workshop’s central ideas are perceived. More specifically, there is a redefining of LD, developing new strategies for confrontation and internalizing the concept of shared responsibility for both the family and school.
Directory of Open Access Journals (Sweden)
Matthew A. Brown
2016-01-01
Full Text Available The structure of the electrical double layer has been debated for well over a century, since it mediates colloidal interactions, regulates surface structure, controls reactivity, sets capacitance, and represents the central element of electrochemical supercapacitors. The surface potential of such surfaces generally exceeds the electrokinetic potential, often substantially. Traditionally, a Stern layer of nonspecifically adsorbed ions has been invoked to rationalize the difference between these two potentials; however, the inability to directly measure the surface potential of dispersed systems has rendered quantitative measurements of the Stern layer potential, and other quantities associated with the outer Helmholtz plane, impossible. Here, we use x-ray photoelectron spectroscopy from a liquid microjet to measure the absolute surface potentials of silica nanoparticles dispersed in aqueous electrolytes. We quantitatively determine the impact of specific cations (Li^{+}, Na^{+}, K^{+}, and Cs^{+} in chloride electrolytes on the surface potential, the location of the shear plane, and the capacitance of the Stern layer. We find that the magnitude of the surface potential increases linearly with the hydrated-cation radius. Interpreting our data using the simplest assumptions and most straightforward understanding of Gouy-Chapman-Stern theory reveals a Stern layer whose thickness corresponds to a single layer of water molecules hydrating the silica surface, plus the radius of the hydrated cation. These results subject electrical double-layer theories to direct and falsifiable tests to reveal a physically intuitive and quantitatively verified picture of the Stern layer that is consistent across multiple electrolytes and solution conditions.
Induced polarization of clay-sand mixtures: experiments and modeling
International Nuclear Information System (INIS)
Okay, G.; Leroy, P.; Tournassat, C.; Ghorbani, A.; Jougnot, D.; Cosenza, P.; Camerlynck, C.; Cabrera, J.; Florsch, N.; Revil, A.
2012-01-01
Document available in extended abstract form only. Frequency-domain induced polarization (IP) measurements consist of imposing an alternative sinusoidal electrical current (AC) at a given frequency and measuring the resulting electrical potential difference between two other non-polarizing electrodes. The magnitude of the conductivity and the phase lag between the current and the difference of potential can be expressed into a complex conductivity with the in-phase representing electro-migration and a quadrature conductivity representing the reversible storage of electrical charges (capacitive effect) of the porous material. Induced polarization has become an increasingly popular geophysical method for hydrogeological and environmental applications. These applications include for instance the characterization of clay materials used as permeability barriers in landfills or to contain various types of contaminants including radioactive wastes. The goal of our study is to get a better understanding of the influence of the clay content, clay mineralogy, and pore water salinity upon complex conductivity measurements of saturated clay-sand mixtures in the frequency range ∼1 mHz-12 kHz. The complex conductivity of saturated unconsolidated sand-clay mixtures was experimentally investigated using two types of clay minerals, kaolinite and smectite in the frequency range 1.4 mHz - 12 kHz. Four different types of samples were used, two containing mainly kaolinite (80% of the mass, the remaining containing 15% of smectite and 5% of illite/muscovite; 95% of kaolinite and 5% of illite/muscovite), and the two others containing mainly Na-smectite or Na-Ca-smectite (95% of the mass; bentonite). The experiments were performed with various clay contents (1, 5, 20, and 100% in volume of the sand-clay mixture) and salinities (distilled water, 0.1 g/L, 1 g/L, and 10 g/L NaCl solution). In total, 44 saturated clay or clay-sand mixtures were prepared. Induced polarization measurements
Autonomous Refueling of Unmanned Vehicles at Sea
2008-03-28
As seen in Figure 3, a floating sponson, similar to the outside flotation collar on a RIB, is towed off the stern of the parent ship with a tow...V. Minnick, Thomas G. Beukema, Wojciech Kauczynski, Andrew L. Silver , and Christopher Cleary, “Stern Boat Deployment Systems and Operability
2011-06-07
...., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone 202- 685-5040. SUPPLEMENTARY INFORMATION... Forward Masthead Side lights Stern light, anchor Anchor lights lights arc Side lights Stern light distance distance light, relationship of Vessel Number of arc of arc of inboard of forward of height above aft light...
2011-04-21
... Navy, 1322 Patterson Ave., SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone number: 202... * * * * * Side lights Forward distance anchor Masthead inboard of Stern light light, Anchor lights lights arc Side lights Stern light ship's distance height relationship of aft Vessel Number of arc of arc of sides...
2012-04-25
... Ave. SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone 202- 685-5040. SUPPLEMENTARY... lights Stern light, Forward anchor relation-ship of Masthead lights arc Side lights arc of Stern light arc of distance inboard distance forward light, height aft light to Vessel Number of visibility; rule...
Structural incorporation of Neptunyl(V) into Calcite: Interfacial Reactions and Kinetics
Heberling, Frank
2010-01-01
In this experimental work the calcite-water interface is characterized by means of zetapotential and surface diffraction measurements. Based on the experimental results a new Basic Stern Surface Complexation model for calcite is developed. Neptunyl(V) adsorption at the calcite surface and incorporation into the calcite structure is studied by batch type adsorption- and mixed flow reactor experiments. Adsorption and incorporation species of Neptunyl are investigated by EXAFS spectroscopy.
Collateral Damage to Satellites from an EMP Attack
2010-08-01
field into regions of weak magnetic field [Stern. 1989, and references therein]. Birkeland’s work captured the interest of auroral researcher Stormer ...dipole magnetic field [ Stormer , 1907]. Although mathematically elegant, Stormer theory did not prove the existence of radiation belts; it set the stage...Based on work by Stormer , Alfven, and others, and on his experience with the Astron thermonuclear device, N. Christofolis in October 1957 suggested
2012-10-16
... Patterson Ave. SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone 202-685-5040. SUPPLEMENTARY... Stern light, Forward anchor relationship Masthead Side light arc Stern light distance in distance light height of aft light Vessel Number Lights arc of of visibility; arc of board of forward of above hull in...
Physics of Magnetic Resonance. Chapter 14
Energy Technology Data Exchange (ETDEWEB)
Song, Hee Kwon [Hospital of the University of Pennsylvania, Philadelphia (United States)
2014-09-15
The discovery of nuclear magnetic resonance (NMR), a property of nuclei in a magnetic field where they are able to absorb applied radiofrequency (RF) energy and subsequently release it at a specific frequency, goes back many decades to the early 1900s. Physicist Isidor I. Rabi, fascinated by the work of Otto Stern and Walther Gerlach which demonstrated that particles have intrinsic quantum properties, delved into the magnetic properties of nuclei, and in 1938 Rabi discovered the phenomenon of NMR. Several years later, in 1946, Felix Bloch and Edward Purcell refined the methods and successfully measured the NMR signal from liquids and solids. For their discoveries, Rabi received the Nobel Prize for physics in 1944 and Bloch and Purcell in 1952. While Rabi, Bloch, Purcell and other physicists working in this field had laid the foundations, a major discovery that transformed the NMR phenomenon for imaging was not made until 1973, when Paul Lauterbur developed a method for spatially encoding the NMR signal by utilizing linear magnetic field gradients. About the same time, Peter Mansfield had also discovered a means of determining the spatial structure of solids by introducing a linear gradient across the object. The idea of applying magnetic field gradients to induce spatially varying resonance frequencies to resolve the spatial distribution of magnetization was a major milestone and the beginning of magnetic resonance imaging (MRI). For their work, Lauterbur and Mansfield were awarded the Nobel Prize for medicine in 2003. Since its discovery, MRI has quickly become one of the most important medical imaging devices available to physicians today. Unlike other imaging modalities, such as X ray and computed tomography, MRI does not involve ionizing radiation. MRI also offers superior soft tissue contrast that is not possible with other imaging modalities. Furthermore, in MRI, the desired level of image contrast among different tissues can often be precisely controlled
Yan, Lujie; Masliyah, Jacob H; Xu, Zhenghe
2013-08-15
Smooth basal plane and edge surfaces of two platy phyllosilicate minerals (muscovite and talc) were prepared successfully to allow accurate colloidal force measurement using an atomic force microscope (AFM), which allowed us to probe independently interactions of divalent cations with phyllosilicate basal planes and edge surfaces. The Stern potential of basal planes and edge surfaces was obtained by fitting the measured force profiles with the classical DLVO theory. The fitted Stern potential of the muscovite basal plane became less negative with increasing Ca(2+) or Mg(2+) concentration but did not reverse its sign even at Ca(2+) or Mg(2+) concentrations up to 5 mM. In contrast, the Stern potential of the muscovite edge surface reversed at Ca(2+) or Mg(2+) concentrations as low as 0.1 mM. The Stern potential of the talc basal plane became less negative with 0.1 mM Ca(2+) addition and nearly zero with 1 mM Ca(2+) addition. The Stern potential of talc edge surface became reversed with 0.1 mM Ca(2+) or 1 mM Mg(2+) addition, showing not only a different binding mechanism of talc basal planes and edge surfaces with Ca(2+) and Mg(2+), but also different binding mechanism between Ca(2+) and Mg(2+) ions with basal planes and edge surfaces. Copyright © 2013 Elsevier Inc. All rights reserved.
Influence of surface conductivity on the apparent zeta potential of calcite.
Li, Shuai; Leroy, Philippe; Heberling, Frank; Devau, Nicolas; Jougnot, Damien; Chiaberge, Christophe
2016-04-15
Zeta potential is a physicochemical parameter of particular importance in describing the surface electrical properties of charged porous media. However, the zeta potential of calcite is still poorly known because of the difficulty to interpret streaming potential experiments. The Helmholtz-Smoluchowski (HS) equation is widely used to estimate the apparent zeta potential from these experiments. However, this equation neglects the influence of surface conductivity on streaming potential. We present streaming potential and electrical conductivity measurements on a calcite powder in contact with an aqueous NaCl electrolyte. Our streaming potential model corrects the apparent zeta potential of calcite by accounting for the influence of surface conductivity and flow regime. We show that the HS equation seriously underestimates the zeta potential of calcite, particularly when the electrolyte is diluted (ionic strength ⩽ 0.01 M) because of calcite surface conductivity. The basic Stern model successfully predicted the corrected zeta potential by assuming that the zeta potential is located at the outer Helmholtz plane, i.e. without considering a stagnant diffuse layer at the calcite-water interface. The surface conductivity of calcite crystals was inferred from electrical conductivity measurements and computed using our basic Stern model. Surface conductivity was also successfully predicted by our surface complexation model. Copyright © 2016 Elsevier Inc. All rights reserved.
Validation of the COBRA code for dry out power calculation in CANDU type advanced fuels
International Nuclear Information System (INIS)
Daverio, Hernando J.
2003-01-01
Stern Laboratories perform a full scale CHF testing of the CANFLEX bundle under AECL request. This experiment is modeled with the COBRA IV HW code to verify it's capacity for the dry out power calculation . Good results were obtained: errors below 10 % with respect to all data measured and 1 % for standard operating conditions in CANDU reactors range . This calculations were repeated for the CNEA advanced fuel CARA obtaining the same performance as the CANFLEX fuel. (author)
A geophysical survey of the De Gerlache Seamounts: Preliminary results
Digital Repository Service at National Institute of Oceanography (India)
Hagen, R.A.; Gohl, K.; Gersonde, R.; Kuhn, G.; Volker, D.; Kodagali, V.N.
/Ar ages between 20.1 ~c 1.0 and 23.2 ~c 1.2 Ma. Basement ridges and sediment-filled troughs between the guyots are associated with the prominent gravity anomaly extending north from the Antarctic margin. This structure possibly played a role in the guyot...
Expanding policy options for educating teenagers.
Stern, David
2009-01-01
David Stern argues that some basic features of the American high school must be modified if it is to serve all students successfully. He notes, for example, that only three-quarters of U.S. high school students graduate four years after beginning ninth grade and that the National Assessment of Educational Progress found no improvement in reading or mathematics for seventeen-year-olds between 1971 and 2004. The nation's system for educating teenagers, says Stern, seems to be stuck, despite the constant efforts of teachers and repeated waves of reform. Citing two widely accepted public purposes of educating teenagers-preparation for civic participation and for economic self-sufficiency-Stern proposes four new strategies to achieve those goals. He draws on empirical evidence suggesting that these are promising directions for research and policy, but acknowledges that existing studies provide only limited guidance. First, he says, schools should continue the current trend toward integrating educational options to provide young people with skills and experiences that pave the way to both college and careers. Second, states and districts should tie education funding not simply to the number of students attending school, but also to what young people learn, whether they graduate, and whether they find jobs or enroll in postsecondary education. Such a move, he argues, would encourage teaching and learning formats that use students' time more effectively. Third, more adults in addition to classroom teachers should be involved in educating teenagers. Other adults acting as academic advisers, learning coaches, student advocates, internship supervisors, mentors, and college counselors could help guide the education of teenagers inside and outside of school and provide some relief for the chronic shortage of teachers. Fourth, schools should expand the options for educating teenagers outside of geographically fixed schools. Combining improved Internet-based curriculum with
Energy Technology Data Exchange (ETDEWEB)
Borissevitch, I.E., E-mail: iourib@ffclrp.usp.br [Departamento de Fisica, Faculdade de Filosofia Ciencia e Letras de Ribeirao Preto, Universidade de Sao Paulo, Av. Bandeirantes 3900, Ribeirao Preto, SP (Brazil); Parra, G.G. [Departamento de Fisica, Faculdade de Filosofia Ciencia e Letras de Ribeirao Preto, Universidade de Sao Paulo, Av. Bandeirantes 3900, Ribeirao Preto, SP (Brazil); Zagidullin, V.E.; Lukashev, E.P.; Knox, P.P.; Paschenko, V.Z.; Rubin, A.B. [Department of Biophysics, Faculty of Biology, M.V. Lomonosov Moscow State University, Vorobyovy Gory, 119991 Moscow (Russian Federation)
2013-02-15
In this work we report on the study of the interaction of CdSe/ZnS-PEGOH 570 Quantum Dot (QD) with negatively charged meso-tetrakis(p-sulfonato-phenyl)porphyrin (TPPS{sub 4}) using optical absorption and fluorescence spectroscopies accompanied with time resolved 'single photon counting' and dynamic and resonance light scattering techniques. In the steady-state experiments the QD luminescence quenching by TPPS{sub 4} was well approximated by a square law. In the time-resolved experiments we observed a typical multi-exponential luminescence decay curve, successfully fitted by a bi-exponential approximation. At QD interaction with porphyrin the time quenching of both components was described by a linear Stern-Volmer dependence. The discrepancy between Stern-Volmer dependences in the steady-state and time resolved experiments may be due to formation of mixed m(TPPS{sub 4})+n(QD) complexes, in which one TPPS{sub 4} molecule can quench several excited QDs. This idea is in accordance with the dynamic and resonance light scattering data, which demonstrate an increase of the scattering particle size at the TPPS{sub 4} addition to QD solutions. - Highlights: Black-Right-Pointing-Pointer Quantum Dot luminescence quenching by TPPS porphyrin was studied in water solutions. Black-Right-Pointing-Pointer The size of particles in QD solutions possessed increase at the TPPS4 addition. Black-Right-Pointing-Pointer Quenching of the QD luminescence by TPPS4 is realized in contact QD-porphyrin complexes. Black-Right-Pointing-Pointer The formation of mixed quantum dot-porphyrin aggregates takes place.
Molecular beams entwined with quantum theory: a bouquet for Max Planck
International Nuclear Information System (INIS)
Herschbach, D.
2001-01-01
In an era when the fledgling quantum theory was ''uncertain and even gave contradictory answers,'' Otto Stern undertook to employ molecular beams to test directly fundamental aspects of the theory. During 1921-1935, this led to five decisive experiments reviewed here, resulting in the discovery or demonstration of space quantization, de Broglie matter waves, anomalous magnetic moments of the proton and neutron, recoil of an atom on emission of a photon, and the limitation of scattering cross-sections for molecular collisions imposed by the uncertainty principle. (orig.)
Bader, Oren
2016-05-01
Attending to bodily expression of emotions plays an important role in the human social world. It provides subjects with valuable information, constructs opportunities to act, and importantly, as Daniel Stern pointed out, it is involved in the constitution of the direct experience of others. Whether mutual or one-sided, these direct experiences, in which the subject can share the perspectives and attitudes of other subjects, always comprise one person's bodily expression of emotions that is available to another person. In this article I suggest that attending to other subjects' expressed emotions involves a special (social) mode of attention and emotional sharing. This suggestion challenges Dan Zahavi's view that confines the sharing of emotions solely to reciprocal experiences. Copyright © 2016 Elsevier Inc. All rights reserved.
Repository Evaluation of Software Reuse
Banker, Rajiv D.; Kauffman, Robert J.; Zweig, Dani
1993-01-01
The article of record as published may be found at: 10.1109/32.223805 Center for Digital Economy Research Stem School of Business Working Paper IS-93-28, Replaces: Working Paper IS-93-1 Working Paper Series STERN IS-93-28 Working Paper series: STERN IS-93-28 The traditional unit of analysis and control for software managers is the software project, and subsequently the resulting application system. Today, with the emerging ca- pabilities of computer-aided software engineering ...
Ghosts in the nursery: a case study of the maternal representations of a woman who killed her baby
Directory of Open Access Journals (Sweden)
A Gous
2005-11-01
Full Text Available The maternal representations as described by Stern (1995:171-190 are used in an extreme case to illustrate the link between depression and pathogenic maternal representations. Opsomming Die moedervoorstellings soos dit deur Stern (1995:171-190 beskryf word, word in ‘n ekstreme geval gebruik om die verband tussen depressie en patogene moedervoorstellings aan te toon. *Please note: This is a reduced version of the abstract. Please refer to PDF for full text.
Global Sulfur Emissions in the 1990s
David I. Stern
2003-01-01
This paper provides global and individual country estimates of sulfur emissions from 1991-2000. Raw estimates are obtained in two ways. For countries and years with published data I compile that data from the available sources. For the remaining countries and for missing years for countries with some published data, I use either the decomposition model estimated by Stern (2002), the first differences environmental Kuznets curve model estimated by Stern and Common (2001), or a simple extrapola...
DEFF Research Database (Denmark)
Bentzen, Martin Mose
2015-01-01
Nyt hotel i Nagasaki tilbyder robotbetjening. Robotter kan lære at tale med gæsterne om præcis det, de finder interessant. Men er vi lykkeligere lukket inde i bløde bure af selvvalgt information?......Nyt hotel i Nagasaki tilbyder robotbetjening. Robotter kan lære at tale med gæsterne om præcis det, de finder interessant. Men er vi lykkeligere lukket inde i bløde bure af selvvalgt information?...
Layering and Ordering in Electrochemical Double Layers
Energy Technology Data Exchange (ETDEWEB)
Liu, Yihua [Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States; Kawaguchi, Tomoya [Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States; Pierce, Michael S. [Rochester Institute of Technology, School of Physics and Astronomy, Rochester, New York 14623, United States; Komanicky, Vladimir [Faculty of Science, Safarik University, 041 54 Kosice, Slovakia; You, Hoydoo [Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States
2018-02-26
Electrochemical double layers (EDL) form at electrified interfaces. While Gouy-Chapman model describes moderately charged EDL, formation of Stern layers was predicted for highly charged EDL. Our results provide structural evidence for a Stern layer of cations, at potentials close to hydrogen evolution in alkali fluoride and chloride electrolytes. Layering was observed by x-ray crystal truncation rods and atomic-scale recoil responses of Pt(111) surface layers. Ordering in the layer is confirmed by glancing-incidence in-plane diffraction measurements.
Intertemporal evaluation criteria for climate change policy: the basic ethical issues
Buchholz, Wolfgang; Schymura, Michael
2011-01-01
The evaluation of long-term effects of climate change in cost-benefit analysis has a long tradition in environmental economics. Since the publication of the Stern Review in 2006 the debate about the "appropriate" discounting of future welfare and utility levels was revived and the most renowned scholars of the profession participated in this debate. But it seems that some contributions dealing with the Stern Review and the Review itself mixed up normative and positive issues to defend the own...
International Nuclear Information System (INIS)
Shoukri, M.; Abdul-Razzak, A.
1990-04-01
Analysis of existing data on fuel channel refilling is presented. The analysis focuses on the data obtained using the Stern Laboratories Cold Water Injection Test (CWIT) Facility. The two-fluid model thermal-hydraulics computer code CATHENA is also used to simulate experimental results on fuel channel refilling from both the CWIT and RD-14 facilities. Conclusions related to single and double break tests, including the effect of non-condensible gases, are presented. A set of recommendations is given for further analysis and separate effect experiments. (67 figs., 5 tabs., 24 refs.)
Fadda, Roberta; Lucarelli, Loredana
2017-01-01
Mother-infant interactions during feeding and play are pivotal experiences in the development of infants' early social abilities (Stern, 1985, 1995; Biringen, 2000). Stern indicated distinctive characteristics of mother-infant interactions, respectively, during feeding and play, suggesting to evaluate both to better describe the complexity of such early affective and social experiences (Stern, 1996). Moreover, during the first years of life, infants acquire cognitive and social skills that allow them to interact with new social partners in extra-dyadic interactions. However, the relations between mother-child interactions and infants' social skills in extra-dyadic interactions are still unknown. We investigated longitudinally the relations between mother-child interactions during feeding and play and child's pre-verbal communicative abilities in extra-dyadic interactions during play. 20 dyads were evaluated at T 1 (infants aged between 9-22 months) and 6 months later, at T 2 . The interdyadic differences in mother-infant interactions during feeding and play were evaluated, respectively, with the "Feeding Scale" (Chatoor et al., 1997) and with the "Play Scale" (Chatoor, 2006) and the socio-communicative abilities of children with a new social partner during play were evaluated with the "Early Social Communication Scales" (Mundy et al., 2003). We distinguished the dyads into two categories: dyads with functional interactions (high dyadic reciprocity, low dyadic conflict) and dyads with dysfunctional interactions (lower dyadic reciprocity, higher dyadic conflict). At T 1 , infants belonging to dyads with dysfunctional interactions were significantly lower in "Initiating Joint Attention" and in "Responding to Joint Attention" in interaction with a new social partner compared to the infants belonging to dyads with functional interactions. At T 2 , infants belonging to dyads with dysfunctional interactions were significantly lower in "Initiating Social Interactions" with
ORF Sequence: NC_005945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Bacillus anthracis str. Sterne] MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGP...TGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGP...TGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGPTGPTGPS
Baby M: babies (and justice) for sale.
Annas, G J
1987-06-01
A professor of health law criticizes the decisions of New Jersey Superior Court Judge Harvey R. Sorkow which culminated in his awarding permanent custody of Baby M to her biological father, William Stern. Annas quotes from the In re Baby M decision and from the contract between Stern and his wife and surrogate mother Mary Beth Whitehead to support his contention that Sorkow "rendered a sermon filled with contradictions, double-standards, inapt analogies, and unsupported conclusions." He argues that legally Mrs. Whitehead could not have prospectively waived her right to rear a child she bore, that Sorkow was biased in favor of the "upper-middle-class Sterns," and that consideration should be given to returning Baby M to Mrs. Whitehead. He urges state legislatures to outlaw the sale of children, to affirm the legal status of the gestational mother, and to forbid a surrogate's relinquishment of parental rights until after her child's birth.
Improvements in and relating to a device for removing oil slicks
Energy Technology Data Exchange (ETDEWEB)
Ivanoff, A
1975-09-10
The invention relates to a means for removing oil floating as an oil slick on a body of water. The device is a water craft consisting of a hull including side walls and a stern wall joining the side walls. The bow end of the hull is open, the side walls channelling oil entering between them toward the stern wall as the craft moves. A means for removing oil accumulating between the side walls is provided. An antisurging means is mounted between the side walls. The antisurging means is disposed to reduce the amplitude of waves prior to reaching the stern wall so as to calm oil covered water between the side walls of the hull. The antisurging means consists of a plate mounted between the side walls, the plate extends horizontally and sternwardly from adjacent to the bow end of the hull and below the surface of calm water relative to the side walls of the hull, at least when the craft moves. (16 claims)
Energy Technology Data Exchange (ETDEWEB)
Novara, Agata, E-mail: agata.novara@unipa.it [Department of Scienze Agrarie e Forestali, University of Palermo, viale delle Scienze, ed.4, 90128 Palermo (Italy); Keesstra, Saskia, E-mail: saskia.keesstra@wur.nl [Soil Physics and Land Management Group, Wageningen University, Droevendaalsesteeg 4, 6708PB Wageningen (Netherlands); Cerdà, Artemio, E-mail: artemio.cerda@uv.es [Soil Erosion and Degradation Research Group, Department of Geography, University of Valencia, Valencia (Spain); Pereira, Paulo, E-mail: paulo@mruni.eu [Environmental Management Centre, Mykolas Romeris University, Vilnius (Lithuania); Gristina, Luciano [Department of Scienze Agrarie e Forestali, University of Palermo, viale delle Scienze, ed.4, 90128 Palermo (Italy)
2016-04-15
Understanding soil water erosion processes is essential to evaluate the redistribution of soil organic carbon (SOC) within a landscape and is fundamental to assess the role of soil erosion in the global carbon (C) budget. The main aim of this study was to estimate the C redistribution and losses using {sup 13}C natural abundance. Carbon losses in soil sediment, dissolved organic carbon (DOC) and CO{sub 2} emission were determined. Four bounded parallel plots were installed on a 10% slope. In the upper part of the plots, C{sub 3}soil was replaced with C{sub 4}soil. The SOC and δ{sup 13}C were measured after 145.2 mm rainfall in the upper (2 m far from C{sub 4}strip), middle (4 m far from C{sub 4}strip) lower (6 m far from C{sub 4}strip) trams of the plot and in the sediments collected in the Gerlach collector at the lower part of the plot. A laboratory incubation experiment was performed to evaluate the CO{sub 2} emission rate of soils in each area. OC was mainly lost in the sediments as 2.08 g{sup −2} of C was lost after 145.2 mm rainfall. DOC losses were only 5.61% of off-site OC loss. Three months after the beginning of the experiment, 15.90% of SOC in the upper tram of the plot had a C{sub 4} origin. The C{sub 4}-SOC content decreased along the 6 m length of the plot, and in the sediments collected by the Gerlach collector. CO{sub 2} emission rate was high in the upper plot tram due to the high SOC content. The discrimination of CO{sub 2} in C{sub 3} and C{sub 4} portion permitted to increase our level of understanding on the stability of SOC and its resilience to decomposition. The transport of sediments along the plot increased SOC mineralization by 43%. Our study underlined the impact of rainfall in C losses in soil and water in abandoned Mediterranean agriculture fields and the consequent implications on the C balance. - Highlights: • The soil C isotopic difference is a useful tracer for erosion processes studies. • The main loss of Carbon was
Sådan bygger man en kvantecomputer
DEFF Research Database (Denmark)
Mølmer, Klaus
2009-01-01
KRONIK: Professor Klaus Mølmer forklarer, hvordan man kan konstruere en kvantecomputer. Det kræver en brudebuket, der både er der og ikke er der, og som kan kastes til alle gæsterne ved et bryllup på samme tid.......KRONIK: Professor Klaus Mølmer forklarer, hvordan man kan konstruere en kvantecomputer. Det kræver en brudebuket, der både er der og ikke er der, og som kan kastes til alle gæsterne ved et bryllup på samme tid....
Fantastiske forbindelser relationer i undervisning og læringssamvær
DEFF Research Database (Denmark)
Antologiens artikler er lavet af en række anerkendte forskere og ide-folk fra Danmark, Norge, Holland, England og USA. Herunder Peter Lang, Daniel Stern, Maria Aarts, Thomas Armstrong, Maria Aarts, Jan Tønnesvang, Stein Bråten, Jesper Juul og Susan Hart......Antologiens artikler er lavet af en række anerkendte forskere og ide-folk fra Danmark, Norge, Holland, England og USA. Herunder Peter Lang, Daniel Stern, Maria Aarts, Thomas Armstrong, Maria Aarts, Jan Tønnesvang, Stein Bråten, Jesper Juul og Susan Hart...
Loomaskulptuuride näitus Kadriorus / Aleksander Stern
Stern, Aleksander, 1948-
2009-01-01
2009. a suvel toimus Kadriorus Kastellaanimaja Galeriis Tallinna Loomaaia juubeliürituste raames näitus. Eksponeeriti Tallinna Loomaaias viiel korral aset leidnud Läänemeremaade animalistliku skulptuuri festivalide raames teostatud töid
Fluorescence quenching of uric acid solubilized in bicontinuous microemulsion by nitrobenzene
Directory of Open Access Journals (Sweden)
Maurice O. Iwunze
2013-02-01
Full Text Available Abstract: Uric Acid is known to be practically insoluble in aqueous and alcoholic media. However, it exhibits a reasonable solubility in a Bicontinuous Microemulsion system – a 15-fold or more increase in solubility in this system compared to its solubility in water. The bicontinuous microemulsion is made up of three components –Dodecane-Surfactant-water. Uric acid solubilized in this system is quenched by nitrobenzene. The obtained fluorescence data do not obey the Stern-Volmer equation when plotted accordingly. Therefore, the modified Stern-Volmer equation was used to analyze the data. It was observed that only one third (1/3 of uric acid is accessible to quenching in this medium and the reaction is diffusion-limited. The Stern-Volmer quenching constant, KSV, was calculated to be 130 M-1 and the fluorescence lifetime, 0, the quantum yield,, and the bimolecular quenching rate constant, kq, were calculated as 10.6 nanoseconds, 0.06 and 1.231010 M-1s-1, respectively.
DEFF Research Database (Denmark)
Andersen, Mathias Bækbo; Frey, Jared; Pennathur, Sumita
2011-01-01
, and pK+ are constant and independent of surface composition. Our theoretical model consists of three parts: (i) a chemical equilibrium model of the bare or coated wall, (ii) a chemical equilibrium model of the buffered bulk electrolyte, and (iii) a self-consistent Gouy–Chapman–Stern triple-layer model...... of the electrochemical double layer coupling these two equilibrium models. To validate our model, we used both pH-sensitive dye-based capillary filling experiments as well as electro-osmotic current-monitoring measurements. Using our model we predict the dependence of ζ potential, surface charge density, and capillary...
Sport et société aux États-Unis : bibliographie sélective, 1981-2008
Peter Marquis
2012-01-01
Bilans historiographiques et critiques DEARDOFF II, Donald L., Sports, A Reference Guide and Critical Commentary, 1980-1999, Westport, Greenwood Press, 2000.GERLACH, Larry R., « Not Quite Ready for Prime Time: Baseball History, 1983-1993 », Journal of Sport History, vol. 21, n°2, été 1994, 103-37.HARDY, Stephen et Alan INGHAM, « Games, Structures, and Agency: Historians of the American Play Movement », Journal of Social History, vol. 17, hiver 1983, 285-301.POPE, Steven W., « Sport History: I...
Sport et société aux États-Unis : bibliographie sélective, 1981-2008
Directory of Open Access Journals (Sweden)
Peter Marquis
2012-03-01
Full Text Available Bilans historiographiques et critiquesDEARDOFF II, Donald L., Sports, A Reference Guide and Critical Commentary, 1980-1999, Westport, Greenwood Press, 2000.GERLACH, Larry R., « Not Quite Ready for Prime Time: Baseball History, 1983-1993 », Journal of Sport History, vol. 21, n°2, été 1994, 103-37.HARDY, Stephen et Alan INGHAM, « Games, Structures, and Agency: Historians of the American Play Movement », Journal of Social History, vol. 17, hiver 1983, 285-301.POPE, Steven W., « Sport History: In...
DEFF Research Database (Denmark)
Dupont, Søren
Dette paper forsøger at trække nogle linjer til relationerne mellem fænomenologi og bevægelse, men også tid, rum og sted. Teoretikerne er Maurice Merleau-Ponty, Hannah Arendt og Daniel Stern. Til sidst diskuteres forholdet mellem fænomenologi og metode.......Dette paper forsøger at trække nogle linjer til relationerne mellem fænomenologi og bevægelse, men også tid, rum og sted. Teoretikerne er Maurice Merleau-Ponty, Hannah Arendt og Daniel Stern. Til sidst diskuteres forholdet mellem fænomenologi og metode....
International Nuclear Information System (INIS)
Skewes, M.A; Arevalo, A; Holmgren, C.; Stern, C.R
2001-01-01
The giant Miocene and Pliocene Rio Blanco-Los Bronces (Warnaars et al., 1985; Serrano et al., 1996; Vargas et al., 1999) and El Teniente (Camus, 1975; Cuadra, 1986; Skewes and Arevalo, 2000) copper deposits of central Chile are among the largest copper deposits in the world. Hypogene copper ore is more significant than supergene ore in these deposits, and most of the hypogene copper occurs in the matrix of multiple clusters of breccias (Skewes and Stern, 1994; 1995). The origin of the large mineralized breccia pipes in these and other Andean copper deposits has been attributed to the explosive expansion of magmatic aqueous fluids derived from cooling plutons (Emmons, 1938; Kents, 1964; Warnaars et al., 1985; Sillitoe, 1985; Skewes and Stern, 1994, 1995). Warnaars et al. (1985) and Skewes and Stern (1996) suggested that mineral deposition in the matrix of these breccias took place by the rapid cooling of the same magmatic fluids that generated the brecciation. Highly saline, high-temperature magmatic fluid inclusions occur in quartz and tourmaline in the matrix of these breccias (Holmgren et al., 1988; Vargas et al., 1999; Skewes et al., 2001) (au)
Current Status and Future Prospects for Nuclear Power
International Nuclear Information System (INIS)
Juhn, P.E.
1999-01-01
In the past 50 years, nuclear power has grown from a new scientific development to become a major part of the energy mix in over 30 countries. In 1998, 434 power reactors worldwide produced 2294 billion kWh of electricity, slightly up on 1997 output. Sixteen countries relied on nuclear power for 25 percent or more of their electricity. Accumulated operating experience for nuclear power plants reached over 9,000 reactor-years. In 1998, 36 nuclear power plants were under construction: 14 in Eastern Europe, 12 in the Fat East; 7 in the Middle East and South Asia, 2 in Latin America, 1 in stern Europe (France)
Bell's Spaceships: The Views from Bow and Stern
Lewis, Geraint F.; Barnes, Luke A.; Sticka, Martin J.
2018-01-01
Unravelling apparent paradoxes has proven to be a powerful tool for understanding the complexities of special relativity. In this paper, we focus upon one such paradox, namely Bell's spaceship paradox, examining the relative motion of two uniformly accelerating spaceships. We consider the view from either spaceship, with the exchange of photons between the two. This recovers the well-known result that the leading spaceship loses sight of the trailing spaceship as it is redshifted and disappears behind what is known as the `Rindler horizon'. An immediate impact of this is that if either spaceship tries to measure the separation through `radar ranging', bouncing photons off one another, they would both eventually fail to receive any of the photon `pings' that they emit. We find that the view from this trailing spaceship is, however, starkly different, initially, seeing the leading spaceship with an increasing blueshift, followed by a decreasing blueshift. We conclude that, while the leading spaceship loses sight of the trailing spaceship, for the trailing spaceship the view of the separation between the two spaceships, and the apparent angular size of the leading spaceship, approach asymptotic values. Intriguingly, for particular parameterisation of the journey of the two spaceships, these asymptotic values are identical to those properties seen before the spaceships began accelerating, and the view from the trailing spaceship becomes identical to when the two spaceships were initially at rest.
Pushpam, S.; Yamini, D.; Ramakrishnan, V.
2014-07-01
The photophysical properties of 1,4-dihydroxy-2,3-dimethyl-9,10-anthroquinone (DHDMAQ) in the absence and presence of titanium dioxide (TiO2) nanoparticles have been studied using UV-visible absorption spectroscopy and steady-state fluorescence spectroscopy. The fluorescence intensity of the DHDMAQ decreases as the concentration of TiO2 nanoparticles increases. The quenching is characterized by a Stern-Volmer plot, which displays a positive deviation from linearity. This could be explained by static quenching models. The Stern-Volmer quenching constant, association constant, and binding constant have been calculated. The distance between DHDMAQ and TiO2 nanoparticles has also been evaluated using Forster's theory of non-radiative energy transfer.
Heilmann, Conrad
2017-10-01
Controversies about time discounting loom large in decisions about climate change. Prominently, a particularly controversial debate about time discounting in climate change decision-making has been conducted within climate economics, between the authors of Stern et al. (Stern review on the economics of climate change, 2006) and their critics (most prominently Dasgupta in Comments on the Stern review's economics of climate change, 2006; Tol in Energy Environ 17(6):977-981, 2006; Weitzman in J Econ Lit XLV:703-724, 2007; Nordhaus in J Econ Lit XLV:686-702, 2007). The article examines the role of values in this debate. Firstly, it is shown that time discounting is a case in which values are key because it is at heart an ethical problem. Secondly, it is argued that time discounting in climate economics is a case of economists making frequent and routine references to ethical values and indeed conduct ethical debates with each other. Thirdly, it is argued that there is evidence for deep and pervasive entanglement between facts and values in the prevalent methodologies for time discounting. Finally, it is argued that this means that economists have given up the 'value-free ideal' concerning time discounting, and discussed how the current methodology of time discounting in economics can be improved.
International Nuclear Information System (INIS)
Evale, Basavaraj G.; Hanagodimath, S.M.
2009-01-01
The fluorescence quenching of newly synthesized coumarin (chromen-2-one) derivative, 4-(5-methyl-3-furan-2-yl-benzofuran-2-yl)-7-methyl-chromen-2-one (MFBMC) by aniline in different solvent mixtures of benzene and acetonitrile was determined at room temperature (296 K) by steady-state fluorescence measurements. The quenching is found to be appreciable and positive deviation from linearity was observed in the Stern-Volmer (S-V) plots in all the solvent mixtures. This could be explained by static and dynamic quenching models. The positive deviation in the S-V plot is interpreted in terms of ground-state complex formation model and sphere of action static quenching model. Various rate parameters for the fluorescence quenching process have been determined by using the modified Stern-Volmer equation. The sphere of action static quenching model agrees very well with experimental results. The dependence of Stern-Volmer constant K SV , on dielectric constant ε of the solvent mixture suggests that the fluorescence quenching is diffusion-limited. Further with the use of finite sink approximation model, it is concluded that these bimolecular quenching reactions are diffusion-limited. Using lifetime (τ o ) data, the distance parameter R' and mutual diffusion coefficient D are estimated independently.
Monolithic Approach to Oxide Dispersion Strengthened Aluminum, Phase I
National Aeronautics and Space Administration — Nassau Stern Company is investigating an approach for manufacturing oxide dispersion strengthened (ODS) aluminum in bulk rather than powder form. The approach...
Biophysical influence of coumarin 35 on bovine serum albumin: Spectroscopic study
Bayraktutan, Tuğba; Onganer, Yavuz
2017-01-01
The binding mechanism and protein-fluorescence probe interactions between bovine serum albumin (BSA) and coumarin 35 (C35) was investigated by using UV-Vis absorption and fluorescence spectroscopies since they remain major research topics in biophysics. The spectroscopic data indicated that a fluorescence quenching process for BSA-C35 system was occurred. The fluorescence quenching processes were analyzed using Stern-Volmer method. In this regard, Stern-Volmer quenching constants (KSV) and binding constants were calculated at different temperatures. The distance r between BSA (donor) and C35 (acceptor) was determined by exploiting fluorescence resonance energy transfer (FRET) method. Synchronous fluorescence spectra were also studied to observe information about conformational changes. Moreover, thermodynamics parameters were calculated for better understanding of interactions and conformational changes of the system.
A report from America: Baby M.
Rachels, James
1987-10-01
Rachels reviews the social and legal facts of the celebrated "Baby M" case, in which surrogate Mary Beth Whitehead attempted to keep the daughter she had borne under contract to William Stern. The first phase of the legal battle between the parents ended in March 1988, when New Jersey Superior Court Judge Harvey R. Sorkow upheld the validity of the surrogacy contract, terminated Whitehead's parental rights, and awarded custody of the child to Stern. Rachels comments on public reaction to "Baby M," on Sorkow's decision, and on the impact the case may have on legislative attempts to regulate surrogacy. He also uses the example of "Baby M," as well as that of California heart transplant patient "Baby Jesse," to discuss how the media sensationalize controversial issues.
Advances in bioartificial liver assist devices.
Patzer, J F
2001-11-01
Rapid advances in development of bioartificial liver assist devices (BLADs) are exciting clinical interest in the application of BLAD technology for support of patients with acute liver failure. Four devices (Circe Biomedical HepatAssist, Vitagen ELAD, Gerlach BELS, and Excorp Medical BLSS) that rely on hepatocytes cultured in hollow-fiber membrane technology are currently in various stages of clinical evaluation. Several alternative approaches for culture and perfusion of hepatocytes have been evaluated in preclinical, large animal models of liver failure, or at a laboratory scale. Engineering design issues with respect to xenotransplantation, BLAD perfusion, hepatocyte functionality and culture maintenance, and ultimate distribution of a BLAD to a clinical site are delineated.
Technical training: places available
2014-01-01
If you would like more information on a course, or have any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Elise Romero, Technical Training Administration (Tel: 74924)
76 FR 59416 - Senior Executive Service Performance Review Board
2011-09-26
..., William Danelo, Daniel J. Davis, Delia Davis, Robert de Vallance, Brian Dean, Nicole DeVita, Charles Di..., Roberta Stern, Warren Stewart, Sharon Stinnett, Melanie S. Strack, Barbara L. Stroud, Dennie Michael...
Technical training: places available
2013-01-01
If you would like more information on a course, or for any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Elise Romero, Technical Training Administration (Tel: 74924)
Technical training - places available
2013-01-01
If you would like more information on a course, or have any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Elise Romero, Technical Training Administration (Tel: 74924)
Technical training: places available
2014-01-01
If you would like more information on a course, or have any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Marie Lahchimi, Technical Training Administration (Tel: 74924)
Renilson, Martin
2015-01-01
This book adopts a practical approach and presents recent research together with applications in real submarine design and operation. Topics covered include hydrostatics, manoeuvring, resistance and propulsion of submarines. The author briefly reviews basic concepts in ship hydrodynamics and goes on to show how they are applied to submarines, including a look at the use of physical model experiments. The issues associated with manoeuvring in both the horizontal and vertical planes are explained, and readers will discover suggested criteria for stability, along with rudder and hydroplane effectiveness. The book includes a section on appendage design which includes information on sail design, different arrangements of bow planes and alternative stern configurations. Other themes explored in this book include hydro-acoustic performance, the components of resistance and the effect of hull shape. Readers will value the author’s applied experience as well as the empirical expressions that are presented for use a...
Chemistry of clitoral gland secretions of the laboratory rat ...
Indian Academy of Sciences (India)
Unknown
which have a unique function in maintaining social and reproductive status. 1. Introduction ... interaction (Leon 1983) and initiation of aggression. (Mugford and Nowell 1971). .... 1997) and humans (Stern and McClintock 1998). These.
Book Review: Review Manual for Massachusetts General Hospital ...
African Journals Online (AJOL)
Abstract. Book Title: Review Manual for Massachusetts General Hospital Handbook of. General Hospital Psychiatry. 5th ed. Book Author: Theodore A. Stern. Pp 121. Philadelphia: Elsevier Mosby. 2004. ISBN 0-323-02768-7.
Technical training: places available
2013-01-01
If you would like more information on a course, or for any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Elise Romero, Technical Training Administration (Tél : 74924)
A Case of Esophagopericardial Fistula as a Complication of Upper ...
African Journals Online (AJOL)
most common causes of OPF include; chronic esophagitis, esophageal ulcers .... Kaufman J, Thongsuwan N, Stern E, Karmy‑Jones R. Esophageal‑pericardial fistula with purulent ... Hepatogastroenterology 2001;48:1375‑8. 9. Greven WL ...
Directory of Open Access Journals (Sweden)
José Odálio dos Santos
2005-03-01
Full Text Available Este artigo trata do tema da criação de valor, da forma como é medida pelo EVA® (Valor Econômico Adicionado e pelo MVA® (Valor de Mercado Agregado, duas metodologias desenvolvidas no final dos anos 80 pela empresa americana de consultoria Stern Stewart & Co. O EVA® é definido como a diferença entre o lucro operacional líquido depois de impostos e o custo do capital investido na empresa, enquanto o MVA® é determinado pela diferença entre o valor de mercado da empresa e o capital total nela investido. Um estudo realizado por G. Bennett Stewart III, que idealizou essas metodologias juntamente com o seu sócio Joel M. Stern, encontrou uma forte correlação entre o EVA® e o MVA®. Visando averiguar se tal resultado se aplica também ao caso das empresas brasileiras, os autores deste artigo realizaram uma pesquisa semelhante, baseada numa amostra formada por empresas de capital aberto cujas ações foram negociadas na Bovespa (Bolsa de Valores de São Paulo durante o período de 1996 a 2001.This article deals with value creation as measured by Economic Value Added (EVA® and Market Value (MVA® which are methods developed by an American consultant, Stern Stewart & Co, in the late l980's. Economic Value Added is defined as the difference between net operating profit after taxes and the cost of capital invested in a company, while Market Value Added is the difference between market value and the total capital invested in a company. G. Bennett Stewart III, who conceived this approach together with his partner Joel M. Stern, found a strong correlation between Economic Value Added and Market Value Added. Our research investigated whether this also applies to a sample of publicly owned Brazilian companies traded on the São Paulo Stock Exchange between 1996 and 2001.
Groupwise information sharing promotes ingroup favoritism in indirect reciprocity.
Nakamura, Mitsuhiro; Masuda, Naoki
2012-11-05
Indirect reciprocity is a mechanism for cooperation in social dilemma situations. In indirect reciprocity, an individual is motivated to help another to acquire a good reputation and receive help from others afterwards. Another aspect of human cooperation is ingroup favoritism, whereby individuals help members in their own group more often than those in other groups. Ingroup favoritism is a puzzle for the theory of cooperation because it is not easily evolutionarily stable. In the context of indirect reciprocity, ingroup favoritism has been shown to be a consequence of employing a double standard when assigning reputations to ingroup and outgroup members. An example of such a double standard is the situation in which helping an ingroup member is regarded as good, whereas the same action toward an outgroup member is regarded as bad. We analyze a computational model of indirect reciprocity in which information sharing is conducted groupwise. In our model, individuals play social dilemma games within and across groups, and the information about their reputations is shared within each group. We show that evolutionarily stable ingroup favoritism emerges even if all the players use the same reputation assignment rule regardless of group (i.e., a single standard). Two reputation assignment rules called simple standing and stern judging yield ingroup favoritism; under these rules, cooperation with (defection against) good individuals is regarded as good (bad) and defection against bad individuals is regarded as good. Stern judging induces much stronger ingroup favoritism than does simple standing. Simple standing and stern judging are evolutionarily stable against each other when groups employing different assignment rules compete and the number of groups is sufficiently large. In addition, we analytically show as a limiting case that homogeneous populations of reciprocators that use reputations are unstable when individuals independently infer reputations of individuals
Groupwise information sharing promotes ingroup favoritism in indirect reciprocity
Directory of Open Access Journals (Sweden)
Nakamura Mitsuhiro
2012-11-01
Full Text Available Abstract Background Indirect reciprocity is a mechanism for cooperation in social dilemma situations. In indirect reciprocity, an individual is motivated to help another to acquire a good reputation and receive help from others afterwards. Another aspect of human cooperation is ingroup favoritism, whereby individuals help members in their own group more often than those in other groups. Ingroup favoritism is a puzzle for the theory of cooperation because it is not easily evolutionarily stable. In the context of indirect reciprocity, ingroup favoritism has been shown to be a consequence of employing a double standard when assigning reputations to ingroup and outgroup members. An example of such a double standard is the situation in which helping an ingroup member is regarded as good, whereas the same action toward an outgroup member is regarded as bad. Results We analyze a computational model of indirect reciprocity in which information sharing is conducted groupwise. In our model, individuals play social dilemma games within and across groups, and the information about their reputations is shared within each group. We show that evolutionarily stable ingroup favoritism emerges even if all the players use the same reputation assignment rule regardless of group (i.e., a single standard. Two reputation assignment rules called simple standing and stern judging yield ingroup favoritism; under these rules, cooperation with (defection against good individuals is regarded as good (bad and defection against bad individuals is regarded as good. Stern judging induces much stronger ingroup favoritism than does simple standing. Simple standing and stern judging are evolutionarily stable against each other when groups employing different assignment rules compete and the number of groups is sufficiently large. In addition, we analytically show as a limiting case that homogeneous populations of reciprocators that use reputations are unstable when individuals
Neli kontserti, mis liigutasid folgil kuulajaid / Maria Uuetoa
Uuetoa, Maria
2008-01-01
Kontsertidest Viljandi pärimusmuusikafestivali raames: setu noormeeste ansambel Klapp 24. juulil Kultrahoovis, Svjata Vatra 25. juulil Saku telgis, Vägilased Kirsimäel, Fernardo Stern ja Alejandro Soto 27. juulil Kaevumäel
A new facility for the determination of critical heat flux in nuclear fuel assemblies
Energy Technology Data Exchange (ETDEWEB)
Fortman, R A; Hadaller, G I; Hamilton, R C; Hayes, R C; Shin, K S; Stern, F [Stern Laboratories Inc., Hamilton, ON (Canada)
1993-11-01
A facility for the determination of critical heat flux in simulated reactor fuel assemblies has been constructed at Stern Laboratories for CANDU Owners` Group. This paper describes the facility and method of testing. 9 figs.
Navy Ship Propulsion Technologies: Options for Reducing Oil Use - Background for Congress
National Research Council Canada - National Science Library
O'Rourke, Ronald
2006-01-01
...%. The Navy has installed fuel-saving bulbous bows and stern flaps on many of its ships. Ship fuel use could be reduced by shifting to advanced turbine designs such as an intercooled recuperated (ICR) turbine...
2010-05-28
..., Thomas[email protected] . Kimberly D. Bose, Secretary. Agenda for AD10-12 Staff Technical Conference on... Gribik and Li Zhang, Midwest ISO Gary Stern, Southern California Edison 9:25 a.m Session G--Variable...
Sterne, Jonathan
2012-01-01
Jonathan Sterne shows that understanding the historical meaning of the MP3, the world's most common format for recorded audio, involves rethinking the place of digital technologies in the broader universe of twentieth-century communication history.
Richard Kelly: Pioneirismo na iluminação da arquitetura moderna
Directory of Open Access Journals (Sweden)
Fernanda Brito Bandeira
2018-04-01
Full Text Available Livros resenhado: NEUMANN, Dietrich; STERN, Robert A. M. The structure of light: Richard Kelly and the illumination of modern architecture. New York: Yale University Press, 2010, 214 p. ISBN: 978-0-300-16370-4
Iirlaste uskumatu edu kivilinnas New Yorgis / Tambet Kaugema
Kaugema, Tambet
1998-01-01
Ameerika Ühendriikide rahvusliku raamatuauhinna laureaadid: Alice McDermott (ilukirjanduse auhind, romaan 'Charming Billy'), Edward Ball (aimekirjanduse auhind, 'Slaves in the family'), Gerald Stern (luuleauhind, 'This time'), Louis Sachar (noorsookirjanduse auhind), John Updike (elutöö auhind)
The Disappearance of Music Media
DEFF Research Database (Denmark)
Ægidius, Andreas Lenander
This paper focuses on the distinct technologies that operate behind, beyond, and below the concept of media. I theorize that the intricate complex of platforms, channels and formats for the consumption of cultural content is better understood through the lens of format theory (Aegidius, 2017; Ste...... we elaborate on the post-media conditions of the music industry through the use of format theory......., experience, and workings of a medium. It also names a set of rules according to which a technology can operate´ (Sterne, 2012, 7). Music consumption in the East Asian countries and especially Japan provides a remarkable and unique case for the continued and global disappearance of music media. But formats...... persist and govern the music experience. Here I focus on the ways in which traditional and physical music formats (CD) intersect with new media formats, e.g. the micromaterial music file and the music stream, here conceptualised as the internet protocols plus music file (Aegidius, 2017). I suggest...
International Nuclear Information System (INIS)
Zhang, Z.; Fenter, P.; Cheng, L.; Sturchio, N.; Bedzyk, M.; Machesky, M.; Anovitz, L.; Wesolowski, D.
2006-01-01
The X-ray standing wave technique was used to probe the sensitivity of Zn 2+ and Sr 2+ ion adsorption to changes in both the adsorbed ion coverage and the background electrolyte species and concentrations at the rutile (α-TiO 2 ) (110)-aqueous interface. Measurements were made with various background electrolytes (NaCl, NaTr, RbCl, NaBr) at concentrations as high as 1 m. The results demonstrate that Zn 2+ and Sr 2+ reside primarily in the condensed layer and that the ion heights above the Ti-O surface plane are insensitive to ionic strength and the choice of background electrolyte (with - , coupled with the insensitivity of Zn 2+ and Sr 2+ cation heights to changes in the background electrolyte, implies that anions do not play a significant role in the adsorption of these divalent metal ions to the rutile (110) surface. Absolute ion coverage measurements for Zn 2+ and Sr 2+ show a maximum Stern-layer coverage of ∼0.5 monolayer, with no significant variation in height as a function of Stern-layer coverage. These observations are discussed in the context of Gouy-Chapman-Stern models of the electrical double layer developed from macroscopic sorption and pH-titration studies of rutile powder suspensions. Direct comparison between these experimental observations and the MUltiSIte Complexation (MUSIC) model predictions of cation surface coverage as a function of ionic strength revealed good agreement between measured and predicted surface coverages with no adjustable parameters
Towards quantum simulation of the Kondo-Lattice-Model
Energy Technology Data Exchange (ETDEWEB)
Kochanke, Andre
2017-04-25
Ultracold quantum gases of alkaline-earth-like metals are a versatile tool to investigate interacting many-body physics by realizing clean and controllable experimental model systems. Their intriguing properties range from energetically low-lying clock transitions, which allow for high-resolution spectroscopy, over meta-stable states, which can be regarded as a second species with orbital degree of freedom, to SU(N) symmetry, allowing novel magnetic phases. These open up new possibilities for quantum simulators. Using them in combination with optical lattices dissipative Fermi-Hubbard models and the Kondo-lattice-model can be realized, two promising examples for probing strongly correlated systems. This thesis presents an experimental apparatus for producing ultracold samples of fermionic {sup 173}Yb (N≤6). A new bicolor dipole trap was implemented with a final, average trap frequency of anti ω=36 Hz. Using optical, resonant pumping and an Optical-Stern-Gerlach scheme, the spin mixture can arbitrarily be changed from a six- to a one-component gas. Typically the degenerate Fermi gases consist of 87000 atoms at 17.5% T{sub F} (N=6) and of 47000 atoms at 19.4% T{sub F} (N=1). The lowest lying meta-stable state {sup 3}P{sub 0} (578 nm) is coherently controlled using a clock-laser setup with a linewidth of FWHM=1 Hz by means of Rabi oscillations or rapid adiabatic passage. By conducting spectroscopic measurements in a 3D magic lattice (759 nm) we demonstrate inter band transitions and observe the {sup 1}S{sub 0}<=>{sup 3}P{sub 0} excitation with a resolution of FWHM=50(2) Hz. Applying these techniques to a two-component spin mixture reveals a shift of the clock-transition caused by spin-exchange interaction between the orbital symmetric vertical stroke eg right angle {sup +} vertical stroke ↑↓ right angle {sup -} and the orbital antisymmetric vertical stroke eg right angle {sup -} vertical stroke ↑↓ right angle {sup +} state. Using the inelastic properties of
“PERFORMANCE TREND” AND “PERFORMANCE CURRENT” RATINGS BY ECONOMIC VALUE ADDED (EVA
Directory of Open Access Journals (Sweden)
ALEXANDRU BOGEANU
2013-08-01
Full Text Available The Economic Value Added (EVA is an index of “durable development.” It was proposed by the Stern-Stewart Office and represents the true economic profit of companies. A company reports economic profit only if thereported accounting profit is higher than the opportunity cost of equity. The authors of the EVA model (Stern-Stewart have also proposed the ways of restating the financial statements to get a “fair image” of the results, thuseliminating the “accounting distortions.”Based on the performance indexes calculated based on EVA and second-generation indexes relating toEVA, we calculated two types of rating: Rating Performance Current and Rating Performance Trend. The rating iscalculated by means of the percentiles technique and the results are split into 22 rating classes.The used database is Russell 3000.
DEFF Research Database (Denmark)
Lupton, Tina Jane
2016-01-01
This article takes a critical approach to the possibility of applying Bruno Lator’s work to Tristram Shandy. Sterne is both reflexive about the impossibility of representing the material work and determined to do just that in relation to his book. But these are competing tendencies in Latour’s te......’s terms, difficult to judge in the context of a single work. Latour’s recent language for Fiction as a “mode” ultimately leaves us without a way to distinguish between texts that are self-conscious and those that aren’t......This article takes a critical approach to the possibility of applying Bruno Lator’s work to Tristram Shandy. Sterne is both reflexive about the impossibility of representing the material work and determined to do just that in relation to his book. But these are competing tendencies in Latour...
Luminescence quenching by reversible ionization or exciplex formation/dissociation.
Ivanov, Anatoly I; Burshtein, Anatoly I
2008-11-20
The kinetics of fluorescence quenching by both charge transfer and exciplex formation is investigated, with an emphasis on the reversibility and nonstationarity of the reactions. The Weller elementary kinetic scheme of bimolecular geminate ionization and the Markovian rate theory are shown to lead to identical results, provided the rates of the forward and backward reactions account for the numerous recontacts during the reaction encounter. For excitation quenching by the reversible exciplex formation, the Stern-Volmer constant is specified in the framework of the integral encounter theory. The bulk recombination affecting the Stern-Volmer quenching constant makes it different for pulse excited and stationary luminescence. The theory approves that the free energy gap laws for ionization and exciplex formation are different and only the latter fits properly the available data (for lumiflavin quenching by aliphatic amines and aromatic donors) in the endergonic region.
A Review of Stroke Cases in a Military Hospital in Nigeria
African Journals Online (AJOL)
Stroke is defined as a syndrome of rapidly developing ... speech as common symptoms, unless the brain stern is involved. ... Sex differences in the stroke patients have not been consistent, but most .... Left stroke + Right hemiparesis. 7. 36.8. 7.
Department of Defense Energy Strategy: Teaching an Old Dog New Tricks
2007-04-01
on surface ships. The stern flaps create lift to the aft portion of the ship and reduces propeller cavitations . This results in reduced hydrodynamic ...Potential Oil Supply Disruptions.................................................................................26 Potential Electricity Supply...16 Figure 4 World Crude Oil Reserves, 1980-2006
Focus on the Learner: Pragmatic Perspectives for the Language Teacher.
Oller, John W., Jr., Ed.; Richards, Jack C., Ed.
This book of readings includes: "Language Didactics and Applied Linguistics" (William Mackey); "Psycholinguistics and Second Language Teaching" (H. H. Stern); "Linguistic Theory" (Noam Chomsky); "Some Psycholinguistic Controversies" (John Oller, Jr.); "The Cognitive Strategies of Language Learning" (John Macnamara); "Conditions for Language…
African Journals Online (AJOL)
DR. AMINU
2014-06-01
Jun 1, 2014 ... Diabetic nephropathy is a common phenomenon in patients with diabetes. Its prevalence risk ... ketoacidosis, or hyperosmolar coma (David, 2001). As ..... Haffner, S.M, Stern, M.p, Gruber, M.k, Hazuda, H.P,. Mitchel, M.D,and ...
Max Havelaar Dan Citra Antikolonial: Sebuah Tinjauan Poskolonial
Directory of Open Access Journals (Sweden)
Christina Dewi
2008-06-01
Full Text Available Max Havelaar is a literary work by Multatuli, a.k.a. E.E. Douwes Dekker. This novel is usually known as a novel with an anti-colonial image. While in the other hand, this novel never suggests to stop colonialism done by Dutch in Hindia Belanda. This research aims at revealing the relationship between colonialism's views with its innovation of narrative technique in this novel. The first analysis is trying to do a focalization on MH. The writer wants to do it because MH presents an argument about the essence of colonialism in Hindia Belanda through opinions and views from three focalizations. MH uniquely uses three focalizers and its uniqueness is shown by Stern as a narrator-fokalizer in the Lebak Episode. Although Stern is one of the characters in the novel, it gives the impression that Stern is in a neutral position. He takes place in the middle-position between the two other character-focalizers. However, since he is one of the characters in this novel, his focalization is not perfectly neutral in the manner of inviting the readers to support the attitude of Multatuli, Readers are confronted to make a choice between the war of anticolonial or procolonial interests and to support either one of the two character-fokulizers : Multatuli or Droogstoppcl. The orientalism theory has been applied to conduct focalization in the novel as the research object.. The novel characterizes Multatuli and Stern as opposing figures against the forced labor while Droogstoppcl, on the other hand, as a figure who is supporting forced labor of the coffee trade. MH strove for labors to earn proper wages so that the issue about the procedures of cultuur-stelsel has a special place in MH. Anti-colonial traits are shown by a rejection of low wages, oppression, robbery, injustice, mistreating, and discrimination. This novel is influencing the colonial hegemony of the competition of industrial products among colonized countries in Europe in the 19th century. That is
Talbot, David
2009-01-01
USA California Ülikooli töötajate Abram Stern'i ja Michael Dale'i poolt 2005. a. algatatud USA kongressis peetud kõnede videoremiksidest ja nende poolt loodud veebisaidist Metavid.org. Ka YouTube keskkonnast ja wikipedia katsetustest muuta oma keskkond multimeedialisemaks
Exploiting Electric and Magnetic Fields for Underwater Characterization
2011-03-01
geophysical surveys are primarily limited to passive magnetic systems towed from a surface vessel. These systems utilize fluxgate , Overhauser, or atomic... magnetometer sensors, often deployed in arrays towed from the stern of small to moderate-size vessels. Active source electromagnetic methods have been
Schaffer, Karl
2012-01-01
The use of traditional string figures by the Dr. Schaffer and Mr. Stern Dance Ensemble led to experimentation with polyhedral string constructions. This article presents a series of polyhedra made with six loops of three colors which sequence through all the Platonic Solids.
how to understand the parables of jesus. a paradigm shift in parable
African Journals Online (AJOL)
and parables with more than one reference are always discussed in terms of the oldest source while .... 1393a.2831), and Quintilian, in the 11th chapter of the fifth book of his. Institutio Oratoria (Quint ...... Harvard University Press. stern, f. 2006.
Eggermont, L.H.P.; Gavett, B.E.; Volkers, K.M.; Blankevoort, C.G.; Scherder, E.J.A.; Jefferson, A.L.; Steinberg, E.; Nair, A.; Green, R.C.; Stern, R.A.
2010-01-01
Eggermont LH, Gavett BE, Volkers KM, Blankevoort CG, Scherder EJ, Jefferson AL, Steinberg E, Nair A, Green RC, Stern RA. Lower-extremity function in cognitively healthy aging, mild cognitive impairment, and Alzheimer's disease. Objective: To examine differences in lower-extremity function in
Annals of African Surgery July 2011 07.12.2011.indd
African Journals Online (AJOL)
andrew
2011-07-30
Jul 30, 2011 ... Background: Dislocation is one of the most common complications after total hip arthroplasty. .... Stern, J. T., Pare, E. B. and Schwartz, J. M. New perspectives on muscle use ... Clin Orthop 2001; 393:163–167. 13. Stähelin T ...
Indian Academy of Sciences (India)
Madhu
” to the Brünn Natural. History Society in 1865 (Mendel 1866; for a translation of the paper, Stern and Sherwood 1966), but only .... not capable of fully explaining the difference between his clear-cut findings with peas and his less easi-.
The ecological production of cleans stock-breeding problems
International Nuclear Information System (INIS)
Meldebekov, A.M.
2002-01-01
KazSRTIS have made researches on study of maintenance in cows' milk developed in Almaty's region, determination of heavy metal salts and radionuclides. It has been noted that maintenance of mercury, lead, cupper and zinc increased in suburb's housekeeping cows' milk, which was disposed nearly international highway and industry activities. It is known that entering radionuclides human organism happens by food chain 'soil - vegetable cover - animals product stock-breeding -person'. Animals transformer stern's plants energy at the in conclusion it allows to take the compare with initial vegetable exponent more ecological tidy products limits stream toxic elements in food series of person. It lets to study agricultural animals, how 'biological filter' in production ecological clean and healthy product of food. Changing structure and set stern's rationals, method contents the limit of animals stream manufacturing pollution from soil vegetable cover agricultural used in milk and in mead from 2 till 5 times. Utilisation tidy stern's in final period fatten meat cattle give possibility to clean the organs and tissue of animals which representative food's value from admixture to level, corresponding medical - hygienic standards. It is necessary to make analysis on compound investigation on the effect of radionuclides in agricultural animals, namely to utilize them, that really barrier migrate toxic elements in captured chain of person. The ways of solutions in ecological stock-breeding problems are next: to show up ecological tidy and ecological unsuccessful places; to study rules of transition in basic pollutions of food chains; toxic elements limitation rules in stock-breeding production; utilization manufactory-polluted territories from technological elements for stock-breeding
Asymmetric systems described by a pair of local covariant wave equations
Energy Technology Data Exchange (ETDEWEB)
Mallik, S [Bern Univ. (Switzerland). Inst. fuer Theoretische Physik
1979-07-16
A class of asymmetric solutions of the integrability conditions for systems obeying the Leutwyler-Stern pair of covariant wave equations is obtained. The class of unequal-mass systems described by these solutions does not embed the particle-antiparticle system behaving as a relativistic harmonic oscillator.
Post enne modernismi / Mari Laaniste
Laaniste, Mari, 1977-
2007-01-01
Laurence Sterne'i romaani ainetel loodud komöödiafilm "Tristram Shandy - härrasmehe paljastused" ("A Cock and Bull Story") : stsenarist Frank Cottrell Boyce : režissöör Michael Winterbottom : peaosas Steve Coogan : Suurbritannia 2005. Lühiandmed ka Steve Coogani kohta
Eggermont, Laura H.; Gavett, Brandon E.; Volkers, Karin M.; Blankevoort, Christiaan G.; Scherder, Erik J.; Jefferson, Angela L.; Steinberg, Eric; Nair, Anil; Green, Robert C.; Stern, Robert A.
Eggermont LH, Gavett BE, Volkers KM, Blankevoort CG, Scherder EJ, Jefferson AL, Steinberg E, Nair A, Green RC, Stern RA. Lower-extremity function in cognitively healthy aging, mild cognitive impairment, and Alzheimer's disease. Arch Phys Med Rehabil 2010;91:584-8. Objective: To examine differences
Indian Academy of Sciences (India)
Admin
can apply an electric force density instead of a pressure ... on a flat surface) try to adopt ... which are bound to the surface (Stern layer), while the others are .... The system is like a parallel plate ... The boundary of the droplet is also shown.
Active and break spells of the Indian summer monsoon
Indian Academy of Sciences (India)
(2001) used the term 'break' to denote weak spells of the daily all-India ... (2001) used the daily all-India rainfall based on ..... erned by a common spatial mode of variability. According ..... Waliser D E, Lau K M and Stern W 2003 Potential pre-.
Kane, Peter E., Ed.
This issue of "Free Speech" contains the following articles: "Daniel Schoor Relieved of Reporting Duties" by Laurence Stern, "The Sellout at CBS" by Michael Harrington, "Defending Dan Schorr" by Tome Wicker, "Speech to the Washington Press Club, February 25, 1976" by Daniel Schorr, "Funds…
2011-05-16
... contained incorrect information concerning side lights arc of visibility; rule 21(b). This correcting... Yard, DC 20374-5066, telephone number: 202-685-5040. SUPPLEMENTARY INFORMATION: Pursuant to the... anchor light, relationship of lights arc Side lights Stern light inboard of distance height above aft...
Settlement of the USS Arizona, Pearl Harbor, Hawaii
Carkin, Brad A.; Kayen, Robert E.
2013-01-01
The U.S. Geological Survey, in collaboration with the National Park Service Submerged Resources Center, undertook investigations at the USS Arizona Memorial at Pearl Harbor, Hawaii, in 2002, 2003, and 2005 to characterize geological factors affecting the deterioration and movement of the hull of the USS Arizona. Since sinking on the morning of December 7, 1941, the hull of the USS Arizona has been slowly but steadily disappearing below the surface of Pearl Harbor. Continuous sediment coring at three of four locations around the hull of the Arizona was only partially successful, but it was sufficient to identify a varied sedimentary substrate beneath the hull. A boring near the stern reveals a thick, continuous sequence of soft, gray clay to the bottom of the boring. In contrast, borings near the bow and starboard side, below about 5 meters subbottom depth, indicate the presence of very stiff, brown clay and coral debris and an absence of soft clay. Multisensor core logger scanning of the recovered cores distinguishes the lower density of the soft, gray clay at the stern from the higher density of the stiff, brown clays and coral debris at the bow and starboard side. Uniaxial consolidation testing of the soft gray clay indicates a normally consolidated sequence, whereas the stiff, brown clay and coral debris are overconsolidated. Profiles of shear wave velocity vs. depth obtained through spectral analysis of interface wave testing around the perimeter of the hull in 2005 identified areas of higher velocity, stiffer sediment at the bow and starboard side, which correspond to the dense, stiff clay recovered near the bow and starboard borings. Low shear-wave velocities at the port midship and quarter of the hull correlate with the lower density, softer sediment recovered from the boring at the stern. Cross sections of the subbottom of the Memorial combine results from the sediment borings and geophysical surveys and depict a wedge of soft clay unconformably overlying
Drei neue gamma-Doradus-Sterne aus der ASAS-3 Datenbank
Bernhard, Klaus; Huemmerich, Stefan
2016-02-01
By analysis of data from the ASAS-3 archive, the stars HD 18011, NSV 16873 and NSV 3272 were identified as multiperiodic gamma Doradus variables. Essential information on these variables is presented, along with unwhitened frequency spectra and statistically significant frequencies, as derived with Period 04.
2007-05-01
Dixon and Stern, 2004), and gun violence prevention programs ( Tita et al., 2003). As DHS considers promulgating regulations and implementing new...communication 2/21/07. Tita , G., K. J. Riley, G. Ridgeway, C. A. Grammich, A. Abrahamse, and P. W. Greenwood (2003), Reducing Gun Violence: Results
Hakeem O. Ijaiya* Abstract The issue of transnational environmental ...
African Journals Online (AJOL)
State for pollution that affects neighbouring states can be traced to the Trail ... the growth of truly global proportions only since the onset of the industrial ... 3 See Thomas W. Merrill, Golden Rules for Transboundary Pollution, .... 20 NICHOLAS STERN, THE ECONOMICS OF CLIMATE CHANGE. ..... The Basel Convention.
Perspectives on the Viable Mobile Virtual Community for Telemedicine
van 't Klooster, J.W.J.R.; Pawar, P.; van Beijnum, Bernhard J.F.; Dulawan, Chariz; Hermens, Hermanus J.
2010-01-01
A virtual community is an electronically supported social network: it can be seen as a group of people who have regular social interaction, independent of time and space, because of a common interest such as a problem, task, or feeling exchange (Eysenbach, Powell, Englesakis, Rizo, & Stern, 2004;
Effect of simulated pulpal pressure on composite bond strength to ...
African Journals Online (AJOL)
STORAGESEVER
2009-10-19
Oct 19, 2009 ... Key words: Bond strength, laser treatment, pulpal pressure, resin composite. INTRODUCTION ... bilities for operative and esthetic dentistry (Kato and. Nakabayashi ... E-mail: kimyais@tbzmed.ac.ir. Tel: 0098411- ... pulse repetition rate of 20 pulses per second (20 Hz). ..... Stern RH, Sognnaes RF (1965).
2012-03-08
... Yard, DC 20374-5066, telephone 202-685-5040. SUPPLEMENTARY INFORMATION: Pursuant to the authority... the sidelights; and Rule 21(c), pertaining to the location and arc of visibility of the sternlight... light, anchor Anchor lights lights arc Side lights Stern light distance distance light, relation-ship of...
2013-05-15
... Ave. SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone 202-685-5040. SUPPLEMENTARY... lights lights arc Side lights Stern light distance distance light, relationship of Vessel Number of arc of arc of inboard of forward of height above aft light to visibility; visibility; visibility; ship's...
The labyrinth of memories in Tristram Shandy and the surrealist procedures
Directory of Open Access Journals (Sweden)
Aline Candido Trigo
2015-12-01
Full Text Available The life and opinions of Tristram Shandy, gentleman, by Laurence Sterne, is a rupture novel that launched narrative devices that were to be consolidated as moderns, in distinct areas. Therefore, the present work proposes a connection between shandyan writing and the ideals of surrealism, in ways shown by André Breton about artists of previous periods who were as much surrealists as the movement founders. Their ideals of the totality of thought to achieve free writing, automatic writing, as well as the reaching of an absolute reality, were spread to many countries and surpassed barriers of temporality, projecting themselves into the contemporaneity. In this way, the present paper, starting from concepts by Walter Benjamin, analyzes the resistance of this form of memory use that characterizes authors such as Aragon and others surrealists, but that had its beginning with the digressive novel by Laurence Sterne.
Toward predicate approaches to modality
Stern, Johannes
2016-01-01
In this volume, the author investigates and argues for, a particular answer to the question: What is the right way to logically analyze modalities from natural language within formal languages? The answer is: by formalizing modal expressions in terms of predicates. But, as in the case of truth, the most intuitive modal principles lead to paradox once the modal notions are conceived as predicates. The book discusses the philosophical interpretation of these modal paradoxes and argues that any satisfactory approach to modality will have to face the paradoxes independently of the grammatical category of the modal notion. By systematizing modal principles with respect to their joint consistency and inconsistency, Stern provides an overview of the options and limitations of the predicate approach to modality that may serve as a useful starting point for future work on predicate approaches to modality. Stern also develops a general strategy for constructing philosophically attractive theories of modal notions conce...
Anthracene Fluorescence Quenching by a Tetrakis (Ketocarboxamide Cavitand
Directory of Open Access Journals (Sweden)
Tibor Zoltan Janosi
2014-01-01
Full Text Available Quenching of both fluorescence lifetime and fluorescence intensity of anthracene was investigated in the presence of a newly derived tetrakis (ketocarboxamide cavitand at various concentrations. Time-correlated single photon counting method was applied for the lifetime measurements. A clear correlation between the fluorescence lifetime of anthracene as a function of cavitand concentration in dimethylformamide solution was observed. The bimolecular collisional quenching constant was derived from the decrease of lifetime. Fluorescence intensity was measured in the emission wavelength region around 400 nm as a result of excitation at 280 nm. Effective quenching was observed in the presence of the cavitand. The obtained Stern-Volmer plot displayed upward curvature. The results did not follow even extended Stern-Volmer behavior, often used to describe deviations from static bimolecular quenching. To explain our results we adopted the Smoluchowski model and obtained a reasonable estimate for the molecular radius of the cavitand in solution.
International Nuclear Information System (INIS)
Ryu, Eui-Seung; You, Sung-Chang
2014-01-01
As pressure tube diameter creep increase, the coolant flows through some of the interior subchannels of the fuel bundle are reduced and consequently reduces the Critical Heat Flux (CHF). For this reason, Canadian Utilities have performed the project that developing the new fuel design (modified 37-element bundle) to increase critical heat flux. The modified 37-element (37M) bundle has the same overall geometry as the reference 37-element (37R) bundle that is using in the Wolsong units now but the center element diameter has been reduced from 13.06mm to 11.5mm. The reduction in center element diameter of the 37M bundle design increase the flow of center areas to improve the cooling and thus to enhance CHF. The CHF experiments with 37M bundle string simulator in un-crept and crept (3.3%, 5.1% peak creep) flow channels were completed at Stern Laboratories in 2008. A substantially large increase in dryout-power was observed for the 37M bundle compared to the 37R bundle, particularly in the 5.1% crept channel. As a result of the experiments, Ontario Power Generation (OPG) and Bruce Power (BP) have increased the operational margin with this CHF correlation and has fully refueled the 37M fuel on some units or almost done on the other units. KHNP also has performed the project to refuel the 37M bundle which is the same design with OPG and BP recently. This paper summarizes the comparison assessment of Thermalhydraulic (T/H) behavior for 37M bundle and 37R bundle with their own correlations and geometry parameters. This analysis performed with the thermal hydraulic code (NUCIRC) and the site measured data at the Wolsong Unit2. Tests to evaluate the CHF performance with the 37M fuel bundle have been conducted in 2008 using the un-crept, 3.3% crept and 5.1% crept flow channels in the CHF Test facility at Stern Laboratories. In addition pressure drop tests have been performed at the same time. The changes of geometry from 37R bundle to 37M bundle reduced the center element
International Nuclear Information System (INIS)
Wall, R.M.; Lara, L.E.; Perez de Arce, C
2001-01-01
The Pudahuel Ignimbrite (Wall et al., 1996) is a characteristic pyroclastic flow deposit placed in the Central Depression, within the Maipo, Mapocho and Cachapoal valleys and, in the eastern side of the Andes, at Yaucha and Papagayos rivers as well (Harrington, 1989; Guerstein, 1993). Close to Santiago, Pudahuel Ignimbrite reaches 40 m in thickness (Dragicevic, 1962) which decreces up to 5 m 60 km to the west. The deposit is compounded by ash and lapilli size pumice within a cineritic matrix with shards, crystals and pumice fragments. Facies of both, laminar and turbulent flow regime can be distinguished, the latter prevailing near topographic barriers and on river plain floors. There, traction structures like cross-bedding and important amount of litic clasts are characteristic. Pumices are rhyolitic in composition (ca. 75% SiO 2 ; Stern et al., 1984; Guerstein, 1993) and have few 0.5-2 mm long biotite crystals. Two 40 Ar/ 39 Ar step-heating experiments on biotite from pumices of two localities, Maipu (Santiago) and Bollenar (Melipilla), show plateau ages of 2.3±0.3 Ma (RW-371) and 2.2±0.3 Ma (RW-1009). In both cases, the first step of the experiment indicates loss of Ar from the cristal rims wich was removed for the plateau calculus only in the second case. For the RW-371 sample an inverse isocrone age of 1.4±0.8 Ma (MSWD: 0.98) was obtained. Previously, the Pudahuel Ignimbrite was dated by Stern et al. (1984) in ca. 450 ka using zircon fission-tracks. Although inconsistent with our new ages, these pleistocene age seemed coherent with the discovery of an Antifer (deer) bone by Tavera (1978) within the ignimbrite close to Santiago. Nevertheless, as was apointed by Tavera (1978) himself, the Antifer genus is recognized in Argentina in the Pliocene-Quaternary interval and make possible a review of the well known 'pleistocene' mammal vertebrate associations in Chile. Another consequence of the new possible pliocene ages is that, since the ignimbrite does not show
Influence of Long-Tailed Alcohols on the Solubilisation of Cationic DHAB Bilayers
Directory of Open Access Journals (Sweden)
Jan B.F.N. Engberts
2005-01-01
Full Text Available Abstract: The effects of n-decanol and cetyl alcohol incorporated into cationic di-n-hexadecyldimethylammonium bromide (DHAB bilayers on the packing and the resistance against solubilisation by Triton X-100 have been investigated. Solubilisation experiments revealed that the mismatch between the C10-tail of n-decanol with the DHAB-tails does not affect the structural integrity of the vesicles. On the contrary, upon increasing amounts of cetyl alcohol, of which the tail matches in size with the DHAB-tails, breakdown of the vesicles is promoted, whereas complete solubilisation is strongly hampered. The system is further investigated by DSC and cryo-EM experiments. In addition, the effects of n-decanol and cetyl alcohol embedded into DHAB bilayers on the vesicular rate constants for the decarboxylation of 6-nitrobenzisoxazole-3-carboxylate (6-NBIC suggest that both alcohols affect the structure of the Stern region in an equal manner, leading to a decrease in the catalysis. Therefore, it is concluded that addition of the alcohols leads to changes in properties of the interior of the bilayer, rather than the polar-apolar interface.
Model of learning for practitioners in dementia care with music therapy as the joint focal point
DEFF Research Database (Denmark)
Ottesen, Aase Marie
Method and the theoretical frame of reference for the project; for example Daniel Stern's theory of senses of self, forms of vitality, the present moment, Barry Reisbergs research on retrogenesis and the recent research on mirror neurons. Methodically the project is organized as a case study of a music...
African Journals Online (AJOL)
R.B. Ruthven
konstitutive Dimension sichtbar wird?“ (S. 1). Die empirische Grundlage der. Untersuchung bilden 136 Parlamentsreden (von 1963 bis 2000), 216 Artikel aus dem Magazin Stern (1968 bis 2000) sowie die Online-Korpora des Instituts für. Deutsche Sprache in Mannheim und das Leipziger Online-Wortschatzlexikon. Im 1.
14 CFR 25.529 - Hull and main float landing conditions.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float landing conditions. 25... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Water Loads § 25.529 Hull and main.... (b) Unsymmetrical landing for hull and single float seaplanes. Unsymmetrical step, bow, and stern...
African Journals Online (AJOL)
2007-03-30
Mar 30, 2007 ... two component density functional theory to calculated positron annihilation rates for positrons trapped in vacancies in Al, Cd, Mg,. Hg, Li, and Na. The results they got were generally lower than experimental values. Sterne and Kaiser (1991) calculated positron lifetimes (inverse of annihilation rates) in.
A Assess and c sing th change he farm e: A ca mers pe ase stu ...
African Journals Online (AJOL)
sunny
drought, and increased frequency of extreme events could make rainfed agriculture more risky and aggravate food insecurity in Ethiopia (Seleshi and Zanke, 2004;. Stern, 2007; Conway and Schipper, 2011). Preliminary projections suggested that climate change can have a sizeable impact that ranges in the order of 7-8% ...
Assessment of diagnostic technology in health care: rationale, methods, problems, and directions
National Research Council Canada - National Science Library
Sox, Harold C
1989-01-01
... Rationale, Methods, Problems, and Directions Harold Sox, Susan Stern, Douglas Owens, and Herbert L. Abrams Institute of Medicine NATIONAL ACADEMY PRESS WASHINGTON, D.C. 1989 Copyrightthe cannot be not from book, paper however, version for formatting, original authoritative the typesetting-specific the as from created publication files XML from...
2003-11-08
Bacillus anthracis BA0068 Ames Sterne SPS 97.13.213 Bacillus cereus Bacillus coagulans Bacillus licheniformis Bacillus macerans Bacillus ...megaterium Bacillus polymyxa Bacillus sphaericus Bacillus stearothermophilus Bacillus subtilis subsp. niger Bacillus thuringiensis Bacillus popilliae...varicella- zoster virus, and Bacillus anthracis DNA by LightCycler polymerase chain reaction after autoclaving:
Law, Democracy & Development - Vol 3, No 1 (1999)
African Journals Online (AJOL)
Governing rules and principles of the WTO: Its scope and future development in the context of globalisation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Brigitte Stern, 1-14. Globalisation, the World Trade Organisation and the implications for developing countries ...
The Trap of History : The States Party and the Revolt of the Netherlands, 1650–1660
Steen, van der J.A.
2013-01-01
Historians of the First Stadholderless Period (1650-1672) have shown that supporters of the house of Orange evoked memories of Prince William i of Orange's role in the Revolt of the Netherlands in support of their political agendas. Jill Stern has recently argued that the supporters of True Freedom
Indian Academy of Sciences (India)
and nucleophile bound to the micelle have been calculated. The above results suggest that reaction occurs between the substrate solubilised into the micelle and the nucleophile residing at the Stern layer rather than at the micelle-water interface. The equilibrium constant, and critical micelle concentration, evaluated using ...
Age and size effects on seed productivity of northern black spruce
J. N. Viglas; C. D. Brown; J. F. Johnstone
2013-01-01
Slow-growing conifers of the northern boreal forest may require several decades to reach reproductive maturity, making them vulnerable to increases in disturbance frequency. Here, we examine the relationship between stand age and seed productivity of black spruce (Picea mariana (Mill.) Britton, Sterns & Poggenb.) in Yukon Territory and Alaska....
The impact of climate change on the balanced growth equivalent: An application of FUND
Anthoff, D.; Tol, R.S.J.
2009-01-01
The Stern Review added balanced growth equivalents (BGE) to the economic climate change research agenda. We first propose rigorous definitions of the BGE for multiple regions and under uncertainty. We show that the change in the BGE is independent of the assumed scenario of per capita income. For
Kas meile tuntud Lääne ühiskonna lõpp? / Urmas Kiil
Kiil, Urmas
2007-01-01
Tuntud briti majandusteadlase Nicholas Sterni juhitud komisjoni koostatud raport prognoosib, et kliimamuutused ähvardavad endaga kaasa tuua majandusajaloo suurima tagasilöögi, lähitulevikus tuleks globaalsest SKT-st eraldada igal aastal vähemalt 1% selleks, et pehmendada kliimasoojenemisest põhjustatud tagajärgi. Lisa: Nicholas Stern
33 CFR 165.515 - Safety Zone: Cape Fear River, Wilmington, North Carolina.
2010-07-01
... Cape Fear River to the stern of the Battleship USS NORTH CAROLINA. (b) Definitions. The designated..., Wilmington, North Carolina. 165.515 Section 165.515 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.515 Safety Zone: Cape Fear River, Wilmington, North Carolina. (a) Location. The following area is...
2010-04-30
... Yard, DC 20374-5066, telephone 202-685-5040. SUPPLEMENTARY INFORMATION: Pursuant to the authority...), pertaining to the location of the sidelights; and Rule 21(c), pertaining to the location and arc of..., Stern light distance distance Forward anchor Anchor lights Masthead lights arc of Side lights arc of arc...
Energy Technology Data Exchange (ETDEWEB)
Pandey, Ashish; Yadav, Anita; Bhawna; Pandey, Siddharth, E-mail: sipandey@chemistry.iitd.ac.in
2017-03-15
Two common and popular deep eutectic solvents (DESs) composed of the salt choline chloride and H-bond donors glycerol and urea in 1:2 mol ratio named glyceline and reline, respectively, are investigated for the analysis of polycyclic aromatic hydrocarbons (PAHs) using quenching of both steady-state and time-resolved fluorescence of ten different PAHs by nitromethane at 30 °C. Based on their quenching efficiencies, the PAHs are divided into two groups – group 1 is constituted of the five PAHs whose fluorescence are quenched less effectively by nitromethane whereas the other five exhibiting high quenching efficiency are associated to group 2. Quenching of steady-state fluorescence of group 1 PAHs by nitromethane, albeit not very significant, follow a simple Stern-Volmer behavior. The excited-state emission intensity decay of these PAHs, in both absence and presence of nitromethane, fit best to a single exponential model with small but monotonic decrease in lifetimes. The decrease in lifetime also follows Stern-Volmer behavior, however, the quenching constants (K{sub D}) are lower than those obtained from steady-state fluorescence (K{sub SV}). This is ascribed to the possible formation of charge-transfer complex between the PAH and the nitromethane. Steady-state fluorescence quenching of group 2 PAHs exhibit distinct upward curvature from linear Stern-Volmer behavior implying highly efficient quenching. The intensity decay fits best to a double exponential decay model with longer of the decay times following simple Stern-Volmer behavior. Formation of a complex or the presence of nitromethane within the quenching sphere of action of the PAH having short decay time is proposed. Quenching behavior was found to be similar irrespective of the identity of the DES. A representative group 2 PAH, pyrene, is employed to investigate diffusion dynamics within aqueous mixtures of the two DESs. The bimolecular quenching rate constant (k{sub q}) is found to increase linearly with
Morphological study of the uncommon rectus sterni muscle in ...
African Journals Online (AJOL)
Objective: The present investigation has been designed to study the incidence of the rectus stern muscle in German human cadavers dissected in the Kingdom of Saudi Arabia, trying to find a postulation for the development of such muscle when present. Design: Gross dissection of 130 cadavers, of both sexes, was ...
14 CFR 23.529 - Hull and main float landing conditions.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float landing conditions. 23... Water Loads § 23.529 Hull and main float landing conditions. (a) Symmetrical step, bow, and stern... directed perpendicularly to the keel line. (b) Unsymmetrical landing for hull and single float seaplanes...
The Sibley Hospital Case: Trustees and Their Loyalty to the Institution.
Harpool, David
1996-01-01
Examines the case of Stern v. Sibley Memorial Hospital, in which hospital patients alleged trustees conspired to enrich themselves and financial institutions with which they were affiliated by favoring them in hospital financial dealings. Discusses two statutory approaches, those of the Revised Model Nonprofit Corporation Act and the Revised Model…
Lev Semjonovitsj Vygotskij og den kulturhistoriske psykologi
DEFF Research Database (Denmark)
Klitmøller, Jacob; Hviid, Pernille
2017-01-01
. Forfatterne legger vekt på å formidle de forskjellige retningenes forståelse av normale utviklingsforløp i vår tid, men ser det også i lys av en mer bekymringsskapende utvikling. Vi møter klassisk psykoanalyse, nyere psykoanalytiske perspektiver, tilknytningsteori, Daniel Sterns, Piagets og Vygotskijs...
Kellow, J. Thomas; Frey, Georgia C.; Sandt, Dawn Rosser
2007-01-01
This study is a conceptual replication of previous work by Storey, Stern, & Parker (1990) that examined the influence of participation in integrated vs. segregated recreation/sports activities on evaluations of a person with mental retardation by persons without a disability. The Storey et al., (1990) study observed that people with mental…
Cassandra Y. Johnson; J. Michael Bowker; H. Ken Cordell
2004-01-01
We use national-level data to test a modified version of Stern, Dietz, & Guagnano's causal model of environmental belief and behavior. We focus on ethnic variation for four environmental behaviors: environmental reading, household recycling, environmental group joining, and participation in nature-based outdoor recreation. Blacks and foreign-born Latinos were...
76 FR 35941 - Offer for Public Sale of Two High Speed Vessels
2011-06-20
... and Marine Engineering, Maritime Administration, 1200 New Jersey Avenue, SE., Washington, DC 20590.... ALAKAI Hull: Length 321.2'. Beam 78.1'. Height to Upper Deck..... 30.8'. Design Draft at Transit.. 11.67...'. Height to Upper Deck..... 30.8'. Design Draft at Transit.. 11.67'. Passengers 836'. Ramp Stern Starboard...
A classic paper on the integrated control concept appeared in the later part of the 1950’s, led by Vernon Stern, Ray Smith, Robert van den Bosch, and Kenneth Hagen. Numerous concepts and definitions were formulated at that time. In this presentation, a short philosophical summary will be presented...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
The mechanism of interaction of vincristine sulphate (VS) and rifampicin (RF) with bovine serum albumin (BSA) has been studied by quenching of BSA fluorescence by RF/VS. The Stern-Volmer plot indicates the presence of a static component in the quenching mechanism. Results also show that both the tryptophan ...
46 CFR 61.20-23 - Tailshaft clearance; bearing weardown.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Tailshaft clearance; bearing weardown. 61.20-23 Section...; bearing weardown. (a) Water lubricated bearings, other than rubber, must be rebushed as follows: (1) Where the propelling machinery is located amidship, the after stern tube bearing must be rebushed when it is...
Quantum and classical control of single photon states via a mechanical resonator
International Nuclear Information System (INIS)
Basiri-Esfahani, Sahar; Myers, Casey R; Combes, Joshua; Milburn, G J
2016-01-01
Optomechanical systems typically use light to control the quantum state of a mechanical resonator. In this paper, we propose a scheme for controlling the quantum state of light using the mechanical degree of freedom as a controlled beam splitter. Preparing the mechanical resonator in non-classical states enables an optomechanical Stern–Gerlach interferometer. When the mechanical resonator has a small coherent amplitude it acts as a quantum control, entangling the optical and mechanical degrees of freedom. As the coherent amplitude of the resonator increases, we recover single photon and two-photon interference via a classically controlled beam splitter. The visibility of the two-photon interference is particularly sensitive to coherent excitations in the mechanical resonator and this could form the basis of an optically transduced weak-force sensor. (paper)
Cordano, Mark; Welcomer, Stephanie; Scherer, Robert; Pradenas, Lorena; Parada, Victor
2010-01-01
We surveyed business students in the U. S. (n = 256) and Chile (n = 310). The survey included measures drawn from studies of pro-environmental behavior using Schwartz's norm activation theory (Schwartz, 1977), the theory of reasoned action (Ajzen & Fishbein, 1980), and a values-beliefs-norms model created by Stern, Dietz, Abel, Guagnano, and…
Cordano, Mark; Welcomer, Stephanie; Scherer, Robert F.; Pradenas, Lorena; Parada, Victor
2011-01-01
We surveyed business students in the United States (n = 256) and Chile (n = 310) to compare three theories of pro-environmental behavior.We examined Ajzen and Fishbein's theory of reasoned action, Schawartz's norm activation theory, and the values-beliefs-norms theory created by Stern, Dietz, Abel, Guagnano, and Kalof. We produced reliable…
Three Dimensional Shallow Water Adaptive Hydraulics (ADH-SW3): Waterborne Vessels
2015-10-01
Type Value Description 1 char CBOW Card type 2 int > 0 Vessel number 3 real # Ratio of vessel bow to vessel draft CSTR FRACTION OF DRAFT...APPLIED TO PSTR Field Type Value Description 1 char CSTR Card type 2 int > 0 Vessel number 3 real # Ratio of vessel stern to vessel draft PROP
The Battle of Hampton Roads: A Revolution in Military Affairs
2003-06-06
when the USS Weehawken sank while anchored in calm water, because she was overweight in the bow with ammunition. The bilge pumps in the stern were...the French Fleet, to the North America/West Indies Squadron to counter the United States Navy, to the Pacific Squadron to counter Chile and Peru , and to
2012-08-31
...,104 Center, Inc. Center. AZ Casa Sierra Vista, Casa Sierra Vista.... 600-A E 25th St...... Yuma 30 190........... 246 176,271 Senior Citizens Avenue. Housing, LTD. NM New Mexico-American La Resolana 1025 Chelwood... Corporation. OH CRS, Ltd (Stern Hendy Clifton Place........ 900 Rue De La Paix... Cincinnati 183 375,387...
46 CFR 61.20-5 - Drydock examination.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Drydock examination. 61.20-5 Section 61.20-5 Shipping... INSPECTIONS Periodic Tests of Machinery and Equipment § 61.20-5 Drydock examination. (a) When any vessel is drydocked, examination shall be made of the propeller, stern bushing, sea connection, and fastenings if...
John E. Major; Kurt H. Johnsen; Debby C. Barsi; Moira Campbell
2012-01-01
Fine and coarse root biomass, C, and N mass parameters were assessed by root size and soil depths from soil cores in plots of 32-year-old black spruce (Picea mariana (Mill.) Britton, Sterns & Poggenb.) from four full-sib families studied previously for drought tolerance and differential productivity on a dry and wet...
International Nuclear Information System (INIS)
Stern, F.
1997-01-01
The CEO of Stern Laboratories delivered a speech on the problems and challenges facing the nuclear industry. The CANDU system is looked at as the practical choice for the future of our energy source. The people of the industry must be utilized and respected to deliver to the best of their ability
Inducing Corporate Proactive Compliance: liability controls & corporate monitors
S. Oded (Sharon)
2012-01-01
textabstract“The steamship 'President Coolidge' arrived in the harbor of Honolulu August 26, 1937, and tied up at pier 8. At about the hour of 10 a.m. of that day, one Norman R. Arthur, a harbor patrol boatman under the United States District Engineer, was passing under the stern of the
African Journals Online (AJOL)
ebutamanya
3 juil. 2015 ... 7. Teitel AD, MacKenzie CR, Stern R, Paget SA. Laryngeal involvement in systemic lupus erythematosus. Semin Arthritis. Rheum. 1992; 22(3):203-14. PubMed | Google Scholar. 8. Azzabi S, Znagui Z, Ben Hassine L, Cherif E, Kooli C, Kaouech. Z, Khalfallah N. Laryngeal involvements in systemic lupus.
Energy Technology Data Exchange (ETDEWEB)
Stern, F. [Stern Laboratories (Canada)
1997-07-01
The CEO of Stern Laboratories delivered a speech on the problems and challenges facing the nuclear industry. The CANDU system is looked at as the practical choice for the future of our energy source. The people of the industry must be utilized and respected to deliver to the best of their ability.
2010-09-24
... Navy, 1322 Patterson Ave., SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone number: 202...: Rule 21(a) pertaining to the arc of visibility of a masthead light. The DAJAG (Admiralty and Maritime... lights arc Side lights Stern light inboard of distance light, relation-ship of aft Vessel No. of arc of...
Energy Technology Data Exchange (ETDEWEB)
Ridley, Mora K. [Texas Tech University, Lubbock; Hiemstra, T [Oak Ridge National Laboratory (ORNL); Van Riemsdijk, Willem H. [Wageningen University and Research Centre, The Netherlands; Machesky, Michael L. [Illinois State Water Survey, Champaign, IL
2009-01-01
Acid base reactivity and ion-interaction between mineral surfaces and aqueous solutions is most frequently investigated at the macroscopic scale as a function of pH. Experimental data are then rationalized by a variety of surface complexation models. These models are thermodynamically based which in principle does not require a molecular picture. The models are typically calibrated to relatively simple solid-electrolyte solution pairs and may provide poor descriptions of complex multicomponent mineral aqueous solutions, including those found in natural environments. Surface complexation models may be improved by incorporating molecular-scale surface structural information to constrain the modeling efforts. Here, we apply a concise, molecularly-constrained surface complexation model to a diverse suite of surface titration data for rutile and thereby begin to address the complexity of multi-component systems. Primary surface charging curves in NaCl, KCl, and RbCl electrolyte media were fit simultaneously using a charge distribution (CD) and multisite complexation (MUSIC) model [Hiemstra T. and Van Riemsdijk W. H. (1996) A surface structural approach to ion adsorption: the charge distribution (CD) model. J. Colloid Interf. Sci. 179, 488 508], coupled with a Basic Stern layer description of the electric double layer. In addition, data for the specific interaction of Ca2+ and Sr2+ with rutile, in NaCl and RbCl media, were modeled. In recent developments, spectroscopy, quantum calculations, and molecular simulations have shown that electrolyte and divalent cations are principally adsorbed in various inner-sphere configurations on the rutile 110 surface [Zhang Z., Fenter P., Cheng L., Sturchio N. C., Bedzyk M. J., Pr edota M., Bandura A., Kubicki J., Lvov S. N., Cummings P. T., Chialvo A. A., Ridley M. K., Be ne zeth P., Anovitz L., Palmer D. A., Machesky M. L. and Wesolowski D. J. (2004) Ion adsorption at the rutile water interface: linking molecular and macroscopic
Ridley, Moira K.; Hiemstra, Tjisse; van Riemsdijk, Willem H.; Machesky, Michael L.
2009-04-01
Acid-base reactivity and ion-interaction between mineral surfaces and aqueous solutions is most frequently investigated at the macroscopic scale as a function of pH. Experimental data are then rationalized by a variety of surface complexation models. These models are thermodynamically based which in principle does not require a molecular picture. The models are typically calibrated to relatively simple solid-electrolyte solution pairs and may provide poor descriptions of complex multi-component mineral-aqueous solutions, including those found in natural environments. Surface complexation models may be improved by incorporating molecular-scale surface structural information to constrain the modeling efforts. Here, we apply a concise, molecularly-constrained surface complexation model to a diverse suite of surface titration data for rutile and thereby begin to address the complexity of multi-component systems. Primary surface charging curves in NaCl, KCl, and RbCl electrolyte media were fit simultaneously using a charge distribution (CD) and multisite complexation (MUSIC) model [Hiemstra T. and Van Riemsdijk W. H. (1996) A surface structural approach to ion adsorption: the charge distribution (CD) model. J. Colloid Interf. Sci. 179, 488-508], coupled with a Basic Stern layer description of the electric double layer. In addition, data for the specific interaction of Ca 2+ and Sr 2+ with rutile, in NaCl and RbCl media, were modeled. In recent developments, spectroscopy, quantum calculations, and molecular simulations have shown that electrolyte and divalent cations are principally adsorbed in various inner-sphere configurations on the rutile 1 1 0 surface [Zhang Z., Fenter P., Cheng L., Sturchio N. C., Bedzyk M. J., Předota M., Bandura A., Kubicki J., Lvov S. N., Cummings P. T., Chialvo A. A., Ridley M. K., Bénézeth P., Anovitz L., Palmer D. A., Machesky M. L. and Wesolowski D. J. (2004) Ion adsorption at the rutile-water interface: linking molecular and macroscopic
The role of SO{sub 4}{sup 2−} surface distribution in arsenic removal by iron oxy-hydroxides
Energy Technology Data Exchange (ETDEWEB)
Tresintsi, S. [Analytical Chemistry Laboratory, Department of Chemical Engineering, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Simeonidis, K., E-mail: ksime@physics.auth.gr [Analytical Chemistry Laboratory, Department of Chemical Engineering, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Department of Mechanical Engineering, University of Thessaly, 38334 Volos (Greece); Pliatsikas, N.; Vourlias, G.; Patsalas, P. [Laboratory of Applied Physics, Department of Physics, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Mitrakas, M. [Analytical Chemistry Laboratory, Department of Chemical Engineering, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece)
2014-05-01
This study investigates the contribution of chemisorbed SO{sub 4}{sup 2−} in improving arsenic removal properties of iron oxy-hydroxides through an ion-exchange mechanism. An analytical methodology was developed for the accurate quantification of sulfate ion (SO{sub 4}{sup 2−}) distribution onto the surface and structural compartments of iron oxy-hydroxides synthesized by FeSO{sub 4} precipitation. The procedure is based on the sequential determination of SO{sub 4}{sup 2−} presence in the diffuse and Stern layers, and the structure of these materials as defined by the sulfate-rich environments during the reaction and the variation in acidity (pH 3–12). Physically sorbed SO{sub 4}{sup 2−}, extracted in distilled water, and physically/chemically adsorbed ions on the oxy-hydroxide's surface leached by a 5 mM NaOH solution, were determined using ion chromatography. Total sulfate content was gravimetrically measured by precipitation as BaSO{sub 4}. To validate the suggested method, results were verified by X-ray photoelectron and Fourier-transformed infrared spectroscopy. Results showed that low precipitation pH-values favor the incorporation of sulfate ions into the structure and the inner double layer, while under alkaline conditions ions shift to the diffuse layer. - Graphical abstract: An analytical methodology for the accurate quantification of sulfate ions (SO{sub 4}{sup 2−}) distribution onto the diffuse layer, the Stern layer and the structure of iron oxy-hydroxides used as arsenic removal agents. - Highlights: • Quantification of sulfate ions presence in FeOOH surface compartments. • Preparation pH defines the distribution of sulfates. • XPS and FTIR verify the presence of SO{sub 4}{sup 2−} in the structure, the Stern layer the diffuse layer of FeOOH. • Chemically adsorbed sulfates control the arsenic removal efficiency of iron oxyhydroxides.
Applications of Universal Grammar (UG) in the ESL/EFL Classroom
Kirkwold, Lorne O.
2007-01-01
The article proposes Stern's (1983) framework for classifying issues related to instruction in order to ascertain the relevance of Universal Grammar (UG) in the ESL/EFL classroom. Discussed in this article, particularly as UG pertains to them, are issues related to: (a) L1 transfer; (b) teaching rules and giving error correction versus presenting…
Ng, Daniel; Supaporn, Potibut
A study investigated the trend of current U.S. television commercial informativeness by comparing the results with Alan Resnik and Bruce Stern's previous benchmark study conducted in 1977. A systematic random sampling procedure was used to select viewing dates and times of commercials from the three national networks. Ultimately, a total of 550…
Reduced Order Modeling Methods for Turbomachinery Design
2009-03-01
and Ma- terials Conference, May 2006. [45] A. Gelman , J. B. Carlin, H. S. Stern, and D. B. Rubin, Bayesian Data Analysis. New York, NY: Chapman I& Hall...Macian- Juan , and R. Chawla, “A statistical methodology for quantif ca- tion of uncertainty in best estimate code physical models,” Annals of Nuclear En
DEFF Research Database (Denmark)
Roesgaard, Marie Højlund
2017-01-01
Chiro og Heksene, mange ved at manga er japanske tegneserier, Nationalmuseet laver udstilling om cosplay og opstiller en purikura-maskine, der kan lave billeder af gæsterne i nuttede, storøjede udgaver – så jo, Japan er synlig i Danmark. Mindre kendt er det, at Japan og Danmark allerede under Christian...
A Comparative Analysis of Word Problems in Selected United States and Russian First Grade Textbooks
Grishchenko, Svetlana
2009-01-01
The purpose of this study was to explore word problems as a subject matter in mathematics textbook curricula. The motivation for the study derived from the following evidence: (a) American students find some word problems are more difficult than others (Garcia, Jimenez, & Hess, 2006; Riley & Green, 1988; Stern, 2001), and (b) one of the…
Robinson, Alan G.; And Others
1995-01-01
Robinson and Stern describe the Management Training Program introduced by the U.S. Air Force in postwar Japan and its effect on Japanese industry. Roberts compares it with U.S. Training within Industries. Umetani comments that the discussion would have been more convincing had its relationship with other Japanese training programs been addressed.…
Directory of Open Access Journals (Sweden)
Hyoung Tae Kim
2016-01-01
Full Text Available The moderator system of CANDU, a prototype of PHWR (pressurized heavy-water reactor, has been modeled in multidimension for the computation based on CFD (computational fluid dynamics technique. Three CFD codes are tested in modeled hydrothermal systems of heavy-water reactors. Commercial codes, COMSOL Multiphysics and ANSYS-CFX with OpenFOAM, an open-source code, are introduced for the various simplified and practical problems. All the implemented computational codes are tested for a benchmark problem of STERN laboratory experiment with a precise modeling of tubes, compared with each other as well as the measured data and a porous model based on the experimental correlation of pressure drop. Also the effect of turbulence model is discussed for these low Reynolds number flows. As a result, they are shown to be successful for the analysis of three-dimensional numerical models related to the calandria system of CANDU reactors.
Directory of Open Access Journals (Sweden)
Junfang Xu
2018-05-01
Full Text Available ‘The Life and Opinions of Tristram Shandy, Gentleman’ (hereafter shortened to “Tristram Shandy” is a unique novel written by British author Laurence Sterne in the eighteenth century. While Sterne’s contemporary readers may have conflicting viewpoints about the artistic value of “Tristram Shandy” because of its surface artlessness and chaos, readers today in the contexts of such twentieth-century critical theories as postmodernism, existentialism, and deconstruction, find it congenial and more intriguing. I argue that despite the apparent chaos of this novel, the author-narrator Tristram is a central consciousness that holds the whole work together. And I believe Sterne narrates his story in such a peculiar way in conformity to his own perception of the outside world. Specifically, this paper aims to explore the inventive narrative strategies employed in Sterne’s “Tristram Shandy” in the three aspects of narrative structure, time-shifting technique and self-conscious narrator. Amazingly, “Tristram Shandy” presents a wholly new notion of creative writing, one that goes beyond its time, and has unbreakable connection with twentieth-century literature.
Water Pressure Distribution on a Twin-Float Seaplane
Thompson, F L
1930-01-01
This is the second of a series of investigations to determine water pressure distribution on various types of seaplane floats and hulls, and was conducted on a twin-float seaplane. It consisted of measuring water pressures and accelerations on a TS-1 seaplane during numerous landing and taxiing maneuvers at various speeds and angles. The results show that water pressures as great as 10 lbs. per sq. in.may occur at the step in various maneuvers and that pressures of approximately the same magnitude occur at the stern and near the bow in hard pancake landings with the stern way down. At the other parts of the float the pressures are less and are usually zero or slightly negative for some distance abaft the step. A maximum negative pressure of 0.87 lb. Per square inch was measured immediately abaft the step. The maximum positive pressures have a duration of approximately one-twentieth to one-hundredth second at any given location and are distributed over a very limited area at any particular instant.
Energy Technology Data Exchange (ETDEWEB)
Bhattar, S.L.; Kolekar, G.B. [Fluorescence Spectroscopy Research Laboratory, Department of Chemistry, Shivaji University, Kolhapur-416 004, Maharashtra (India); Patil, S.R., E-mail: srp_fsl@rediffmail.co [Fluorescence Spectroscopy Research Laboratory, Department of Chemistry, Shivaji University, Kolhapur-416 004, Maharashtra (India)
2010-03-15
The interaction between salicylic acid (SA) and riboflavin (RF) was studied by Fluorescence Resonance Energy Transfer (FRET) in micellar solution. The riboflavin strongly quenches the intrinsic fluorescence of SA by radiative energy transfer. The extent of energy transfer in sodium dodecyl sulphate (SDS) micellar solution of different concentration is quantified from the energy transfer efficiency data. It is seen that the energy transfer is more efficient in the micellar solution. The critical energy transfer distance (R{sub 0}) was determined from which the mean distance between SA and RF molecules was calculated. The quenching was found to fit into Stern-Volmer relation. The results on variation of Stern-Volmer constant (K{sub sv}) with quencher concentration obtained at different temperatures suggested the formation of complex between SA and RF. The association constant of complex formation was estimated and found to decrease with temperature. The values of thermodynamic parameters DELTAH, DELTAG and DELTAS at different temperatures were estimated and the results indicated that the molecular interaction between SA and RF is electrostatic in nature.
Energy Technology Data Exchange (ETDEWEB)
Tamazian, Artur [School of Economics and Business Administration, University of Santiago de Compostela (Spain); Bhaskara Rao, B. [School of Economics and Finance, University of Western Sydney, Sydney (Australia)
2010-01-15
Several studies have examined the relationship between environmental degradation and economic growth. However, most of them did not take into account financial developments and institutional quality. Moreover, Stern [Stern, D., 2004. The rise and fall of the environmental Kuznets curve. World Development 32(8): 1419-1439.] noted that there are important econometric weaknesses in the earlier studies, such as endogeneity, heteroscedasticity, omitted variables, etc. The purpose of this paper is to fill this gap in the literature by investigating the linkage between not only economic development and environmental quality but also financial development and institutional quality. We employ the standard reduced-form modelling approach to control for country-specific unobserved heterogeneity and GMM estimation to control for endogeneity. Our study considers 24 transition economies and panel data for 1993-2004. Our results support the EKC hypothesis while confirming the importance of both institutional quality and financial development for environmental performance. We also found that financial liberalization may be harmful for environmental quality if it is not accomplished in a strong institutional framework. (author)
Flow analysis of new type propulsion system for UV’s
Eimanis, M.; Auzins, J.
2017-10-01
This paper presents an original design of an autonomous underwater vehicle where thrust force is created by the helicoidal shape of the hull rather than screw propellers. Propulsion force is created by counter-rotating bow and stern parts. The middle part of the vehicle has the function of a cargo compartment containing all control mechanisms and communications. It’s made of elastic material, containing a Cardan-joint mechanism, which allows changing the direction of vehicle, actuated by bending drives. A bending drive velocity control algorithm for the automatic control of vehicle movement direction is proposed. The dynamics of AUV are simulated using multibody simulation software MSC Adams. For the simulation of water resistance forces and torques the surrogate polynomial metamodels are created on the basis of computer experiments with CFD software. For flow interaction with model geometry the simplified vehicle model is submerged in fluid medium using special CFD software, with the same idea used in wind tunnel experiments. The simulation results are compared with measurements of the AUV prototype, created at Institute of Mechanics of Riga Technical University. Experiments with the prototype showed good agreement with simulation results and confirmed the effectiveness and the future potential of the proposed principle.
Erzherzog Ferdinand II., Astrologie und das Lustschloss Hvězda (Stern)
Czech Academy of Sciences Publication Activity Database
Purš, Ivo
-, č. 14 (2014), s. 15-29 ISSN 1213-5372 Institutional support: RVO:68378033 Keywords : astrology * iconography * archduke Ferdinand of Tirol * Star (Hvězda) villa Subject RIV: AL - Art, Architecture, Cultural Heritage
Hetero-interaction between Gouy-Stern double layers : charge and potential regulation
Lyklema, J.; Duval, J.F.L.
2005-01-01
This issue of Advances is devoted to the memory of Hans-Joachim Schulze who, before his untimely death, made substantial contributions in the domains of flotation, wetting and particle interaction, often under adverse working conditions. Many of his publications involve hetero-interaction between
Changes in plasma membrane structure upon irradiation on thymocytes
International Nuclear Information System (INIS)
Dreval', V.I.
1993-01-01
Thymocytes were irradiated with doses of 4 to 10 4 Gy. The binding of 1-anilinonaphtalene-8-sulphonate and Ca 2+ to plasma membranes; viscosity and lipid peroxidation; Stern-Folmer constant; and the number of Sh-groups of membrane proteins were determined. The structural changes in plasma membranes after irradiation of thymocytes were found to be cooperative
Literary Origins of the Term "School Psychologist" Revisited
Fagan, Thomas K.
2005-01-01
Previous research on the literary origins of the term "school psychologist" is revisited, and conclusions are revised in light of new evidence. It appears that the origin of the term in the American literature occurred as early as 1898 in an article by Hugo Munsterberg, predating the usage by Wilhelm Stern in 1911. The early references to the…
Response to crop-tree release by 7-year-old stems of yellow-poplar and black cherry
G.R. Jr. Trimble; G.R. Jr. Trimble
1973-01-01
Five years after crop-tree release of yellow-poplar and black cherry sterns in a 7-year-old stand of Appalachian hardwoods, measurements indicated that released trees were but slightly superior to control trees in height, diameter, and crown position. Sprout regrowth of cut tree stems and grapevines had largely nullified the effects of release. Indications are that for...
Postnatal growth, age estimation and development of foraging ...
Indian Academy of Sciences (India)
Unknown
growth after the first year (Kunz and Stern 1995). The values of the lengths of forearm and epiphyseal gap dur- ing their linear phases of growth increased during the preflight period and decreased during the postflight period, and were reliable for deriving equations to esti- mate the age of young bats (e.g. Kunz and Robson ...
50 CFR 665.815 - Pelagic longline seabird mitigation measures.
2010-10-01
... stern of the vessel; (ii) The mainline and branch lines must be set from the port or the starboard side... (v) Feathers are dry. (9) Any seabird that is released in accordance with paragraph (b)(8) of this... immediately upon the vessel's return to port. Do not give the bird food or water; and (11) Complete the short...
Improved Robustness and Efficiency for Automatic Visual Site Monitoring
2009-09-01
detection from a moving vehicle. In ECCV, pages 37–49, 2000. 36, 91, 158 [37] Andrew Gelman , John B. Carlin, Hal S. Stern, and Donald B. Rubin. Bayesian Data...luggage items in a public space. In PETS Workshop, pages 75–82. IEEE, 2006. 180, 192 [98] Juan Soulie. C++ language tutorial: Arrays. World Wide Web
Lexicography, Terminography and Copyright
African Journals Online (AJOL)
stern from the very nature of a dictionary as a specific kind of intellectual pro- perty type, because of ... --The most important convention that binds us today, is still the Berne Con- ention, as ..... These units or data element categories are described ... terminologist to use these terms as well as their definitions to a large extent.
International Nuclear Information System (INIS)
Gerlach, Robin
2005-01-01
This project report addresses one part of a 3-way collaboration between researchers (Drs. Robin Gerlach and Al Cunningham) at Montana State University's (MSU's) Center for Biofilm Engineering (CBE), (Dr. Brent Peyton at) the WSU/NSF IGERT Center for Multiphase Environmental Research (CMER) at Washington State University (WSU), and (Drs. William Apel and Frank Roberto at) the Biotechnology Department at the INEEL. Each part of this project is funded under a different contract with the Science Division of the US Department of Energy. The project is designed to evaluate the possibility to develop a subsurface remediation technology for mixed wastes at Department of Energy sites using a group of common soil bacteria of the genus Cellulomonas. We are seeking to gain a better understanding of microbial transformation of chromium, uranium, and carbon tetrachloride by Cellulomonas spp. in simulated subsurface environments
Data acquisition. GRAAL experiment. Hybrid reactor experiment. AMS experiment
International Nuclear Information System (INIS)
Barancourt, D.; Barbier, G.; Bosson, G.; Bouvier, J.; Gallin-Martel, L.; Meillon, B.; Stassi, P.; Tournier, M.
1997-01-01
The main activity of the data acquisition team has consisted in hardware and software developments for the GRAAL experiment with the trigger board, for the 'Reacteurs Hybrides' group with an acquisition board ADCVME8V and for the AMS experiment with the monitoring of the aerogel detector. (authors)
A subchannel based annular flow dryout model
International Nuclear Information System (INIS)
Hammouda, Najmeddine; Cheng, Zhong; Rao, Yanfei F.
2016-01-01
Highlights: • A modified annular flow dryout model for subchannel thermalhydraulic analysis. • Implementation of the model in Canadian subchannel code ASSERT-PV. • Assessment of the model against tube CHF experiments. • Assessment of the model against CANDU-bundle CHF experiments. - Abstract: This paper assesses a popular tube-based mechanistic critical heat flux model (Hewitt and Govan’s annular flow model (based on the model of Whalley et al.), and modifies and implements the model for bundle geometries. It describes the results of the ASSERT subchannel code predictions using the modified model, as applied to a single tube and the 28-element, 37-element and 43-element (CANFLEX) CANDU bundles. A quantitative comparison between the model predictions and experimental data indicates good agreement for a wide range of flow conditions. The comparison has resulted in an overall average error of −0.15% and an overall root-mean-square error of 5.46% with tube data representing annular film dryout type critical heat flux, and in an overall average error of −0.9% and an overall RMS error of 9.9% with Stern Laboratories’ CANDU-bundle data.
Mabilia, Diana
2015-01-01
The present research proposes the analysis of specific aspects of psychosocial functioning and development with a focus on issues related to internalizing symptoms, attachment styles and interpersonal dimensions of interpersonal functioning. Developmental theories emphasized the importance of transitions, as periods of biologically and socially characterized changes (Arnett, 1997; Gurevitz Stern, 2004; Schulenberg, Magges, Hurrelmann, 1997; Schulenberg & Zarrett, 2006). The development...
International Nuclear Information System (INIS)
Sidhu, M.S.; Bhatia, P.V.K.
1994-01-01
The presence of heterocyclic compounds triggers off a competition between photophysical and photochemical annihilation of excited uranyl ion during its photochemical reduction with triphenylphosphine. This competition is used to measure Stern-Volmer constant using UV visible spectrophotometer for quenching the uranyl ion luminescence with a number of heterocyclic molecules viz., pyridine, thiophene bipyridyl, tetrahydrofuran and piperidine. (author). 7 refs., 2 figs., 1 tab
Directory of Open Access Journals (Sweden)
John Wilkes
1997-11-01
Full Text Available Few ancient Greek place names are so embedded in Western consciousness as Sparta, evoking as it does courage, harsh training, stern duty and endurance. By the 2nd century AD it had become a "heritage centre " admired by visiting Romans, and it flourished again in the Byzantine period. The Institute has been involved in new excavations at Sparta since 1989.
Invited Lectures from a Spatial Orientation Symposium in Honor of Frederick Guedry, Day 2
2015-11-10
physically in the right spot, and then as you load it, the Achilles tendon and patella tendon shift and cause the knee and the ankle to support your body...Princeton, he kicked the back of the stern anchor off and he got caught in the cable, and so he was severely injured and we got him back on board. And
International Nuclear Information System (INIS)
Moll, H.; Geipel, G.; Bernhard, G.; Fanghaenel, Th.; Grenthe, I.
2002-01-01
We observed a very strong quenching of the U(VI) fluorescence in these systems that can be quantitatively described by the Stern-Volmer equation. The following stability constants were determined: a) for the glycolate system log β 1:1 = 2.52±0.20, b) for the α-hydroxyisobutyrate system log β 1:1 = 3.40±0.21. (orig.)
International Nuclear Information System (INIS)
Mirbach, M.
1975-01-01
Based on spectroscopic and kinetic measurements the influence of high pressure on some selected photochemical cycloaddition-reactions is studied. The photo-cycloaddition-reaction of maleic acid anhydride with ethylen has been performed under high ethylen pressures ( 90%). Surprisingly the quantum yield of the cyclo aduct decreases with increasing ethylene pressure from PHI = 0.06 at p = 1 bar to PHI = 0.022 at p = 42 bar. Based on Stern-Volmer quenching experiments, the decrease in ring formation with increasing ethylene concentrations could be explained by an endoergic triplet energy transfer from maleic acid anhydride to ethylene. The type II dissociation of butyrophenone has been quenched also with ethylene. With a lifetime for the first excited butyrophenone triplett state of tau = 6.8 x 10 -8 sec, obtained from kinetic data, the velocity constant can be calculated for this reaction with the result k 5 = 3 x 10 6 M -1 sec -1 . (orig./HK) [de
Andersen, Mathias Bækbo; Frey, Jared; Pennathur, Sumita; Bruus, Henrik
2011-01-01
We present a combined theoretical and experimental analysis of the solid-liquid interface of fused-silica nanofabricated channels with and without a hydrophilic 3-cyanopropyldimethylchlorosilane (cyanosilane) coating. We develop a model that relaxes the assumption that the surface parameters C(1), C(2), and pK(+) are constant and independent of surface composition. Our theoretical model consists of three parts: (i) a chemical equilibrium model of the bare or coated wall, (ii) a chemical equilibrium model of the buffered bulk electrolyte, and (iii) a self-consistent Gouy-Chapman-Stern triple-layer model of the electrochemical double layer coupling these two equilibrium models. To validate our model, we used both pH-sensitive dye-based capillary filling experiments as well as electro-osmotic current-monitoring measurements. Using our model we predict the dependence of ζ potential, surface charge density, and capillary filling length ratio on ionic strength for different surface compositions, which can be difficult to achieve otherwise. Copyright © 2010 Elsevier Inc. All rights reserved.
The Experiment Factory: standardizing behavioral experiments
Directory of Open Access Journals (Sweden)
Vanessa V Sochat
2016-04-01
Full Text Available The administration of behavioral and experimental paradigms for psychology research is hindered by lack of a coordinated effort to develop and deploy standardized paradigms. While several frameworks (de Leeuw (2015; McDonnell et al. (2012; Mason and Suri (2011; Lange et al. (2015 have provided infrastructure and methods for individual research groups to develop paradigms, missing is a coordinated effort to develop paradigms linked with a system to easily deploy them. This disorganization leads to redundancy in development, divergent implementations of conceptually identical tasks, disorganized and error-prone code lacking documentation, and difficulty in replication. The ongoing reproducibility crisis in psychology and neuroscience research (Baker (2015; Open Science Collaboration (2015 highlights the urgency of this challenge: reproducible research in behavioral psychology is conditional on deployment of equivalent experiments. A large, accessible repository of experiments for researchers to develop collaboratively is most efficiently accomplished through an open source framework. Here we present the Experiment Factory, an open source framework for the development and deployment of web-based experiments. The modular infrastructure includes experiments, virtual machines for local or cloud deployment, and an application to drive these components and provide developers with functions and tools for further extension. We release this infrastructure with a deployment (http://www.expfactory.org that researchers are currently using to run a set of over 80 standardized web-based experiments on Amazon Mechanical Turk. By providing open source tools for both deployment and development, this novel infrastructure holds promise to bring reproducibility to the administration of experiments, and accelerate scientific progress by providing a shared community resource of psychological paradigms.
Can outstanding research be done under less than ideal conditions?
Directory of Open Access Journals (Sweden)
Igić Rajko
2004-01-01
Full Text Available Great scientific discoveries rarely originate from small and poor countries. However, the lives and achievements of three Yugoslav scientists who were active in the biomedical sciences, Laza K. Lazarević (1851-1891, Ivan Djaja (1884-1957, and Pavao Stern (1913-1976, serve as an example of success in this environment. These scientists, as well as the majority of other successful investigators in small and poor countries, were trained in foreign and developed countries and, upon return, were given the freedom to start a self dependent research program. They overcame many obstacles, including wars and civil unrests, to contribute significantly to certain medical fields. It is interesting that although a Jew, Stern was allowed to work during the World War II in Zagreb, which became capital of the so-called Independent State of Croatia, a puppet state under German control. Perhaps his good name among pharmacologists helped him to keep position during this tough period. Nowadays, new technologies requiring for biomedical research are rather expensive, and poor countries cannot afford to finance many scientists. Thus, selection of the most productive researchers is the challenge for those who finance scientific work.
Atomistic Molecular Dynamics Simulations of the Electrical Double
Li, Zifeng; Milner, Scott; Fichthorn, Kristen
2015-03-01
The electrical double layer (EDL) near the polymer/water interface plays a key role in the colloidal stability of latex paint. To elucidate the structure of the EDL at the molecular level, we conducted an all-atom molecular dynamics simulations. We studied two representative surface charge groups in latex, the ionic surfactant sodium dodecyl sulfate (SDS) and the grafted short polyelectrolyte charged by dissociated methyl methacrylic acid (MAA) monomers. Our results confirm that the Poisson-Boltzmann theory works well outside the Stern layer. Our calculated electrostatic potential at the Outer Helmholtz Plane (OHP) is close to the zeta potential measured experimentally, which suggests that the potential at the OHP is a good estimate of the zeta potential. We found that the position of the OHP for the MAA polyelectrolyte system extends much further into the aqueous phase than that in the SDS system, resulting in a Stern layer that is twice as thick. This model will allow for future investigations of the interactions of the surface with different surfactants and rheology modifiers, which may serve as a guide to tune the rheology of latex formulations. We thank Dow Chemical Company for financial support.
2010-01-01
UAV Autonomy program which includes intelligent reasoning for autonomy, technologies to enhance see and avoid capabilities, object identification ...along the ship’s base recovery course (BRC). The pilot then flies toward the stern of the ship, aligning his approach path with the ship’s lineup line...quiescent point identification . CONCLUSIONS The primary goal for conducting dynamic interface analysis is to expand existing operating envelopes and
Report of Freshwater Mollusks Workshop 19-20 May 1981.
1982-05-01
RELOCATION OF LAMPSILIS HIGGINSI IN THE UPPER MISSISSIPPI RIVER ....... ....................... 104 David Nelson HIGGINS ’ EYE MUSSEL RECOVERY PLAN...0830 The Higgins ’ Eye Mussel Recovery Team - Dr. Edward Stern, University of Wisconsin Dealing with Endangered Mollusks at Corps of Engineers District...typically dark yellowish-brown to brown in color. Quadrula stapes appears to be most closely related to Q. intermedia which is endemic to the Tennessee
DEFF Research Database (Denmark)
Jensen, J. P.; Søndergaard, M.; Jeppesen, E.
små cladoceer og hjuldyr, og især er maksimumsforekom-sterne af calanoide vandlopper og de små og store cladoceer og daf-nier gået tilbage. Den gennemsnitlige biomasse af dafnier er derimod øget især p.g.a. stigning i de 25 % af søerne med størst forekomster. Dyreplanktons græsning Betragtet under et...
International Nuclear Information System (INIS)
Schymura, Michael
2013-01-01
The evaluation of long-term effects of climate change in cost-benefit analysis has a long tradition in environmental economics. Since the publication of the ''Stern Review'' in 2006, the debate about the impacts of climate change on the economy and how to compare cost and benefits with each other was revived. The assessment of climate change mitigation policies mainly depends on three not mutually exclusive decisions: First, the discount rate chosen, since costs are incurred today and long-term benefits occur in the future. Second, the uncertainties related to the problem of climate change. This debate was spurred by the literature surrounding Martin Weitzman's ''dismal theorem'', stating that the unknown unknowns could be too large for cost-benefit analysis of long-term climate policy measures. And third, the treatment of technological change in economic models of climate policy. This dissertation contributes to all three mentioned aspects and consists of two interrelated parts. First, I discuss norms, economic welfare criteria, and catastrophic risks in the context of climate change. This first part is closely bound to a discussion of the Stern Review. The second part of the dissertation deals with technological change in its various dimensions and addresses several questions: How is technological change taken into consideration in large-scale environment-economy models? How do certain inputs substitute each other? And how does technology affect energy intensity, a key parameter for meeting targets set by climate policy? Alongside these questions, I also discuss how the production of knowledge takes place in an environmental and resource economics framework and how knowledge production patterns have changed during previous decades. While the first part is of theoretical nature, the second part is mainly empirical. Summing up, I suggest approaches towards long-term evaluation of climate policies and how some methodological drawbacks of the ''Stern Review'' could
Das, Siddhartha; Chakraborty, Suman
2010-07-06
In this article, we investigate the implications of ionic conductivity variations within the electrical double layer (EDL) on the streaming potential estimation in pressure-driven fluidic transport through narrow confinements. Unlike the traditional considerations, we do not affix the ionic conductivities apriori by employing preset values of dimensionless parameters (such as the Dukhin number) to estimate the streaming potential. Rather, utilizing the Gouy-Chapman-Grahame model for estimating the electric potential and charge density distribution within the Stern layer, we first quantify the Stern layer electrical conductivity as a function of the zeta potential and other pertinent parameters quantifying the interaction of the ionic species with the charged surface. Next, by invoking the Boltzmann model for cationic and anionic distribution within the diffuse layer, we obtain the diffuse layer electrical conductivity. On the basis of these two different conductivities pertaining to the two different portions of the EDL as well as the bulk conductivity, we define two separate Dukhin numbers that turn out to be functions of the dimensionless zeta potential and the channel height to Debye length ratio. We derive analytical expressions for the streaming potential as a function of the fundamental governing parameters, considering the above. The results reveal interesting and significant deviations between the streaming potential predictions from the present considerations against the corresponding predictions from the classical considerations in which electrochemically consistent estimates of variable EDL conductivity are not traditionally accounted for. In particular, it is revealed that the variations of streaming potential with zeta potential are primarily determined by the competing effects of EDL electromigration and ionic advection. Over low and high zeta potential regimes, the Stern layer and diffuse layer conductivities predominantly dictate the streaming
Buitenhuis, Johan
2012-09-18
The electrophoretic mobility of rodlike fd viruses is measured and compared to theory, with the theoretical calculations performed according to Stigter (Stigter, D. Charged Colloidal Cylinder with a Gouy Double-Layer. J. Colloid Interface Sci. 1975, 53, 296-306. Stigter, D. Electrophoresis of Highly Charged Colloidal Cylinders in Univalent Salt- Solutions. 1. Mobility in Transverse Field. J. Phys. Chem. 1978, 82, 1417-1423. Stigter, D. Electrophoresis of Highly Charged Colloidal Cylinders in Univalent Salt Solutions. 2. Random Orientation in External Field and Application to Polyelectrolytes. J. Phys. Chem. 1978, 82, 1424-1429. Stigter, D. Theory of Conductance of Colloidal Electrolytes in Univalent Salt Solutions. J. Phys. Chem. 1979, 83, 1663-1670), who describes the electrophoretic mobility of infinite cylinders including relaxation effects. Using the dissociation constants of the ionizable groups on the surfaces of the fd viruses, we can calculate the mobility without any adjustable parameter (apart from the possible Stern layer thickness). In addition, the approximation in the theoretical description of Stigter (and others) of using a model of infinitely long cylinders, which consequently is independent of the aspect ratio, is examined by performing more elaborate numerical calculations for finite cylinders. It is shown that, although the electrophoretic mobility of cylindrical particles in the limit of low ionic strength depends on the aspect ratio much more than "end effects", at moderate and high ionic strengths the finite and infinite cylinder models differ only to a degree that can be attributed to end effects. Furthermore, the range of validity of the Stokes regime is systematically calculated.
Cerdà, A.
2009-04-01
The session on "Soil erosion and sediment control with vegetation and bioengineering on severely eroded terrain" pays special attention to the severe soil erosion suffered on steep slopes and erodible parent materials and soils. Within the last 20 years, in the Mediterranean lands, the citrus orchards were reallocated on steep slopes due to the urban development and better climatic and management conditions of the new plantations. The lack of vegetation cover on the new slope plantations of citrus resulted in high erosion rates. Those non-sustainable soil losses were measured by means of rainfall simulation experiments, Gerlach collectors, geomorphological transect and topographical measurements. The October 2007 and October 2008 rainy periods resulted in sheet, rill and gully erosion. Some recently planted orchards (2005) had the first pruning season in 2008. The pruned chipped branches reduced the soil losses to 50 % of the expected, although the litter (pruned branches) covered 4.67 % of the soil. This is why a research was developed by means of simulated rainfall experiments to determine the vegetation cover (litter, mainly leaves) to protect the soil to reach a sustainable erosion rate. Rainfall simulation experiments at 43 mm h-1 where performed on 1 m2 plots covered with 0, 3, 7, 15, 30, 45, 60, 80 and 100 % litter cover (pruned chipped branches) to determine the sustainable litter cover to avoid the soil losses. The results show that more that 45 % litter cover almost reduces the soil losses to negligible rates. The results confirm that 4 % of vegetation cover reduces the soil losses to 50 %. Key words: Agriculture land, erodible terrain, land management, citrus, erosion, Spain, Valencia, herbicides. Acknowledgements, We thanks the financial support of the Ministerio de Ciencia e Innovación by means of the project CGL2008-02879/BTE, "PERDIDA DE SUELO EN NUEVAS EXPLOTACIONES CITRICOLAS EN PENDIENTE. ESTRATEGIAS PARA EL CONTROL DE LA EROSION HIDRICA"
International Nuclear Information System (INIS)
Duffa, Céline; Bailly du Bois, Pascal; Caillaud, Matthieu; Charmasson, Sabine; Couvez, Céline; Didier, Damien; Dumas, Franck; Fievet, Bruno; Morillon, Mehdi; Renaud, Philippe
2016-01-01
The Fukushima nuclear accident resulted in the largest ever accidental release of artificial radionuclides in coastal waters. This accident has shown the importance of marine assessment capabilities for emergency response and the need to develop tools for adequately predicting the evolution and potential impact of radioactive releases to the marine environment. The French Institute for Radiological Protection and Nuclear Safety (IRSN) equips its emergency response centre with operational tools to assist experts and decision makers in the event of accidental atmospheric releases and contamination of the terrestrial environment. The on-going project aims to develop tools for the management of marine contamination events in French coastal areas. This should allow us to evaluate and anticipate post-accident conditions, including potential contamination sites, contamination levels and potential consequences. In order to achieve this goal, two complementary tools are developed: site-specific marine data sheets and a dedicated simulation tool (STERNE, Simulation du Transport et du transfert d’Eléments Radioactifs dans l'environNEment marin). Marine data sheets are used to summarize the marine environment characteristics of the various sites considered, and to identify vulnerable areas requiring implementation of population protection measures, such as aquaculture areas, beaches or industrial water intakes, as well as areas of major ecological interest. Local climatological data (dominant sea currents as a function of meteorological or tidal conditions) serving as the basis for an initial environmental sampling strategy is provided whenever possible, along with a list of possible local contacts for operational management purposes. The STERNE simulation tool is designed to predict radionuclide dispersion and contamination in seawater and marine species by incorporating spatio-temporal data. 3D hydrodynamic forecasts are used as input data. Direct discharge points or
Koperdáková, Zuzana
2016-01-01
Bachelor thesis deals with the theme of customer experience and terms related to this topic. The thesis consists of three parts. The first part explains the terms generally, as the experience or customer loyalty. The second part is dedicated to medotology used for Customer Experience Management. In the third part is described application of Customer Experience Management in practice, particularly in the context Touch Point Analyses in GE Money Bank.
Simulator experiments: effects of NPP operator experience on performance
International Nuclear Information System (INIS)
Beare, A.N.; Gray, L.H.
1984-01-01
During the FY83 research, a simulator experiment was conducted at the control room simulator for a GE Boiling Water Reactor (BWR) NPP. The research subjects were licensed operators undergoing requalification training and shift technical advisors (STAs). This experiment was designed to investigate the effects of senior reactor operator (SRO) experience, operating crew augmentation with an STA and practice, as a crew, upon crew and individual operator performance, in response to anticipated plant transients. Sixteen two-man crews of licensed operators were employed in a 2 x 2 factorial design. The SROs leading the crews were split into high and low experience groups on the basis of their years of experience as an SRO. One half of the high- and low-SRO experience groups were assisted by an STA. The crews responded to four simulated plant casualties. A five-variable set of content-referenced performance measures was derived from task analyses of the procedurally correct responses to the four casualties. System parameters and control manipulations were recorded by the computer controlling the simulator. Data on communications and procedure use were obtained from analysis of videotapes of the exercises. Questionnaires were used to collect subject biographical information and data on subjective workload during each simulated casualty. For four of the five performance measures, no significant differences were found between groups led by high (25 to 114 months) and low (1 to 17 months as an SRO) experience SROs. However, crews led by low experience SROs tended to have significantly shorter task performance times than crews led by high experience SROs. The presence of the STA had no significant effect on overall team performance in responding to the four simulated casualties. The FY84 experiments are a partial replication and extension of the FY83 experiment, but with PWR operators and simulator
2017-01-01
Working Group on Infrastructure Finance Stern School of Business, New York University Pankaj Ghemawat, Professor of Management Joel Hasbrouck, Professor of Finance Peter Henry, Professor of Economics Michael Posner, Professor of Business and Society Paul Romer, Professor of Economics Michael Spence, Professor of Economics Paul Tice, Executive in Residence Stijn Van Nieuwerburgh, Professor of Finance Ingo Walter, Professor Emeritus of Finance Tensie Whelan, Professor of Business and Society La...
2014-06-01
625 (an Inconel ) sleeve. These sleeves exhibit exceptional corrosion performance, and are used as the wear surfaces in contact with the lubricated...it exits the stern tube bearing. There is an alloy 625 ( Inconel ) sleeve, used as a wear surface for the bearing interaction, as seen in the drawing...Industry Day at MIT, October 13, 2011. Alloy 625 sleeve Mild steel shaft Typical Corrosion Area Epoxy Filler Glass Reinforced Plastic Cover
Origin of constraints in relativistic classical Hamiltonian dynamics
International Nuclear Information System (INIS)
Mallik, S.; Hugentobler, E.
1979-01-01
We investigate the null-plane or the front form of relativistic classical Hamiltonian dynamics as proposed by Dirac and developed by Leutwyler and Stern. For systems of two spinless particles we show that the algebra of Poincare generators is equivalent to describing dynamics in terms of two covariant constraint equations, the Poisson bracket of the two constraints being weakly zero. The latter condition is solved for certain simple forms of constraints
Murdin, P.
2000-11-01
(the Ship) a large southern constellation representing the ship Argo of Jason and the Argonauts in Greek mythology whose brightest stars were cataloged by Ptolemy (c. AD 100-175) in the Almagest. It was divided up by the French astronomer Nicolas L de Lacaille (1713-62), who charted the southern sky in 1751-2, into the constellations Carina (the Keel), Vela (the Sails), Puppis (the Poop or Stern)...
Monetary ecosystem services valuation in natural environment management
Álvarez, David
2017-01-01
As it happened with Stern Report, which made international community change their attitude related to climate change, TEEB (The Economics of Ecosystem Services and Biodiversity) was a turning point in valuing biodiversity and ecosystem services. This change of attitude happened, partially, thanks to include monetary ecosystem valuation of ecosystem services and how much their conservation and avoid their loss worth to the entire society. Integrate monetary valuation in green infrastructur...
A Group Theoretic Approach to Metaheuristic Local Search for Partitioning Problems
2005-05-01
Tabu Search. Mathematical and Computer Modeling 39: 599-616. 107 Daskin , M.S., E. Stern. 1981. A Hierarchical Objective Set Covering Model for EMS... A Group Theoretic Approach to Metaheuristic Local Search for Partitioning Problems by Gary W. Kinney Jr., B.G.S., M.S. Dissertation Presented to the...DISTRIBUTION STATEMENT A Approved for Public Release Distribution Unlimited The University of Texas at Austin May, 2005 20050504 002 REPORT
International Nuclear Information System (INIS)
Radjabov, U.R.; Yusupov, Z.N.; Sharipov, I.Kh.
2001-01-01
C H lm=0.1 mol/l, C F e(II)=1·10 - 4 m ol/l and iron sterns: 0.10, 0.25, 0.50 and 1.00 mol/l. It is established that in the investigated systems form at different on composition mono-, polynuclear, homo-- and heterovalent coordination compounds. In aids of the oxidation function accurate the composition, defined the constants formation and domination sphere of complex forms
Murdin, P.
2000-11-01
(the Poop or Stern; abbrev. Pup, gen. Puppis; area 673 sq. deg.) A southern constellation which lies between Canis Major and Vela, and culminates at midnight in early January. It was introduced by the French astronomer Nicolas L de Lacaille (1713-62), who charted the southern sky in 1751-2, from stars that formed part of the ancient constellation of Argo Navis (the Ship), which had been included ...
Extracting Insights from Experience Designers to Enhance User Experience Design
Kremer, Simon; Lindemann, Udo
2016-01-01
User Experience (UX) summarizes how a user expects, perceives and assesses an encounter with a product. User Experience Design (UXD) aims at creating meaningful experiences. While UXD is a rather young discipline with-in product development and traditional processes predominate, other disciplines traditionally focus on creating experiences. We engaged with experience de-signers from the fields of arts, movies, sports, music and event management. By analyzing their working processes via interv...
Development of thermal-hydraulic models for the safety evaluation of CANDU reactors
Energy Technology Data Exchange (ETDEWEB)
Lee, Jae Young; Jung, Yun Sik; Hwang, Gi Suk; Kim, Nam Seok [Handong Univ., Pohang (Korea, Republic of); No, Hee Cheon [Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)
2004-02-15
The objective of the present research is to evaluate the safety analysis for CANDU and to improve the Horizontal Stratification Entrainment Model (HSEM) of RELAP5/MOD3.3. This report includes two items the one is the experimental study of entrainment at horizontal pipe with {+-} 36 .deg. C , {+-} 72 .deg. C branch pies, the other is the model improvement of the moderator heat sink in the Calandria. The off-take experiments on onset of entrainment and branch quality were investigated by using water and air as working fluid, and the experimental data were compared by the previous correlations. The previous correlations could not expect experimental results, thus the weak points of the previous correlations were investigated. The improvement of the previous model continues as the next year research. The thermal hydraulic scaling analysis of SPEL, STERN and ideal linear scaling analysis have been studied. As a result, a new scaling method were needed to design a new experimental facility (HGU). A new scaling method with 1/8 length scale was applied. From these results, the thermal hydraulic model for CFD code simulation was designed and test apparatus has been made. The moderator temperature distribution experiments and CFD code simulation will be continued in next year.
Cassidy, David C.
2013-03-01
It's July 1945. Germany is in defeat and the atomic bombs are on their way to Japan. Under the direction of Samuel Goudsmit, the Allies are holding some of the top German nuclear scientists-among them Heisenberg, Hahn, and Gerlach-captive in Farm Hall, an English country manor near Cambridge, England. As secret microphones record their conversations, the scientists are unaware of why they are being held or for how long. Thinking themselves far ahead of the Allies, how will they react to the news of the atomic bombs? How will these famous scientists explain to themselves and to the world their failure to achieve even a chain reaction? How will they come to terms with the horror of the Third Reich, their work for such a regime, and their behavior during that period? This one-act play is based upon the transcripts of their conversations as well as the author's historical work on the subject.
Energy Technology Data Exchange (ETDEWEB)
Peyton, Brent, M.; Gerlach, Robin; Cunningham, Al, B.; Apel, William, A.; Roberto, Francisco
2007-12-04
This project report summarizes the results of a 3-way collaboration between researchers at Montana State University’s (MSU’s) Center for Biofilm Engineering (CBE) (Drs. Robin Gerlach and Al Cunningham), the WSU/NSF IGERT Center for Multiphase Environmental Research (CMER) at Washington State University (WSU) (Dr. Brent Peyton who recently moved to MSU), and the Idaho National Laboratory (INL) (Drs. William Apel and Frank Roberto). At WSU, removal of uranium (U) from aqueous solution was studied using Cellulomonas sp. strain ES6, under anaerobic, non-growth conditions. The Cellulomonadaceae are environmentally relevant subsurface bacteria, and strain ES6 was isolated from the DOE Hanford subsurface. To better understand the role of the pH buffer in the U immobilization process, both bicarbonate and PIPES buffers were used. Our results show for the first time the strain ES6 has multiple U immobilization mechanisms within one organism. Citations to resulting publications are included in the report.
The experience sampling method: Investigating students' affective experience
Nissen, Jayson M.; Stetzer, MacKenzie R.; Shemwell, Jonathan T.
2013-01-01
Improving non-cognitive outcomes such as attitudes, efficacy, and persistence in physics courses is an important goal of physics education. This investigation implemented an in-the-moment surveying technique called the Experience Sampling Method (ESM) [1] to measure students' affective experience in physics. Measurements included: self-efficacy, cognitive efficiency, activation, intrinsic motivation, and affect. Data are presented that show contrasts in students' experiences (e.g., in physics vs. non-physics courses).
Simulator experiments: effects of NPP operator experience on performance
International Nuclear Information System (INIS)
Beare, A.N.; Gray, L.H.
1985-01-01
Experiments are being conducted on nuclear power plant (NPP) control room training simulators by the Oak Ridge National Laboratory, its subcontractor, General Physics Corporation, and participating utilities. The experiments are sponsored by the Nuclear Regulatory Commission's (NRC) Human Factors and Safeguards Branch, Division of Risk Analysis and Operations, and are a continuation of prior research using simulators, supported by field data collection, to provide a technical basis for NRC human factors regulatory issues concerned with the operational safety of nuclear power plants. During the FY83 research, a simulator experiment was conducted at the control room simulator for a GE boiling water reactor (BWR) NPP. The research subjects were licensed operators undergoing requalification training and shift technical advisors (STAs). This experiment was designed to investigate the effects of (a) senior reactor operator (SRO) experience, (b) operating crew augmentation with an STA and (c) practice, as a crew, upon crew and individual operator performance, in response to anticipated plant transients. The FY84 experiments are a partial replication and extension of the FY83 experiment, but with PWR operators and simulator. Methodology and results to date are reported
Experiment WA1 (CDHS Neutrino Experiment)
CERN PhotoLab
1977-01-01
Experiment WA1, also known under CDHS (CERN, Dortmund, Heidelberg, Saclay; spokesman Jack Steinberger), was the first neutrino experiment on the SPS, in its West Area. Magnetized iron (with a toroidal field) forms the core of the detector. On its outside we see drift chambers and photomultipliers (detecting the light from the plastic scintillators further in). Peter Schilly is wearing a white coat. See also CERN Annual Report 1976, p.57.
The Sensitivity Analysis of Axial Pressure Tube Creep Profile for Dryout Power in PHWR
Energy Technology Data Exchange (ETDEWEB)
Ryu, Euiseung; Kim, Youngae [KHNP CRI, Daejeon (Korea, Republic of)
2016-10-15
The Stern Laboratory performed the CHF tests with only one axial pressure tube creep profile per 3.3%, 5.1% peak crept channel and made CHF correlation including creep factor from the CHF test results. Wolsong nuclear power plants also have utilized the same CHF correlation derived by CNL. Pressure tube diameter creep rate is function of fast neutron, coolant temperature, and coolant pressure in a channel. It means that various axial pressure tube creep profiles exist in PHWR due to the history of operating conditions. Usually, CHF correlation is used during ROP(Regional Overpower Protection) Trip Setpoint Analysis or Safety Analysis in PHWR. The sensitivity analysis for CHF effects using various creep profiles is needed. This paper summarizes the comparison results of dryout power between CHF test creep profile and estimated creep profiles of Wolsong units. The effect of axial pressure tube creep profile for dryout power in fuel channel is evaluated by using Stern Lab. CHF test creep profile and 380 channel creep profiles of Wolsong. The dryout powers at 3.3% and 5.1% test conditions are slightly smaller when using 380 Wolsong channels creep profiles. These also show that the simulated dryout powers maintain consistency regardless of flow conditions.
Urea-induced binding between diclofenac sodium and bovine serum albumin: a spectroscopic insight.
Dohare, Neeraj; Khan, Abbul Bashar; Athar, Fareeda; Thakur, Sonu Chand; Patel, Rajan
2016-06-01
We investigated the interaction of diclofenac sodium (Dic.Na) with bovine serum albumin (BSA) in the absence and presence of urea using different spectroscopic techniques. A fluorescence quenching study revealed that the Stern-Volmer quenching constant decreases in the presence of urea, decreasing further at higher urea concentrations. The binding constant and number of binding sites were also evaluated for the BSA-Dic.Na interaction system in the absence and presence of urea using a modified Stern-Volmer equation. The binding constant is greater at high urea concentrations, as shown by the fluorescence results. In addition, for the BSA-Dic.Na interaction system, a static quenching mechanism was observed, which was further confirmed using time-resolved fluorescence spectroscopy. UV-vis spectroscopy provided information about the formation of a complex between BSA and Dic.Na. Circular dichroism was carried out to explain the conformational changes in BSA induced by Dic.Na in the absence and presence of urea. The presence of urea reduced the α-helical content of BSA as the Dic.Na concentration varied. The distance r between the donor (BSA) and acceptor (Dic.Na) was also obtained in the absence and presence of urea, using fluorescence resonance energy transfer. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.
Heavy atom induced room temperature fluorescence quenching of PAH from a glucose glass
Energy Technology Data Exchange (ETDEWEB)
Marlow, Matt, E-mail: matthew.marlow@nicholls.edu
2017-06-15
Sugar glasses are a relatively new matrix for solid-matrix luminescence. Molecular interactions within the sugar glass are not well understood. Fluorescence quenching was used to investigate molecular interactions within the sugar glass matrix. The room temperature fluorescence quenching of pyrene and naphthalene was observed from a glucose glass. The heavy atom salt NaI was the quencher. Two solvent compositions 50/50 and 60/40 MeOH/water, used for glass preparation, were examined for their effect on glass rigidity and molecular interactions. A complex static mechanism was observed for glasses prepared with 50/50 MeOH/water. This data was fit to the sphere of action model and associations constants determined. A Stern-Volmer static mechanism of quenching was observed for glasses prepared with 60/40 MeOH/water. This data fit the Stern-Volmer equation and association constants were determined. A larger association constant was observed for pyrene compared to naphthalene for both solvent systems used. Pyrene had a larger association constant with a sugar glass prepared with 60/40 MeOH/water compared to 50/50 MeOH/water implying a greater association between pyrene and iodide. The greater association is a reflection of a more rigid internal environment for the sugar glass prepared with 60/40 MeOH/water.
Directory of Open Access Journals (Sweden)
Tone Pernille Østern
2014-12-01
Full Text Available I denne artikkelen har forfatterne fokus på hvordan ulikhet mellom mennesker kan fungere som en impuls som bidrar til meningsskaping, nye oppdagelser og transformasjon i improvisasjon i dans. Artikkelen tar utgangspunkt i Østerns avhandling ”Meaning-making in the Dance Laboratory. Exploring dance improvisation with differently bodied dancers” (2009. I artikkelen vever forfatterne sammen sine ulike stemmer. Tone Pernille Østerns perspektiv er som initiativtaker og tidligere koreograf-dansepedagog i Danselaboratoriet, mens Elen Øyens perspektiv er som danser i den samme gruppen. Øyen er danser og rullestolbruker. Hovedkonklusjonen i artikkelen er at gjennom å forstå ulikhet som en verdi og impuls til å møtes og skape i improvisasjon i dans, så kan deltakerne i gruppen gjennomgå kraftfulle transformative endringsprosesser når det gjelder synet på ”den andre”. Dette har en betydning som går langt ut over det konkrete, kunstneriske undervisningsrommet. ”Den andre” forstås i artikkelen som en konstruksjon som både muliggjør adskillelse og utestenging fra et fellesskap, men også som en mulighet til å forstå at ”den andre” ikke nødvendigvis er, eller skal være, som meg.
Saha, Dipika; Negi, Devendra P. S.
2018-01-01
The purpose of the present work was to develop a method for the sensing of thioacetamide by using spectroscopic techniques. Thioacetamide is a carcinogen and it is important to detect its presence in food-stuffs. Semiconductor quantum dots are frequently employed as sensing probes since their absorption and fluorescence properties are highly sensitive to the interaction with substrates present in the solution. In the present work, the interaction between thioacetamide and ZnO quantum dots has been investigated by using UV-visible, fluorescence and infrared spectroscopy. Besides, dynamic light scattering (DLS) has also been utilized for the interaction studies. UV-visible absorption studies indicated the bonding of the lone pair of sulphur atom of thioacetamide with the surface of the semiconductor. The fluorescence band of the ZnO quantum dots was found to be quenched in the presence of micromolar concentrations of thioacetamide. The quenching was found to follow the Stern-Volmer relationship. The Stern-Volmer constant was evaluated to be 1.20 × 105 M- 1. Infrared spectroscopic measurements indicated the participation of the sbnd NH2 group and the sulphur atom of thioacetamide in bonding with the surface of the ZnO quantum dots. DLS measurements indicated that the surface charge of the semiconductor was shielded by the thioacetamide molecules.
Directory of Open Access Journals (Sweden)
Susana Amézqueta
2018-03-01
Full Text Available Serum albumin is the main drug transporter of the bloodstream and contains two main binding sites: Sudlow I or acidic drug binding site, and Sudlow II or benzodiazepine binding site. Warfarin, a well-known anticoagulant drug commonly used in the prevention of thrombosis and thromboembolism, binds to Sudlow I site, whereas non-steroidal antiinflammatory drugs (NSAIDs such as diflunisal bind preferentially to Sudlow II site. Albumin is a fluorophore that modifies its fluorescence (quenching or enhancement effect when it is bound to a drug. The application of the double logarithm Stern-Volmer equation allows the calculation of the stoichiometry and the binding constant of the process. This procedure does not consider the possible interferences coming from the fluorescence of the drug though. Another strategy to evaluate the binding constants is to consider the whole spectrum, taking into account all the possible species in equilibrium; in this case we have used an extended version of the STAR program, which can deal with 300 spectra, each containing up to 300 data points. The aim of this work is to compare both approaches to evaluate the interaction between warfarin (Sudlow I and diflunisal (Sudlow II and HSA: the double logarithm Stern-Volmer equation and the STAR program.
Fluorescence quenching of fluorescein by Merocyanine 540 in liposomes
International Nuclear Information System (INIS)
Toprak, Mahmut; Meryem Aydin, Burcu; Arik, Mustafa; Onganer, Yavuz
2011-01-01
The fluorescence quenching of fluorescein (FL) by merociyanine 540 (MC540) was examined in L-egg lecithin phosphatidycholine (PC) liposomes using spectroscopic methods. The type of quenching mechanism (dynamic or static) was evaluated using the Stern-Volmer plots. Findings were also supported by the temperature studies and florescence decay measurements. The Stern-Volmer equation was utilized to calculate bimolecular quenching constants (K q ). Furthermore, the bimolecular quenching constant of the quencher in the liposomes (K SV ), partition coefficient (K p ), binding constant (K), and corresponding thermodynamic parameters ΔH, ΔS, and ΔG were calculated. The quenching property was also used in determining quantitatively (K p ) the partition coefficient of Merociyanini 540 in PC liposome.The obtained data indicated that static quenching occurred in the system and the K SV values decreased with increasing lipid concentration. In addition, thermodynamic analysis suggested that van der Waals interactions and hydrogen bonding were the main acting forces between fluorescein and merociyanine 540 molecules in the medium. - Highlights: → Fluorescence quenching of FL by MC540 in liposome system was analyzed. → Fluorescence quenching mechanism of FL by MC540 was consistent with the static model. → Binding FL to MC540 was spontaneous and carried out by hydrogen bond and van der Waals forces.
International Nuclear Information System (INIS)
Clemmer, R.G.; Finn, P.A.; Malecha, R.F.
1984-09-01
The TRIO experiment is a test of in-situ tritium recovery and heat transfer performance of a miniaturized solid breeder blanket assembly. The assembly (capsule) was monitored for temperature and neutron flux profiles during irradiation and a sweep gas flowed through the capsule to an anaytical train wherein the amounts of tritium in its various chemical forms were determined. The capsule was designed to operate at different temperatures and sweep gas conditions. At the end of the experiment the amount of tritium retained in the solid was at a concentration of less than 0.1 wppM. More than 99.9% of tritium generated during the experiment was successfully recovered. The results of the experiment showed that the tritium inventories at the beginning and at the end of the experiment follow a relationship which appears to be characteristic of intragranular diffusion
DEFF Research Database (Denmark)
Petersen, Kjell Yngve; Søndergaard, Karin; Augustesen, Christina
2015-01-01
Pixel Experiments The term pixel is traditionally defined as any of the minute elements that together constitute a larger context or image. A pixel has its own form and is the smallest unit seen within a larger structure. In working with the potentials of LED technology in architectural lighting...... for using LED lighting in lighting design practice. The speculative experiments that have been set-up have aimed to clarify the variables that can be used as parameters in the design of lighting applications; including, for example, the structuring and software control of light. The experiments also...... elucidate and exemplify already well-known problems in relation to the experience of vertical and horizontal lighting. Pixel Experiments exist as a synergy between speculative test setups and lighting design in practice. This book is one of four books that is published in connection with the research...
Investigation of longitudinal control system for a small hydrofoil boat
Phillips, W. H.; Shaughnessy, J. D.
1976-01-01
An analysis of a hydromechanical system for longitudinal control of a small hydrofoil boat is presented. The system incorporates height and acceleration sensors operating flaps on the foils through a mechanical linkage. Effects of some of the system parameters on the stability and response to waves are shown. The results indicate that the system is capable of providing adequate stability, but the response to stern waves at low frequencies is larger than desired.
Photochemical assessment of UO2+2 complexation in Triton X-100 micellar system
International Nuclear Information System (INIS)
Das, S.K.; Ganguly, B.N.
1994-01-01
This is a report on the spectral characteristics of UO 2 +2 in the excited state in the Triton X-100 micellar medium. The downward curving of the Stern-Volmer plot explains the two kinds of populations of UO 2 +2 upon micellization. A blue shift of the quenched emission is ascribed due to the collisional encounter of UO 2 +2 with the head groups of Triton X-100. (author). 5 refs., 2 figs
Report: Fourth International Conference on Gas Hydrates, held at Yokohama, Japan, 19-23 May 2002
Digital Repository Service at National Institute of Oceanography (India)
Karisiddaiah, S.M.
formations, while Dr. L. Stern presented ne insights into the phenomena of anomalous or self- preservation of gas hydrates. JOUR.GEOL.SOC.INDIA, VOL.61, JAN. 2001 Posters on hydrate formation and prevention in pipelines and hydrate based...-1 REPORT ON THE 4TH INTERNATIONAL CONFERENCE ON GAS HYDRATES The fourth International Conference on Gas Hydrates was recently held at Yokohama, Japan, between 19-23 May 2002 following the earlier conferences held in USA (1993...
1-Cyclohexyl-6,7-dimethoxy-1,4-dihydronaphthalene
Directory of Open Access Journals (Sweden)
Shao-Yuan Chen
2014-06-01
Full Text Available The title compound, C18H24O2, was isolated from the leaves extract of Ficus carica L. The cyclohexane ring displays a chair conformation whereas the cyclohexa-1,4-diene ring adopts a flattened boat conformation with methyl C atoms at the prow and stern. In the crystal, molecules are linked by weak C—H...O hydrogen bonds into supramolecular chains propagated along the b-axis direction.
Behavioural responses to climate change: Asymmetry of intentions and impacts
Whitmarsh, Lorraine E.
2009-01-01
In seeking to determine whether climate change mitigation strategies are effective, researchers and policy-makers typically use energy consumption as an indicator. UK government data show that energy use amongst the public is rising, despite measures to encourage energy conservation. Yet, research to date has not explicitly asked which actions the public are taking with the express intention of mitigating climate change. Using Stern's classification of impact-oriented and intent-oriented beha...
Tools for Managing Repository Objects
Banker, Rajiv D.; Isakowitz, Tomas; Kauffman, Robert J.; Kumar, Rachna; Zweig, Dani
1993-01-01
working Paper Series: STERN IS-93-46 The past few years have seen the introduction of repository-based computer aided software engineering (CASE) tools which may finally enable us to develop software which is reliable and affordable. With the new tools come new challenges for management: Repository-based CASE changes software development to such an extent that traditional approaches to estimation, performance, and productivity assessment may no longer suffice - if they ever...
The Conflicts in Yemen and U.S. National Security
2011-01-01
independence.99 In the same statement, the al-Qaeda leader sternly warned southerners that Marxism was a failed ideology, and that it could not provide any...itself internationally by voting with Cuba against UNSC Resolution 678, which authorized the U.S.-led coalition to use “all necessary means” to...that is probably more significant for Washington than Sana’a involves the Guantanamo Bay, Cuba , detainees. In mid-2010, the United States held over
Poincare invariant algebra from instant to light-front quantization
International Nuclear Information System (INIS)
Ji, Chueng-Ryong; Mitchell, Chad
2001-01-01
We present the Poincare algebra interpolating between instant and light-front time quantizations. The angular momentum operators satisfying SU(2) algebra are constructed in an arbitrary interpolation angle and shown to be identical to the ordinary angular momentum and Leutwyler-Stern angular momentum in the instant and light-front quantization limits, respectively. The exchange of the dynamical role between the transverse angular mometum and the boost operators is manifest in our newly constructed algebra
Enzyme Triggered Drug Delivery for Graft Targeted Immunosupression and Neuroregeneration after VCA
2016-05-11
Banz,6 Mihal A. Constant lnescu,1•2 Jeffrey M. Karp,4 t Praveen Kumar Vemula1 3 t Robert Rieben, 2t Esthe r Vogelin 1’ 2 Curre ntly, syst·emic... Praveen Vemula NAMRU, San Antonio Ms Carrie Crane Ms Candice Angueira i11Stern I) UPMC Lmer.i t ~ uf 1 1,Jmr~h .\\l r<l1c.1l < c111er ’
Documentation of CATHENA input files for the APOLLO computer
International Nuclear Information System (INIS)
1988-06-01
Input files created for the VAX version of the CATHENA two-fluid code have been modified and documented for simulation on the AECB's APOLLO computer system. The input files describe the RD-14 thermalhydraulic loop, the RD-14 steam generator, the RD-12 steam generator blowdown test facility, the Stern Laboratories Cold Water Injection Facility (CWIT), and a CANDU 600 reactor. Sample CATHENA predictions are given and compared with experimental results where applicable. 24 refs
ARC EMCS Experiments (Seedling Growth-2) Experiment Status
Heathcote, David; Steele, Marianne
2015-01-01
Presentation of the status of the ARC ISS (International Space Station) Experiment, Seedling Growth-2 to the Payload Operations Investigator Working Group meeting at MSFC, Huntsville AL. The experiment employs the European Modular Cultivation System (ECMS).
TRACY transient experiment databook. 2) ramp withdrawal experiment
International Nuclear Information System (INIS)
Nakajima, Ken; Yamane, Yuichi; Ogawa, Kazuhiko; Aizawa, Eiju; Yanagisawa, Hiroshi; Miyoshi, Yoshinori
2002-03-01
This is a databook of TRACY ''ramp withdrawal'' experiments. TRACY is a reactor to perform supercritical experiments using low-enriched uranyl nitrate aqueous solution. The excess reactivity of TRACY is 3$ at maximum, and it is inserted by feeding the solution to a core tank or by withdrawing a control rod, which is called as the transient rod, from the core. In the ramp withdrawal experiment, the supercritical experiment is initiated by withdrawing the transient rod from the core in a constant speed using a motor drive system. The data in the present databook consist of datasheets and graphs. Experimental conditions and typical values of measured parameters are tabulated in the datasheet. In the graph, power and temperature profiles are plotted. Those data are useful for the investigation of criticality accidents with fissile solutions, and for validation of criticality accident analysis codes. (author)
Experiment prediction for Loft Nonnuclear Experiment L1-4
International Nuclear Information System (INIS)
White, J.R.; Berta, V.T.; Holmstrom, H.L.O.
1977-04-01
A computer analysis, using the WHAM and RELAP4 computer codes, was performed to predict the LOFT system thermal-hydraulic response for Experiment L1-4 of the nonnuclear (isothermal) test series. Experiment L1-4 will simulate a 200 percent double-ended offset shear in the cold leg of a four-loop large pressurized water reactor. A core simulator will be used to provide a reactor vessel pressure drop representative of the LOFT nuclear core. Experiment L1-4 will be initiated with a nominal isothermal primary coolant temperature of 282.2 0 C, a pressurizer pressure of 15.51 MPa, and a primary coolant flow of 270.9 kg/s. In general, the predictions of saturated blowdown for Experiment Ll-4 are consistent with the expected system behavior, and predicted trends agree with results from Semiscale Test S-01-4A, which simulated the Ll-4 experiment conditions
Diffusion of anions and cations in compacted sodium bentonite
International Nuclear Information System (INIS)
Muurinen, A.
1994-02-01
The thesis presents the results of studies on the diffusion mechanisms of anions and cations in compacted sodium bentonite, which is planned to be used as a buffer material in nuclear waste disposal in Finland. The diffusivities and sorption factors were determined by tracer experiments. The pore volume accessible to chloride, here defined as effective porosity, was determined as a function of bentonite density and electrolyte concentration in water, and the Stern-Gouy double-layer model was used to explain the observed anion exclusion. The sorption of Cs + and Sr 2+ was studied in loose and compacted bentonite samples as a function of the electrolyte concentration in solution. In order to obtain evidence of the diffusion of exchangeable cations, defined as surface diffusion, the diffusivities of Cs + and Sr 2+ in compacted bentonite were studied as a function of the sorption factor, which was varied by electrolyte concentration in solution. The measurements were performed both by a non-steady state method and by a through-diffusion method. (89 refs., 35 fig., 4 tab.)
Interaction between Saikosaponin D, Paeoniflorin, and Human Serum Albumin.
Liang, Guo-Wu; Chen, Yi-Cun; Wang, Yi; Wang, Hong-Mei; Pan, Xiang-Yu; Chen, Pei-Hong; Niu, Qing-Xia
2018-01-27
Saikosaponin D (SSD) and paeoniflorin (PF) are the major active constituents of Bupleuri Radix and Paeonia lactiflora Pall , respectively, and have been widely used in China to treat liver and other diseases for many centuries. We explored the binding of SSD/PF to human serum albumin (HSA) by using fluorospectrophotometry, circular dichroism (CD) and molecular docking. Both SSD and PF produced a conformational change in HSA. Fluorescence quenching was accompanied by a blue shift in the fluorescence spectra. Co-binding of PF and SSD also induced quenching and a conformational change in HSA. The Stern-Volmer equation showed that quenching was dominated by static quenching. The binding constant for ternary interaction was below that for binary interaction. Site-competitive experiments demonstrated that SSD/PF bound to site I (subdomain IIA) and site II (subdomain IIIA) in HSA. Analysis of thermodynamic parameters indicated that hydrogen bonding and van der Waals forces were mostly responsible for the binary association. Also, there was energy transfer upon binary interaction. Molecular docking supported the experimental findings in conformation, binding sites and binding forces.
Schwartz, N.; Huisman, J. A.; Furman, A.
2012-12-01
, direct evidence showed that the organic cation was adsorbed on the soil surface and exchanged with inorganic ions that usually exist in soil. This experiment confirmed that adsorption to the soil surface and the associated release of inorganic ions is the main mechanism affecting the complex conductivity of the contaminated porous media. Furthermore, our results show that adsorption of organic ions to the soil surface resulted in a decrease of the soil polarization. Using a chemical complexation model of the soil surface and a model for the polarization of the Stern layer, we were able to show that the decrease in the polarization of the soil can be related to the decrease in the surface site density of inorganic ions, and that the contribution of the soil-organic complexes to the polarization of the soil is negligible. We attribute this to the strong interaction between polar organic compounds and soil which results in a significant decrease in the mobility of the organic compounds in the Stern layer. The results of this work are essential to better interpret SIP signatures of soil contaminated with organic contaminants.
DEFF Research Database (Denmark)
Olesen, Henning Salling
2017-01-01
Abstract: This chapter introduces a psycho-societal approach to theorizing learning, combining a materialist theory of socialization with a hermeneutic interpretation methodology. The term "approach" indicates the intrinsic connection between theory, empirical research process and epistemic subject....... Learning is theorized as dynamic subjective experience of (socially situated) realities, counting on individual subjectivity as well as subjective aspects of social interaction. This psycho-societal theory of subjective experiences conceptualizes individual psychic development as interactional experience...... of societal relations, producing an inner psycho-dynamic as a conscious and unconscious individual resource in future life. The symbolization of immediate sensual experiences form an individual life experience of social integration, language use being the medium of collective, social experience (knowledge...
TRACY transient experiment databook. 3) Ramp feed experiment
Energy Technology Data Exchange (ETDEWEB)
Nakajima, Ken; Yamane, Yuichi; Ogawa, Kazuhiko; Aizawa, Eiju; Yanagisawa, Hiroshi; Miyoshi, Yoshinori [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
2002-03-01
This is a databook of TRACY ''ramp feed'' experiments. TRACY is a reactor to perform supercritical experiments using low-enriched uranyl nitrate aqueous solution. The excess reactivity of TRACY is 3$ at maximum, and it is inserted by feeding the solution to a core tank or by withdrawing a control rod, which is called as the transient rod, from the core. In the ramp feed experiment, the supercritical experiment is initiated by feeding the fuel solution to the core tank in a constant feed rate. The data in the present databook consist of datasheets and graphs. Experimental conditions and typical values of measured parameters are tabulated in the datasheet. In the graph, power and temperature profiles are plotted. Those data are useful for the investigation of criticality accidents with fissile solutions, and for validation of criticality accident analysis codes. (author)
The difference between traditional experiments and CFD validation benchmark experiments
Energy Technology Data Exchange (ETDEWEB)
Smith, Barton L., E-mail: barton.smith@usu.edu
2017-02-15
Computation Fluid Dynamics provides attractive features for design, and perhaps licensing, of nuclear power plants. The most important of these features is low cost compared to experiments. However, uncertainty of CFD calculations must accompany these calculations in order for the results to be useful for important decision making. In order to properly assess the uncertainty of a CFD calculation, it must be “validated” against experimental data. Unfortunately, traditional “discovery” experiments are normally ill-suited to provide all of the information necessary for the validation exercise. Traditionally, experiments are performed to discover new physics, determine model parameters, or to test designs. This article will describe a new type of experiment; one that is designed and carried out with the specific purpose of providing Computational Fluid Dynamics (CFD) validation benchmark data. We will demonstrate that the goals of traditional experiments and validation experiments are often in conflict, making use of traditional experimental results problematic and leading directly to larger predictive uncertainty of the CFD model.
The difference between traditional experiments and CFD validation benchmark experiments
International Nuclear Information System (INIS)
Smith, Barton L.
2017-01-01
Computation Fluid Dynamics provides attractive features for design, and perhaps licensing, of nuclear power plants. The most important of these features is low cost compared to experiments. However, uncertainty of CFD calculations must accompany these calculations in order for the results to be useful for important decision making. In order to properly assess the uncertainty of a CFD calculation, it must be “validated” against experimental data. Unfortunately, traditional “discovery” experiments are normally ill-suited to provide all of the information necessary for the validation exercise. Traditionally, experiments are performed to discover new physics, determine model parameters, or to test designs. This article will describe a new type of experiment; one that is designed and carried out with the specific purpose of providing Computational Fluid Dynamics (CFD) validation benchmark data. We will demonstrate that the goals of traditional experiments and validation experiments are often in conflict, making use of traditional experimental results problematic and leading directly to larger predictive uncertainty of the CFD model.
Barrett, Frederick S; Bradstreet, Matthew P; Leoutsakos, Jeannie-Marie S; Johnson, Matthew W; Griffiths, Roland R
2016-12-01
Acute adverse psychological reactions to classic hallucinogens ("bad trips" or "challenging experiences"), while usually benign with proper screening, preparation, and support in controlled settings, remain a safety concern in uncontrolled settings (such as illicit use contexts). Anecdotal and case reports suggest potential adverse acute symptoms including affective (panic, depressed mood), cognitive (confusion, feelings of losing sanity), and somatic (nausea, heart palpitation) symptoms. Responses to items from several hallucinogen-sensitive questionnaires (Hallucinogen Rating Scale, the States of Consciousness Questionnaire, and the Five-Dimensional Altered States of Consciousness questionnaire) in an Internet survey of challenging experiences with the classic hallucinogen psilocybin were used to construct and validate a Challenging Experience Questionnaire. The stand-alone Challenging Experience Questionnaire was then validated in a separate sample. Seven Challenging Experience Questionnaire factors (grief, fear, death, insanity, isolation, physical distress, and paranoia) provide a phenomenological profile of challenging aspects of experiences with psilocybin. Factor scores were associated with difficulty, meaningfulness, spiritual significance, and change in well-being attributed to the challenging experiences. The factor structure did not differ based on gender or prior struggle with anxiety or depression. The Challenging Experience Questionnaire provides a basis for future investigation of predictors and outcomes of challenging experiences with classic hallucinogens. © The Author(s) 2016.
International Nuclear Information System (INIS)
Stuart, G.W.
1986-01-01
The report of the Rutherford Appleton Laboratory describes the work carried out in 1985 on experiments approved by the Particle Physics Experiments Selection Panel. The contents consist of unedited contributions from each experiment. (author)
Sharing ESA's knowledge and experience - the Erasmus Experiment Archive
Isakeit, Dieter; Sabbatini, Massimo; Carey, William
2004-11-01
The Erasmus Experiment Archive is an electronic database, that collects all experiments performed to date in the faciliteis that fall under the responsibility of the ESA (human spaceflight, microgravity, exploration).
International Nuclear Information System (INIS)
Jung, Yun Sik; Lee, Jae Young; Kim, Man Woong
2004-01-01
The moderator cooling system to the Calandria tank of CANDU nuclear power plant provides an alternative pass of heat sink during the hypothetical loss of coolant accident. Also, the neutron population in the CANDU plant can be affected by the moderator temperature change which strongly depends on the circulating flow pattern in the Calandria tank. It has been known that there are three distinguished flow patterns: the buoyancy dominated flow, the momentum dominated flow, and the mixed type flow. The Canadian Nuclear Safety Commission (CNSC) recommended that a series of experimental works should be performed to verify the three dimensional codes. Two existing facilities, SPEL (1982) and STERN (1990), have produced experimental data for these purposes. The present work is also motivated to build up a new scaled experimental facility named HGU for the same purposes. CANDU-6 was selected as the target plant to be scaled down. In the design for the scaled facility, the knowledge on the flow regime transitions in the circulating flow was imperative. In the present study, to pave the way for the scaling, the flow pattern maps of circulating flow were constructed based on the Reynolds number and Archimedes number. The CFX code was employed with real meshes to represent all calandria tubes in the tank. The flow pattern maps were constructed for SPEL, STERN, HGU, and CANDU6. As the key transition criterion useful for scaling law, a new Archimedes number considering the jet impingement of the feed water in the Calandria tank was found. The transition of flow patterns was made with the same Archimedes number for CANDU6, STERN and HGU. However, SPEL which has third of the modified Archimedes number showed different maps in the wider region of mixed flow pattern was observed. It was found that the Archimedes number considering the inlet nozzle velocity plays the key role in patterns classification. Also, it can be suggested that the moderator cooling system needs to be designed
International Nuclear Information System (INIS)
Park, Sung Hweon
1984-03-01
This book is for researchers and engineers, which is written to focus on practical design of experiments. It gives descriptions of conception of design of experiments, basic statistics theory, one way design of experiment, two-way layout without repetition, two-way layout with repetition, partition, a correlation analysis and regression analysis, latin squares, factorial design, design of experiment by table of orthogonal arrays, design of experiment of response surface, design of experiment on compound, Evop, and design of experiment of taguchi.
Wunschel, D S; Hutchison, J R; Deatherage Kaiser, B L; Merkley, E D; Hess, B M; Lin, A; Warner, M G
2017-12-18
The process of sporulation is vital for the stability and infectious cycle of Bacillus anthracis. The spore is the infectious form of the organism and therefore relevant to biodefense. While the morphological and molecular events occurring during sporulation have been well studied, the influence of growth medium and temperature on the proteins expressed in sporulated cultures is not well understood. Understanding the features of B. anthracis sporulation specific to natural vs. laboratory production will address an important question in microbial forensics. In an effort to bridge this knowledge gap, a system for sporulation on two types of agar-immobilized soils was used for comparison to cultures sporulated on two common types of solid laboratory media, and one liquid sporulation medium. The total number of proteins identified as well as their identity differed between samples generated in each medium and growth temperature, demonstrating that sporulation environment significantly impacts the protein content of the spore. In addition, a subset of proteins common in all of the soil-cultivated samples was distinct from the expression profiles in laboratory medium (and vice versa). These differences included proteins involved in thiamine and phosphate metabolism in the sporulated cultures produced on soils with a notable increase in expression of ATP binding cassette (ABC) transporters annotated to be for phosphate and antimicrobial peptides. A distinct set of ABC transporters for amino acids, sugars and oligopeptides were found in cultures produced on laboratory media as well as increases in carbon and amino acid metabolism-related proteins. These protein expression changes indicate that the sporulation environment impacts the protein profiles in specific ways that are reflected in the metabolic and membrane transporter proteins present in sporulated cultures.
The Nature of the Micellar Stern Region As Studied by Reaction Kinetics. 2
Buurma, Niklaas J.; Serena, Paola; Blandamer, Michael J.; Engberts, Jan B.F.N.
2004-01-01
The nature of rate-retarding effects of cationic micelles on the water-catalyzed hydrolyses of a series of para-substituted 1-benzoyl-1,2,4-triazoles (1a-f) and 1-benzoyl-3-phenyl-1,2,4-triazole (2) has been studied using kinetic methods. A comparison is drawn between medium effects in the micellar
Critical Exchange: Peculiar Bedfellows--Gender, Sexuality, Religion and Schooling: A Reply to Stern
Rasmussen, Mary L.
2017-01-01
Mary L. Rasmussen is a sociologist of education with expertise in studies of gender and sexuality. This angle of scrutiny (Harwood 2006) is her point of departure in conversations about schooling and religion. From this angle, Rasmussen believes that schooling and religion can be incredibly powerful in creating community. She is also clear that…
CERN. Geneva; Franklin, M
2001-01-01
These will be a set of lectures on classic particle physics experiments, with emphasis on how the emasurements are made. I will discuss experiments made to measure the electric charge distribution of particles, to measure the symmetries of the weak decays, to measure the magnetic moment of the muon. As well as experiments performed which discovered new particles or resonances, like the tAU2and the J/Psi. The coverage will be general and should be understandable to someone knowing little particle physics.
DEFF Research Database (Denmark)
Gjedde, Lisa; Ingemann, Bruno
In the beginning was - not the word - but the experience. This phenomenological approach provides the basis for this book, which focuses on how a person-in-situation experiences and constructs meaning from a variety of cultural visual events. This book presents video-based processual methods......, dialogue, moods, values and narratives have been investigated qualitatively with more than sixty informants in a range of projects. The processual methodological insights are put into a theoretical perspective and also presented as pragmatic dilemmas. Researching Experiences is relevant not only...
Particle physics experiments 1986
International Nuclear Information System (INIS)
Stuart, G.W.
1987-01-01
The paper presents research work carried out in 1986 on 52 elementary particle experiments approved by the Particle Physics Experiments Selection Panel. Most of the experiments were collaborative and involved research groups from different countries. About half of the experiments were conducted at CERN, the remaining experiments employed the accelerators: LAMPT, LEP, PETRA, SLAC, and HERA. The contents consist of unedited contributions from each experiment. (U.K.)
re ipit tion re onstru tion using ringEwidth hronology of rim lyn ed r ...
Indian Academy of Sciences (India)
r nges from IHHEEIUS mF hue to he vy r inf ll it does not grow in the e stern rim l y eyond q rhw lF he ringEwidth hronology of rim l y n ed r @eh. IIUIEEIWVVAD prep red from tree ores olle ted from two disjun t m ture forests in western rim l y . @figure IAD h s een used in the present studyF het ils of the methodology ...
Religious Extremism in Pakistan
2014-12-01
Jessica Stern, “Pakistan’s Jihad Culture ,” Foreign Affairs 79, no. 6 (November–December 2000): 115‒126, http://www.jstor.org/stable/20049971; see also...Pakistan’s Jihad Culture ,” Foreign Affairs 79, no. 6 (November‒December 2000): 115‒126, http://www.jstor.org/stable/20049971; Religions and Development...after the JUD was implicated in the Mumbai attack in 2008, protesting that the organization was a charity that helped them by providing food and water
Ionic Liquids in Electro-active Devices (ILED)
2013-12-12
near a charged wall can be modeled by Poisson- Nernst -Planck (PNP) equations , Poisson-Boltzmann (PB) equations , and Gouy-Chapman-Stern (GCS) model...actuators can be calculated from the bending curvature к and the Young’s moduli of the ionic polymer layer Yi and the Au layer Ym by the equation below...Arrhenius equation exp a E p p RT (1) wherein p and aE are the conducting ion concentration as T and the activation energy for conducting
1984-08-01
entrepreneurship -’team made up of J. Stanley programs for people (incentives, and innovation; stern disciplinarians; Baumgartner, Calvin Brown, training, hoopla...they let them know that they were Autonomy and Entrepreneurship important to the success of the pro- Simultaneous Loose-Tight ". ,. Every PM we talked to...account hand, managing a fast-food franchise $40,000 which is now his tax base. "-" (IRA) concept. These refreshing de- is a job that can easily be
Perspectives on the Viable Mobile Virtual Community for Telemedicine
van 't Klooster, J.W.J.R.; Pawar, P.; van Beijnum, Bernhard J.F.; Dulawan, Chariz; Hermens, Hermanus J.
2010-01-01
A virtual community is an electronically supported social network: it can be seen as a group of people who have regular social interaction, independent of time and space, because of a common interest such as a problem, task, or feeling exchange (Eysenbach, Powell, Englesakis, Rizo, & Stern, 2004; Rheingold, 1993). When independence of time and space is achieved through the use of mobile devices and wireless communication technologies, such a virtual community is called a Mobile Virtual Commun...
Bribery: What do Australian managers know and what do they do?
Michael Segon; Chris Booth
2014-01-01
The recent conviction and gaoling of former Rio Tinto executive Stern Hu and as well as a further 18 Australian citizens facing charges in relation to "fraud and other economic crimes raises a number of questions regarding ethical business practice. A key issue that should be considered is whether Australian businesses are as ethical and transparent as the current high ranking in the Transparency International corruption index tends to suggest.This paper reviews literature pertaining to the n...
ORF Alignment: NC_005945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005945 gi|49185498 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci
ORF Alignment: NC_003995 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003995 gi|21400565 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci
ORF Alignment: NC_003997 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003997 gi|30262655 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci
ORF Alignment: NC_007530 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_007530 gi|47527965 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci
Raymond, Ogbuka Obinna
2017-01-01
In analyzing survey data, most researchers and analysts make use of statistical methods with straight forward statistical approaches. More common, is the use of one‐way, two‐way or multi‐way tables, and graphical displays such as bar charts, line charts, etc. A brief overview of these approaches and a good discussion on aspects needing attention during the data analysis process can be found in Wilson & Stern (2001). In most cases however, analysis procedures that go beyond simp...
External heavy atom effect on intersystem crossing reactions of aromatic hydrocarbons
International Nuclear Information System (INIS)
Wojnarovits, L.; Foeldiak, G.
1988-01-01
The external heavy atom effect by xenon on the S 1 → T n and T 1 → S o transitions of naphthalene and pyrene was investigated in hydrocarbon solvents by fluorescence or absorption spectroscopy. The quencher forms a short-lived encounter complex (that may be called exciplex as well) with the excited molecules in equilibrium process. This exciplex formation in solutions with naphthalene leads to some deviation from the Stern-Volmer type concentration dependence of the quenching. (author)
Rational and Emotional Communication in Advertising in Women's Magazines in Brazil
Edward Robinson Marin; Nadia Kassouf Pizzinatto; Antonio Carlos Giuliani
2014-01-01
This article investigated the incidence of rational and emotional arguments in messages from 5.536 advertisements of six women's magazines in Brazil (Claudia, Nova, Estilo, Marie Claire, Elle and Gloss), published between May / 2008 and August / 2009. The methodology was based on an exploratory study, supported on a scale of 14 items, by Resnik and Stern (1977), which recommend matching appeals to attitude toward the product, that is, use informative advertising, based on rational appeals for...
DEFF Research Database (Denmark)
Petersen, Kjell Yngve; Søndergaard, Karin; Augustesen, Christina
2015-01-01
Pixel Experiments The term pixel is traditionally defined as any of the minute elements that together constitute a larger context or image. A pixel has its own form and is the smallest unit seen within a larger structure. In working with the potentials of LED technology in architectural lighting...... lighting design in practice, one quickly experiences and realises that there are untapped potentials in the attributes of LED technology. In this research, speculative studies have been made working with the attributes of LEDs in architectural contexts, with the ambition to ascertain new strategies...... for using LED lighting in lighting design practice. The speculative experiments that have been set-up have aimed to clarify the variables that can be used as parameters in the design of lighting applications; including, for example, the structuring and software control of light. The experiments also...
Monopoli, Bruno; Bistacchi, Andrea; Bertolo, Davide; Dal Piaz, Giovanni; Gouffon, Yves; Massironi, Matteo; Sartori, Mario; Vittorio Dal Piaz, Giorgio
2016-04-01
We know since the beginning of the 20th century, thanks to mapping and structural studies by the Italian Regio Servizio Geologico (Franchi et al., 1908) and Argand's work (1909; 1911; 1916), that the Austroalpine-Penninic collisional wedge of the NW Alps is spectacularly exposed across the Aosta Valley and Valais ranges (Italy and Switzerland). In the 150th anniversary of the first ascent to Ruskin's "most noble cliff in Europe" - the Cervino/Matterhorn (Whymper, July 14th 1865), first described in a geological profile by Giordano (1869) and in a detailed map by Gerlach (1869; 1871), we have seen the conclusion of very detailed mapping projects carried out in the last years over the two regions, with collaborative efforts across the Italy-Switzerland border, constellated by 4000 m-high peaks. These projects have pictured with an unprecedented detail (up to 1:10.000 scale) the geology of this complex region, resulting from pre-Alpine events, Alpine subduction- and collision-related ductile deformations, and finally late-Alpine brittle deformations from the Oligocene to the Present. Based on this dataset, we use up-to-date technology and software to undertake a 3D modelling study aimed at: i) reconstructing the 3D geometry of the principal tectonic units, ii) detecting and unravelling problems and incongruences in the 2D geometrical models, iii) modelling the kinematics of the Oligocene and Miocene brittle fault network using 2D and 3D balancing and palinspastic restoration techniques. In this contribution we mainly discuss the prerequisites of the project. Common geomodelling paradigms (mainly developed for the hydrocarbon industry) cannot be applied in this project due to (i) the little scale, (ii) the source of the data - fieldwork, and (iii) the polyphase ductile and brittle deformations in the metamorphic nappe stack. Our goals at the moment are to model the post-metamorphic fault network and the boundaries of the principal tectonic units, which will be
International Nuclear Information System (INIS)
Bjerknes, R.
1977-01-01
A cybernetic model has been developed to elucidate some of the main principles of the growth regulation system in the epidermis of the hairless mouse. A number of actual and theoretical biological experiments have been simulated on the model. These included simulating the cell kinetics as measured by pulse labelling with tritiated thymidine and by continuous labelling with tritiated thymidine. Other simulated experiments included steady state, wear and tear, painting with a carcinogen, heredity and heredity and tumour. Numerous diagrams illustrate the results of these simulated experiments. (JIW)
International Nuclear Information System (INIS)
Mun, Seok Sik
2005-02-01
This book deals with organic chemistry experiments, it is divided five chapters, which have introduction, the way to write the experiment report and safety in the laboratory, basic experiment technic like recrystallization and extraction, a lot of organic chemistry experiments such as fischer esterification, ester hydrolysis, electrophilic aromatic substitution, aldol reaction, benzoin condensation, wittig reaction grignard reaction, epoxidation reaction and selective reduction. The last chapter introduces chemistry site on the internet and way to find out reference on chemistry.
Vanschoren, Joaquin; Blockeel, Hendrik
Next to running machine learning algorithms based on inductive queries, much can be learned by immediately querying the combined results of many prior studies. Indeed, all around the globe, thousands of machine learning experiments are being executed on a daily basis, generating a constant stream of empirical information on machine learning techniques. While the information contained in these experiments might have many uses beyond their original intent, results are typically described very concisely in papers and discarded afterwards. If we properly store and organize these results in central databases, they can be immediately reused for further analysis, thus boosting future research. In this chapter, we propose the use of experiment databases: databases designed to collect all the necessary details of these experiments, and to intelligently organize them in online repositories to enable fast and thorough analysis of a myriad of collected results. They constitute an additional, queriable source of empirical meta-data based on principled descriptions of algorithm executions, without reimplementing the algorithms in an inductive database. As such, they engender a very dynamic, collaborative approach to experimentation, in which experiments can be freely shared, linked together, and immediately reused by researchers all over the world. They can be set up for personal use, to share results within a lab or to create open, community-wide repositories. Here, we provide a high-level overview of their design, and use an existing experiment database to answer various interesting research questions about machine learning algorithms and to verify a number of recent studies.
Understanding patient experience
DEFF Research Database (Denmark)
Andersen, Tariq O.; Andersen, Pernille R. D.; Kornum, Anders C.
2017-01-01
, safety) arise from getting feedback on symptoms and from continuous and comforting interaction with clinicians. With this paper, we aim to sensitise UX researchers and designers of patient-centred e-health by proposing three UX dimensions: connectedness, comprehension, and compassion.......The term 'patient experience' is currently part of a global discourse on ways to improve healthcare. This study empirically explores what patient experience is in cardiac remote monitoring and considers the implications for user experience (UX). Through interviews around the deployment of a mobile...... app that enables patients to collaborate with clinicians, we unpack experiences in six themes and present narratives of patients' lifeworlds. We find that patients' emotions are grounded in negative feelings (uncertainty, anxiety, loss of hope) and that positive experiences (relief, reassurance...
DEFF Research Database (Denmark)
Smed, Karina Madsen
become part of the individual self, worldview, and behaviour. This paper seeks to explore links between consumer experiences through the exploration of narrative sequences in travel blogs. Findings indicate that non-consumption is a central element to the bloggers and also indicative of a community......Consumers consume products in various ways serving a number of purposes. Much attention has been paid to experiences attached to consumption, sometimes very explicitly, e.g. in tourism, the essence of which is experiences of various sorts, but often also implicitly as internalised experiences...
Analytical chemistry experiment
International Nuclear Information System (INIS)
Park, Seung Jo; Paeng, Seong Gwan; Jang, Cheol Hyeon
1992-08-01
This book deals with analytical chemistry experiment with eight chapters. It explains general matters that require attention on experiment, handling of medicine with keep and class, the method for handling and glass devices, general control during experiment on heating, cooling, filtering, distillation and extraction and evaporation and dry, glass craft on purpose of the craft, how to cut glass tube and how to bend glass tube, volumetric analysis on neutralization titration and precipitation titration, gravimetric analysis on solubility product, filter and washing and microorganism experiment with necessary tool, sterilization disinfection incubation and appendixes.
Using Mixed Methods and Collaboration to Evaluate an Education and Public Outreach Program (Invited)
Shebby, S.; Shipp, S. S.
2013-12-01
Traditional indicators (such as the number of participants or Likert-type ratings of participant perceptions) are often used to provide stakeholders with basic information about program outputs and to justify funding decisions. However, use of qualitative methods can strengthen the reliability of these data and provide stakeholders with more meaningful information about program challenges, successes, and ultimate impacts (Stern, Stame, Mayne, Forss, David & Befani, 2012). In this session, presenters will discuss how they used a mixed methods evaluation to determine the impact of an education and public outreach (EPO) program. EPO efforts were intended to foster more effective, sustainable, and efficient utilization of science discoveries and learning experiences through three main goals 1) increase engagement and support by leveraging of resources, expertise, and best practices; 2) organize a portfolio of resources for accessibility, connectivity, and strategic growth; and 3) develop an infrastructure to support coordination. The evaluation team used a mixed methods design to conduct the evaluation. Presenters will first discuss five potential benefits of mixed methods designs: triangulation of findings, development, complementarity, initiation, and value diversity (Greene, Caracelli & Graham, 2005). They will next demonstrate how a 'mix' of methods, including artifact collection, surveys, interviews, focus groups, and vignettes, was included in the EPO project's evaluation design, providing specific examples of how alignment between the program theory and the evaluation plan was best achieved with a mixed methods approach. The presentation will also include an overview of different mixed methods approaches and information about important considerations when using a mixed methods design, such as selection of data collection methods and sources, and the timing and weighting of quantitative and qualitative methods (Creswell, 2003). Ultimately, this presentation will
Mariana Nicoara, Floare
2016-04-01
My name is Nicoara Floarea and I am teacher at Secondary School Calatele and I teach students from preparatory class and the second grade . They are six-eight years old. In my activity, for introducing scientific concepts to my students, I use various and active methods or traditional methods including experiments. The experiment stimulates students' curiosity, their creativity, the understanding and knowledge taught accessibility. I propose you two such experiments: The life cycle of the plants (long-term experiment, with rigorous observation time):We use beans, wheat or other; They are grown in pots and on the cotton soaked with water,keeping under students' observation protecting them ( just soak them regularly) and we waiting the plants rise. For discussions and comments of plant embryo development we use the plants which rose on the cotton soaked with water plants at the end of the first week. Last school year we had in the pot climbing beans which in May made pods. They were not too great but our experiment was a success. The students could deduce that there will develop those big beans which after drying will be planted again. The influence of light on plants (average duration experiment with the necessary observation time): We use two pots in which plants are of the same type (two geraniums), one of them is situated so as to get direct sunlight and other plant we put in a closed box. Although we wet both plants after a week we see that the plant that benefited from sunlight has turned strain in direct sunlight, developing normally in return the plant out of the box I have yellowed leaves, photosynthesis does not She has occurred . Students will understand the vital role of the Sun in plants' life, both in the classroom and in nature. The experiment is a method of teaching students extremely pleasant, with a remarkable percentage of acquiring more knowledge.
Experiments in computing: a survey.
Tedre, Matti; Moisseinen, Nella
2014-01-01
Experiments play a central role in science. The role of experiments in computing is, however, unclear. Questions about the relevance of experiments in computing attracted little attention until the 1980s. As the discipline then saw a push towards experimental computer science, a variety of technically, theoretically, and empirically oriented views on experiments emerged. As a consequence of those debates, today's computing fields use experiments and experiment terminology in a variety of ways. This paper analyzes experimentation debates in computing. It presents five ways in which debaters have conceptualized experiments in computing: feasibility experiment, trial experiment, field experiment, comparison experiment, and controlled experiment. This paper has three aims: to clarify experiment terminology in computing; to contribute to disciplinary self-understanding of computing; and, due to computing's centrality in other fields, to promote understanding of experiments in modern science in general.
Saha, Dipika; Negi, Devendra P S
2018-01-15
The purpose of the present work was to develop a method for the sensing of thioacetamide by using spectroscopic techniques. Thioacetamide is a carcinogen and it is important to detect its presence in food-stuffs. Semiconductor quantum dots are frequently employed as sensing probes since their absorption and fluorescence properties are highly sensitive to the interaction with substrates present in the solution. In the present work, the interaction between thioacetamide and ZnO quantum dots has been investigated by using UV-visible, fluorescence and infrared spectroscopy. Besides, dynamic light scattering (DLS) has also been utilized for the interaction studies. UV-visible absorption studies indicated the bonding of the lone pair of sulphur atom of thioacetamide with the surface of the semiconductor. The fluorescence band of the ZnO quantum dots was found to be quenched in the presence of micromolar concentrations of thioacetamide. The quenching was found to follow the Stern-Volmer relationship. The Stern-Volmer constant was evaluated to be 1.20×10 5 M -1 . Infrared spectroscopic measurements indicated the participation of the NH 2 group and the sulphur atom of thioacetamide in bonding with the surface of the ZnO quantum dots. DLS measurements indicated that the surface charge of the semiconductor was shielded by the thioacetamide molecules. Copyright © 2017 Elsevier B.V. All rights reserved.
Dong, Conglin; Yuan, Chengqing; Wang, Lei; Liu, Wei; Bai, Xiuqin; Yan, Xinping
2016-01-01
Frictional vibration and noise caused by water-lubricated rubber stern tube bearings, which are generated under extreme conditions, severely threaten underwater vehicles’ survivability and concealment performance. This study investigates the effect of flaky and spherical MoS2 nanoparticles on tribological properties and damping capacity of water-lubricated rubber materials, with the aim of decreasing frictional noise. A CBZ-1 tribo-tester was used to conduct the sliding tests between rubber ring-discs and ZCuSn10Zn2 ring-discs with water lubrication. These materials’ typical mechanical properties were analysed and compared. Coefficients of friction (COFs), wear rates, and surface morphologies were evaluated. Frictional noise and critical velocities of generating friction vibration were examined to corroborate above analysis. Results showed that spherical MoS2 nanoparticles enhanced rubber material’s mechanical and tribological properties and, in turn, reduced the friction noise and critical velocity. Flaky MoS2 nanoparticles reduced COF but did not enhance their mechanical properties, i.e., the damping capacity, wear resistance property; thus, these nanoparticles did not reduce the critical velocity obviously, even though increased the frictional noise at high load. The knowledge gained in the present work will be useful for optimizing friction pairs under extreme conditions to decrease frictional noise of water-lubricated rubber stern tube bearings. PMID:27713573
luxury marketing: internationalization strategies for brazilian jewelry companies
Directory of Open Access Journals (Sweden)
Chaline Gasperini
2010-04-01
Full Text Available This article seeks to make an analysis of the luxury market and of Brazilian jewelry companies. The main objective is to analyze the attraction of external marketing to luxury brands internationalization, emphasizing Brazilian jewelry companies. First, the national environment of luxury market an jewelry in Brazil is presented. In sequence, it will address the possible goals, risks and opportunities that internationalized jewelry companies face in the expansion process and its difficulties in foreign markets. Finally, some forms of internationalization will be presented based on the case of the Brazilian jewelry companies H Stern and Talento Jóias. The methodology used in this article is exploratory, with documental analysis and in depth interview. As theoretical foundations for the article, the themes luxury, exportations, company internationalization and global market were addressed. The main author(s researched were: Allérès (2006, Almeida (2007, Czinkota (2001, Grande (2007, Lipovetsky e Roux (2005. Among the main conclusions, Brazilian jewelry companies have great advantages compared to other countries, having the possibility to use Brazilian nature resources, like precious stones and gems, thus, it become more interesting and viable to innovate and conquer external market. Besides, jewelry market attractions make several entrepreneurs interested in opening business in this field, and lately internationalize them, such as H Stern case.
International Nuclear Information System (INIS)
Yuan Jipei; Guo Weiwei; Wang Erkang
2008-01-01
The unique surface-sensitive properties make quantum dots (QDs) great potential in the development of sensors for various analytes. However, quantum dots are not only sensitive to a certain analyte, but also to the surrounding conditions. The controlled response to analyte may be the first step in the designing of functional quantum dots sensors. In this study, taking the quenching effect of benzoquinone (BQ) on CdTe QDs as model, several critical parameters of buffer solution conditions with potential effect on the sensors were investigated. The pH value and the concentration of sodium citrate in the buffer solution critically influenced the quenching effects of BQ. Dozens folds elevation of the quenching extents were observed with the increase of concentrations of H + and sodium citrate, and the quenching mechanisms were also fundamentally different with the changes of the surrounding buffer solutions. The quenching models were proposed and analyzed at different buffer conditions. Taking pH values for example, QDs quenching obeyed the sphere of effective quenching model with the sphere radii of 8.29 nm at pH 8.0, the linear Stern-Volmer equation with Stern-Volmer constant of 2.0 x 10 3 mol -1 L at pH 7.0, and the two binding site static quenching model at basic conditions. The elucidation of parameters for assay performance was important in the development of QDs-based optical sensors
Photophysics of tryptophan in H2O, D2O, and in nonaqueous solvents
International Nuclear Information System (INIS)
Gudgin, E.; Lopez-Delgado, R.; Ware, W.R.
1983-01-01
The fluorescence properties of tryptophan in water and deuterated water have been examined. Tryptophan molecules exhibit three distinct fluorescence lifetimes in water which become longer in deuterated water; the two shorter lifetimes are present below the pK of the amino group and the long lifetime appears as the pH is raised through this pK. The steady-state quenching of tryptophan fluorescence by hydrogen ion in the region of pH less than 3 shows a definite wavelength effect, consistent with less-pronounced quenching of the subnanosecond component whose emission maximum is at 330 nm. The Stern-Volmer plots show a marked curvature in the direction of decreasing Stern-Volmer constant as [H 3 O + ] increases. Deuterium ion also quenches tryptophan fluorescence at low pD. A kinetic scheme is proposed which reproduces both the steady-state and lifetime quenching results. Tryptophan in methanol or ethanol exhibits three fluorescence lifetimes; the relative percentage of the long component vs. the intermediate component can be varied by the addition of triethylamine or acid. In dimethyl sulfoxide, tryptophan and tryptophan deuterated at the amino and ring nirogen positions show identical behavior, both having the same decay parameters. These results are discussed in light of the theories which have recently been proposed to account for the several components in tryptophan fluorescence decay. Solvent interaction is suggested to play a critical role
Particle physics experiments 1982
International Nuclear Information System (INIS)
Rousseau, M.D.; Stuart, G.
1983-01-01
Work carried out in 1982 on 52 experiments approved by the Particle Physics Experiments Selection Panel is described. Each experiment is listed under title, collaboration, technique, accelerator, year of running, status and spokesman. Unedited contributions are given from each experiment. (U.K.)
Framework of product experience
Desmet, P.; Hekkert, P.
2007-01-01
In this paper, we introduce a general framework for product experience that applies to all affective responses that can be experienced in human-product interaction. Three distinct components or levels of product experiences are discussed: aesthetic experience, experience of meaning, and emotional
Experience in Design and Learning Approaches – Enhancing the Framework for Experience
Directory of Open Access Journals (Sweden)
Merja L.M. Bauters
2017-06-01
Full Text Available In design and learning studies, an increasing amount of attention has been paid to experience. Many design approaches relate experience to embodiment and phenomenology. The growth in the number of applications that use the Internet of Things (IoT has shifted human interactions from mobile devices and computers to tangible, material things. In education, the pressure to learn and update skills and knowledge, especially in work environments, has underlined the challenge of understanding how workers learn from reflection while working. These directions have been fuelled by research findings in the neurosciences, embodied cognition, the extended phenomenological–cognitive system and the role of emotions in decision-making and meaning making. The perspective on experience in different disciplines varies, and the aim is often to categorise experience. These approaches provide a worthwhile view of the importance of experience in learning and design, such as the recent emphasis on conceptual and epistemological knowledge creation. In pragmatism, experience plays a considerable role in research, art, communication and reflection. Therefore, I rely on Peirce’s communicative theory of signs and Dewey’s philosophy of experience to examine how experience is connected to reflection and therefore how it is necessarily tangible.
Popper's Thought Experiment Reinvestigated
Richardson, Chris; Dowling, Jonathan
2012-02-01
Karl Popper posed an interesting thought experiment in 1934. With it, he meant to question the completeness of quantum mechanics. He claimed that the notion of quantum entanglement leads to absurd scenarios that cannot be true in real life and that an implementation of his thought experiment would not give the results that QM predicts. Unfortunately for Popper, it has taken until recently to perform experiments that test his claims. The results of the experiments do not refute QM as Popper predicted, but neither do they confirm what Popper claimed QM predicted. Kim and Shih implemented Popper's thought experiment in the lab. The results of the experiment are not clear and have instigated many interpretations of the results. The results show some correlation between entangled photons, but not in the way that Popper thought, nor in the way a simple application of QM might predict. A ghost-imaging experiment by Strekalov, et al. sheds light on the physics behind Popper's thought experiment, but does not try to directly test it. I will build the physics of Popper's thought experiment from the ground up and show how the results of both of these experiments agree with each other and the theory of QM, but disprove Popper.
Adaptive structures flight experiments
Martin, Maurice
The topics are presented in viewgraph form and include the following: adaptive structures flight experiments; enhanced resolution using active vibration suppression; Advanced Controls Technology Experiment (ACTEX); ACTEX program status; ACTEX-2; ACTEX-2 program status; modular control patch; STRV-1b Cryocooler Vibration Suppression Experiment; STRV-1b program status; Precision Optical Bench Experiment (PROBE); Clementine Spacecraft Configuration; TECHSAT all-composite spacecraft; Inexpensive Structures and Materials Flight Experiment (INFLEX); and INFLEX program status.
Drndarski, Marina
2015-04-01
Every 21st century student is expected to develop science literacy skills. As this is not part of Serbian national curriculum yet, we decided to introduce it with this project. Experiment-o-mania provides students to experience science in different and exciting way. It makes opportunity for personalized learning offering space and time to ask (why, where, how, what if) and to try. Therefore, we empower young people with skills of experimenting, and they love science back. They ask questions, make hypothesis, make problems and solve them, make mistakes, discuss about the results. Subsequently this raises the students' interest for school curriculum. This vision of science teaching is associated with inquiry-based learning. Experiment-o-mania is the unique and recognizable teaching methodology for the elementary school Drinka Pavlović, Belgrade, Serbia. Experiment-o-mania implies activities throughout the school year. They are held on extra class sessions, through science experiments, science projects or preparations for School's Days of science. Students learn to ask questions, make observations, classify data, communicate ideas, conduct experiments, analyse results and make conclusions. All science teachers participate in designing activities and experiments for students in Experiment-o-mania teaching method. But they are not alone. Teacher of fine arts, English teachers and others also take part. Students have their representatives in this team, too. This is a good way to blend knowledge among different school subject and popularize science in general. All the experiments are age appropriate and related to real life situations, local community, society and the world. We explore Fibonacci's arrays, saving energy, solar power, climate change, environmental problems, pollution, daily life situations in the country or worldwide. We introduce great scientists as Nikola Tesla, Milutin Milanković and sir Isaac Newton. We celebrate all relevant international days, weeks
ORF Alignment: NC_007530 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_007530 gi|47530092 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain protein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom
2014-01-01
M.A. (Geography and Environmental Management) Water can be regarded as a scarce commodity in South Africa and one cannot rely solely on the discovery of new water resources to meet the ever increasing demands. Water is arguably the most precious resource in South Africa and its proper management in all spheres of activity is imperative ( Middleton and Stern,1987 ). This is no different in the mining industry where a primary consumptive use of water is in the tailings dams and associated re...
1975-07-07
ship because of increese of propeller efficiency and saving on the high cost of difficult to obtain materials (bronze, brass, stainless steel). The...indAjate that. x :axmuin stresses in the blade cross section are the cor-,prc-.,; ivFe norm-al strcs3es at point G. The maximom tensile stres-ses cis a...and stern part of the ship. Because of purely technical difficulties and also because of the relatively high cost of preparations for such tests, only
The United States Navy and Israeli Navy: Background, Current Issues, Scenarios, and Prospects
2012-02-01
second missile flew a sea- skimming profile, and hit the ship’s crane on the stern, near the ship’s helicopter pad.67 Hanit is a stealthy design, with a...IN had a long-standing mission of protecting the sea lines of communication to Israel, as well as preventing terrorists from penetrating its...economic conditions—there is currently a glut of gas on the world market —Israel could become a net exporter of gas.75 The prospect of offshore gas
Deep Drilling Results in the Atlantic Ocean: Ocean Crust
1979-01-01
the volcano Agua de Pau. //i ( ,.which nas eruted 5 tir-es in tile past 4.600 / ye,.rs, the last in 1563. Xumerous not springs S/ o3220 an’ soradic...complex. In a study layered structure and physical properties to of ophiolite complexes in southern Chile , de Wit ce those of oceanic crust...Spooner et al, 1977) and and Govett, 1973). A large lens, for example that S. Chile (Stern et al, 1976). Zeolite to amphib- at Skouriotissa, had a
Bättig, Michèle B.; Bernauer, Thomas
2017-01-01
This article examines whether democracies contribute more to the provision of global public goods. It thus contributes to the debate on the effects of domestic institutions on international cooperation. The focus is on human-induced climate change, in Stern's words "the biggest market failure the world has ever seen.” Using new data on climate change cooperation we study a cross-section of 185 countries in 1990-2004. The results show that the effect of democracy on levels of political commitm...
A Goal Programming Model for the Siting of Multilevel EMS Systems.
1980-03-01
Management," unpublished Ph.D. thesis, University of Texas, Austin, Texas, 1971. -23- (11) Daskin , M. and E. Stern, " A Multiobjective Set Covering...GOAL PROGRAM4MING MODEL FOR THE SITING OF MULTILEVEL EMS SYSTE-ETC(U) UNM1AR 80 A CHARNES, J E STORBECK N000iA-75-C-569 WICLASSIFIED CCS-366 N...366 A GOAL PROGRAMMING MODEL FOR THE SITING OF MULTILEVEL EMS SYSTEMS by A . Charnes J. Storbeck March 1980 This project was partially supported by
International Nuclear Information System (INIS)
Abelin, H.; Birgersson, L.; Widen, H.; Aagren, T.; Moreno, L.; Neretnieks, I.
1990-07-01
Channeling of water flow and tracer transport in real fractures in a granite body at Stripa have been investigated experimentally. The experimental site was located 360 m below the ground level. Two kinds of experiments were performed. In the single hole experiments, 20 cm diameter holes were drilled about 2.5 m into the rock in the plane of the fracture. Specially designed packers were used to inject water into the fracture in 5 cm intervals all along the fracture trace in the hole. The variation of the injection flowrates along the fracture were used to determine the transmissivity variations in the fracture plane. Detailed photographs were taken from inside the hole and the visual fracture aperture was compared with the injection flowrates in the same locations. Geostatistical methods were used to evaluate the results. Five holes were measured in great detail. In addition 7 holes were drilled and scanned by simpler packer systems. A double hole experiment was performed where two parallel holes were drilled in the same fracture plane at nearly 2 m distance. Pressure pulse tests were made between the holes in both directions. Tracers were injected in 5 locations in one hole and monitored for in many locations in the other hole. The single hole experiment and the double hole experiment show that most of the fracture planes are tight but that there are open sections which form connected channels over distances of at least 2 meters. It was also found in the double hole experiment that the investigated fracture was intersected by at least one fracture between the two holes which diverted a large amount of the injected tracers to several distant locations at the tunnel wall. (authours)
The ERASMUS experiment archive
Isakeit, Dieter; Sabbatini, Massimo; Carey, William
2005-08-01
The Erasmus Experiment Archive is an electronic database, accessible through the Internet, that collects in a single reference repository scientific, technical and operational information regarding the experiments performed in the experiment facilities which fall under the responsibility of the ESA Directorate of Human Spaceflight, Microgravity and Exploration. The archive is operated, filled with content and kept up-to-date by the Erasmus User Centre. which forms part of the Directorate. The archive shares its records and is interoperable with similar experiment archives of the partner agencies NASA USA) and JAXA (Japan) through a mutually agreed standard for experiment records called the International Distributed Experiment Archive (IDEA).
International Nuclear Information System (INIS)
Chang, C.; Yodh, G.; Cutts, D.; Lanou, R.; Engels, E.; Kramer, M.; Danby, G.
1977-01-01
A study was made to examine the effects which raising the ISA from 200 x 200 GeV to 400 x 400 GeV would have on the ''canonical'' experiments. These were ''canonical'' in the sense that they span the full range of foreseeable physics and have served as topics in previous Summer Studies and Workshops which resulted in quite explicit hardware designs and experimental goals. The study results indicate that all of the ''canonical'' experiments survive. Some are actually improved, some are unaffected, and some require changes which are suggested. In general, the 90 0 experiments are relatively unaffected. The single arm small angle spectrometer, the wide aperture (FATS-WASP) spectrometer and the Coulomb interference experiment have the largest number of modifications suggested. No uniqueness to these solutions are claimed, and there may be more desirable radical approaches. It is, however, felt that the 400 x 400 GeV ISA not only permits the work on conceptual experiments from previous Summer Studies to be taken over entirely, but indicates areas of improvement in many of them. Specifics of the individual experiments are discussed
Diagnostics for pellet experiments
International Nuclear Information System (INIS)
Johnson, R.R.
1978-01-01
The target diagnostics which are being used and planned in current laser driven ICF Experiments are described. Most of these diagnostics can be easily applied to future ion-beam fusion experiments. The status of laser fusion diagnostics has been much improved in the last 5 years and further improvements can be expected and should be available when the first ICF experiments using ion beams are performed. As an example, x-ray temporal and spatial resolutions are now approximately 5 psec and 3 μm, which is approximately a factor of 4 better than the resolution reported in the first implosion experiments. As one plans ahead for ion-beam fusion experiments it should be emphasized that high yield experiments are easier to diagnose provided adequate shielding is employed. However, in the event that the first high yield experiments fail it will be necessary to have diagnostics available to determine where the problems lie. In laser fusion it is interesting to note that higher laser powers are required now for breakeven experiments than first anticipated, mainly because some aspects of the laser-interaction physics were not recognized until the experiments were carefully diagnosed. Thus as has been pointed out, it may be necessary to increase the energy of the ion-beam driver to enable us to do breakeven experiments with high confidence
Waltemath, Dagmar; Adams, Richard; Bergmann, Frank T; Hucka, Michael; Kolpakov, Fedor; Miller, Andrew K; Moraru, Ion I; Nickerson, David; Sahle, Sven; Snoep, Jacky L; Le Novère, Nicolas
2011-12-15
The increasing use of computational simulation experiments to inform modern biological research creates new challenges to annotate, archive, share and reproduce such experiments. The recently published Minimum Information About a Simulation Experiment (MIASE) proposes a minimal set of information that should be provided to allow the reproduction of simulation experiments among users and software tools. In this article, we present the Simulation Experiment Description Markup Language (SED-ML). SED-ML encodes in a computer-readable exchange format the information required by MIASE to enable reproduction of simulation experiments. It has been developed as a community project and it is defined in a detailed technical specification and additionally provides an XML schema. The version of SED-ML described in this publication is Level 1 Version 1. It covers the description of the most frequent type of simulation experiments in the area, namely time course simulations. SED-ML documents specify which models to use in an experiment, modifications to apply on the models before using them, which simulation procedures to run on each model, what analysis results to output, and how the results should be presented. These descriptions are independent of the underlying model implementation. SED-ML is a software-independent format for encoding the description of simulation experiments; it is not specific to particular simulation tools. Here, we demonstrate that with the growing software support for SED-ML we can effectively exchange executable simulation descriptions. With SED-ML, software can exchange simulation experiment descriptions, enabling the validation and reuse of simulation experiments in different tools. Authors of papers reporting simulation experiments can make their simulation protocols available for other scientists to reproduce the results. Because SED-ML is agnostic about exact modeling language(s) used, experiments covering models from different fields of research
2011-01-01
Background The increasing use of computational simulation experiments to inform modern biological research creates new challenges to annotate, archive, share and reproduce such experiments. The recently published Minimum Information About a Simulation Experiment (MIASE) proposes a minimal set of information that should be provided to allow the reproduction of simulation experiments among users and software tools. Results In this article, we present the Simulation Experiment Description Markup Language (SED-ML). SED-ML encodes in a computer-readable exchange format the information required by MIASE to enable reproduction of simulation experiments. It has been developed as a community project and it is defined in a detailed technical specification and additionally provides an XML schema. The version of SED-ML described in this publication is Level 1 Version 1. It covers the description of the most frequent type of simulation experiments in the area, namely time course simulations. SED-ML documents specify which models to use in an experiment, modifications to apply on the models before using them, which simulation procedures to run on each model, what analysis results to output, and how the results should be presented. These descriptions are independent of the underlying model implementation. SED-ML is a software-independent format for encoding the description of simulation experiments; it is not specific to particular simulation tools. Here, we demonstrate that with the growing software support for SED-ML we can effectively exchange executable simulation descriptions. Conclusions With SED-ML, software can exchange simulation experiment descriptions, enabling the validation and reuse of simulation experiments in different tools. Authors of papers reporting simulation experiments can make their simulation protocols available for other scientists to reproduce the results. Because SED-ML is agnostic about exact modeling language(s) used, experiments covering models from
Kahn, J
2017-01-01
Set to begin data taking at the end of 2018, the Belle II experiment is the next-generation B-factory experiment hosted at KEK in Tsukuba, Japan. The experiment represents the cumulative effort from the collaboration of experimental and detector physics, computing, and software development. Taking everything learned from the previous Belle experiment, which ran from 1998 to 2010, Belle II aims to probe deeper than ever before into the field of heavy quark physics. By achieving an integrated luminosity of 50 ab−1 and accumulating 50 times more data than the previous experiment across its lifetime, along with a rewritten analysis framework, the Belle II experiment will push the high precision frontier of high energy physics. This paper will give an overview of the key components and development activities that make the Belle II experiment possible.
Virtual neutron scattering experiments
DEFF Research Database (Denmark)
Overgaard, Julie Hougaard; Bruun, Jesper; May, Michael
2016-01-01
We describe how virtual experiments can be utilized in a learning design that prepares students for hands-on experiments at large-scale facilities. We illustrate the design by showing how virtual experiments are used at the Niels Bohr Institute in a master level course on neutron scattering....... In the last week of the course, students travel to a large-scale neutron scattering facility to perform real neutron scattering experiments. Through student interviews and survey answers, we argue, that the virtual training prepares the students to engage more fruitfully with experiments by letting them focus...... on physics and data rather than the overwhelming instrumentation. We argue that this is because they can transfer their virtual experimental experience to the real-life situation. However, we also find that learning is still situated in the sense that only knowledge of particular experiments is transferred...
Experiments in physical chemistry
Wilson, J M; Denaro, A R
1968-01-01
Experiments in Physical Chemistry, Second Edition provides a compilation of experiments concerning physical chemistry. This book illustrates the link between the theory and practice of physical chemistry. Organized into three parts, this edition begins with an overview of those experiments that generally have a simple theoretical background. Part II contains experiments that are associated with more advanced theory or more developed techniques, or which require a greater degree of experimental skill. Part III consists of experiments that are in the nature of investigations wherein these invest
Particle physics experiments 1983
International Nuclear Information System (INIS)
Stuart, G.W.
1983-01-01
The report describes work carried out in 1983 on experiments approved by the Particle Physics Experiments Selection Panel. The contents consist of unedited contributions from each experiment. (author)
The Information Science Experiment System - The computer for science experiments in space
Foudriat, Edwin C.; Husson, Charles
1989-01-01
The concept of the Information Science Experiment System (ISES), potential experiments, and system requirements are reviewed. The ISES is conceived as a computer resource in space whose aim is to assist computer, earth, and space science experiments, to develop and demonstrate new information processing concepts, and to provide an experiment base for developing new information technology for use in space systems. The discussion covers system hardware and architecture, operating system software, the user interface, and the ground communication link.
International Nuclear Information System (INIS)
Drake, R.P.
1985-11-01
The Nova laser, at the Lawrence Livermore National Laboratory, provides unique opportunities for target experiments. It has unprecedented energy on target and significant flexibility. The paper presented by John Hunt described the capabilities and the status of Nova. This paper discusses plans for future experiments using Nova, and the present status of target experiments. We plan to perform high-quality physics experiments that exploit the unique capabilities of Nova. Because this is our goal, we are fielding an extensive array of well-characterized target diagnostics to measure the emissions from the target. The first section of this paper discusses the basic target diagnostics. We are also taking care to quantify the performance of the laser
Directory of Open Access Journals (Sweden)
Chiu Choi
2017-02-01
Full Text Available Transient response such as ringing in a control system can be reduced or removed by velocity feedback. It is a useful control technique that should be covered in the relevant engineering laboratory courses. We developed velocity feedback experiments using two different low cost technologies, viz., operational amplifiers and microcontrollers. These experiments can be easily integrated into laboratory courses on feedback control systems or microcontroller applications. The intent of developing these experiments was to illustrate the ringing problem and to offer effective, low cost solutions for removing such problem. In this paper the pedagogical approach for these velocity feedback experiments was described. The advantages and disadvantages of the two different implementation of velocity feedback were discussed also.
The International Heat Pipe Experiment. [international cooperation zero g experiment
Mcintosh, R.; Ollendorf, S.; Harwell, W.
1976-01-01
The aims of the experiment are outlined. Flight experiments included in this program were provided by NASA, Goddard Space Flight Center, ESA (European Space Agency), the German Ministry of Technology, Hughes Aircraft Company and NASA, Ames Research Center.
Virtual neutron scattering experiments
DEFF Research Database (Denmark)
Overgaard, Julie Hougaard; Bruun, Jesper; May, Michael
2017-01-01
. In the last week of the course, students travel to a large-scale neutron scattering facility to perform real neutron scattering experiments. Through student interviews and survey answers, we argue, that the virtual training prepares the students to engage more fruitfully with experiments by letting them focus......We describe how virtual experiments can be utilized in a learning design that prepares students for hands-on experiments at large-scale facilities. We illustrate the design by showing how virtual experiments are used at the Niels Bohr Institute in a master level course on neutron scattering...
Explicating Experience: Development of a Valid Scale of Past Hazard Experience for Tornadoes.
Demuth, Julie L
2018-03-23
People's past experiences with a hazard theoretically influence how they approach future risks. Yet, past hazard experience has been conceptualized and measured in wide-ranging, often simplistic, ways, resulting in mixed findings about its relationship with risk perception. This study develops a scale of past hazard experiences, in the context of tornadoes, that is content and construct valid. A conceptual definition was developed, a set of items were created to measure one's most memorable and multiple tornado experiences, and the measures were evaluated through two surveys of the public who reside in tornado-prone areas. Four dimensions emerged of people's most memorable experience, reflecting their awareness of the tornado risk that day, their personalization of the risk, the intrusive impacts on them personally, and impacts experienced vicariously through others. Two dimensions emerged of people's multiple experiences, reflecting common types of communication received and negative emotional responses. These six dimensions are novel in that they capture people's experience across the timeline of a hazard as well as intangible experiences that are both direct and indirect. The six tornado experience dimensions were correlated with tornado risk perceptions measured as cognitive-affective and as perceived probability of consequences. The varied experience-risk perception results suggest that it is important to understand the nuances of these concepts and their relationships. This study provides a foundation for future work to continue explicating past hazard experience, across different risk contexts, and for understanding its effect on risk assessment and responses. © 2018 Society for Risk Analysis.
Particle physics experiments 1987
International Nuclear Information System (INIS)
Stuart, G.W.
1988-01-01
This report describes work carried out in 1987 on experiments approved by the Particle Physics Experiments Selection Panel (United Kingdom). The contents consist of unedited contributions from each experiment. (author)
Understanding customer experience.
Meyer, Christopher; Schwager, Andre
2007-02-01
Anyone who has signed up for cell phone service, attempted to claim a rebate, or navigated a call center has probably suffered from a company's apparent indifference to what should be its first concern: the customer experiences that culminate in either satisfaction or disappointment and defection. Customer experience is the subjective response customers have to direct or indirect contact with a company. It encompasses every aspect of an offering: customer care, advertising, packaging, features, ease of use, reliability. Customer experience is shaped by customers' expectations, which largely reflect previous experiences. Few CEOs would argue against the significance of customer experience or against measuring and analyzing it. But many don't appreciate how those activities differ from CRM or just how illuminating the data can be. For instance, the majority of the companies in a recent survey believed they have been providing "superior" experiences to customers, but most customers disagreed. The authors describe a customer experience management (CEM) process that involves three kinds of monitoring: past patterns (evaluating completed transactions), present patterns (tracking current relationships), and potential patterns (conducting inquiries in the hope of unveiling future opportunities). Data are collected at or about touch points through such methods as surveys, interviews, focus groups, and online forums. Companies need to involve every function in the effort, not just a single customer-facing group. The authors go on to illustrate how a cross-functional CEM system is created. With such a system, companies can discover which customers are prospects for growth and which require immediate intervention.
Particle physics experiments 1989
International Nuclear Information System (INIS)
Bairstow, R.
1990-01-01
This report describes work carried out in 1989 on experiments approved by the Particle Physics Experiments Selection Panel of Rutherford Appleton Laboratory. The contents consist of unedited contributions from each experiment. (author)
Experiment data report for LOFT Boron dilution Experiment L6-6
International Nuclear Information System (INIS)
Stitt, B.D.; Divine, J.M.
1982-06-01
Selected pertinent and uninterpreted data from the sixth anticipated transient experiment (Experiment L6-6) conducted in the Loss-of-Fluid Test (LOFT) facility are presented. Experiment L6-6 simulated a boron dilution accident by injecting demineralized water into the primary coolant system (PCS) at a rate of 0.47 L/s while the reactor was in a cold shutdown condition with the control rods withdrawn. System pressure was maintained at approximately 285 kPa throughout the experiment. The experiment was divided into two parts. In the first part, L6-6A, a recirculation flow of 4.7 L/s was maintained through the PCS and criticality was achieved 7416 +- 10 s after the initiation of the dilution flow. The second part, L6-6B, was identical to L6-6A except that a recirculation flow of 9.5 L/s was maintained and criticality occurred at 8058 +- 10 s
LDR structural experiment definition
Russell, R. A.
1988-01-01
A system study to develop the definition of a structural flight experiment for a large precision segmented reflector on the Space Station was accomplished by the Boeing Aerospace Company for NASA's Langley Research Center. The objective of the study was to use a Large Deployable Reflector (LDR) baseline configuration as the basis for focusing an experiment definition, so that the resulting accommodation requirements and interface constraints could be used as part of the mission requirements data base for Space Station. The primary objectives of the first experiment are to construct the primary mirror support truss and to determine its structural and thermal characteristics. Addition of an optical bench, thermal shield and primary mirror segments, and alignment of the optical components, would occur on a second experiment. The structure would then be moved to the payload point system for pointing, optical control, and scientific optical measurement for a third experiment. Experiment 1 will deploy the primary support truss while it is attached to the instrument module structure. The ability to adjust the mirror attachment points and to attach several dummy primary mirror segments with a robotic system will also be demonstrated. Experiment 2 will be achieved by adding new components and equipment to experiment one. Experiment 3 will demonstrate advanced control strategies, active adjustment of the primary mirror alignment, and technologies associated with optical sensing.
Stimulated Brillouin scattering experiments
International Nuclear Information System (INIS)
Slater, D.C.; Berger, R.L.; Busch, G.; Kinzer, C.M.; Mayer, F.J.; Powers, L.V.; Tanner, D.J.
1981-01-01
This report describes two experiments in which SBS would be expected to play an important role. In the first experiment, we find a clear signature of the Brillouin backscatter of a short (100 psec) pulse from a long (approx. 50 μm) gradient length gas target plasma. The second experiment used much longer (approx. 1 nsec) pulses on spherical glass shell targets. These experiments were done with both narrow ( 30A) bandwidth laser light. Using one-dimensional, spherically symmetric fluid simulations, we have attempted to model many of the laser-plasma interaction processes which combine to determine the amount of absorbed energy in the long-pulse experiments. These simulations indicate that modest laser bandwidths are successful in reducing the level of SBS at the irradiances ( 15 W/cm 2 ) used in these experiments