Antibiotic Overproduction in Steptomyces coelicolor A3(2) Mediated by Phosphofructokinase Deletion
DEFF Research Database (Denmark)
Borodina, Irina; Siebring, Jeroen; Zhang, Jie
2008-01-01
the primary metabolism. High level production of antibiotics in streptomycetes therefore requires engineering of the primary metabolism. Here we demonstrate this by targeting a key enzyme in glycolysis, phosphofructokinase, leading to improved antibiotic production in Streptomyces coelicolor A3(2). Deletion...... of pfkA2 (SCO5426), one of three annotated pfkA homologues in S. coelicolor A3(2), resulted in a higher production of the pigmented antibiotics actinorhodin and undecylprodigiosin. The pfkA2 deletion strain had an increased carbon flux through the pentose phosphate pathway, as measured by C-13 metabolic....... Through genome-scale metabolic model simulations, we predicted that decreased phosphofructokinase activity leads to an increase in pentose phosphate pathway flux and in flux to pigmented antibiotics and pyruvate. Integrated analysis of gene expression data using a genome-scale metabolic model further...
Formation and dispersion of mycelial pellets of Streptomyces coelicolor A3(2).
Kim, Yul-Min; Kim, Jae-heon
2004-03-01
The pellets from a culture of Streptomyces coelicolor A3(2) that were submerged shaken were disintegrated into numerous hyphal fragments by DNase treatment. The pellets were increasingly dispersed by hyaluronidase treatment, and mycelial fragments were easily detached from the pellets. The submerged mycelium grew by forming complexes with calcium phosphate precipitates or kaolin, a soil particle. Therefore, the pellet formation of Streptomyces coelicolor A3(2) can be considered a biofilm formation, including the participation of adhesive extracellular polymers and the insoluble substrates.
Production of actinorhodin-related ''blue pigments'' by Streptomyces coelicolor A3(2)
Bystrykh, LV; FernandezMoreno, MA; Herrema, JK; Malpartida, F; Hopwood, DA; Dijkhuizen, L
The genetically well-known strain Streptomyces coelicolor A3(2) produces the pH indicator (red/blue) antibiotic actinorhodin, but not all the ''blue pigment'' produced by this strain is actinorhodin. When the organism was subjected to various nutrient limitations (ammonium, nitrate, phosphate, or
DEFF Research Database (Denmark)
Sohoni, Sujata Vijay; Fazio, Alessandro; Workman, Christopher
2014-01-01
The objective of this study was the application of the synthetic promoter library (SPL) technology for modulation of actinorhodin production in Streptomyces coelicolor A3(2). The SPL technology was used to optimize the expression of a pathway specific positive transcriptional regulator Actll orf4...... constitutive promoter. ScoSPL20 demonstrated exceptional productivity despite having a comparatively weak expression from the promoter. Interestingly, the ScoSPL20 promoter was activated at a much earlier stage of growth compared to the wild type, demonstrating the advantage of fine-tuning and temporal tuning......, which activates the transcription of the S. coelicolor actinorhodin biosynthetic gene cluster. The native actll orf4 promoter was replaced with synthetic promoters, generating a S. coelicolor library with a broad range of expression levels of actll orf4. The resulting library was screened based...
Sohoni, Sujata Vijay; Fazio, Alessandro; Workman, Christopher T.; Mijakovic, Ivan; Lantz, Anna Eliasson
2014-01-01
The objective of this study was the application of the synthetic promoter library (SPL) technology for modulation of actinorhodin production in Streptomyces coelicolor A3(2). The SPL technology was used to optimize the expression of a pathway specific positive transcriptional regulator ActII orf4, which activates the transcription of the S. coelicolor actinorhodin biosynthetic gene cluster. The native actII orf4 promoter was replaced with synthetic promoters, generating a S. coelicolor library with a broad range of expression levels of actII orf4. The resulting library was screened based on the yield of actinorhodin. Selected strains were further physiologically characterized. One of the strains from the library, ScoSPL20, showed considerably higher yield of actinorhodin and final actinorhodin titer, compared to S. coelicolor wild type and S. coelicolor with actII orf4 expressed from a strong constitutive promoter. ScoSPL20 demonstrated exceptional productivity despite having a comparatively weak expression from the promoter. Interestingly, the ScoSPL20 promoter was activated at a much earlier stage of growth compared to the wild type, demonstrating the advantage of fine-tuning and temporal tuning of gene expression in metabolic engineering. Transcriptome studies were performed in exponential and actinorhodin-producing phase of growth to compare gene expression between ScoSPL20 and the wild type. To our knowledge, this is the first successful application of the SPL technology for secondary metabolite production in filamentous bacteria. PMID:24963940
Transcription analysis of the Streptomyces coelicolor A3(2) rrnA operon
DEFF Research Database (Denmark)
van Wezel, G P; Krab, I M; Douthwaite, S
1994-01-01
Transcription start sites and processing sites of the Streptomyces coelicolor A3(2) rrnA operon have been investigated by a combination of in vivo and in vitro transcription analyses. The data from these approaches are consistent with the existence of four in vivo transcription sites, corresponding...... to the promoters P1-P4. The transcription start sites are located at -597, -416, -334 and -254 relative to the start of the 16S rRNA gene. Two putative processing sites were identified, one of which is similar to a sequence reported earlier in S. coelicolor and other eubacteria. The P1 promoter is likely...... common to P2, P3 and P4 is not similar to any other known consensus promoter sequence. In fast-growing mycelium, P2 appears to be the most frequently used promoter. Transcription from all of the rrnA promoters decreased during the transition from exponential to stationary phase, although transcription...
Production of Actinorhodin-Related ‘‘Blue Pigments’’ by Streptomyces coelicolor A3(2)
Bystrykh, Leonid V.; Fernández-Moreno, Miguel A.; Herrema, Jan K.; Malpartida, Francisco; Hopwood, David A.; Dijkhuizen, Lubbert
1996-01-01
The genetically well-known strain Streptomyces coelicolor A3(2) produces the pH indicator (red/blue) antibiotic actinorhodin, but not all the ‘‘blue pigment’’ produced by this strain is actinorhodin. When the organism was subjected to various nutrient limitations (ammonium, nitrate, phosphate, or
Gottelt, Marco; Kol, Stefan; Gomez-Escribano, Juan Pablo; Bibb, Mervyn; Takano, Eriko
Genome sequencing of Streptomyces coelicolor A3(2) revealed an uncharacterized type I polyketide synthase gene cluster (cpk) Here we describe the discovery of a novel antibacterial activity (abCPK) and a yellow-pigmented secondary metabolite (yCPK) after deleting a presumed pathway-specific
Extracellular carbohydrate metabolites from Streptomyces coelicolor A3(2)
Czech Academy of Sciences Publication Activity Database
Pospíšil, Stanislav; Sedmera, Petr; Halada, Petr; Petříček, Miroslav
2007-01-01
Roč. 70, - (2007), s. 768-771 ISSN 0163-3864 R&D Projects: GA ČR GA310/03/0285 Institutional research plan: CEZ:AV0Z50200510 Keywords : streptomyces coelicolor * cultivation * spectroscopic Subject RIV: EE - Microbiology, Virology Impact factor: 2.551, year: 2007
Energy Technology Data Exchange (ETDEWEB)
Ndlovu, T.M., E-mail: tm.ndlovu@nutriss.com [NUTRISS Limited, INEX, Herschel Annex, Kings Road, Newcastle upon Tyne NE1 7RU (United Kingdom); Ward, A.C. [School of Biology, Newcastle University, Newcastle upon Tyne, NE1 7RU (United Kingdom); Department of Microbiology, Chung-Ang University, College of Medicine, Seoul, Republic of Korea 156-756 (Korea, Republic of); Glassey, J. [School of Chemical Engineering and Advanced Materials, Newcastle University, Newcastle upon Tyne NE1 7RU (United Kingdom); Eskildsen, J. [NUTRISS Limited, INEX, Herschel Annex, Kings Road, Newcastle upon Tyne NE1 7RU (United Kingdom); Akay, G. [School of Chemical Engineering and Advanced Materials, Newcastle University, Newcastle upon Tyne NE1 7RU (United Kingdom)
2015-04-01
A novel functionalized micro-porous matrix was developed with well-controlled physicochemical proprieties such as pore size and surface chemistry. The matrix was used as a solid support in the growth of “Streptomyces coelicolor” A3(2) to enhance the production of antibiotics. The results shown support a higher production of prodigiosin and actinorhodin with overall production increase of 2–5 and 6–17, respectively, compared to conventional submerged liquid culture, offering a potential improvement in volumetric productivity. Scanning Electron Microscopy was used to evaluate pore size as well as bacterial adhesion, penetration, proliferation and migration within the micro-porous matrix. - Highlights: • Preparation of novel micro-porous matrix with different physiochemical proprieties • S. coelicolor A3(2) was cultured in those micro-porous and antibiotics was enhanced. • Matrix pore sizes and surface chemistry influenced bacterial signalling. • Bacterial signalling has a profound effect in the overproduction of Prodigiosin and actinorhodin. • Prodigiosin and actinorhodin production within micro-porous was 5–17 times higher compared with liquid growth.
International Nuclear Information System (INIS)
Ndlovu, T.M.; Ward, A.C.; Glassey, J.; Eskildsen, J.; Akay, G.
2015-01-01
A novel functionalized micro-porous matrix was developed with well-controlled physicochemical proprieties such as pore size and surface chemistry. The matrix was used as a solid support in the growth of “Streptomyces coelicolor” A3(2) to enhance the production of antibiotics. The results shown support a higher production of prodigiosin and actinorhodin with overall production increase of 2–5 and 6–17, respectively, compared to conventional submerged liquid culture, offering a potential improvement in volumetric productivity. Scanning Electron Microscopy was used to evaluate pore size as well as bacterial adhesion, penetration, proliferation and migration within the micro-porous matrix. - Highlights: • Preparation of novel micro-porous matrix with different physiochemical proprieties • S. coelicolor A3(2) was cultured in those micro-porous and antibiotics was enhanced. • Matrix pore sizes and surface chemistry influenced bacterial signalling. • Bacterial signalling has a profound effect in the overproduction of Prodigiosin and actinorhodin. • Prodigiosin and actinorhodin production within micro-porous was 5–17 times higher compared with liquid growth
D'Alia, Davide; Nieselt, Kay; Steigele, Stephan; Mueller, Jonas; Verburg, Ilse; Takano, Eriko; Alia, Davide D’; Müller, Jonas
Overexpression of antisense chromosomal cis-encoded noncoding RNAss (ncRNAs) in glutamine synthetase I resulted in a decrease in growth, protein synthesis, and antibiotic production in Streptomyces coelicolor. In addition, we predicted 3,597 cis-encoded ncRNAs and validated 13 of them
Fujii, T.; Gramajo, H.C.; Takano, E.; Bibb, M.J.
1996-01-01
redD and actII-ORF4, regulatory genes required for synthesis of the antibiotics undecylprodigiosin and actinorhodin by Streptomyces coelicolor A3(2), were transcribed in vitro by an RNA polymerase holoenzyme containing σhrdD. Disruption of hrdD had no effect on antibiotic production, indicating that
Rodríguez, E.; Banchio, C.; Diacovich, L.; Bibb, M. J.; Gramajo, H.
2001-01-01
Two genes, accB and accE, that form part of the same operon, were cloned from Streptomyces coelicolor A3(2). AccB is homologous to the carboxyl transferase domain of several propionyl coezyme A (CoA) carboxylases and acyl-CoA carboxylases (ACCases) of actinomycete origin, while AccE shows no significant homology to any known protein. Expression of accB and accE in Escherichia coli and subsequent in vitro reconstitution of enzyme activity in the presence of the biotinylated protein AccA1 or AccA2 confirmed that AccB was the carboxyl transferase subunit of an ACCase. The additional presence of AccE considerably enhanced the activity of the enzyme complex, suggesting that this small polypeptide is a functional component of the ACCase. The impossibility of obtaining an accB null mutant and the thiostrepton growth dependency of a tipAp accB conditional mutant confirmed that AccB is essential for S. coelicolor viability. Normal growth phenotype in the absence of the inducer was restored in the conditional mutant by the addition of exogenous long-chain fatty acids in the medium, indicating that the inducer-dependent phenotype was specifically related to a conditional block in fatty acid biosynthesis. Thus, AccB, together with AccA2, which is also an essential protein (E. Rodriguez and H. Gramajo, Microbiology 143:3109–3119, 1999), are the most likely components of an ACCase whose main physiological role is the synthesis of malonyl-CoA, the first committed step of fatty acid synthesis. Although normal growth of the conditional mutant was restored by fatty acids, the cultures did not produce actinorhodin or undecylprodigiosin, suggesting a direct participation of this enzyme complex in the supply of malonyl-CoA for the synthesis of these secondary metabolites. PMID:11526020
Hsiao, Nai-hua; Kirby, Ralph
DNA/DNA microarray hybridization was used to compare the genome content of Streptomyces avermitilis, Streptomyces cattleya, Streptomyces maritimus and Kitasatospora aureofaciens with that of Streptomyces coelicolor A3(2). The array data showed an about 93% agreement with the genome sequence data
Discovery, characterization, and kinetic analysis of an alditol oxidase from streptomyces coelicolor
Heuts, Dominic P. H. M.; van Hellemond, Erik W.; Janssen, Dick B.; Fraaije, Marco W.
2007-01-01
A gene encoding an alditol oxidase was found in the genome of Streptomyces coelicolor A3(2). This newly identified oxidase, AldO, was expressed at extremely high levels in Escherichia coli when fused to maltose-binding protein. AldO is a soluble monomeric flavoprotein with subunits of 45.1 kDa, each
The Level of AdpA Directly Affects Expression of Developmental Genes in Streptomyces coelicolor ▿ †
Wolański, Marcin; Donczew, Rafał; Kois-Ostrowska, Agnieszka; Masiewicz, Paweł; Jakimowicz, Dagmara; Zakrzewska-Czerwińska, Jolanta
2011-01-01
AdpA is a key regulator of morphological differentiation in Streptomyces. In contrast to Streptomyces griseus, relatively little is known about AdpA protein functions in Streptomyces coelicolor. Here, we report for the first time the translation accumulation profile of the S. coelicolor adpA (adpASc) gene; the level of S. coelicolor AdpA (AdpASc) increased, reaching a maximum in the early stage of aerial mycelium formation (after 36 h), and remained relatively stable for the next several hour...
DEFF Research Database (Denmark)
Sohoni, Sujata Vijay; Lieder, Sarah; Bapat, Prashant Madhusudhan
2014-01-01
3700 was established usingpara-nitrophenyl phosphate and the tyrosine-phosphorylated protein PtkA from Bacillus subtilis as substrates. Theoptimum pH for the Sco3700 phosphatase activity was 6.8, and KM for pNPP was 14.3 mM compared to pH 6.0and KM0.75 mM for PtpA. The potential of Sco3700...... of ACT in the ptpA over expression strain. Furthermore, a significantly earlier onset of ACT productionwas observed when ptpA was over expressed. Sco3700 overexpression had a pleiotropic effect on the cell, and thestrain exhibited lower productivities and final concentrations of antibiotics. We conclude...... that Sco3700 is indeed atyrosine phosphatase, and it contributes to regulation of antibiotic production in S. coelicolor affecting the timing ofonset of the antibiotic production...
Kim, Yoon Jung; Moon, Myung Hee; Lee, Jae Sun; Hong, Soon-Kwang; Chang, Yong Keun
2011-09-01
Culture pH change has some important roles in signal transduction and secondary metabolism. We have already reported that acidic pH shock enhanced actinorhodin production in Streptomyces coelicolor. Among many potential governing factors on pH variation, the putative Na(+)/H(+) antiporter (sha) genes in S. coelicolor have been investigated in this study to elucidate the association of the sha on pH variation and secondary metabolism. Through the transcriptional analysis and overexpression experiments on 8 sha genes, we observed that most of the sha expressions were promoted by pH shock, and in the opposite way the pH changes and actinorhodin production were enhanced by the overexpression of each sha. We also confirmed that sha8 especially has a main role in maintaining cell viability and pH homeostasis through Na(+) extrusion, in salt effect experiment under the alkaline medium condition by deleting sha8. Moreover, this gene was observed to have a function of pH recovery after pH variation such as the pH shock, being able to cause the sporulation. However, actinorhodin production was not induced by the only pH recovery. The sha8 gene could confer on the host cell the ability to recover pH to the neutral level after pH variation like a pH drop. Sporulation was closely associated with this pH recovery caused by the action of sha8, whereas actinorhodin production was not due to such pH variation patterns alone.
D'Alia, Davide; Eggle, D.; Nieselt, K.; Hu, W.-S.; Breitling, R.; Takano, E.
2011-01-01
Streptomycetes have high biotechnological relevance as producers of diverse metabolites widely used in medical and agricultural applications. The biosynthesis of these metabolites is controlled by signalling molecules, gamma-butyrolactones, that act as bacterial hormones. In Streptomyces coelicolor,
van Bloois, Edwin; Winter, Remko T.; Janssen, Dick B.; Fraaije, Marco W.
Streptomyces coelicolor A3(2) alditol oxidase (AldO) is a soluble monomeric flavoprotein in which the flavin cofactor is covalently linked to the polypeptide chain. AldO displays high reactivity towards different polyols such as xylitol and sorbitol. These characteristics make AldO industrially
The small laccase from Streptomyces coelicolor
Czech Academy of Sciences Publication Activity Database
Dohnálek, Jan; Skálová, Tereza; Ostergaard, L. H.; Ostergaard, P. R.; Hašek, Jindřich
2009-01-01
Roč. 16, 1a (2009), b4-b5 ISSN 1211-5894. [Discussions in Structural Molecular Biology /7./. 12.03.2009-14.03.2009, Nové Hrady] R&D Projects: GA ČR GA305/07/1073 Institutional research plan: CEZ:AV0Z40500505 Keywords : laccase * Streptomyces coelicolor * enzymer Subject RIV: CD - Macromolecular Chemistry
Crystallization and diffraction analysis of thioredoxin reductase from Streptomyces coelicolor
International Nuclear Information System (INIS)
Koháryová, Michaela; Brynda, Jiří; Řezáčová, Pavlína; Kollárová, Marta
2011-01-01
Thioredoxin reductase from S. coelicolor was crystallized and diffraction data were collected to 2.4 Å resolution. Thioredoxin reductases are homodimeric flavoenzymes that catalyze the transfer of electrons from NADPH to oxidized thioredoxin substrate. Bacterial thioredoxin reductases represent a promising target for the development of new antibiotics. Recombinant thioredoxin reductase TrxB from Streptomyces coelicolor was crystallized using the hanging-drop vapour-diffusion method. X-ray diffraction data were collected from cryocooled crystals to 2.4 Å resolution using a synchrotron-radiation source. The crystals belonged to the primitive monoclinic space group P2 1 , with unit-cell parameters a = 82.9, b = 60.6, c = 135.4 Å, α = γ = 90.0, β = 96.5°
Huang, Hao; Mackel, Brian J; Grove, Anne
2013-11-01
Many transcriptional regulators control gene activity by responding to specific ligands. Members of the multiple-antibiotic resistance regulator (MarR) family of transcriptional regulators feature prominently in this regard, and they frequently function as repressors in the absence of their cognate ligands. Plant pathogens such as Dickeya dadantii encode a MarR homolog named PecS that controls expression of a gene encoding the efflux pump PecM in addition to other virulence genes. We report here that the soil bacterium Streptomyces coelicolor also encodes a PecS homolog (SCO2647) that regulates a pecM gene (SCO2646). S. coelicolor PecS, which exists as a homodimer, binds the intergenic region between pecS and pecM genes with high affinity. Several potential PecS binding sites were found in this intergenic region. The binding of PecS to its target DNA can be efficiently attenuated by the ligand urate, which also quenches the intrinsic fluorescence of PecS, indicating a direct interaction between urate and PecS. In vivo measurement of gene expression showed that activity of pecS and pecM genes is significantly elevated after exposure of S. coelicolor cultures to urate. These results indicate that S. coelicolor PecS responds to the ligand urate by attenuated DNA binding in vitro and upregulation of gene activity in vivo. Since production of urate is associated with generation of reactive oxygen species by xanthine dehydrogenase, we propose that PecS functions under conditions of oxidative stress.
Jayapal, Karthik P; Lian, Wei; Glod, Frank; Sherman, David H; Hu, Wei-Shou
2007-01-01
Abstract Background The genomes of Streptomyces coelicolor and Streptomyces lividans bear a considerable degree of synteny. While S. coelicolor is the model streptomycete for studying antibiotic synthesis and differentiation, S. lividans is almost exclusively considered as the preferred host, among actinomycetes, for cloning and expression of exogenous DNA. We used whole genome microarrays as a comparative genomics tool for identifying the subtle differences between these two chromosomes. Res...
Directory of Open Access Journals (Sweden)
Simón Menendez-Bravo
2017-08-01
Full Text Available Oleaginous microorganisms represent possible platforms for the sustainable production of oleochemicals and biofuels due to their metabolic robustness and the possibility to be engineered. Streptomyces coelicolor is among the narrow group of prokaryotes capable of accumulating triacylglycerol (TAG as carbon and energy reserve. Although the pathways for TAG biosynthesis in this organism have been widely addressed, the set of genes required for their breakdown have remained elusive so far. Here, we identified and characterized three gene clusters involved in the β-oxidation of fatty acids (FA. The role of each of the three different S. coelicolor FadAB proteins in FA catabolism was confirmed by complementation of an Escherichia coliΔfadBA mutant strain deficient in β-oxidation. In S. coelicolor, the expression profile of the three gene clusters showed variation related with the stage of growth and the presence of FA in media. Flux balance analyses using a corrected version of the current S. coelicolor metabolic model containing detailed TAG biosynthesis reactions suggested the relevance of the identified fadAB genes in the accumulation of TAG. Thus, through the construction and analysis of fadAB knockout mutant strains, we obtained an S. coelicolor mutant that showed a 4.3-fold increase in the TAG content compared to the wild type strain grown under the same culture conditions.
Directory of Open Access Journals (Sweden)
Mario eSandoval-Calderón
2015-12-01
Full Text Available Streptomyces coelicolor is a model actinomycete that is well known for the diversity of its secondary metabolism and its complex life cycle. As a soil inhabitant, it is exposed to heterogeneous and frequently changing environmental circumstances. In the present work, we studied the effect of diverse growth conditions and phosphate depletion on its lipid profile and the relationship between membrane lipid composition and development in S. coelicolor. The lipid profile from cultures grown on solid media, which is closer to the natural habitat of this microorganism, does not resemble the previously reported lipid composition from liquid grown cultures of S. coelicolor. Wide variations were also observed across different media, growth phases, and developmental stages indicating active membrane remodeling. Ornithine lipids (OL are phosphorus-free polar lipids that were accumulated mainly during sporulation stages, but were also major components of the membrane under phosphorus limitation. In contrast, phosphatidylethanolamine, which had been reported as one of the major polar lipids in the genus Streptomyces, is almost absent under these conditions. We identified one of the genes responsible for the synthesis of OL (SCO0921 and found that its inactivation causes the absence of OL, precocious morphological development and actinorhodin production. Our observations indicate a remarkable plasticity of the membrane composition in this bacterial species, reveal a higher metabolic complexity than expected, and suggest a relationship between cytoplasmic membrane components and the differentiation programs in S. coelicolor.
Straight, Paul D; Willey, Joanne M; Kolter, Roberto
2006-07-01
Using mixed-species cultures, we have undertaken a study of interactions between two common spore-forming soil bacteria, Bacillus subtilis and Streptomyces coelicolor. Our experiments demonstrate that the development of aerial hyphae and spores by S. coelicolor is inhibited by surfactin, a lipopeptide surfactant produced by B. subtilis. Current models of aerial development by sporulating bacteria and fungi postulate a role for surfactants in reducing surface tension at air-liquid interfaces, thereby removing the major barrier to aerial growth. S. coelicolor produces SapB, an amphipathic peptide that is surface active and required for aerial growth on certain media. Loss of aerial hyphae in developmental mutants can be rescued by addition of purified SapB. While a surfactant from a fungus can substitute for SapB in a mutant that lacks aerial hyphae, not all surfactants have this effect. We show that surfactin is required for formation of aerial structures on the surface of B. subtilis colonies. However, in contrast to this positive role, our experiments reveal that surfactin acts antagonistically by arresting S. coelicolor aerial development and causing altered expression of developmental genes. Our observations support the idea that surfactants function specifically for a given organism regardless of their shared ability to reduce surface tension. Production of surfactants with antagonistic activity could provide a powerful competitive advantage during surface colonization and in competition for resources.
Salerno, Paola; Persson, Jessica; Bucca, Giselda; Laing, Emma; Ausmees, Nora; Smith, Colin P; Flärdh, Klas
2013-12-05
The sporulation of aerial hyphae of Streptomyces coelicolor is a complex developmental process. Only a limited number of the genes involved in this intriguing morphological differentiation programme are known, including some key regulatory genes. The aim of this study was to expand our knowledge of the gene repertoire involved in S. coelicolor sporulation. We report a DNA microarray-based investigation of developmentally controlled gene expression in S. coelicolor. By comparing global transcription patterns of the wild-type parent and two mutants lacking key regulators of aerial hyphal sporulation, we found a total of 114 genes that had significantly different expression in at least one of the two mutants compared to the wild-type during sporulation. A whiA mutant showed the largest effects on gene expression, while only a few genes were specifically affected by whiH mutation. Seven new sporulation loci were investigated in more detail with respect to expression patterns and mutant phenotypes. These included SCO7449-7451 that affect spore pigment biogenesis; SCO1773-1774 that encode an L-alanine dehydrogenase and a regulator-like protein and are required for maturation of spores; SCO3857 that encodes a protein highly similar to a nosiheptide resistance regulator and affects spore maturation; and four additional loci (SCO4421, SCO4157, SCO0934, SCO1195) that show developmental regulation but no overt mutant phenotype. Furthermore, we describe a new promoter-probe vector that takes advantage of the red fluorescent protein mCherry as a reporter of cell type-specific promoter activity. Aerial hyphal sporulation in S. coelicolor is a technically challenging process for global transcriptomic investigations since it occurs only as a small fraction of the colony biomass and is not highly synchronized. Here we show that by comparing a wild-type to mutants lacking regulators that are specifically affecting processes in aerial hypha, it is possible to identify previously
Botas, Alma; Pérez-Redondo, Rosario; Rodríguez-García, Antonio; Álvarez-Álvarez, Rubén; Yagüe, Paula; Manteca, Angel; Liras, Paloma
2018-01-01
ArgR is a well-characterized transcriptional repressor controlling the expression of arginine and pyrimidine biosynthetic genes in bacteria. In this work, the biological role of Streptomyces coelicolor ArgR was analyzed by comparing the transcriptomes of S. coelicolor ΔargR and its parental strain, S. coelicolor M145, at five different times over a 66-h period. The effect of S. coelicolor ArgR was more widespread than that of the orthologous protein of Escherichia coli, affecting the expression of 1544 genes along the microarray time series. This S. coelicolor regulator repressed the expression of arginine and pyrimidine biosynthetic genes, but it also modulated the expression of genes not previously described to be regulated by ArgR: genes involved in nitrogen metabolism and nitrate utilization; the act, red, and cpk genes for antibiotic production; genes for the synthesis of the osmotic stress protector ectoine; genes related to hydrophobic cover formation and sporulation (chaplins, rodlins, ramR, and whi genes); all the cwg genes encoding proteins for glycan cell wall biosynthesis; and genes involved in gas vesicle formation. Many of these genes contain ARG boxes for ArgR binding. ArgR binding to seven new ARG boxes, located upstream or near the ectA-ectB, afsS, afsR, glnR, and redH genes, was tested by DNA band-shift assays. These data and those of previously assayed fragments permitted the construction of an improved model of the ArgR binding site. Interestingly, the overexpression of sporulation genes observed in the ΔargR mutant in our culture conditions correlated with a sporulation-like process, an uncommon phenotype. PMID:29545785
Traxler, Matthew F; Watrous, Jeramie D; Alexandrov, Theodore; Dorrestein, Pieter C; Kolter, Roberto
2013-08-20
Soils host diverse microbial communities that include filamentous actinobacteria (actinomycetes). These bacteria have been a rich source of useful metabolites, including antimicrobials, antifungals, anticancer agents, siderophores, and immunosuppressants. While humans have long exploited these compounds for therapeutic purposes, the role these natural products may play in mediating interactions between actinomycetes has been difficult to ascertain. As an initial step toward understanding these chemical interactions at a systems level, we employed the emerging techniques of nanospray desorption electrospray ionization (NanoDESI) and matrix-assisted laser desorption ionization-time of flight (MALDI-TOF) imaging mass spectrometry to gain a global chemical view of the model bacterium Streptomyces coelicolor interacting with five other actinomycetes. In each interaction, the majority of secreted compounds associated with S. coelicolor colonies were unique, suggesting an idiosyncratic response from S. coelicolor. Spectral networking revealed a family of unknown compounds produced by S. coelicolor during several interactions. These compounds constitute an extended suite of at least 12 different desferrioxamines with acyl side chains of various lengths; their production was triggered by siderophores made by neighboring strains. Taken together, these results illustrate that chemical interactions between actinomycete bacteria exhibit high complexity and specificity and can drive differential secondary metabolite production. Actinomycetes, filamentous actinobacteria from the soil, are the deepest natural source of useful medicinal compounds, including antibiotics, antifungals, and anticancer agents. There is great interest in developing new strategies that increase the diversity of metabolites secreted by actinomycetes in the laboratory. Here we used several metabolomic approaches to examine the chemicals made by these bacteria when grown in pairwise coculture. We found that
Mavituna, Ferda; Luti, Khalid Jaber Kadhum; Gu, Lixing
2016-08-01
The aim of this work was to investigate the interaction between E.coli and Streptomyces coelicolor A3 (2) for the increased production of undecylprodigiosin and identify the E. coli actives mediating this inter-species interaction. The antibiotics of interest were the red-pigmented undecylprodigiosin and blue-pigmented actinorhodin. Pure cultures of S. coelicolor in a defined medium produced higher concentrations of actinorhodin compared to those of undecylprodigiosin. The latter however, is more important due to its immunosuppressive and antitumor properties. As a strategy to increase undecylprodigiosin production, we added separately, live cells and heat-killed cells of E. coli C600, and the cell-free supernatant of E. coli culture to S. coelicolor cultures in shake flasks. The interaction with live cells of E. coli altered the antibiotic production pattern and undecylprodigiosin production was enhanced by 3.5-fold compared to the pure cultures of S. coelicolor and actinorhodin decreased by 15-fold. The heat-killed cells of E. coli however, had no effect on antibiotic production. In all cases, growth and glucose consumption of S. coelicolor remained almost the same as those observed in the pure culture indicating that the changes in antibiotic production were not due to nutritional stress. Results with cell-free supernatant of E. coli culture indicated that the interaction between S. coelicolor and E. coli was mediated via diffusible molecule(s). Using a set of extraction procedures and agar-well diffusion bioassays, we isolated and preliminarily identified a class of compounds. For the preliminary verification, we added the compound which was the common chemical structural moiety in this class of compounds to the pure S. coelicolor cultures. We observed similar effects on antibiotic production as with the live E. coli cells and their supernatant indicating that this class of compounds secreted by E. coli indeed could act as actives during interspecies
Scaffaro, Roberto; Lopresti, Francesco; Sutera, Alberto; Botta, Luigi; Fontana, Rosa Maria; Gallo, Giuseppe
2017-09-01
Most of industrially relevant bioproducts are produced by submerged cultivations of actinomycetes. The immobilization of these Gram-positive filamentous bacteria on suitable porous supports may prevent mycelial cell-cell aggregation and pellet formation which usually negatively affect actinomycete submerged cultivations, thus, resulting in an improved biosynthetic capability. In this work, electrospun polylactic acid (PLA) membranes, subjected or not to O 2 -plasma treatment (PLA-plasma), were used as support for immobilized-cell submerged cultivations of Streptomyces coelicolor M145. This strain produces different bioactive compounds, including the blue-pigmented actinorhodin (ACT) and red-pigmented undecylprodigiosin (RED), and constitutes a model for the study of antibiotic-producing actinomycetes. Wet contact angles and X-ray photoelectron spectroscopy analysis confirmed the increased wettability of PLA-plasma due to the formation of polar functional groups such as carboxyl and hydroxyl moieties. Scanning electron microscope observations, carried out at different incubation times, revealed that S. coelicolor immobilized-cells created a dense "biofilm-like" mycelial network on both kinds of PLA membranes. Cultures of S. coelicolor immobilized-cells on PLA or PLA-plasma membranes produced higher biomass (between 1.5 and 2 fold) as well as higher levels of RED and ACT than planktonic cultures. In particular, cultures of immobilized-cells on PLA and PLA-plasma produced comparable levels of RED that were approximatively 4 and 5 fold higher than those produced by planktonic cultures, respectively. In contrast, levels of ACT produced by immobilized-cell cultures on PLA and PLA-plasma were different, being 5 and 10 fold higher than those of planktonic cultures, respectively. Therefore, this is study demonstrated the positive influence of PLA membrane on growth and secondary metabolite production in S. coelicolor and also revealed that O 2 -plasma treated PLA membranes
Heichlinger, Andrea; Ammelburg, Moritz; Kleinschnitz, Eva-Maria; Latus, Annette; Maldener, Iris; Flärdh, Klas; Wohlleben, Wolfgang; Muth, Günther
2011-04-01
Most bacteria with a rod-shaped morphology contain an actin-like cytoskeleton consisting of MreB polymers, which form helical spirals underneath the cytoplasmic membrane to direct peptidoglycan synthesis for the elongation of the cell wall. In contrast, MreB of Streptomyces coelicolor is not required for vegetative growth but has a role in sporulation. Besides MreB, S. coelicolor encodes two further MreB-like proteins, Mbl and SCO6166, whose function is unknown. Whereas MreB and Mbl are highly similar, SCO6166 is shorter, lacking the subdomains IB and IIB of actin-like proteins. Here, we showed that MreB and Mbl are not functionally redundant but cooperate in spore wall synthesis. Expression analysis by semiquantitative reverse transcription-PCR revealed distinct expression patterns. mreB and mbl are induced predominantly during morphological differentiation. In contrast, sco6166 is strongly expressed during vegetative growth but switched off during sporulation. All genes could be deleted without affecting viability. Even a ΔmreB Δmbl double mutant was viable. Δsco6166 had a wild-type phenotype. ΔmreB, Δmbl, and ΔmreB Δmbl produced swollen, prematurely germinating spores that were sensitive to various kinds of stress, suggesting a defect in spore wall integrity. During aerial mycelium formation, an Mbl-mCherry fusion protein colocalized with an MreB-enhanced green fluorescent protein (MreB-eGFP) fusion protein at the sporulation septa. Whereas MreB-eGFP localized properly in the Δmbl mutant, Mbl-mCherry localization depended on the presence of a functional MreB protein. Our results revealed that MreB and Mbl cooperate in the synthesis of the thickened spore wall, while SCO6166 has a nonessential function during vegetative growth.
Directory of Open Access Journals (Sweden)
Takano Eriko
2011-09-01
Full Text Available Abstract Background Streptomyces coelicolor, a model organism of antibiotic producing bacteria, has one of the largest genomes of the bacterial kingdom, including 7825 predicted protein coding genes. A large number of these genes, nearly 34%, are functionally orphan (hypothetical proteins with unknown function. However, in gene expression time course data, many of these functionally orphan genes show interesting expression patterns. Results In this paper, we analyzed all functionally orphan genes of Streptomyces coelicolor and identified a list of "high priority" orphans by combining gene expression analysis and additional phylogenetic information (i.e. the level of evolutionary conservation of each protein. Conclusions The prioritized orphan genes are promising candidates to be examined experimentally in the lab for further characterization of their function.
TOF-SIMS investigation of Streptomyces coelicolor, a mycelial bacterium
International Nuclear Information System (INIS)
Vaidyanathan, Seetharaman; Fletcher, John S.; Lockyer, Nicholas P.; Vickerman, John C.
2008-01-01
Streptomyces coelicolor is a mycelial microorganism that produces several secondary metabolites, including antibiotics. The physiology of the organism has largely been investigated in liquid cultures due to ease of monitoring different physiological parameters and more homogeneous culture conditions. However, solid cultures reflect the natural physiology of the microorganism better, given that in its natural state it grows in the soil. Imaging mass spectrometry with TOF-SIMS and C 60 + primary ion beams offers a potential route to studying chemical changes at the molecular level, both intracellular and extracellular that can help in understanding the natural physiology of the microorganism. Here, we report the application of the technique for studying the lateral distribution of the chemical species detected in a population, grown in both liquid and solid cultures. The capability of the technique for studying biological systems with minimal system intervention is demonstrated.
TOF-SIMS investigation of Streptomyces coelicolor, a mycelial bacterium
Vaidyanathan, Seetharaman; Fletcher, John S.; Lockyer, Nicholas P.; Vickerman, John C.
2008-12-01
Streptomyces coelicolor is a mycelial microorganism that produces several secondary metabolites, including antibiotics. The physiology of the organism has largely been investigated in liquid cultures due to ease of monitoring different physiological parameters and more homogeneous culture conditions. However, solid cultures reflect the natural physiology of the microorganism better, given that in its natural state it grows in the soil. Imaging mass spectrometry with TOF-SIMS and C 60+ primary ion beams offers a potential route to studying chemical changes at the molecular level, both intracellular and extracellular that can help in understanding the natural physiology of the microorganism. Here, we report the application of the technique for studying the lateral distribution of the chemical species detected in a population, grown in both liquid and solid cultures. The capability of the technique for studying biological systems with minimal system intervention is demonstrated.
International Nuclear Information System (INIS)
Stevenson, Clare E. M.; Kock, Holger; Mootien, Saraspadee; Davies, Sîan C.; Bibb, Mervyn J.; Lawson, David M.
2007-01-01
A novel regulator of antibiotic production in S. coelicolor, AbsC, has been crystallized in space group P2 1 2 1 2 1 . X-ray data to 2.25 Å resolution were collected on station PX 14.1 at Daresbury. Crystals of recombinant AbsC (subunit MW = 18 313 Da; 158 amino acids), a novel regulator of antibiotic production from Streptomyces coelicolor, were grown by vapour diffusion. The protein crystallizes in space group P2 1 2 1 2 1 , with unit-cell parameters a = 43.53, b = 121.30, c = 143.75 Å. Native data to a resolution of 2.25 Å were recorded at station PX 14.1 (Daresbury) from a single crystal. Preliminary analysis of these data suggests that the asymmetric unit contains four copies of the AbsC monomer, giving an estimated solvent content of 47.0%. AbsC belongs to the MarR family of proteins that mediate ligand-responsive transcriptional control
Heichlinger, Andrea; Ammelburg, Moritz; Kleinschnitz, Eva-Maria; Latus, Annette; Maldener, Iris; Flärdh, Klas; Wohlleben, Wolfgang; Muth, Günther
2011-01-01
Most bacteria with a rod-shaped morphology contain an actin-like cytoskeleton consisting of MreB polymers, which form helical spirals underneath the cytoplasmic membrane to direct peptidoglycan synthesis for the elongation of the cell wall. In contrast, MreB of Streptomyces coelicolor is not required for vegetative growth but has a role in sporulation. Besides MreB, S. coelicolor encodes two further MreB-like proteins, Mbl and SCO6166, whose function is unknown. Whereas MreB and Mbl are highly similar, SCO6166 is shorter, lacking the subdomains IB and IIB of actin-like proteins. Here, we showed that MreB and Mbl are not functionally redundant but cooperate in spore wall synthesis. Expression analysis by semiquantitative reverse transcription-PCR revealed distinct expression patterns. mreB and mbl are induced predominantly during morphological differentiation. In contrast, sco6166 is strongly expressed during vegetative growth but switched off during sporulation. All genes could be deleted without affecting viability. Even a ΔmreB Δmbl double mutant was viable. Δsco6166 had a wild-type phenotype. ΔmreB, Δmbl, and ΔmreB Δmbl produced swollen, prematurely germinating spores that were sensitive to various kinds of stress, suggesting a defect in spore wall integrity. During aerial mycelium formation, an Mbl-mCherry fusion protein colocalized with an MreB-enhanced green fluorescent protein (MreB-eGFP) fusion protein at the sporulation septa. Whereas MreB-eGFP localized properly in the Δmbl mutant, Mbl-mCherry localization depended on the presence of a functional MreB protein. Our results revealed that MreB and Mbl cooperate in the synthesis of the thickened spore wall, while SCO6166 has a nonessential function during vegetative growth. PMID:21257777
Lim, Ju-Hyeon; Lee, Chang-Ro; Dhakshnamoorthy, Vijayalakshmi; Park, Jae Seon; Hong, Soon-Kwang
2016-02-01
Genomic sequencing analysis and previous studies have shown that there are eight genes in Streptomyces coelicolor A3(2) encoding putative cellulases. One of these genes, sco6548, was cloned into the Streptomyces/Escherichia coli shuttle vector pUWL201PW. The recombinant protein was successfully overexpressed in S. lividans TK24 under the control of the strong ermE promoter. Sco6548 was 1740 bp in length, and encoded a 579-amino acid-, 60.8-kDa protein with strong hydrolyzing activity toward Avicel and filter paper, yielding cellobiose as the final product. SCO6548 showed optimal activity at 50°C and pH 5. The Km values of SCO6548 toward Avicel and filter paper were 15.38 and 16.1 mg/mL, respectively. The Vmax values toward Avicel and filter paper were 0.432 and 0.084 μM/min, respectively. EDTA did not affect cellulase activity; however, several divalent cations, including Co(2+), Cu(2+), Ni(2+) and Mn(2+) (at 10 mM) had severe inhibitory effects on enzyme activity. Our analysis showed that SCO6548 is a cellulose 1,4-β-cellobiosidase that hydrolyzes cellulose into cellobiose. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
DEFF Research Database (Denmark)
Rioseras, Beatriz; Sliaha, Pavel V; Gorshkov, Vladimir
2018-01-01
identified and quantified 3461 proteins corresponding to 44.3% of the S. coelicolor proteome across three developmental stages: vegetative hypha (MI); secondary metabolite producing hyphae (MII); and sporulating hyphae. A total of 1350 proteins exhibited more than 2-fold expression changes during....../Thr/Tyr kinases, making this genus an outstanding model for the study of bacterial protein phosphorylation events. We used mass spectrometry based quantitative proteomics and phosphoproteomics to characterize bacterial differentiation and activation of secondary metabolism of Streptomyces coelicolor. We...... the bacterial differentiation process. These proteins include 136 regulators (transcriptional regulators, transducers, Ser/Thr/Tyr kinases, signalling proteins), as well as 542 putative proteins with no clear homology to known proteins which are likely to play a role in differentiation and secondary metabolism...
Bhatia, Shashi Kant; Lee, Bo-Rahm; Sathiyanarayanan, Ganesan; Song, Hun Seok; Kim, Junyoung; Jeon, Jong-Min; Yoon, Jeong-Jun; Ahn, Jungoh; Park, Kyungmoon; Yang, Yung-Hun
2016-12-01
Various chemicals, i.e., furfural, vanillin, 4-hydroxybenzaldehyde and acetate produced during the pretreatment of biomass affect microbial fermentation. In this study, effect of vanillin, 4-hydroxybenzaldehyde and acetate on antibiotic production in Streptomyces coelicolor is investigated. IC 50 value of vanillin, 4-hydroxybenzaldehyde and acetate was recorded as 5, 11.3 and 115 mM, respectively. Vanillin was found as a very effective molecule, and it completely abolished antibiotic (undecylprodigiosin and actinorhodin) production at 1 mM concentration, while 4-hydroxybenzaldehyde and acetate have little effect. Microscopic analysis with field emission scanning electron microscopy (FESEM) showed that addition of vanillin inhibits mycelia formation and increases differentiation of S. coelicolor cells. Vanillin increases expression of genes responsible for sporulation (ssgA) and decreases expression of antibiotic transcriptional regulator (redD and actII-orf4), while it has no effect on genes related to the mycelia formation (bldA and bldN) and quorum sensing (scbA and scbR). Vanillin does not affect the glycolysis process, but may affect acetate and pyruvate accumulation which leads to increase in fatty acid accumulation. The production of antibiotics using biomass hydrolysates can be quite complex due to the presence of exogenous chemicals such as furfural and vanillin, and needs further detailed study.
Liu, Jing; Li, Jie; Dong, Hong; Chen, Yunfu; Wang, Yansheng; Wu, Hang; Li, Changrun; Weaver, David T; Zhang, Lixin; Zhang, Buchang
2017-07-01
Lrp/AsnC family regulators have been found in many bacteria as crucial regulators controlling diverse cellular processes. By genomic alignment, we found that SCO3361, an Lrp/AsnC family protein from Streptomyces coelicolor, shared the highest similarity to the SACE_Lrp from Saccharopolyspora erythraea. Deletion of SCO3361 led to dramatic reduction in actinorhodin (Act) production and delay in aerial mycelium formation and sporulation on solid media. Dissection of the mechanism underlying the function of SCO3361 in Act production revealed that it altered the transcription of the cluster-situated regulator gene actII-ORF4 by directly binding to its promoter. SCO3361 was an auto-regulator and simultaneously activated the transcription of its adjacent divergently transcribed gene SCO3362. SCO3361 affected aerial hyphae formation and sporulation of S. coelicolor by activating the expression of amfC, whiB, and ssgB. Phenylalanine and cysteine were identified as the effector molecules of SCO3361, with phenylalanine reducing the binding affinity, whereas cysteine increasing it. Moreover, interactional regulation between SCO3361 and SACE_Lrp was discovered for binding to each other's target gene promoter in this work. Our findings indicate that SCO3361 functions as a pleiotropic regulator controlling secondary metabolism and morphological development in S. coelicolor.
Czech Academy of Sciences Publication Activity Database
Skálová, Tereza; Dohnálek, Jan; Ostergaard, L. H.; Ostergaard, P. R.; Kolenko, Petr; Dušková, Jarmila; Štěpánková, Andrea; Hašek, Jindřich
2009-01-01
Roč. 385, č. 4 (2009), s. 1165-1178 ISSN 0022-2836 R&D Projects: GA MŠk 1K05008; GA ČR GA305/07/1073; GA AV ČR 1ET400500402 Institutional research plan: CEZ:AV0Z40500505 Keywords : laccase * oxidoreductase * multicopper blue protein * Streptomyces coelicolor * crystal structure Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.871, year: 2009
DEFF Research Database (Denmark)
Rønnest, Nanna Petersen; Stocks, Stuart M; Eliasson Lantz, Anna
2012-01-01
and pellets of Streptomyces coelicolor compare to image analysis. Samples, taken five times during fed-batch cultivation, were analyzed by image analysis and laser diffraction. The volume-weighted size distribution was calculated for each sample. Laser diffraction and image analysis yielded similar size...
Manikprabhu, Deene; Lingappa, K.
2013-01-01
Traditional synthesis of silver nanoparticles using chemical methods produces toxic substances. In contrast biological synthesis is regarded as a safe and nontoxic process but the major drawback of biological synthesis is, this process is slow. In the present investigation, we developed a rapid and green synthesis of silver nanoparticles employing a pigment produced by Streptomyces coelicolor klmp33 in just 90?s. The silver nanoparticles were characterized by UV-visible spectroscopy, transmis...
Role of GntR Family Regulatory Gene SCO1678 in Gluconate Metabolism in Streptomyces coelicolor M145
Directory of Open Access Journals (Sweden)
Olga Tsypik
2017-01-01
Full Text Available Here we report functional characterization of the Streptomyces coelicolor M145 gene SCO1678, which encodes a GntR-like regulator of the FadR subfamily. Bioinformatic analysis suggested that SCO1678 is part of putative operon (gnt involved in gluconate metabolism. Combining the results of SCO1678 knockout, transcriptional analysis of gnt operon, and Sco1678 protein-DNA electromobility shift assays, we established that Sco1678 protein controls the gluconate operon. It does so via repression of its transcription from a single promoter located between genes SCO1678 and SCO1679. The knockout also influenced, in a medium-dependent manner, the production of secondary metabolites by S. coelicolor. In comparison to the wild type, on gluconate-containing minimal medium, the SCO1678 mutant produced much less actinorhodin and accumulated a yellow-colored pigment, likely to be the cryptic polyketide coelimycin. Possible links between gluconate metabolism and antibiotic production are discussed.
Uncovering genes with divergent mRNA-protein dynamics in Streptomyces coelicolor.
Directory of Open Access Journals (Sweden)
Karthik P Jayapal
2008-05-01
Full Text Available Many biological processes are intrinsically dynamic, incurring profound changes at both molecular and physiological levels. Systems analyses of such processes incorporating large-scale transcriptome or proteome profiling can be quite revealing. Although consistency between mRNA and proteins is often implicitly assumed in many studies, examples of divergent trends are frequently observed. Here, we present a comparative transcriptome and proteome analysis of growth and stationary phase adaptation in Streptomyces coelicolor, taking the time-dynamics of process into consideration. These processes are of immense interest in microbiology as they pertain to the physiological transformations eliciting biosynthesis of many naturally occurring therapeutic agents. A shotgun proteomics approach based on mass spectrometric analysis of isobaric stable isotope labeled peptides (iTRAQ enabled identification and rapid quantification of approximately 14% of the theoretical proteome of S. coelicolor. Independent principal component analyses of this and DNA microarray-derived transcriptome data revealed that the prominent patterns in both protein and mRNA domains are surprisingly well correlated. Despite this overall correlation, by employing a systematic concordance analysis, we estimated that over 30% of the analyzed genes likely exhibited significantly divergent patterns, of which nearly one-third displayed even opposing trends. Integrating this data with biological information, we discovered that certain groups of functionally related genes exhibit mRNA-protein discordance in a similar fashion. Our observations suggest that differences between mRNA and protein synthesis/degradation mechanisms are prominent in microbes while reaffirming the plausibility of such mechanisms acting in a concerted fashion at a protein complex or sub-pathway level.
pH-Induced interfacial properties of Chaplin E from Streptomyces coelicolor.
Dokouhaki, Mina; Hung, Andrew; Prime, Emma L; Qiao, Greg G; Day, Li; Gras, Sally L
2017-12-01
Chaplin E, or Chp E, is a surface active peptide secreted by Streptomyces coelicolor that adopts different structures depending on solution pH but the effect of these structures on the interfacial properties of Chp E is not known. In experiments paired with simulations, Chp E was found to display pH-dependent interfacial assembly and surface activity. At pH 3.0, Chp E formed an ordered non-amyloidal interfacial film with high surface activity; while at pH 10.0, Chp E self-assembled into a heterogeneous film containing randomly arranged fibrils at the interface that was less surface active compared to the film formed at pH 3.0. In simulations at pH 10.0, Chp E molecules showed a higher propensity for dimerization within the solution phase, lower rate of adsorption to the interface and tighter inter-molecular associations at the interface, consistent with the lower surface activity and smaller interfacial area coverage per molecule measured at this pH compared to at pH 3.0. A model is presented for the role of Chp E in the developmental differentiation of Streptomyces coelicolor, where Chp E contributes to changes in surface tension at low pH and the formation of fibrils on the surface of aerial hyphae at high pH. Our data also suggest Chp E could be a promising surface active agent with functional activity that can be controlled by pH. Copyright © 2017 Elsevier B.V. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Palečková, Petra; Kontrová, K.; Kofroňová, Olga; Bobek, Jan; Benada, Oldřich; Mikulík, Karel
2007-01-01
Roč. 52, č. 3 (2007), s. 215-222 ISSN 0015-5632 R&D Projects: GA ČR GA203/05/0106 Institutional research plan: CEZ:AV0Z50200510 Keywords : streptomyces coelicolor * protein kinase * phosphoprotein Subject RIV: EE - Microbiology, Virology Impact factor: 0.989, year: 2007
Czech Academy of Sciences Publication Activity Database
Straková, Eva; Bobek, Jan; Ziková, Alice; Vohradský, Jiří
2013-01-01
Roč. 8, č. 9 (2013) E-ISSN 1932-6203 R&D Projects: GA ČR GAP302/11/0229; GA ČR GAP302/10/0468 Institutional support: RVO:61388971 Keywords : Streptomycetes * Gene expression * s. coelicolor Subject RIV: EE - Microbiology, Virology Impact factor: 3.534, year: 2013
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21218662 >1cxqA 5 133 141 282 2e-06 ... ref|NP_624441.1| putative noncomposite... transposon transposase [Streptomyces ... coelicolor A3(2)] emb|CAB52910.1| putative noncomposite... ... transposon transposase [Streptomyces coelicolor A3(2)] ... pir||T36996 probable noncomposite
Claessen, Dennis; Wösten, Han A.B.; Keulen, Geertje van; Faber, Onno G.; Alves, Alexandra M.C.R.; Meijer, Wim G.; Dijkhuizen, Lubbert
The filamentous bacteria Streptomyces coelicolor and Streptomyces lividans exhibit a complex life cycle. After a branched submerged mycelium has been established, aerial hyphae are formed that may septate to form chains of spores. The aerial structures possess several surface layers of unknown
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan
Syson, Karl; Stevenson, Clare E. M.; Miah, Farzana; Barclay, J. Elaine; Tang, Minhong; Gorelik, Andrii; Rashid, Abdul M.; Lawson, David M.; Bornemann, Stephen
2016-01-01
GlgE is a maltosyltransferase involved in α-glucan biosynthesis in bacteria that has been genetically validated as a target for tuberculosis therapies. Crystals of the Mycobacterium tuberculosis enzyme diffract at low resolution so most structural studies have been with the very similar Streptomyces coelicolor GlgE isoform 1. Although the donor binding site for α-maltose 1-phosphate had been previously structurally defined, the acceptor site had not. Using mutagenesis, kinetics, and protein crystallography of the S. coelicolor enzyme, we have now identified the +1 to +6 subsites of the acceptor/product, which overlap with the known cyclodextrin binding site. The sugar residues in the acceptor subsites +1 to +5 are oriented such that they disfavor the binding of malto-oligosaccharides that bear branches at their 6-positions, consistent with the known acceptor chain specificity of GlgE. A secondary binding site remote from the catalytic center was identified that is distinct from one reported for the M. tuberculosis enzyme. This new site is capable of binding a branched α-glucan and is most likely involved in guiding acceptors toward the donor site because its disruption kinetically compromises the ability of GlgE to extend polymeric substrates. However, disruption of this site, which is conserved in the Streptomyces venezuelae GlgE enzyme, did not affect the growth of S. venezuelae or the structure of the polymeric product. The acceptor subsites +1 to +4 in the S. coelicolor enzyme are well conserved in the M. tuberculosis enzyme so their identification could help inform the design of inhibitors with therapeutic potential. PMID:27531751
DEFF Research Database (Denmark)
Ödman, Peter; Johansen, C.L.; Olsson, L.
2010-01-01
of biomass and substrate (casamino acids) concentrations, respectively. The effect of combination of fluorescence and gas analyzer data as well as of different variable selection methods was investigated. Improved prediction models were obtained by combination of data from the two sensors and by variable......Fed-batch cultivations of Streptomyces coelicolor, producing the antibiotic actinorhodin, were monitored online by multiwavelength fluorescence spectroscopy and off-gas analysis. Partial least squares (PLS), locally weighted regression, and multilinear PLS (N-PLS) models were built for prediction...
Dalton, KA; Thibessard, A; Hunter, JI; Kelemen, GH
2007-01-01
Streptomyces coelicolor has nine SigB-like RNA polymerase sigma factors, several of them implicated in morphological differentiation and/or responses to different stresses. One of the nine, SigN, is the focus of this article. A constructed sigN null mutant was delayed in development and exhibited a bald phenotype when grown on minimal medium containing glucose as carbon source. One of two distinct sigN promoters, sigNP1, was active only during growth on solid medium, when its activation coinc...
Secondary Metabolites Produced during the Germination of Streptomyces coelicolor
Directory of Open Access Journals (Sweden)
Matouš Čihák
2017-12-01
Full Text Available Spore awakening is a series of actions that starts with purely physical processes and continues via the launching of gene expression and metabolic activities, eventually achieving a vegetative phase of growth. In spore-forming microorganisms, the germination process is controlled by intra- and inter-species communication. However, in the Streptomyces clade, which is capable of developing a plethora of valuable compounds, the chemical signals produced during germination have not been systematically studied before. Our previously published data revealed that several secondary metabolite biosynthetic genes are expressed during germination. Therefore, we focus here on the secondary metabolite production during this developmental stage. Using high-performance liquid chromatography-mass spectrometry, we found that the sesquiterpenoid antibiotic albaflavenone, the polyketide germicidin A, and chalcone are produced during germination of the model streptomycete, S. coelicolor. Interestingly, the last two compounds revealed an inhibitory effect on the germination process. The secondary metabolites originating from the early stage of microbial growth may coordinate the development of the producer (quorum sensing and/or play a role in competitive microflora repression (quorum quenching in their nature environments.
DEFF Research Database (Denmark)
Manteca, Angel; Sanchez, Jesus; Jung, Hye Ryung
2010-01-01
mycelial stages: an early compartmentalized vegetative mycelium (first mycelium, MI), and a multinucleated reproductive mycelium (second mycelium, MII), arising after PCD processes. In the present study, we made a detailed proteomic analysis of the distinct developmental stages of solid confluent...... Streptomyces coelicolor cultures using iTRAQ labelling and LC-MS/MS. A new experimental approach was developed to obtain homogeneous samples at each developmental stage (temporal protein analysis) and also to obtain membrane and cytosolic protein fractions (spatial protein analysis). A total of 345 proteins...
Czech Academy of Sciences Publication Activity Database
Holub, Martin; Bezoušková, Silvia; Kalachová, Ladislava; Weiser, Jaroslav
2007-01-01
Roč. 52, č. 5 (2007), s. 471-478 ISSN 0015-5632 R&D Projects: GA ČR GA204/03/1014; GA AV ČR IAA600200702 Institutional research plan: CEZ:AV0Z50200510 Keywords : phosphorylation * s. coelicolor * protein kinase Subject RIV: EE - Microbiology, Virology Impact factor: 0.989, year: 2007
Thomas, Louise; Hodgson, David A; Wentzel, Alexander; Nieselt, Kay; Ellingsen, Trond E; Moore, Jonathan; Morrissey, Edward R; Legaie, Roxane; Wohlleben, Wolfgang; Rodríguez-García, Antonio; Martín, Juan F; Burroughs, Nigel J; Wellington, Elizabeth M H; Smith, Margaret C M
2012-02-01
Bacteria in the genus Streptomyces are soil-dwelling oligotrophs and important producers of secondary metabolites. Previously, we showed that global messenger RNA expression was subject to a series of metabolic and regulatory switches during the lifetime of a fermentor batch culture of Streptomyces coelicolor M145. Here we analyze the proteome from eight time points from the same fermentor culture and, because phosphate availability is an important regulator of secondary metabolite production, compare this to the proteome of a similar time course from an S. coelicolor mutant, INB201 (ΔphoP), defective in the control of phosphate utilization. The proteomes provide a detailed view of enzymes involved in central carbon and nitrogen metabolism. Trends in protein expression over the time courses were deduced from a protein abundance index, which also revealed the importance of stress pathway proteins in both cultures. As expected, the ΔphoP mutant was deficient in expression of PhoP-dependent genes, and several putatively compensatory metabolic and regulatory pathways for phosphate scavenging were detected. Notably there is a succession of switches that coordinately induce the production of enzymes for five different secondary metabolite biosynthesis pathways over the course of the batch cultures.
Howlett, Robert; Anttonen, Katri; Read, Nicholas; Smith, Margaret C M
2018-04-01
Actinomycete bacteria use polyprenol phosphate mannose as a lipid linked sugar donor for extra-cytoplasmic glycosyl transferases that transfer mannose to cell envelope polymers, including glycoproteins and glycolipids. We showed recently that strains of Streptomyces coelicolor with mutations in the gene ppm1 encoding polyprenol phosphate mannose synthase were both resistant to phage φC31 and have greatly increased susceptibility to antibiotics that mostly act on cell wall biogenesis. Here we show that mutations in the genes encoding enzymes that act upstream of Ppm1 in the polyprenol phosphate mannose synthesis pathway can also confer phage resistance and antibiotic hyper-susceptibility. GDP-mannose is a substrate for Ppm1 and is synthesised by GDP-mannose pyrophosphorylase (GMP; ManC) which uses GTP and mannose-1-phosphate as substrates. Phosphomannomutase (PMM; ManB) converts mannose-6-phosphate to mannose-1-phosphate. S. coelicolor strains with knocked down GMP activity or with a mutation in sco3028 encoding PMM acquire phenotypes that resemble those of the ppm1 - mutants i.e. φC31 resistant and susceptible to antibiotics. Differences in the phenotypes of the strains were observed, however. While the ppm1 - strains have a small colony phenotype, the sco3028 :: Tn5062 mutants had an extremely small colony phenotype indicative of an even greater growth defect. Moreover we were unable to generate a strain in which GMP activity encoded by sco3039 and sco4238 is completely knocked out, indicating that GMP is also an important enzyme for growth. Possibly GDP-mannose is at a metabolic branch point that supplies alternative nucleotide sugar donors.
DEFF Research Database (Denmark)
Bürger, Patrick; Flores-Alsina, Xavier; Arellano-Garcia, Harvey
2018-01-01
The multiplicity of physicochemical and biological processes, where phosphorus is involved, makes their accurate prediction using current mathematical models in biotechnology quite a challenge. In this work, an antibiotic production model of Streptomyces coelicolor is chosen as a representative...... approach describing intracellular polyphosphate accumulation and consumption has been developed and implemented. A heuristic re-estimation of selected parameters is carried out to improve overall model performance. The improved process model predicts phosphate dynamics (root mean squared error ≤52h: −90...
Directory of Open Access Journals (Sweden)
Fabien Coze
Full Text Available Metabolic Flux Analysis is now viewed as essential to elucidate the metabolic pattern of cells and to design appropriate genetic engineering strategies to improve strain performance and production processes. Here, we investigated carbon flux distribution in two Streptomyces coelicolor A3 (2 strains: the wild type M145 and its derivative mutant M1146, in which gene clusters encoding the four main antibiotic biosynthetic pathways were deleted. Metabolic Flux Analysis and (13C-labeling allowed us to reconstruct a flux map under steady-state conditions for both strains. The mutant strain M1146 showed a higher growth rate, a higher flux through the pentose phosphate pathway and a higher flux through the anaplerotic phosphoenolpyruvate carboxylase. In that strain, glucose uptake and the flux through the Krebs cycle were lower than in M145. The enhanced flux through the pentose phosphate pathway in M1146 is thought to generate NADPH enough to face higher needs for biomass biosynthesis and other processes. In both strains, the production of NADPH was higher than NADPH needs, suggesting a key role for nicotinamide nucleotide transhydrogenase for redox homeostasis. ATP production is also likely to exceed metabolic ATP needs, indicating that ATP consumption for maintenance is substantial.Our results further suggest a possible competition between actinorhodin and triacylglycerol biosynthetic pathways for their common precursor, acetyl-CoA. These findings may be instrumental in developing new strategies exploiting S. coelicolor as a platform for the production of bio-based products of industrial interest.
Directory of Open Access Journals (Sweden)
Agnieszka Bera
2017-04-01
Full Text Available Streptomyces coelicolor M145 was shown to be able to grow in the presence of high concentrations of polyamines, such as putrescine, cadaverine, spermidine, or spermine, as a sole nitrogen source. However, hardly anything is known about polyamine utilization and its regulation in streptomycetes. In this study, we demonstrated that only one of the three proteins annotated as glutamine synthetase-like protein, GlnA3 (SCO6962, was involved in the catabolism of polyamines. Transcriptional analysis revealed that the expression of glnA3 was strongly induced by exogenous polyamines and repressed in the presence of ammonium. The ΔglnA3 mutant was shown to be unable to grow on defined Evans agar supplemented with putrescine, cadaverine, spermidine, and spermine as sole nitrogen source. HPLC analysis demonstrated that the ΔglnA3 mutant accumulated polyamines intracellularly, but was unable to degrade them. In a rich complex medium supplemented with a mixture of the four different polyamines, the ΔglnA3 mutant grew poorly showing abnormal mycelium morphology and decreased life span in comparison to the parental strain. These observations indicated that the accumulation of polyamines was toxic for the cell. An in silico analysis of the GlnA3 protein model suggested that it might act as a gamma-glutamylpolyamine synthetase catalyzing the first step of polyamine degradation. GlnA3-catalyzed glutamylation of putrescine was confirmed in an enzymatic in vitro assay and the GlnA3 reaction product, gamma-glutamylputrescine, was detected by HPLC/ESI-MS. In this work, the first step of polyamine utilization in S. coelicolor has been elucidated and the putative polyamine utilization pathway has been deduced based on the sequence similarity and transcriptional analysis of homologous genes expressed in the presence of polyamines.
Zhang, Le; Willemse, Joost; Hoskisson, Paul A; van Wezel, Gilles P
2018-05-09
Cell division during the reproductive phase of the Streptomyces life-cycle requires tight coordination between synchronous formation of multiple septa and DNA segregation. One remarkable difference with most other bacterial systems is that cell division in Streptomyces is positively controlled by the recruitment of FtsZ by SsgB. Here we show that deletion of ylmD (SCO2081) or ylmE (SCO2080), which lie in operon with ftsZ in the dcw cluster of actinomycetes, has major consequences for sporulation-specific cell division in Streptomyces coelicolor. Electron and fluorescence microscopy demonstrated that ylmE mutants have a highly aberrant phenotype with defective septum synthesis, and produce very few spores with low viability and high heat sensitivity. FtsZ-ring formation was also highly disturbed in ylmE mutants. Deletion of ylmD had a far less severe effect on sporulation. Interestingly, the additional deletion of ylmD restored sporulation to the ylmE null mutant. YlmD and YlmE are not part of the divisome, but instead localize diffusely in aerial hyphae, with differential intensity throughout the sporogenic part of the hyphae. Taken together, our work reveals a function for YlmD and YlmE in the control of sporulation-specific cell division in S. coelicolor, whereby the presence of YlmD alone results in major developmental defects.
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Streptomyces coelicolor A3(2)] ... Length = 117 ... Query: 1 ... MSTIQPVILTADHDVLVDFYTKLFGAEEIFRVPEK...GPVFYLGLRIGDTDLGLVAKPDPGD 60 ... MSTIQPVILTADHDVLVDFYTKLFGAEEIFRVPEKGPVFYL...GLRIGDTDLGLVAKPDPGD Sbjct: 1 ... MSTIQPVILTADHDVLVDFYTKLFGAEEIFRVPEKGPVFYLGLRIGDTDLGLVAKPDPGD 60 ...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Streptomyces coelicolor A3(2)] ... Length = 110 ... Query: 93 ... AAEFRATWLPRVADRYPAPQGPPGTRTPDEVMAGLLHDPE...RMVVPELAAYPAHLHIDLLP 152 ... AAEFRATWLPRVADRYPAPQGPPGTRTPDEVMAGLLHDPERMV...VPELAAYPAHLHIDLLP Sbjct: 1 ... AAEFRATWLPRVADRYPAPQGPPGTRTPDEVMAGLLHDPERMVVPELAAYPAHLHIDLLP 60 ...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Streptomyces coelicolor A3(2)] ... Length = 95 ... Query: 109 AQLHVVAGPDAGGVHLLHGGQIRLGRSXXXXXXXXXXXXSRMHC...AVTVGPDARVSVADLG 168 ... AQLHVVAGPDAGGVHLLHGGQIRLGRS ... SRMHC...AVTVGPDARVSVADLG Sbjct: 1 ... AQLHVVAGPDAGGVHLLHGGQIRLGRSADADVALDDPDVSRMHCAVTVGPDARVSVADLG 60 ...
Winter, Remko T.; Heuts, Dominic P. H. M.; Rijpkema, Egon M. A.; van Bloois, Edwin; Wijma, Hein J.; Fraaije, Marco W.
We describe the discovery, isolation and characterization of a highly thermostable alditol oxidase from Acidothermus cellulolyticus 11B. This protein was identified by searching the genomes of known thermophiles for enzymes homologous to Streptomyces coelicolor A3(2) alditol oxidase (AldO). A gene
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ry ... protein [Streptomyces coelicolor A3(2)] ... Length = 92 ... Query: 6 ... DDRRPKYQRIADTLREAIRSGEYGPGDRLPGENDLMATH...GVARMTARQALSVLRDEGVAE 65 ... DDRRPKYQRIADTLREAIRSGEYGPGDRLPGENDLMATH...GVARMTARQALSVLRDEGVAE Sbjct: 1 ... DDRRPKYQRIADTLREAIRSGEYGPGDRLPGENDLMATHGVARMTARQALSVLRDEGVAE 60 ...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available n NarJ3 ... [Streptomyces coelicolor A3(2)] ... Length = 155 ... Query: 21 ... AALLLAYPDRDWPRRPHTVRDTVAALPGPEI...QLLLSFCDRAEREDPLAVAARYVATFDRS 80 ... AALLLAYPDRDWPRRPHTVRDTVAALPGPEI...QLLLSFCDRAEREDPLAVAARYVATFDRS Sbjct: 1 ... AALLLAYPDRDWPRRPHTVRDTVAALPGPEIQLLLSFCDRAEREDPLAVAARYVATFDRS 60
Lu, Jie; Yao, Yufeng; Jiang, Weihong; Jiao, Ruishen
2003-02-01
Acetyl CoA carboxylase (EC 6.4.1.2, ACC) catalyzes the ATP-dependent carboxylation of acetyl CoA to yield malonyl CoA, which is the first committed step in fatty acid synthesis. A pair of degenerate PCR primers were designed according to the conserved amino acid sequence of AccA from M. tuberculosis and S. coelicolor. The product of the PCR amplification, a DNA fragment of 250bp was used as a probe for screening the U32 genomic cosmid library and its gene, accA, coding the biotinylated protein subunit of acetyl CoA carboxylase, was successfully cloned from U32. The accA ORF encodes a 598-amino-acid protein with the calculated molecular mass of 63.7kD, with 70.1% of G + C content. A typical Streptomyces RBS sequence, AGGAGG, was found at the - 6 position upstream of the start codon GTG. Analysis of the deduced amino acid sequence showed the presence of biotin-binding site and putative ATP-bicarbonate interaction region, which suggested the U32 AccA may act as a biotin carboxylase as well as a biotin carrier protein. Gene accA was then cloned into the pET28 (b) vector and expressed solubly in E. coli BL21 (DE3) by 0.1 mmol/L IPTG induction. Western blot confirmed the covalent binding of biotin with AccA. Northern blot analyzed transcriptional regulation of accA by 5 different nitrogen sources.
Wu, Changsheng; Ichinose, Koji; Choi, Young Hae; van Wezel, Gilles P
2017-07-18
The biosynthesis of aromatic polyketides derived from type II polyketide synthases (PKSs) is complex, and it is not uncommon that highly similar gene clusters give rise to diverse structural architectures. The act biosynthetic gene cluster (BGC) of the model actinomycete Streptomyces coelicolor A3(2) is an archetypal type II PKS. Here we show that the act BGC also specifies the aromatic polyketide GTRI-02 (1) and propose a mechanism for the biogenesis of its 3,4-dihydronaphthalen-1(2H)-one backbone. Polyketide 1 was also produced by Streptomyces sp. MBT76 after activation of the act-like qin gene cluster by overexpression of the pathway-specific activator. Mining of this strain also identified dehydroxy-GTRI-02 (2), which most likely originated from dehydration of 1 during the isolation process. This work shows that even extensively studied model gene clusters such as act of S. coelicolor can still produce new chemistry, offering new perspectives for drug discovery. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Streptomyces coelicolor A3(2)] ... Length = 132 ... Query: 6 ... VVGVRVEMPSNQPIVLLREVGGDRYLPIWIGPGEATAIAFAQQGMAPA...RPLTHDLFKDVL 65 ... VVGVRVEMPSNQPIVLLREVGGDRYLPIWIGPGEATAIAFAQQGMAPA...RPLTHDLFKDVL Sbjct: 1 ... VVGVRVEMPSNQPIVLLREVGGDRYLPIWIGPGEATAIAFAQQGMAPARPLTHDLFKDVL 60 ... Query: 126 GIAIPDEQEDEV 137 ... GIAIPDEQEDEV Sbjct: 121 GIAIPDEQEDEV 132
Cen, Xu-Feng; Wang, Jing-Zhi; Zhao, Guo-Ping; Wang, Ying; Wang, Jin
2016-03-18
In the agl3EFGXYZ operon (SCO7167-SCO7162, abbreviated as agl3 operon) of Streptomyces coelicolor M145, agl3EFG genes encode a putative ABC-type carbohydrate transporter. The transcription of this operon has been proved to be repressed by Agl3R (SCO7168), a neighboring GntR-family regulator, and this repression can be released by growth on poor carbon sources. Here in this study, we prove that the transcription of agl3 operon is also directly repressed by GlnR, a central regulator governing the nitrogen metabolism in S. coelicolor. The electrophoretic mobility shift assay (EMSA) employing the agl3 promoter and mixtures of purified recombinant GlnR and Agl3R indicates that GlnR and Agl3R bind to different DNA sequences within the promoter region of agl3 operon, which is further confirmed by the DNase I footprinting assay. As Agl3R and GlnR have been demonstrated to sense the extracellular carbon and nitrogen supplies, respectively, it is hypothesized that the transcription of agl3 operon is stringently governed by the availabilities of extracellular carbon and nitrogen sources. Consistent with the hypothesis, the agl3 operon is further found to be derepressed only under the condition of poor carbon and rich nitrogen supplies, when both regulators are inactivated. It is believed that activation of the expression of agl3 operon may facilitate the absorption of extracellular carbohydrates to balance the ratio of intracellular carbon to nitrogen. Copyright © 2016 Elsevier Inc. All rights reserved.
Salerno, Paola; Larsson, Jessica; Bucca, Giselda; Laing, Emma; Smith, Colin P.; Flärdh, Klas
2009-01-01
Streptomyces genomes encode two homologs of the nucleoid-associated HU proteins. One of them, here designated HupA, is of a conventional type similar to E. coli HUα and HUβ, while the other, HupS, is a two-domain protein. In addition to the N-terminal part that is similar to that of HU proteins, it has a C-terminal domain that is similar to the alanine- and lysine-rich C termini of eukaryotic linker histones. Such two-domain HU proteins are found only among Actinobacteria. In this phylum some organisms have only a single HU protein of the type with a C-terminal histone H1-like domain (e.g., Hlp in Mycobacterium smegmatis), while others have only a single conventional HU. Yet others, including the streptomycetes, produce both types of HU proteins. We show here that the two HU genes in Streptomyces coelicolor are differentially regulated and that hupS is specifically expressed during sporulation, while hupA is expressed in vegetative hyphae. The developmental upregulation of hupS occurred in sporogenic aerial hyphal compartments and was dependent on the developmental regulators whiA, whiG, and whiI. HupS was found to be nucleoid associated in spores, and a hupS deletion mutant had an average nucleoid size in spores larger than that in the parent strain. The mutant spores were also defective in heat resistance and spore pigmentation, although they possessed apparently normal spore walls and displayed no increased sensitivity to detergents. Overall, the results show that HupS is specifically involved in sporulation and may affect nucleoid architecture and protection in spores of S. coelicolor. PMID:19717607
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...
DEFF Research Database (Denmark)
Harris, Abigail K P; Williamson, Neil R; Slater, Holly
2004-01-01
The prodigiosin biosynthesis gene cluster (pig cluster) from two strains of Serratia (S. marcescens ATCC 274 and Serratia sp. ATCC 39006) has been cloned, sequenced and expressed in heterologous hosts. Sequence analysis of the respective pig clusters revealed 14 ORFs in S. marcescens ATCC 274...... and 15 ORFs in Serratia sp. ATCC 39006. In each Serratia species, predicted gene products showed similarity to polyketide synthases (PKSs), non-ribosomal peptide synthases (NRPSs) and the Red proteins of Streptomyces coelicolor A3(2). Comparisons between the two Serratia pig clusters and the red cluster...... from Str. coelicolor A3(2) revealed some important differences. A modified scheme for the biosynthesis of prodigiosin, based on the pathway recently suggested for the synthesis of undecylprodigiosin, is proposed. The distribution of the pig cluster within several Serratia sp. isolates is demonstrated...
Physiological factors affecting the production of an antimicrobial ...
African Journals Online (AJOL)
moustafa el-naggar
(1966) and the diagnostic key of Szabo et al. (1975). They were ... Mueller-Hinton agar as an assay medium and S. aureus as a test organism. ..... and rel A mutant strains of Streptomyces coelicolor A3(2) grown in continuous culture. FEMS.
Transposition of Tn5096 from a temperature-sensitive transducible plasmid in Streptomyces spp.
McHenney, M A; Baltz, R H
1991-01-01
Transposon Tn5096 was inserted into a derivative of the temperature-sensitive plasmid pMT660 containing the bacteriophage FP43 pac site. The resulting plasmid, pRHB126, was transduced by FP43 into several Streptomyces species. Tn5096 transposed from pRHB126 into different sites in the genomes of Streptomyces ambofaciens, Streptomyces cinnamonensis, Streptomyces coelicolor A3(2), Streptomyces fradiae, Streptomyces griseofuscus, and Streptomyces thermotolerans.
Czech Academy of Sciences Publication Activity Database
Straková, Eva; Ziková, Alice; Vohradský, Jiří
2014-01-01
Roč. 42, č. 2 (2014), s. 748-763 ISSN 0305-1048 R&D Projects: GA ČR GAP302/11/0229 Institutional support: RVO:61388971 Keywords : STREPTOMYCES-COELICOLOR A3(2) * SMALL NONCODING RNAS * GENE-EXPRESSION Subject RIV: CE - Biochemistry Impact factor: 9.112, year: 2014
Boukhris, Ines; Dulermo, Thierry; Chouayekh, Hichem; Virolle, Marie-Joëlle
2016-01-01
Sco7697, a gene encoding a phytase, enzyme able to degrade phytate (myo-inositol 1,2,3,4,5,6-hexakis phosphate), the most abundant phosphorus storing compound in plants is present in the genome of S. coelicolor, a soil born bacteria with a saprophytic lifestyle. The expression of this gene was previously shown to be induced in conditions of Pi limitation by the response regulator PhoP binding to an operator sequence, the PHO box, located upstream of the -35 promoter sequence. A close examination of the promoter region of sco7697 revealed the presence of another putative operator site, a Direct Repeat (DR), located downstream of the -10 promoter sequence. In order to determine whether this DR played a role in regulation of sco7697 expression, different variants of the phytase gene promoter region were transcriptionally fused to the ß-glucuronidase reporter gene (GUS). As expected, deletion of the PHO box led to abolition of sco7697 induction in conditions of Pi limitation. Interestingly, alteration of the DR correlated with a dramatic increase of GUS expression but only when PhoP was present. These results demonstrated that this DR is the site of strong negative regulation by an unknown repressor. The latter would impede the necessary activation of phytase expression by PhoP. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Chatterjee, Anushree; Drews, Laurie; Mehra, Sarika; Takano, Eriko; Kaznessis, Yiannis N.; Hu, Wei-Shou
2011-01-01
cis-encoded antisense RNAs (cis asRNA) have been reported to participate in gene expression regulation in both eukaryotic and prokaryotic organisms. Its presence in Streptomyces coelicolor has also been reported recently; however, its role has yet to be fully investigated. Using mathematical modeling we explore the role of cis asRNA produced as a result of convergent transcription in scbA-scbR genetic switch. scbA and scbR gene pair, encoding repressor–amplifier proteins respectively, mediates the synthesis of a signaling molecule, the γ-butyrolactone SCB1 and controls the onset of antibiotic production. Our model considers that transcriptional interference caused by convergent transcription of two opposing RNA polymerases results in fatal collision and transcriptional termination, which suppresses transcription efficiency. Additionally, convergent transcription causes sense and antisense interactions between complementary sequences from opposing strands, rendering the full length transcript inaccessible for translation. We evaluated the role of transcriptional interference and the antisense effect conferred by convergent transcription on the behavior of scbA-scbR system. Stability analysis showed that while transcriptional interference affects the system, it is asRNA that confers scbA-scbR system the characteristics of a bistable switch in response to the signaling molecule SCB1. With its critical role of regulating the onset of antibiotic synthesis the bistable behavior offers this two gene system the needed robustness to be a genetic switch. The convergent two gene system with potential of transcriptional interference is a frequent feature in various genomes. The possibility of asRNA regulation in other such gene-pairs is yet to be examined. PMID:21765930
Dicty_cDB: Contig-U03326-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 129_116( AL939129 |pid:none) Streptomyces coelicolor A3(2) co... 137 9e-31 AF079138_3( AF079138 |pid:none) Streptomyces venezuela...none) Streptomyces sp. MP39-85 putative ... 127 6e-28 AF079138_6( AF079138 |pid:none) Streptomyces venezuela
Czech Academy of Sciences Publication Activity Database
Holub, Martin; Bezoušková, Silvia; Petráčková, Denisa; Kalachová, Ladislava; Kofroňová, Olga; Benada, Oldřich; Weiser, Jaroslav
2010-01-01
Roč. 55, č. 3 (2010), s. 203-210 ISSN 0015-5632 R&D Projects: GA AV ČR IAA600200702; GA AV ČR IAA500200913 Institutional research plan: CEZ:AV0Z50200510 Keywords : ESCHERICHIA-COLI * COELICOLOR A3(2) * OUTER-MEMBRANE Subject RIV: EE - Microbiology, Virology Impact factor: 0.977, year: 2010
Energy Technology Data Exchange (ETDEWEB)
Watrous, Jeramie D.; Roach, Patrick J.; Heath, Brandi S.; Alexandrov, Theodore; Laskin, Julia; Dorrestein, Pieter C.
2013-11-05
Understanding molecular interaction pathways in complex biological systems constitutes a treasure trove of knowledge that might facilitate the specific, chemical manipulation of the countless microbiological systems that occur throughout our world. However, there is a lack of methodologies that allow the direct investigation of chemical gradients and interactions in living biological systems, in real time. Here, we report the use of nanospray desorption electrospray ionization (nanoDESI) imaging mass spectrometry for in vivo metabolic profiling of living bacterial colonies directly from the Petri dish with absolutely no sample preparation needed. Using this technique, we investigated single colonies of Shewanella oneidensis MR-1, Bacillus subtilis 3610, and Streptomyces coelicolor A3(2) as well as a mixed biofilm of S. oneidensis MR-1 and B. subtilis 3610. Data from B. subtilis 3610 and S. coelicolor A3(2) provided a means of validation for the method while data from S. oneidensis MR-1 and the mixed biofilm showed a wide range of compounds that this bacterium uses for the dissimilatory reduction of extracellular metal oxides, including riboflavin, iron-bound heme and heme biosynthetic intermediates, and the siderophore putrebactin.
Quan, Wei; Zhang, Chong; Zheng, Meixia; Lu, Zhaoxin; Lu, Fengxia
2018-08-01
The effects of small laccase (SLAC) from Streptomyces coelicolor on the properties of whey protein isolate (WPI) films were studied. WPI was catalyze by SLAC without phenolic acid assistance. Particle size distribution results showed that some complexes with higher relative molecular weight formed in WPI samples treated with SLAC. The content of α-helixes decreased while those of β-sheets and random coils increased following SLAC treatment according to circular dichroism results. Fourier transform infrared spectral analysis suggested that some conformational changes occurred in WPI following SLAC treatment. Analysis of WPI films prepared by casting after SLAC treatment indicated that their film properties were all improved, including mechanical properties, solubility, water vapor, oxygen and carbon dioxide barrier properties, film color, light transmission, transparency and thermal properties. Compared with that of the control film, some obvious differences in the morphology of the WPI films were observed following SLAC treatment. This report demonstrates that laccase can directly catalyze protein cross-linking, which may be useful to improve the performance of protein films. In this study, SLAC was applied to WPI edible film during the film-making process. The results showed that SLAC can catalyze WPI cross-linking without phenolic acid assistance, and WPI film properties were improved after SLAC treatment. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.
International Nuclear Information System (INIS)
Manikprabhu, Deene; Lingappa, K.
2014-01-01
The increasing emergence of extended-spectrum beta-lactamase (ESBL) producing Escherichia coli (E. coli) occurred mainly due to continuous persistent exposure to antibiotics causing high morbidity and mortality so studies in controlling this infection are required. In the present investigation, we developed a synthesis for silver nanoparticles employing a pigment produced by Streptomyces coelicolor klmp33, and assessed the antimicrobial activity of these nanoparticles against ESBL producing E. coli. The ESBL producing E. coli were isolated from urine samples collected from the Gulbarga region in India. As can been seen from our studies, the silver nanoparticles having irregular shapes and size of 28–50 nm showed remarkable antimicrobial activity and moreover the synthesis time is just 20 min and thus the same can be used for formulating pharmaceutical remedies. - Highlights: • Silver nanoparticle synthesis by photo-irradiation method in just 20 min • Isolation of ESBL producing E. coli from urine samples from the Gulbarga region. • Antimicrobial activity of silver nanoparticles against ESBL producing E. coli • The minimum inhibitory concentration of silver nanoparticles against ESBL producing E. coli was 40 μL
Energy Technology Data Exchange (ETDEWEB)
Manikprabhu, Deene; Lingappa, K., E-mail: lingappak123@gmail.com
2014-12-01
The increasing emergence of extended-spectrum beta-lactamase (ESBL) producing Escherichia coli (E. coli) occurred mainly due to continuous persistent exposure to antibiotics causing high morbidity and mortality so studies in controlling this infection are required. In the present investigation, we developed a synthesis for silver nanoparticles employing a pigment produced by Streptomyces coelicolor klmp33, and assessed the antimicrobial activity of these nanoparticles against ESBL producing E. coli. The ESBL producing E. coli were isolated from urine samples collected from the Gulbarga region in India. As can been seen from our studies, the silver nanoparticles having irregular shapes and size of 28–50 nm showed remarkable antimicrobial activity and moreover the synthesis time is just 20 min and thus the same can be used for formulating pharmaceutical remedies. - Highlights: • Silver nanoparticle synthesis by photo-irradiation method in just 20 min • Isolation of ESBL producing E. coli from urine samples from the Gulbarga region. • Antimicrobial activity of silver nanoparticles against ESBL producing E. coli • The minimum inhibitory concentration of silver nanoparticles against ESBL producing E. coli was 40 μL.
Interspecies modulation of bacterial development through iron competition and siderophore piracy.
Traxler, Matthew F; Seyedsayamdost, Mohammad R; Clardy, Jon; Kolter, Roberto
2012-11-01
While soil-dwelling actinomycetes are renowned for secreting natural products, little is known about the roles of these molecules in mediating actinomycete interactions. In a previous co-culture screen, we found that one actinomycete, Amycolatopsis sp. AA4, inhibited aerial hyphae formation in adjacent colonies of Streptomyces coelicolor. A siderophore, amychelin, mediated this developmental arrest. Here we present genetic evidence that confirms the role of the amc locus in the production of amychelin and in the inhibition of S. coelicolor development. We further characterize the Amycolatopsis sp. AA4 - S. coelicolor interaction by examining expression of developmental and iron acquisition genes over time in co-culture. Manipulation of iron availability and/or growth near Amycolatopsis sp. AA4 led to alterations in expression of the critical developmental gene bldN, and other key downstream genes in the S. coelicolor transcriptional cascade. In Amycolatopsis sp. AA4, siderophore genes were downregulated when grown near S. coelicolor, leading us to find that deferrioxamine E, produced by S. coelicolor, could be readily utilized by Amycolatopsis sp. AA4. Collectively these results suggest that competition for iron via siderophore piracy and species-specific siderophores can alter patterns of gene expression and morphological differentiation during actinomycete interactions. © 2012 Blackwell Publishing Ltd.
Wu, Changsheng; Zacchetti, Boris; Ram, Arthur F.J.; van Wezel, Gilles P.; Claessen, Dennis; Hae Choi, Young
2015-01-01
Actinomycetes and filamentous fungi produce a wide range of bioactive compounds, with applications as antimicrobials, anticancer agents or agrochemicals. Their genomes contain a far larger number of gene clusters for natural products than originally anticipated, and novel approaches are required to exploit this potential reservoir of new drugs. Here, we show that co-cultivation of the filamentous model microbes Streptomyces coelicolor and Aspergillus niger has a major impact on their secondary metabolism. NMR-based metabolomics combined with multivariate data analysis revealed several compounds that correlated specifically to co-cultures, including the cyclic dipeptide cyclo(Phe-Phe) and 2-hydroxyphenylacetic acid, both of which were produced by A. niger in response to S. coelicolor. Furthermore, biotransformation studies with o-coumaric acid and caffeic acid resulted in the production of the novel compounds (E)-2-(3-hydroxyprop-1-en-1-yl)-phenol and (2E,4E)-3-(2-carboxy-1-hydroxyethyl)-2,4-hexadienedioxic acid, respectively. This highlights the utility of microbial co-cultivation combined with NMR-based metabolomics as an efficient pipeline for the discovery of novel natural products. PMID:26040782
Directory of Open Access Journals (Sweden)
Hotchkiss Graham
2007-08-01
Full Text Available Abstract Background In Streptomyces coelicolor, bldA encodes the only tRNA for a rare leucine codon, UUA. This tRNA is unnecessary for growth, but is required for some aspects of secondary metabolism and morphological development. We describe a transcriptomic and proteomic analysis of the effects of deleting bldA on cellular processes during submerged culture: conditions relevant to the industrial production of antibiotics. Results At the end of rapid growth, a co-ordinated transient up-regulation of about 100 genes, including many for ribosomal proteins, was seen in the parent strain but not the ΔbldA mutant. Increased basal levels of the signal molecule ppGpp in the mutant strain may be responsible for this difference. Transcripts or proteins from a further 147 genes classified as bldA-influenced were mostly expressed late in culture in the wild-type, though others were significantly transcribed during exponential growth. Some were involved in the biosynthesis of seven secondary metabolites; and some have probable roles in reorganising metabolism after rapid growth. Many of the 147 genes were "function unknown", and may represent unknown aspects of Streptomyces biology. Only two of the 147 genes contain a TTA codon, but some effects of bldA could be traced to TTA codons in regulatory genes or polycistronic operons. Several proteins were affected post-translationally by the bldA deletion. There was a statistically significant but weak positive global correlation between transcript and corresponding protein levels. Different technical limitations of the two approaches were a major cause of discrepancies in the results obtained with them. Conclusion Although deletion of bldA has very conspicuous effects on the gross phenotype, the bldA molecular phenotype revealed by the "dualomic" approach has shown that only about 2% of the genome is affected; but this includes many previously unknown effects at a variety of different levels, including post
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Introduction. 651.32 Section 651.32 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) ENVIRONMENTAL QUALITY ENVIRONMENTAL ANALYSIS OF ARMY ACTIONS (AR 200-2) Environmental Assessment § 651.32 Introduction. (a) An EA is...
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true General. 635.32 Section 635.32 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS LAW ENFORCEMENT REPORTING Army Quarterly Trends and Analysis Report § 635.32 General. (a) This subpart prescribes policies and procedures...
2010-07-01
... in total aggregate value upon termination or completion of the project or program and the supplies... 32 National Defense 1 2010-07-01 2010-07-01 false Supplies. 32.35 Section 32.35 National Defense... ORGANIZATIONS Post-Award Requirements Property Standards § 32.35 Supplies. (a) Title to supplies shall vest in...
2011-01-01
Background Streptomyces species are a major source of antibiotics. They usually grow slowly at their optimal temperature and fermentation of industrial strains in a large scale often takes a long time, consuming more energy and materials than some other bacterial industrial strains (e.g., E. coli and Bacillus). Most thermophilic Streptomyces species grow fast, but no gene cloning systems have been developed in such strains. Results We report here the isolation of 41 fast-growing (about twice the rate of S. coelicolor), moderately thermophilic (growing at both 30°C and 50°C) Streptomyces strains, detection of one linear and three circular plasmids in them, and sequencing of a 6996-bp plasmid, pTSC1, from one of them. pTSC1-derived pCWH1 could replicate in both thermophilic and mesophilic Streptomyces strains. On the other hand, several Streptomyces replicons function in thermophilic Streptomyces species. By examining ten well-sporulating strains, we found two promising cloning hosts, 2C and 4F. A gene cloning system was established by using the two strains. The actinorhodin and anthramycin biosynthetic gene clusters from mesophilic S. coelicolor A3(2) and thermophilic S. refuineus were heterologously expressed in one of the hosts. Conclusions We have developed a gene cloning and expression system in a fast-growing and moderately thermophilic Streptomyces species. Although just a few plasmids and one antibiotic biosynthetic gene cluster from mesophilic Streptomyces were successfully expressed in thermophilic Streptomyces species, we expect that by utilizing thermophilic Streptomyces-specific promoters, more genes and especially antibiotic genes clusters of mesophilic Streptomyces should be heterologously expressed. PMID:22032628
2010-07-01
... awarding agency. (d) Management requirements. Procedures for managing equipment (including replacement... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no... 32 National Defense 1 2010-07-01 2010-07-01 false Equipment. 33.32 Section 33.32 National Defense...
32 CFR 32.52 - Financial reporting.
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Financial reporting. 32.52 Section 32.52..., HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Reports and Records § 32.52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for...
Energy Technology Data Exchange (ETDEWEB)
Alanis M, J. [ININ, Departamento de Materiales Radiactivos, 52045 Ocoyoacac, Estado de Mexico (Mexico)
2004-12-15
In the National Institute of Nuclear Research, it is the Radioisotopes Production plant, which covers in the area of the medicine 70% approximately of the national market and it exports to some countries of Latin America (Technetium-99, iodine-131, Sm-153 among other). At the moment the plant has modern facilities and certified with the ISO-9001-2000 standard, this, gives trust to the clients as for the quality of its products. Besides the production of radioisotopes dedicated for the medical area, the work of the plant tends to be more enlarged every time, producing new radioisotopes not only but with medical purposes but also industrial and agricultural ones, such it is the case of the production of Phosphorus-32 ({sup 32}P) that has applications with medical, industrial and in the agriculture purposes. The investigation studies from the prime matter (sulfur-32), sulfur purification, sulfur irradiation in the nuclear reactor and the obtaining process of {sup 32}P in a prototype, its took us to design and to build the obtaining process from {sup 32}P to more high level, which is presented in this work. To be able to select the obtaining method of {sup 32} P that is presented it was necessary to study the methods that have been developed in the world, later on it was selected the way that is presented. In that way the physical and chemical properties of the sulfur were studied which is used as prime matter, the interest nuclear reaction was also studied to carry out the production of {sup 32}P by means of the realization of mathematical calculations of irradiation of the sulfur in TRIGA Mark lll nuclear reactor. Once the sulfur is irradiated, it is necessary to carry out the radiochemical separation of the {sup 32}P produced from the sulfur, for this, it was necessary to carry out experimental tests of this separation, later on it was developed a prototype where it was carried out this separation and finally it was developed the final equipment of production of
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Noise. 989.32 Section 989.32 National Defense... ANALYSIS PROCESS (EIAP) § 989.32 Noise. Aircraft noise data files used for analysis during EIAP will be... System for Aircraft Noise for military training routes and military operating areas. Guidance on...
28 CFR 32.32 - Time for filing claim.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Time for filing claim. 32.32 Section 32.32 Judicial Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE BENEFIT CLAIMS Educational Assistance Benefit Claims § 32.32 Time for filing claim. (a...
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Housing. 15a.32 Section 15a.32 Agriculture Office of... § 15a.32 Housing. (a) General. A recipient shall not, on the basis of sex, apply different rules or regulations, impose different fees or requirements, or offer different services or benefits related to housing...
32 CFR 634.32 - Traffic violation reports.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Traffic violation reports. 634.32 Section 634.32 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION Traffic Supervision § 634.32 Traffic violation reports. (a) Most traffic violations...
32 CFR 32.24 - Program income.
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Program income. 32.24 Section 32.24 National... income. (a) DoD Components shall apply the standards set forth in this section in requiring recipient organizations to account for program income related to projects financed in whole or in part with Federal funds...
Energy Technology Data Exchange (ETDEWEB)
Thanna, Sandeep; Lindenberger, Jared J.; Gaitonde, Vishwanath V.; Ronning, Donald R.; Sucheck, Steven J. (Toledo)
2015-06-05
Streptomyces coelicolor (Sco) GlgEI is a glycoside hydrolase involved in α-glucan biosynthesis and can be used as a model enzyme for structure-based inhibitor design targeting Mycobacterium tuberculosis (Mtb) GlgE. The latter is a genetically validated drug target for the development of anti-Tuberculosis (TB) treatments. Inhibition of Mtb GlgE results in a lethal buildup of the GlgE substrate maltose-1-phosphate (M1P). However, Mtb GlgE is difficult to crystallize and affords lower resolution X-ray structures. Sco GlgEI-V279S on the other hand crystallizes readily, produces high resolution X-ray data, and has active site topology identical to Mtb GlgE. We report the X-ray structure of Sco GlgEI-V279S in complex with 2-deoxy-2,2-difluoro-α-maltosyl fluoride (α-MTF, 5) at 2.3 Å resolution. α-MTF was designed as a non-hydrolysable mimic of M1P to probe the active site of GlgE1 prior to covalent bond formation without disruption of catalytic residues. The α-MTF complex revealed hydrogen bonding between Glu423 and the C1F which provides evidence that Glu423 functions as proton donor during catalysis. Further, hydrogen bonding between Arg392 and the axial C2 difluoromethylene moiety of α-MTF was observed suggesting that the C2 position tolerates substitution with hydrogen bond acceptors. The key step in the synthesis of α-MDF was transformation of peracetylated 2-fluoro-maltal 1 into peracetylated 2,2-difluoro-α-maltosyl fluoride 2 in a single step via the use of Selectfluor®
Czech Academy of Sciences Publication Activity Database
Ševčíková, B.; Benada, Oldřich; Kofroňová, Olga; Kormanec, J.
2001-01-01
Roč. 177, - (2001), s. 98-106 ISSN 0302-8933 R&D Projects: GA ČR GA204/98/0421; GA AV ČR IAA5020903; GA AV ČR IPP1043020 Institutional research plan: CEZ:AV0Z5020903 Keywords : Streptomyces * stress response * RNA polymerase Subject RIV: EE - Microbiology, Virology Impact factor: 2.156, year: 2001
8 CFR 245a.32 - Ineligible aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 245a.32 Section 245a.32 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO... IMMIGRATION AND NATIONALITY ACT LIFE Act Amendments Family Unity Provisions § 245a.32 Ineligible aliens. The...
32 CFR 643.32 - Policy-Endangered species.
2010-07-01
... ESTATE Policy § 643.32 Policy—Endangered species. The Endangered Species Act of 1973 (16 U.S.C. 1531 et seq.), declares the intention of Congress to conserve threatened and endangered species of fish... 32 National Defense 4 2010-07-01 2010-07-01 true Policy-Endangered species. 643.32 Section 643.32...
The enzymatic preparation of [α-32P]nucleoside triphosphates, cyclic [32P]AMP, and cyclic [32P]GMP
International Nuclear Information System (INIS)
Walseth, T.F.; Johnson, R.A.
1979-01-01
A method has been developed for the enzymatic preparation of α- 32 P-labelled ribo- and deoxyribonucleoside triphosphates, cyclic [ 32 P]AMP, and cyclic [ 32 P]GMP of high specific radioactivity and in high yield from 32 Psub(i). The method also enables the preparation of [γ- 32 P]ATP, [γ- 32 P]GTP, [γ- 32 P]ITP, and [γ- 32 P]-dATP of very high specific activity and in high yield. (Auth.)
32 CFR 32.3 - Effect on other issuances.
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Effect on other issuances. 32.3 Section 32.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DoD GRANT AND AGREEMENT..., HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS General § 32.3 Effect on other issuances. For awards subject...
32 CFR 32.21 - Standards for financial management systems.
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Standards for financial management systems. 32... Program Management § 32.21 Standards for financial management systems. (a) DoD Components shall require... unit cost information. (b) Recipients' financial management systems shall provide for the following. (1...
32 CFR 32.50 - Purpose of reports and records.
2010-07-01
... the recipient's financial and program performance and the necessary standard reporting forms. They... 32 National Defense 1 2010-07-01 2010-07-01 false Purpose of reports and records. 32.50 Section 32..., HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Reports and Records § 32.50 Purpose of...
32 CFR 32.45 - Cost and price analysis.
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Cost and price analysis. 32.45 Section 32.45... price analysis. Some form of cost or price analysis shall be made and documented in the procurement files in connection with every procurement action. Price analysis may be accomplished in various ways...
32 CFR 776.32 - Department of the Navy as client.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Department of the Navy as client. 776.32 Section... Rules of Professional Conduct § 776.32 Department of the Navy as client. (a) Department of Navy as client: (1) Except when representing an individual client pursuant to paragraph (a)(6) of this section, a...
From osp(1|32)⊕osp(1|32) to the M-theory superalgebra: a contraction procedure
Energy Technology Data Exchange (ETDEWEB)
Fernández, J. J., E-mail: julio.j.fernandez@hotmail.es; Izquierdo, J. M., E-mail: izquierd@fta.uva.es; Olmo, M. A. del, E-mail: olmo@fta.uva.es [Universidad de Valladolid, Departamento de Física Teórica and IMUVA (Spain)
2017-03-15
We show the impossibility to obtain the D’auria–Fré-type superalgebras that allow for an underlying gauge theoretical structure of D = 11 supergravity from the superalgebra osp(1|32)⊕osp(1|32)−, by means of aWeimar-Woods contraction.
Chan, Derek V; Somani, Ally-Khan; Young, Andrew B; Massari, Jessica V; Ohtola, Jennifer; Sugiyama, Hideaki; Garaczi, Edina; Babineau, Denise; Cooper, Kevin D; McCormick, Thomas S
2011-05-26
Elevated numbers of regulatory T cells (T(regs)) have been implicated in certain cancers. Depletion of T(regs) has been shown to increase anti-tumor immunity. T(regs) also play a critical role in the suppression of autoimmune responses. The study of T(regs) has been hampered by a lack of adequate surface markers. Leucine Rich Repeat Containing 32 (LRRC32), also known as Glycoprotein A Repetitions Predominant (GARP), has been postulated as a novel surface marker of activated T(regs). However, there is limited information regarding the processing of LRRC32 or the regulatory phenotype and functional activity of T(regs) expressing LRRC32. Using naturally-occurring freshly isolated T(regs), we demonstrate that low levels of LRRC32 are present intracellularly prior to activation and that freshly isolated LRRC32+ T(regs) are distinct from LRRC32- T(regs) with respect to the expression of surface CD62L. Using LRRC32 transfectants of HEK cells, we demonstrate that the N-terminus of LRRC32 is cleaved prior to expression of the protein at the cell surface. Furthermore, we demonstrate using a construct containing a deleted putative signal peptide region that the presence of a signal peptide region is critical to cell surface expression of LRRC32. Finally, mixed lymphocyte assays demonstrate that LRRC32+ T(regs) are more potent suppressors than LRRC32- T(regs). A cleaved signal peptide site in LRRC32 is necessary for surface localization of native LRRC32 following activation of naturally-occurring freshly-isolated regulatory T cells. LRRC32 expression appears to alter the surface expression of activation markers of T cells such as CD62L. LRRC32 surface expression may be useful as a marker that selects for more potent T(reg) populations. In summary, understanding the processing and expression of LRRC32 may provide insight into the mechanism of action of T(regs) and the refinement of immunotherapeutic strategies aimed at targeting these cells.
Directory of Open Access Journals (Sweden)
Sugiyama Hideaki
2011-05-01
Full Text Available Abstract Background Elevated numbers of regulatory T cells (Tregs have been implicated in certain cancers. Depletion of Tregs has been shown to increase anti-tumor immunity. Tregs also play a critical role in the suppression of autoimmune responses. The study of Tregs has been hampered by a lack of adequate surface markers. Leucine Rich Repeat Containing 32 (LRRC32, also known as Glycoprotein A Repetitions Predominant (GARP, has been postulated as a novel surface marker of activated Tregs. However, there is limited information regarding the processing of LRRC32 or the regulatory phenotype and functional activity of Tregs expressing LRRC32. Results Using naturally-occurring freshly isolated Tregs, we demonstrate that low levels of LRRC32 are present intracellularly prior to activation and that freshly isolated LRRC32+ Tregs are distinct from LRRC32- Tregs with respect to the expression of surface CD62L. Using LRRC32 transfectants of HEK cells, we demonstrate that the N-terminus of LRRC32 is cleaved prior to expression of the protein at the cell surface. Furthermore, we demonstrate using a construct containing a deleted putative signal peptide region that the presence of a signal peptide region is critical to cell surface expression of LRRC32. Finally, mixed lymphocyte assays demonstrate that LRRC32+ Tregs are more potent suppressors than LRRC32- Tregs. Conclusions A cleaved signal peptide site in LRRC32 is necessary for surface localization of native LRRC32 following activation of naturally-occurring freshly-isolated regulatory T cells. LRRC32 expression appears to alter the surface expression of activation markers of T cells such as CD62L. LRRC32 surface expression may be useful as a marker that selects for more potent Treg populations. In summary, understanding the processing and expression of LRRC32 may provide insight into the mechanism of action of Tregs and the refinement of immunotherapeutic strategies aimed at targeting these cells.
2010-04-01
... select an independent public accountant. 270.32a-3 Section 270.32a-3 Commodity and Securities Exchanges... management investment company must select an independent public accountant. (a) A registered management... U.S.C. 80a-31(a)(1)) that the independent public accountant (“accountant”) be selected at a board of...
Replication the association of 2q32.2-q32.3 and 14q32.11 with hepatocellular carcinoma.
Chen, Wei; Wang, Mingquan; Zhang, Zhen; Tang, Huayang; Zuo, Xianbo; Meng, Xiangling; Xiong, Maoming; Zhou, Fusheng; Liang, Bo; Dai, Fen; Fang, Jun; Gao, Jinping; Zhu, Jun; Zhu, Yong; Wan, Hong; Wang, Miaofeng; Chan, Shixin; Sun, Liangdan
2015-04-25
Hepatocellular carcinoma (HCC) is a malignant tumor. The morbidity and mortality of HCC tend to ascend and become a serious threat to the population health. Genetic studies of HCC have identified several susceptibility loci of HCC. In this study, we aim to replicate the association of these loci in our samples from Chinese population and further investigate the genetic interaction. We selected 16 SNPs within 1p36.22, 2q32.2-q32.3, 3p21.33, 8p12, 14q32.11 and 21q21.3 and genotyped in 507 HCC patients and 3014 controls by using Sequenom MassARRAY system. Association analyses were performed by using PLINK 1.07. We observed that the STAT4 (2q32.2-q32.3) at rs7574865 (P=1.17×10(-3), OR=0.79) and EFCAB11 (14q32.11) at rs8013403 (P=1.54×10(-3), OR=0.80) were significantly associated with HCC in this study. In 3p21.33, genetic variant rs6795737 within GLB1 was also observed with suggestive evidence (P=9.98×10(-3), OR=0.84). In the interaction analysis, the pair of associated SNPs (rs7574865 within STAT4, rs8013403 within EFCAB11) generated evidence for interaction (P=4.10×10(-3)). In summary, our work first reported the association of 14q32.11 (EFCAB11) with HCC in Chinese Han population and revealed the genetic interaction between STAT4 (2q32.2-q32.3) and EFCAB11 (14q32.11) in HCC. Copyright © 2015 Elsevier B.V. All rights reserved.
[Antibacterial activity of rare Streptomyces species against clinical resistant bacteria].
Boughachiche, Faiza; Reghioua, Sihem; Zerizer, Habiba; Boulahrouf, Abderrahmane
2012-01-01
In the search for new antibiotics from Steptomyces, investigating extremes habitats enhances the probability of isolating novel producers. In this context, the antibacterial activity of four Streptomyces strains isolated from Ezzmoul saltpans was studied. Two of them showed antibacterial activity against antibiotic's resistant bacteria (Bacillus cereus: β-lactamines and sulfamides resistant, Streptococcus faecalis: penicillin, tetracycline and cotrimoxazole resistant, and Staphylococcus aureus Mu 50: vancomycine resistant). The most active Streptomyces strain produces one type of polar bioactive molecules that resists to temperature variation and light exposition. Its activity appears in the first culture day and reaches its maximal value in the fourth day. The second strain presents themoresistant activity that reaches its maximal value in the first culture day. It produces two types of bioactive molecules, one is polar and the second is non polar (according to thin layer chromatography technique results).
Directory of Open Access Journals (Sweden)
Timothy K Williams
Full Text Available The expression of protein phosphatase 32 (PP32, ANP32A is low in poorly differentiated pancreatic cancers and is linked to the levels of HuR (ELAV1, a predictive marker for gemcitabine response. In pancreatic cancer cells, exogenous overexpression of pp32 inhibited cell growth, supporting its long-recognized role as a tumor suppressor in pancreatic cancer. In chemotherapeutic sensitivity screening assays, cells overexpressing pp32 were selectively resistant to the nucleoside analogs gemcitabine and cytarabine (ARA-C, but were sensitized to 5-fluorouracil; conversely, silencing pp32 in pancreatic cancer cells enhanced gemcitabine sensitivity. The cytoplasmic levels of pp32 increased after cancer cells are treated with certain stressors, including gemcitabine. pp32 overexpression reduced the association of HuR with the mRNA encoding the gemcitabine-metabolizing enzyme deoxycytidine kinase (dCK, causing a significant reduction in dCK protein levels. Similarly, ectopic pp32 expression caused a reduction in HuR binding of mRNAs encoding tumor-promoting proteins (e.g., VEGF and HuR, while silencing pp32 dramatically enhanced the binding of these mRNA targets. Low pp32 nuclear expression correlated with high-grade tumors and the presence of lymph node metastasis, as compared to patients' tumors with high nuclear pp32 expression. Although pp32 expression levels did not enhance the predictive power of cytoplasmic HuR status, nuclear pp32 levels and cytoplasmic HuR levels associated significantly in patient samples. Thus, we provide novel evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy.
Directory of Open Access Journals (Sweden)
Bamidele T. Odumosu
2017-11-01
Full Text Available The aim of this study was to screen for important antibiotic producing species of the genus Streptomyces from a tropical estuary. Five bacterial strains were isolated from the Lagos lagoon and identified by 16S rDNA gene sequencing as Streptomyces albogriseolus, S. aureus, S. coelicolor, S. albus, and S. pseudogriseolus. Ethyl acetate extracts of Streptomyces spp. fermented broths were evaluated against laboratory strains of MRSA Methicillin-resistant Staphyloccus aureus (MRSA 144 m, Bacillus coagulans UL001, and Escherichia coli as well as the standard strains Klebsiella pneumonia ATCC 8308, Gardnerella vaginalis ATCC 27853 and Salmonella typhi ATCC 13311 using the well diffusion method. The presence of secondary metabolites was determined and analysed using gas chromatography-mass spectrometry (GC-MS. A broad spectrum of activity was only observed for S. coelicolor on all of the tested bacteria except S. typhi, ant GC-MS analysis revealed the presence of 16 secondary metabolites with relevant antibiotic properties. The result of this study suggest that Lagos Lagoon is a potential source and reservoir of novel antibiotics. Keywords: Streptomyces, Antibiotics, Resistance, Secondary Metabolites
32 CFR 720.32 - Certificates of full faith and credit.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Certificates of full faith and credit. 720.32... Official Records § 720.32 Certificates of full faith and credit. The Judge Advocate General, the Deputy... full faith and credit certifying the signatures and authority of officers of the Department of the Navy...
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Streptomyces coelicolor ... Length = 117 ... Query: 214 ETPVRDLMAPAAGIVAVDXX...XXXXXXXXXXXXHDRTRLLVRQEDAILGSVHARDVLVXXX 273 ... ETPVRDLMAPAAGIVAVD ... HDRTRLLVRQEDAILGSVHA...RDVLV ... Sbjct: 1 ... ETPVRDLMAPAAGIVAVDAGAEAEEILALAAAHDRTRLLVRQEDAILGSVHARDVLVARA 60 ...
Equipment and obtention process of phosphorus-32 starting from sulfur-32
International Nuclear Information System (INIS)
Alanis M, J.
2004-12-01
In the National Institute of Nuclear Research, it is the Radioisotopes Production plant, which covers in the area of the medicine 70% approximately of the national market and it exports to some countries of Latin America (Technetium-99, iodine-131, Sm-153 among other). At the moment the plant has modern facilities and certified with the ISO-9001-2000 standard, this, gives trust to the clients as for the quality of its products. Besides the production of radioisotopes dedicated for the medical area, the work of the plant tends to be more enlarged every time, producing new radioisotopes not only but with medical purposes but also industrial and agricultural ones, such it is the case of the production of Phosphorus-32 ( 32 P) that has applications with medical, industrial and in the agriculture purposes. The investigation studies from the prime matter (sulfur-32), sulfur purification, sulfur irradiation in the nuclear reactor and the obtaining process of 32 P in a prototype, its took us to design and to build the obtaining process from 32 P to more high level, which is presented in this work. To be able to select the obtaining method of 32 P that is presented it was necessary to study the methods that have been developed in the world, later on it was selected the way that is presented. In that way the physical and chemical properties of the sulfur were studied which is used as prime matter, the interest nuclear reaction was also studied to carry out the production of 32 P by means of the realization of mathematical calculations of irradiation of the sulfur in TRIGA Mark lll nuclear reactor. Once the sulfur is irradiated, it is necessary to carry out the radiochemical separation of the 32 P produced from the sulfur, for this, it was necessary to carry out experimental tests of this separation, later on it was developed a prototype where it was carried out this separation and finally it was developed the final equipment of production of 32 P mainly composed of three
CRISPR-Cas9 Toolkit for Actinomycete Genome Editing
DEFF Research Database (Denmark)
Tong, Yaojun; Robertsen, Helene Lunde; Blin, Kai
2018-01-01
engineering approaches for boosting known and discovering novel natural products. In order to facilitate the genome editing for actinomycetes, we developed a CRISPR-Cas9 toolkit with high efficiency for actinomyces genome editing. This basic toolkit includes a software for spacer (sgRNA) identification......, a system for in-frame gene/gene cluster knockout, a system for gene loss-of-function study, a system for generating a random size deletion library, and a system for gene knockdown. For the latter, a uracil-specific excision reagent (USER) cloning technology was adapted to simplify the CRISPR vector...... construction process. The application of this toolkit was successfully demonstrated by perturbation of genomes of Streptomyces coelicolor A3(2) and Streptomyces collinus Tü 365. The CRISPR-Cas9 toolkit and related protocol described here can be widely used for metabolic engineering of actinomycetes....
RGC-32 is a novel regulator of the T-lymphocyte cell cycle.
Tegla, Cosmin A; Cudrici, Cornelia D; Nguyen, Vinh; Danoff, Jacob; Kruszewski, Adam M; Boodhoo, Dallas; Mekala, Armugam P; Vlaicu, Sonia I; Chen, Ching; Rus, Violeta; Badea, Tudor C; Rus, Horea
2015-06-01
We have previously shown that RGC-32 is involved in cell cycle regulation in vitro. To define the in vivo role of RGC-32, we generated RGC-32 knockout mice. These mice developed normally and did not spontaneously develop overt tumors. To assess the effect of RGC-32 deficiency on cell cycle activation in T cells, we determined the proliferative rates of CD4(+) and CD8(+) T cells from the spleens of RGC-32(-/-) mice, as compared to wild-type (WT, RGC-32(+/+)) control mice. After stimulation with anti-CD3/anti-CD28, CD4(+) T cells from RGC-32(-/-) mice displayed a significant increase in [(3)H]-thymidine incorporation when compared to WT mice. In addition, both CD4(+) and CD8(+) T cells from RGC-32(-/-) mice displayed a significant increase in the proportion of proliferating Ki67(+) cells, indicating that in T cells, RGC-32 has an inhibitory effect on cell cycle activation induced by T-cell receptor/CD28 engagement. Furthermore, Akt and FOXO1 phosphorylation induced in stimulated CD4(+) T-cells from RGC-32(-/-) mice were significantly higher, indicating that RGC-32 inhibits cell cycle activation by suppressing FOXO1 activation. We also found that IL-2 mRNA and protein expression were significantly increased in RGC-32(-/-) CD4(+) T cells when compared to RGC-32(+/+) CD4(+) T cells. In addition, the effect of RGC-32 on the cell cycle and IL-2 expression was inhibited by pretreatment of the samples with LY294002, indicating a role for phosphatidylinositol 3-kinase (PI3K). Thus, RGC-32 is involved in controlling the cell cycle of T cells in vivo, and this effect is mediated by IL-2 in a PI3K-dependent fashion. Copyright © 2015 Elsevier Inc. All rights reserved.
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available reptomyces coelicolor ... Length = 192 ... Query: 37 ... RGYHATTTRDIAGRAGMSPAALYIHYKTKEELLHRISRIGHT...RAVAILRSAAQGEGSAAE 96 ... RGYHATTTRDIAGRAGMSPAALYIHYKTKEELLHRISRIGHTRAVAILRSAAQGEG...SAAE Sbjct: 14 ... RGYHATTTRDIAGRAGMSPAALYIHYKTKEELLHRISRIGHTRAVAILRSAAQGEGSAAE 73 ... Query: 157 EFDVPDVKGTTLAVLS
Engineering of secondary metabolite production in streptomycetes
DEFF Research Database (Denmark)
Robertsen, Helene Lunde; Gram, Lone
Streptomycetes are known for their ability to produce a range of different secondary metabolites, including antibiotics, immunosuppressive, anti-fungals, and anti-cancer compounds. Of these compounds, antibiotics play an important role in the clinics for treatment of both mild and severe bacterial...... the computational prediction of suitable 20 bp protospacers for the single guide RNAs and a USER-cloning method for construction of the CRISPR plasmids. Additional improvement to the system was achieved through the development of an optimised USER assembly workflow for cheaper and faster plasmid construction....... The workflow was verified by manual knock-down of two biosynthetic gene clusters in model organism Streptomyces coelicolor A3(2), which confirmed the applicability of the system. A second part of the thesis was devoted to engineering of Streptomyces collinus Tü 365, which is a known producer of the narrow...
Wang, Junhua; Wang, Cheng; Song, Kejing; Wen, Jianping
2017-10-03
Ascomycin is a 23-membered polyketide macrolide with high immunosuppressant and antifungal activity. As the lower production in bio-fermentation, global metabolic analysis is required to further explore its biosynthetic network and determine the key limiting steps for rationally engineering. To achieve this goal, an engineering approach guided by a metabolic network model was implemented to better understand ascomycin biosynthesis and improve its production. The metabolic conservation of Streptomyces species was first investigated by comparing the metabolic enzymes of Streptomyces coelicolor A3(2) with those of 31 Streptomyces strains, the results showed that more than 72% of the examined proteins had high sequence similarity with counterparts in every surveyed strain. And it was found that metabolic reactions are more highly conserved than the enzymes themselves because of its lower diversity of metabolic functions than that of genes. The main source of the observed metabolic differences was from the diversity of secondary metabolism. According to the high conservation of primary metabolic reactions in Streptomyces species, the metabolic network model of Streptomyces hygroscopicus var. ascomyceticus was constructed based on the latest reported metabolic model of S. coelicolor A3(2) and validated experimentally. By coupling with flux balance analysis and using minimization of metabolic adjustment algorithm, potential targets for ascomycin overproduction were predicted. Since several of the preferred targets were highly associated with ethylmalonyl-CoA biosynthesis, two target genes hcd (encoding 3-hydroxybutyryl-CoA dehydrogenase) and ccr (encoding crotonyl-CoA carboxylase/reductase) were selected for overexpression in S. hygroscopicus var. ascomyceticus FS35. Both the mutants HA-Hcd and HA-Ccr showed higher ascomycin titer, which was consistent with the model predictions. Furthermore, the combined effects of the two genes were evaluated and the strain HA
International Nuclear Information System (INIS)
Pereira, M.C.
1988-04-01
Sugar cane straw and/or P-fertilizer phosphorus-32 labelled were added to a Red Yellow podzolic soil from Goiana-PE. The treated samples were used in a pot experiment, growing sorghum plants for 4 and 6 weeks, and in an incubation experiment with incubation periods of 1, 2, 3, 4 and 6 weeks without plants in order to follow the dynamics of the P added. After each harvest and incubation period the soil were analysed for 31 P and 32 P in the microbial biomass and in sequential extracts with resin (Pi), 0.5 M Na H Co 3 (Pi, Po) and 0.1 N NaOH (Pi, Po). The 31 P and 32 P contents of the sorghum in the pot experiment were also determined. (author)
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Materiality. 32.26 Section 32.26... FOR TELECOMMUNICATIONS COMPANIES General Instructions § 32.26 Materiality. Companies shall follow this... materiality under GAAP, unless a waiver has been granted under the provisions of § 32.18 of this subpart to do...
27 CFR 5.32a - Voluntary disclosure of major food allergens.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Voluntary disclosure of major food allergens. 5.32a Section 5.32a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Labeling Requirements for Distilled Spirits § 5.32a Voluntary disclosure of major food allergens. (a...
Chen, C.; Chen, Z.; Bera, Deep; Raghunathan, S.B.; ShabaniMotlagh, M.; Noothout, E.C.; Chang, Z.Y.; Ponte, Jacco; Prins, Christian; Vos, H.J.; Bosch, Johan G.; Verweij, M.D.; de Jong, N.; Pertijs, M.A.P.
2017-01-01
This paper presents a power-and area-efficient front-end application-specific integrated circuit (ASIC) that is directly integrated with an array of 32 × 32 piezoelectric transducer elements to enable next-generation miniature ultrasound probes for real-time 3-D transesophageal echocardiography.
27 CFR 4.32a - Voluntary disclosure of major food allergens.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Voluntary disclosure of major food allergens. 4.32a Section 4.32a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Requirements for Wine § 4.32a Voluntary disclosure of major food allergens. (a) Definitions. For purposes of...
A biomedical application of 32Si using accelerator mass spectrometry
International Nuclear Information System (INIS)
Di Tada, M.L.; Fifield, L.K.; Liu, K.; Cresswell, R.G.; Day, J.L.; Oldham, C.L.; Popplewell, J.; Carling, R.
1998-01-01
As a first application of the 32 Si tracer to a biomedical project, the first measurement of silicon uptake by a human subject has been carried out. The motivation for this study aroused from the supposition that silicate may be important in human physiology in protecting against aluminium toxicity. Indeed, in an earlier study of aluminium uptake, using the isotopic tracer, 26 Al, it had been shown that blood-Al levels following Al dosing were lower when the dose was accompanied by dissolved silicate than when it was not. An experiment was set out to determine directly the fraction absorbed from the gastrointestinal tract, and to quantify the kinetics of renal elimination, using the silicon isotopic tracer, 32 Si. A gas-filled magnet technique was developed for measuring 32 Si by AMS which allows a spatial separation of 32 S from 32 Si and hence a reduction in the counting rate entering the detector by a factor of 10 6 . The results for silicon absorption are consistent with those from earlier studies, indicating that the simultaneous ingestion of Al and silicate enhances the rate of aluminium excretion for a period of 12-24 hours
Directory of Open Access Journals (Sweden)
Guang Liu
2010-12-01
Full Text Available Many taxonomically diverse prokaryotes enzymatically modify their DNA by replacing a non-bridging oxygen with a sulfur atom at specific sequences. The biological implications of this DNA S-modification (phosphorothioation were unknown. We observed that simultaneous expression of the dndA-E gene cluster from Streptomyces lividans 66, which is responsible for the DNA S-modification, and the putative Streptomyces coelicolor A(32 Type IV methyl-dependent restriction endonuclease ScoA3McrA (Sco4631 leads to cell death in the same host. A His-tagged derivative of ScoA3McrA cleaved S-modified DNA and also Dcm-methylated DNA in vitro near the respective modification sites. Double-strand cleavage occurred 16-28 nucleotides away from the phosphorothioate links. DNase I footprinting demonstrated binding of ScoA3McrA to the Dcm methylation site, but no clear binding could be detected at the S-modified site under cleavage conditions. This is the first report of in vitro endonuclease activity of a McrA homologue and also the first demonstration of an enzyme that specifically cleaves S-modified DNA.
ANP32B is a nuclear target of henipavirus M proteins.
Directory of Open Access Journals (Sweden)
Anja Bauer
Full Text Available Membrane envelopment and budding of negative strand RNA viruses (NSVs is mainly driven by viral matrix proteins (M. In addition, several M proteins are also known to be involved in host cell manipulation. Knowledge about the cellular targets and detailed molecular mechanisms, however, is poor for many M proteins. For instance, Nipah Virus (NiV M protein trafficking through the nucleus is essential for virus release, but nuclear targets of NiV M remain unknown. To identify cellular interactors of henipavirus M proteins, tagged Hendra Virus (HeV M proteins were expressed and M-containing protein complexes were isolated and analysed. Presence of acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B in the complex suggested that this protein represents a direct or indirect interactor of the viral matrix protein. Over-expression of ANP32B led to specific nuclear accumulation of HeV M, providing a functional link between ANP32B and M protein. ANP32B-dependent nuclear accumulation was observed after plasmid-driven expression of HeV and NiV matrix proteins and also in NiV infected cells. The latter indicated that an interaction of henipavirus M protein with ANP32B also occurs in the context of virus replication. From these data we conclude that ANP32B is a nuclear target of henipavirus M that may contribute to virus replication. Potential effects of ANP32B on HeV nuclear shuttling and host cell manipulation by HeV M affecting ANP32B functions in host cell survival and gene expression regulation are discussed.
32 CFR 383a.6 - Relationships.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Relationships. 383a.6 Section 383a.6 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) ORGANIZATIONAL CHARTERS DEFENSE COMMISSARY AGENCY (DeCA) § 383a.6 Relationships. (a) In the performance of assigned...
32 CFR 352a.5 - Relationships.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Relationships. 352a.5 Section 352a.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) ORGANIZATIONAL CHARTERS DEFENSE FINANCE AND ACCOUNTING SERVICE (DFAS) § 352a.5 Relationships. (a) In the performance of...
32 CFR 383a.8 - Administration.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Administration. 383a.8 Section 383a.8 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) ORGANIZATIONAL CHARTERS DEFENSE COMMISSARY AGENCY (DeCA) § 383a.8 Administration. (a) The Director and Deputy Director(s...
Mattoon, C. M.; Sarazin, F.; Hackman, G.; Cunningham, E. S.; Austin, R. A. E.; Ball, G. C.; Chakrawarthy, R. S.; Finlay, P.; Garrett, P. E.; Grinyer, G. F.; Hyland, B.; Koopmans, K. A.; Leslie, J. R.; Phillips, A. A.; Schumaker, M. A.; Scraggs, H. C.; Schwarzenberg, J.; Smith, M. B.; Svensson, C. E.; Waddington, J. C.; Walker, P. M.; Washbrook, B.; Zganjar, E.
2007-01-01
The β-decay of Na32 has been studied using β-γ coincidences. New transitions and levels are tentatively placed in the level scheme of Mg32 from an analysis of γ-γ and β-γ-γ coincidences. The observation of the indirect feeding of the 2321 keV state in Mg32 removes some restrictions previously placed on the spin assignment for this state. No evidence of a state at 2117 keV in Mg32 is found. Previously unobserved weak transitions up to 5.4 MeV were recorded but could not be placed in the decay scheme of Na32.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Individual. 32.655 Section 32.655 Transportation Office of the Secretary of Transportation GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 32.655 Individual. Individual means a natural person. ...
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Definition. 168a.3 Section 168a.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING NATIONAL DEFENSE SCIENCE AND ENGINEERING GRADUATE FELLOWSHIPS § 168a.3 Definition. Sponsoring Agency. A DoD Component or an...
A study on the distribution of P-32 in chicken
International Nuclear Information System (INIS)
Lim, H.Y.; Chung, K.H.; Won, P.O.
1981-01-01
Radioactive phosphorus (P-32) was injected to the chicken in the purpose of determination of the uptake and distribution, as related to sex and hour differences of the various organs of the body. 2μCi of P-32 were injected to each chicken and the distribution of P-32 was observed at 1 hr, 6 hrs, 12 hrs, 24 hrs and 48 hrs after injection. In this experiment 34 heads of chicken were used (30 chicken for P-32, 4 chicken for control group) and the results obtained as follows: 1. The uptake of P-32 per gram of various organ in g. mm, femur (1 hr), liver, femur, tibia (24 hrs) and tibia (48 hrs) exhibited higher in the male than the female. 2. The uptake of P-32 per gram of various organ in heart, kidney, ovary (1 hr), kidney, brain (24 hrs) and kidney (48 hrs) exhibited higher in the female than the male. 3. The uptake ratio of brain, spleen, g. mm and tibia were increased gradually by the 12 hrs ahter injection of P-32, but decreased in liver, heart and kidney by the 24 hrs. 4. The uptake ratio of the femur was increased gradually by the 24 hrs, but testis and ovary was increased after 24 hrs. 5. The organs showed an uptake of P-32 per gram of various organ, with the following sequence: femur, tibia, testis or spleen, liver, kidney, heart, g. mm and brain. (Author)
DARPP-32: from neurotransmission to cancer
Belkhiri, Abbes; Zhu, Shoumin; El-Rifai, Wael
2016-01-01
Dopamine and cAMP-regulated phosphoprotein Mr 32,000 (DARPP-32), also known as phosphoprotein phosphatase-1 regulatory subunit 1B (PPP1R1B), was initially discovered as a substrate of dopamine-activated protein kinase A (PKA) in the neostriatum in the brain. While phosphorylation at Thr-34 by PKA converts DARPP-32 into a potent inhibitor of protein phosphatase 1 (PP1), phosphorylation at Thr-75 transforms DARPP-32 into an inhibitor of PKA. Through regulation of DARPP-32 phosphorylation and modulation of protein phosphatase and kinase activities, DARPP-32 plays a critical role in mediating the biochemical, electrophysiological, and behavioral effects controlled by dopamine and other neurotransmitters in response to drugs of abuse and psychostimulants. Altered expression of DARPP-32 and its truncated isoform (t-DARPP), specifically in the prefrontal cortex, has been associated with schizophrenia and bipolar disorder. Moreover, cleavage of DARPP-32 by calpain has been implicated in Alzheimer's disease. Amplification of the genomic locus of DARPP-32 at 17q12 has been described in several cancers. DARPP-32 and t-DARPP are frequently overexpressed at the mRNA and protein levels in adenocarcinomas of the breast, prostate, colon, and stomach. Several studies demonstrated the pro-survival, pro-invasion, and pro-angiogenic functions of DARPP-32 in cancer. Overexpression of DARPP-32 and t-DARPP also promotes chemotherapeutic drug resistance and cell proliferation in gastric and breast cancers through regulation of pro-oncogenic signal transduction pathways. The expansion of DARPP-32 research from neurotransmission to cancer underscores the broad scope and implication of this protein in disparate human diseases. PMID:26872373
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Employee. 32.640 Section 32.640 Transportation... ASSISTANCE) Definitions § 32.640 Employee. (a) Employee means the employee of a recipient directly engaged in the performance of work under the award, including— (1) All direct charge employees; (2) All indirect...
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Housing. 86.32 Section 86.32 Public Welfare... in Education Programs or Activities Prohibited § 86.32 Housing. (a) Generally. A recipient shall not... offer different services or benefits related to housing, except as provided in this section (including...
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Hearing. 32.5 Section 32.5 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION ADMINISTRATIVE WAGE GARNISHMENT § 32.5 Hearing. (a) In general. Upon timely written request of the debtor, the Secretary shall provide a hearing...
48 CFR 32.411 - Agreement for special account at a financial institution.
2010-10-01
... account at a financial institution. 32.411 Section 32.411 Federal Acquisition Regulations System FEDERAL... Items 32.411 Agreement for special account at a financial institution. The contracting officer must use... Contractor), and ____, a financial institution operating under the laws of ____, located at ____ (the...
A dynamical theory for linearized massive superspin 3/2
International Nuclear Information System (INIS)
Gates, James S. Jr.; Koutrolikos, Konstantinos
2014-01-01
We present a new theory of free massive superspin Y=3/2 irreducible representation of the 4D, N=1 Super-Poincaré group, which has linearized non-minimal supergravity (superhelicity Y=3/2) as it’s massless limit. The new results will illuminate the underlying structure of auxiliary superfields required for the description of higher massive superspin systems
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Review. 218.32 Section 218.32 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Procedures § 218.32 Review. (a) Purpose and scope. This subpart establishes the procedures for the filing of an application for review of a supply order...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Buildings. 32.2121 Section 32.2121... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.2121 Buildings. (a) This account shall include the original cost of buildings, and the cost of all permanent fixtures, machinery...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Subpoenas. 210.32 Section 210.32 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Discovery and Compulsory Process § 210.32 Subpoenas. (a) Application for issuance...
CRISPR-Cas9 Based Engineering of Actinomycetal Genomes
DEFF Research Database (Denmark)
Tong, Yaojun; Charusanti, Pep; Zhang, Lixin
2015-01-01
. To facilitate the genetic manipulation of actinomycetes, we developed a highly efficient CRISPR-Cas9 system to delete gene(s) or gene cluster(s), implement precise gene replacements, and reversibly control gene expression in actinomycetes. We demonstrate our system by targeting two genes, actIORF1 (SCO5087......) and actVB (SCO5092), from the actinorhodin biosynthetic gene cluster in Streptomyces coelicolor A3(2). Our CRISPR-Cas9 system successfully inactivated the targeted genes. When no templates for homology-directed repair (HDR) were present, the site-specific DNA double-strand breaks (DSBs) introduced by Cas9....... Moreover, we developed a system to efficiently and reversibly control expression of target genes, deemed CRISPRi, based on a catalytically dead variant of Cas9 (dCas9). The CRISPR-Cas9 based system described here comprises a powerful and broadly applicable set of tools to manipulate actinomycetal genomes....
International Nuclear Information System (INIS)
Wei Guozhu; Miao Hailing
2009-01-01
The magnetic properties of a mixed spin-3/2 and spin-2 and a mixed spin-3/2 and spin-5/2 Ising ferromagnetic system with different anisotropies are studied by means of mean-field theory (MFT). The dependence of the phase diagram on single-ion anisotropy strengths is studied too. In the mixed spin-3/2 and spin-2 Ising model, besides the second-order phase transition, the first order-disorder phase transition and the tricritical line are found. In the mixed spin-3/2 and spin-5/2 Ising model, there is no first-order transition and tricritical line. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
34 CFR 32.4 - Employee response.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Employee response. 32.4 Section 32.4 Education Office... FROM DEPARTMENT OF EDUCATION EMPLOYEES § 32.4 Employee response. (a) Voluntary repayment agreement. Within 7 days of receipt of the written notice under § 32.3, the employee may submit a request to the...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Review. 32.53 Section 32.53 Judicial... BENEFIT CLAIMS Director Appeals and Reviews § 32.53 Review. (a) Upon the filing of the approval (under subpart E of this part) of a claim, the Director shall review the same. (b) The Director may review— (1...
20 CFR 219.32 - Evidence of a common-law marriage.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a common-law marriage. 219.32... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.32 Evidence of a common-law marriage. (a) Preferred evidence. Evidence of a common-law marriage must give the reasons why the informant believes that...
Nold-Petry, C.A.; Rudloff, I.; Baumer, Y.; Ruvo, M.; Marasco, D.; Botti, P.; Farkas, L.; Cho, S.X.; Zepp, J.A.; Azam, T.; Dinkel, H.; Palmer, B.E.; Boisvert, W.A.; Cool, C.D.; Taraseviciene-Stewart, L.; Heinhuis, B.; Joosten, L.A.; Dinarello, C.A.; Voelkel, N.F.; Nold, M.F.
2014-01-01
IL-32 is a multifaceted cytokine with a role in infections, autoimmune diseases, and cancer, and it exerts diverse functions, including aggravation of inflammation and inhibition of virus propagation. We previously identified IL-32 as a critical regulator of endothelial cell (EC) functions, and we
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 32.1 Section 32.1 Public Lands: Interior Office of the Secretary of the Interior GRANTS TO STATES FOR ESTABLISHING YOUNG ADULT CONSERVATION CORPS (YACC) PROGRAM § 32.1 Introduction. (a) The Young Adult Conservation Corps (YACC) is...
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Discovery. 1955.32 Section 1955.32 Labor Regulations...) PROCEDURES FOR WITHDRAWAL OF APPROVAL OF STATE PLANS Preliminary Conference and Discovery § 1955.32 Discovery... allow discovery by any other appropriate procedure, such as by interrogatories upon a party or request...
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Publication. 174.32 Section 174.32 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) PROTESTS Review and Disposition of Protests § 174.32 Publication. Within 120 days after issuing a...
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Mediation. 110.32 Section 110.32 Education Regulations..., Conciliation, and Enforcement Procedures § 110.32 Mediation. (a) ED promptly refers to the Federal Mediation and Conciliation Service or to the mediation agency designated by the Secretary of Health and Human...
Preparation of carrier-free Phosphorus-32 from 31P(n,γ )32P reaction
International Nuclear Information System (INIS)
Rafii, H.; Arbab Zavar, H.; Avaz Moghadam, S.
1999-01-01
The phosphorus-32 is a widely used radioisotope as as tracer or radioactive source in nuclear medicine, and in many other biotechnical applications. In this paper, preparation of carrier-free P-32 with a high specific activity was studied by 31 P(n, γ) 32 P reaction. The anhydrous KH 2 PO 4 , as a target material, was irradiated in Tehran Nuclear Research Reactor with a neutron flux of 2.5x10 13 n/cm 2 .sec. The P-32 produced as a result of Szilard-Chalmers effect was isolated from the target by a strong anion exchange resin, (Dowex - X 8). The quality control of the product shows a high chemical, and radiochemical purity (>98%) and the increase specific activity depends on the irradiation time
Phenotypic expressions of CCR5-Delta 32/Delta 32 homozygosity
Nguyen, GT; Carrington, M; Beeler, JA; Dean, M; Aledort, LM; Blatt, PM; Cohen, AR; DiMichele, D; Eyster, ME; Kessler, CM; Konkle, B; Leissinger, C; Luban, N; O'Brien, SJ; Goedert, JJ; O'Brien, TR
1999-01-01
Objective: As blockade of CC-chemokine receptor 5 (CCR5) has been proposed as therapy for HIV-1, we examined whether the CCR5-Delta 32/Delta 32 homozygous genotype has phenotypic expressions other than those related to HIV-1. Design: Study subjects were white homosexual men or men with hemophilia
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Housing. 106.32 Section 106.32 Education Regulations of... Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 106.32 Housing. (a) Generally... fees or requirements, or offer different services or benefits related to housing, except as provided in...
International Nuclear Information System (INIS)
Nomoto, Ryohei; Tezuka, Takeaki; Miyazono, Ken-ichi; Tanokura, Masaru; Horinouchi, Sueharu; Ohnishi, Yasuo
2012-01-01
A Streptomyces homologue of the mycobacterial integration host factor mIHF was heterologously produced, purified and crystallized in the presence of a 16-mer duplex DNA by the sitting-drop vapour-diffusion method. The best crystal diffracted X-rays to 2.22 Å resolution and belonged to space group C2. The mycobacterial integration host factor (mIHF) is a small nonspecific DNA-binding protein that is essential for the growth of Mycobacterium smegmatis. mIHF homologues are widely distributed among Actinobacteria, and a Streptomyces homologue of mIHF is involved in control of sporulation and antibiotic production in S. coelicolor A3(2). Despite their important biological functions, a structure of mIHF or its homologues has not been elucidated to date. Here, the S. griseus mIHF homologue (SGR6054) was expressed and purified from Escherichia coli and crystallized in the presence of a 16-mer duplex DNA by the sitting-drop vapour-diffusion method. The plate-shaped crystal belonged to space group C2, with unit-cell parameters a = 88.53, b = 69.35, c = 77.71 Å, β = 96.63°, and diffracted X-rays to 2.22 Å resolution
Energy Technology Data Exchange (ETDEWEB)
Nomoto, Ryohei; Tezuka, Takeaki; Miyazono, Ken-ichi; Tanokura, Masaru; Horinouchi, Sueharu; Ohnishi, Yasuo [Graduate School of Agricultural and Life Sciences, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657 (Japan)
2012-08-31
A Streptomyces homologue of the mycobacterial integration host factor mIHF was heterologously produced, purified and crystallized in the presence of a 16-mer duplex DNA by the sitting-drop vapour-diffusion method. The best crystal diffracted X-rays to 2.22 Å resolution and belonged to space group C2. The mycobacterial integration host factor (mIHF) is a small nonspecific DNA-binding protein that is essential for the growth of Mycobacterium smegmatis. mIHF homologues are widely distributed among Actinobacteria, and a Streptomyces homologue of mIHF is involved in control of sporulation and antibiotic production in S. coelicolor A3(2). Despite their important biological functions, a structure of mIHF or its homologues has not been elucidated to date. Here, the S. griseus mIHF homologue (SGR6054) was expressed and purified from Escherichia coli and crystallized in the presence of a 16-mer duplex DNA by the sitting-drop vapour-diffusion method. The plate-shaped crystal belonged to space group C2, with unit-cell parameters a = 88.53, b = 69.35, c = 77.71 Å, β = 96.63°, and diffracted X-rays to 2.22 Å resolution.
Redox-active antibiotics control gene expression and community behavior in divergent bacteria.
Dietrich, Lars E P; Teal, Tracy K; Price-Whelan, Alexa; Newman, Dianne K
2008-08-29
It is thought that bacteria excrete redox-active pigments as antibiotics to inhibit competitors. In Pseudomonas aeruginosa, the endogenous antibiotic pyocyanin activates SoxR, a transcription factor conserved in Proteo- and Actinobacteria. In Escherichia coli, SoxR regulates the superoxide stress response. Bioinformatic analysis coupled with gene expression studies in P. aeruginosa and Streptomyces coelicolor revealed that the majority of SoxR regulons in bacteria lack the genes required for stress responses, despite the fact that many of these organisms still produce redox-active small molecules, which indicates that redox-active pigments play a role independent of oxidative stress. These compounds had profound effects on the structural organization of colony biofilms in both P. aeruginosa and S. coelicolor, which shows that "secondary metabolites" play important conserved roles in gene expression and development.
32 CFR 32.46 - Procurement records.
2010-07-01
..., HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Procurement Standards § 32.46... for lack of competition when competitive bids or offers are not obtained; and (c) Basis for award cost or price. ...
Identification of p32 as a novel substrate for ATM in heart
International Nuclear Information System (INIS)
Kato, Hisakazu; Takashima, Seiji; Asano, Yoshihiro; Shintani, Yasunori; Yamazaki, Satoru; Seguchi, Osamu; Yamamoto, Hiroyuki; Nakano, Atsushi; Higo, Shuichiro; Ogai, Akiko; Minamino, Tetsuo; Kitakaze, Masafumi; Hori, Masatsugu
2008-01-01
Chemotherapeutic agents to induce DNA damage have been limited to use due to severe side effects of cardiotoxicity. ATM (Ataxia-telangiectasia mutated) is an essential protein kinase in triggering DNA damage responses. However, it is unclear how the ATM-mediated DNA damage responses are involved in the cardiac cell damage. To elucidate these functions in heart, we searched for specific substrates of ATM from mouse heart homogenate. Combining an in vitro phosphorylation following anion-exchange chromatography with purification by reverse-phase high-performance liquid chromatography (HPLC), we successfully identified p32, an ASF/SF2-associated protein, as a novel substrate for ATM. An in vitro kinase assay using recombinant p32 revealed that ATM directly phosphorylated p32. Furthermore, we determined Ser 148 of p32 as an ATM phosphorylation site. Since p32 is known to regulate mRNA splicing and transcription, p32 phosphorylation by ATM might be a new transcriptional regulatory pathway for specific DNA damage responses in heart
Directory of Open Access Journals (Sweden)
Joachim Breternitz
2018-06-01
Full Text Available Nickel nitrate diammine, Ni(NH32(NO32, can be synthesised from the thermal decomposition of nickel nitrate hexammine, Ni[(NH36](NO32. The hexammine decomposes in two distinct major stages; the first releases 4 equivalents of ammonia while the second involves the release of NOx, N2, and H2O to yield NiO. The intermediate diammine compound can be isolated following the first deammoniation step or synthesised as a single phase from the hexammine under vacuum. Powder X-ray diffraction (PXD experiments have allowed the structure of Ni(NH32(NO32 to be solved for the first time. The compound crystallises in orthorhombic space group Pca21 (a = 11.0628 (5 Å, b = 6.0454 (3 Å, c = 9.3526 (4 Å; Z = 4 and contains 11 non-hydrogen atoms in the asymmetric unit. Fourier transform infrared (FTIR spectroscopy demonstrates that the bonding in the ammine is consistent with the structure determined by PXD.
Energy Technology Data Exchange (ETDEWEB)
Pereira, M C
1988-04-01
Sugar cane straw and/or P-fertilizer phosphorus-32 labelled were added to a Red Yellow podzolic soil from Goiana-PE. The treated samples were used in a pot experiment, growing sorghum plants for 4 and 6 weeks, and in an incubation experiment with incubation periods of 1, 2, 3, 4 and 6 weeks without plants in order to follow the dynamics of the P added. After each harvest and incubation period the soil were analysed for {sup 31} P and {sup 32} P in the microbial biomass and in sequential extracts with resin (Pi), 0.5 M Na H Co{sub 3} (Pi, Po) and 0.1 N NaOH (Pi, Po). The {sup 31} P and {sup 32} P contents of the sorghum in the pot experiment were also determined. (author).
TR32DB - Management of Research Data in a Collaborative, Interdisciplinary Research Project
Curdt, Constanze; Hoffmeister, Dirk; Waldhoff, Guido; Lang, Ulrich; Bareth, Georg
2015-04-01
The management of research data in a well-structured and documented manner is essential in the context of collaborative, interdisciplinary research environments (e.g. across various institutions). Consequently, set-up and use of a research data management (RDM) system like a data repository or project database is necessary. These systems should accompany and support scientists during the entire research life cycle (e.g. data collection, documentation, storage, archiving, sharing, publishing) and operate cross-disciplinary in interdisciplinary research projects. Challenges and problems of RDM are well-know. Consequently, the set-up of a user-friendly, well-documented, sustainable RDM system is essential, as well as user support and further assistance. In the framework of the Transregio Collaborative Research Centre 32 'Patterns in Soil-Vegetation-Atmosphere Systems: Monitoring, Modelling, and Data Assimilation' (CRC/TR32), funded by the German Research Foundation (DFG), a RDM system was self-designed and implemented. The CRC/TR32 project database (TR32DB, www.tr32db.de) is operating online since early 2008. The TR32DB handles all data, which are created by the involved project participants from several institutions (e.g. Universities of Cologne, Bonn, Aachen, and the Research Centre Jülich) and research fields (e.g. soil and plant sciences, hydrology, geography, geophysics, meteorology, remote sensing). Very heterogeneous research data are considered, which are resulting from field measurement campaigns, meteorological monitoring, remote sensing, laboratory studies and modelling approaches. Furthermore, outcomes like publications, conference contributions, PhD reports and corresponding images are regarded. The TR32DB project database is set-up in cooperation with the Regional Computing Centre of the University of Cologne (RRZK) and also located in this hardware environment. The TR32DB system architecture is composed of three main components: (i) a file-based data
32 CFR 32.41 - Recipient responsibilities.
2010-07-01
... Federal, State or local authority as may have proper jurisdiction. ..., HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Procurement Standards § 32.41... contractual responsibilities arising under its contract(s). The recipient is the responsible authority...
A 32 x 32 capacitive micromachined ultrasonic transducer array manufactured in standard CMOS.
Lemmerhirt, David F; Cheng, Xiaoyang; White, Robert; Rich, Collin A; Zhang, Man; Fowlkes, J Brian; Kripfgans, Oliver D
2012-07-01
As ultrasound imagers become increasingly portable and lower cost, breakthroughs in transducer technology will be needed to provide high-resolution, real-time 3-D imaging while maintaining the affordability needed for portable systems. This paper presents a 32 x 32 ultrasound array prototype, manufactured using a CMUT-in-CMOS approach whereby ultrasonic transducer elements and readout circuits are integrated on a single chip using a standard integrated circuit manufacturing process in a commercial CMOS foundry. Only blanket wet-etch and sealing steps are added to complete the MEMS devices after the CMOS process. This process typically yields better than 99% working elements per array, with less than ±1.5 dB variation in receive sensitivity among the 1024 individually addressable elements. The CMUT pulseecho frequency response is typically centered at 2.1 MHz with a -6 dB fractional bandwidth of 60%, and elements are arranged on a 250 μm hexagonal grid (less than half-wavelength pitch). Multiplexers and CMOS buffers within the array are used to make on-chip routing manageable, reduce the number of physical output leads, and drive the transducer cable. The array has been interfaced to a commercial imager as well as a set of custom transmit and receive electronics, and volumetric images of nylon fishing line targets have been produced.
A simple enzymic method for the synthesis of [32P]phosphoenolpyruvate
International Nuclear Information System (INIS)
Parra, F.
1982-01-01
A rapid and simple enzymic method is described for the synthesis of [ 32 P]phosphoenolpyruvate from [ 32 P]Psub(i), with a reproducible yield of 74%. The final product was shown to be a good substrate for pyruvate kinase (EC 2.7.1.40). (author)
International Nuclear Information System (INIS)
Thomas, P.; Campos, J.
1979-01-01
A system for sampling and averaging repetitive signals in the order of nanoseconds is discussed. The system uses as storage memory a multichannel analyzer operating in multi scaling mode. This instrument is employed for the measurement of atomic level lifetimes using a dye laser to excite the atoms and is applied to the study of lifetimes of the 3 2 P1/2 and 3 2 P3/2 states of sodium. (Author) 32 refs
Dose Assessment of Phosphorus-32 (32P for the Treatment of Recurrent Pterygium
Directory of Open Access Journals (Sweden)
Alireza Nazempoor
2014-11-01
Full Text Available Introduction Pterygium is a wing-shaped, vascular, fleshy growth that originates from the conjunctiva and can spread into the corneal limbus and beyond. Beta irradiation after bare sclera surgery of primary pterygium is a simple, effective, and safe treatment, which reduces the risk of local recurrence. Materials and Methods Dosimetric components of strontium-90 (90Sr, phosphorous-32 (32P, and ruthenium-106 (106Ru, in form of ophthalmic applicators, were evaluated, using the Monte Carlo method. Results The obtained results indicated that 32P applicator could deliver higher doses (about 10 Gy to a target, located within a close distance from the surface, compared to 90Sr and 106Ru; it also delivered a lower dose to normal tissues. Conclusion The risk of pterygium has increased given the geographical location and climate of Iran. Spread of dust in the country over the past few years has also contributed to the rising rate of this condition. Our results showed that using 32P applicator is a cost-effective method for pterygium treatment.
45 CFR 1170.32 - Existing facilities.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Existing facilities. 1170.32 Section 1170.32... ASSISTED PROGRAMS OR ACTIVITIES Accessibility § 1170.32 Existing facilities. (a) Accessibility. A recipient... require a recipient to make each of its existing facilities or every part of a facility accessible to and...
48 CFR 32.909 - Contractor inquiries.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor inquiries. 32.909 Section 32.909 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Prompt Payment 32.909 Contractor inquiries. (a) Direct questions...
The remaining percentage of 32P after burning of sulphur tablet containing 32P
International Nuclear Information System (INIS)
Ke Weiqing
1991-01-01
Three types of sulphur tablet containing 32 P are made artificially. The remaining percentage of 32 P after burning of three types of sulphur tablets containing 32 P is 98.1 ± 1.3% for 1st and 2nd types and 97.2 ± 2.8% for 3rd type
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false [Reserved] 73.32 Section 73.32 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) SULFUR DIOXIDE ALLOWANCE SYSTEM Allowance Tracking System § 73.32 [Reserved] ...
47 CFR 32.2441 - Conduit systems.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Conduit systems. 32.2441 Section 32.2441 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.2441 Conduit systems. (a...
47 CFR 32.2231 - Radio systems.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Radio systems. 32.2231 Section 32.2231 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.2231 Radio systems. (a...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Marketing. 32.6610 Section 32.6610 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS FOR TELECOMMUNICATIONS COMPANIES Instructions for Expense Accounts § 32.6610 Marketing. Class B...
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 32.302 Section 32.302 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Loan Guarantees for Defense Production 32.302 Authority. Congress has...
Okamoto, Susumu; Taguchi, Takaaki; Ochi, Kozo; Ichinose, Koji
2009-02-27
All known benzoisochromanequinone (BIQ) biosynthetic gene clusters carry a set of genes encoding a two-component monooxygenase homologous to the ActVA-ORF5/ActVB system for actinorhodin biosynthesis in Streptomyces coelicolor A3(2). Here, we conducted molecular genetic and biochemical studies of this enzyme system. Inactivation of actVA-ORF5 yielded a shunt product, actinoperylone (ACPL), apparently derived from 6-deoxy-dihydrokalafungin. Similarly, deletion of actVB resulted in accumulation of ACPL, indicating a critical role for the monooxygenase system in C-6 oxygenation, a biosynthetic step common to all BIQ biosyntheses. Furthermore, in vitro, we showed a quinone-forming activity of the ActVA-ORF5/ActVB system in addition to that of a known C-6 monooxygenase, ActVA-ORF6, by using emodinanthrone as a model substrate. Our results demonstrate that the act gene cluster encodes two alternative routes for quinone formation by C-6 oxygenation in BIQ biosynthesis.
Stuttard, C
1983-01-01
A lysate of the generalized transducing phage SV1, grown on the prototrophic type strain 10712 of Streptomyces venezuelae, was mutagenized with hydroxylamine and used to transduce a lysineless auxotroph to lysine independence on supplemented minimal agar. A complex threonine mutant, strain VS95, was isolated from among the transductants and was shown to be carrying at least two different thr mutations. These were about 50% cotransducible with alleles of four independently isolated lysA mutations, as were two other independently isolated threonine mutations, thr-1 and hom-5. The location of thr genes close to lysA occurs in at least three other streptomycetes, but apparently not in Streptomyces coelicolor A3(2), in which the lysA and thr loci are at diametrically opposite locations on the linkage map. This first observation of cotransduction between loci governing the biosynthesis of different amino acids in the genus Streptomyces demonstrates the feasibility of fine-structure genetic analysis by transduction in these antibiotic-producing bacteria. PMID:6411685
28 CFR 551.32 - Staff supervision.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Staff supervision. 551.32 Section 551.32 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE INSTITUTIONAL MANAGEMENT MISCELLANEOUS Inmate Organizations § 551.32 Staff supervision. (a) The Warden shall appoint a staff member as the institution's Inmate Organization Manager (IO...
22 CFR 228.32 - Nonprofit organizations.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Nonprofit organizations. 228.32 Section 228.32 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES ON SOURCE, ORIGIN AND NATIONALITY FOR... USAID Financing § 228.32 Nonprofit organizations. (a) Nonprofit organizations, such as educational...
47 CFR 32.6623 - Customer services.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Customer services. 32.6623 Section 32.6623... FOR TELECOMMUNICATIONS COMPANIES Instructions for Expense Accounts § 32.6623 Customer services. (a... includes: (1) Initiating customer service orders and records; (2) Maintaining and billing customer accounts...
Bacterial single-stranded DNA-binding proteins are phosphorylated on tyrosine
DEFF Research Database (Denmark)
Mijakovic, Ivan; Petranovic, Dina; Macek, B
2006-01-01
for phosphotyrosine-containing proteins in Streptomyces griseus by immunoaffinity chromatography identified bacterial SSBs as a novel target of bacterial tyrosine kinases. Since genes encoding protein-tyrosine kinases (PTKs) have not been recognized in streptomycetes, and SSBs from Streptomyces coelicolor (Sc......SSB) and Bacillus subtilis (BsSSB) share 38.7% identity, we used a B.subtilis protein-tyrosine kinase YwqD to phosphorylate two cognate SSBs (BsSSB and YwpH) in vitro. We demonstrate that in vivo phosphorylation of B.subtilis SSB occurs on tyrosine residue 82, and this reaction is affected antagonistically...... by kinase YwqD and phosphatase YwqE. Phosphorylation of B.subtilis SSB increased binding almost 200-fold to single-stranded DNA in vitro. Tyrosine phosphorylation of B.subtilis, S.coelicolor and Escherichia coli SSBs occured while they were expressed in E.coli, indicating that tyrosine phosphorylation...
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 32.101 Section 32.101 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.101 Authority. The basic authority...
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Definitions. 32.801 Section 32.801 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Assignment of Claims 32.801 Definitions. Designated agency, as used in this...
42 CFR 137.32 - Is a compact required to participate in self-governance?
2010-10-01
...-governance? 137.32 Section 137.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.32 Is a compact required to participate in self-governance? Yes, Tribes must have a...
32 CFR 32.42 - Codes of conduct.
2010-07-01
... NON-PROFIT ORGANIZATIONS Post-Award Requirements Procurement Standards § 32.42 Codes of conduct. The..., recipients may set standards for situations in which the financial interest is not substantial or the gift is...
Energy Technology Data Exchange (ETDEWEB)
Scheidhauer, J; Chabidon, M [Commissariat a l' Energie Atomique, Centre de Production de Plutonium, Marcoule (France). Centre d' Etudes Nucleaires
1963-07-01
The problem of fast neutron dosimetry using activation is studied from the radio-protection point of view. The practical development of methods for analyzing phosphorus 32 produced by the activation of sulphur 32 in human hair by the reaction {sup 32}S(n, p){sup 32}P is described. The sensitivity obtained is 5 rad. A preliminary study was made of the variations in the natural sulphur and phosphorus concentrations. (authors) [French] Le probleme de la dosimetrie des neutrons rapides par activation est etudie sous l'angle de la radioprotectlon. Une mise au point pratique de methodes d'analyae du phosphore 32 induit par activation du soufre 32 des cheveux humains par reaction {sup 32}S(n, p){sup 32}P est exposee. La sensibilite obtenue est de 5 rad. Les variations du soufre et du phosphore naturels ont fait l'objet d'une etude preliminaire. (auteurs)
PFM2: a 32 × 32 processor for X-ray diffraction imaging at FELs
Manghisoni, M.; Fabris, L.; Re, V.; Traversi, G.; Ratti, L.; Grassi, M.; Lodola, L.; Malcovati, P.; Vacchi, C.; Pancheri, L.; Benkechcache, M. E. A.; Dalla Betta, G.-F.; Xu, H.; Verzellesi, G.; Ronchin, S.; Boscardin, M.; Batignani, G.; Bettarini, S.; Casarosa, G.; Forti, F.; Giorgi, M.; Paladino, A.; Paoloni, E.; Rizzo, G.; Morsani, F.
2016-11-01
This work is concerned with the design of a readout chip for application to experiments at the next generation X-ray Free Electron Lasers (FEL). The ASIC, named PixFEL Matrix (PFM2), has been designed in a 65 nm CMOS technology and consists of 32 × 32 pixels. Each cell covers an area of 110 × 110 μm2 and includes a low-noise charge sensitive amplifier (CSA) with dynamic signal compression, a time-variant shaper used to process the preamplifier output signal, a 10-bit successive approximation register (SAR) analog-to-digital converter (ADC) and digital circuitry for channel control and data readout. Two different solutions for the readout channel, based on different versions of the time-variant filter, have been integrated in the chip. Both solutions can be operated in such a way to cope with the high frame rate (exceeding 1 MHz) foreseen for future X-ray FEL machines. The ASIC will be bump bonded to a slim/active edge pixel sensor to form the first demonstrator for the PixFEL X-ray imager. This work has been carried out in the frame of the PixFEL project funded by Istituto Nazionale di Fisica Nucleare (INFN), Italy.
47 CFR 32.4040 - Customers' deposits.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Customers' deposits. 32.4040 Section 32.4040... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.4040 Customers' deposits. (a) This account shall include the amount of cash deposited with the company by customers as security...
28 CFR 32.35 - Disqualification.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Disqualification. 32.35 Section 32.35 Judicial Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE BENEFIT CLAIMS Educational Assistance Benefit Claims § 32.35 Disqualification. No claim shall be...
22 CFR 226.32 - Real property.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Real property. 226.32 Section 226.32 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADMINISTRATION OF ASSISTANCE AWARDS TO U.S. NON-GOVERNMENTAL ORGANIZATIONS Post-award Requirements Property Standards § 226.32 Real property. (a) Unless the agreement...
7 CFR 1794.32 - Environmental report.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Environmental report. 1794.32 Section 1794.32... AGRICULTURE (CONTINUED) ENVIRONMENTAL POLICIES AND PROCEDURES Procedure for Categorical Exclusions § 1794.32 Environmental report. (a) For proposed actions listed in § 1794.21(b) and (c), the applicant is normally not...
40 CFR 230.32 - Other wildlife.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Other wildlife. 230.32 Section 230.32... Characteristics of the Aquatic Ecosystem § 230.32 Other wildlife. (a) Wildlife associated with aquatic ecosystems... cover, travel corridors, and preferred food sources for resident and transient wildlife species...
29 CFR 32.4 - Discrimination prohibited.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Discrimination prohibited. 32.4 Section 32.4 Labor Office of... FEDERAL FINANCIAL ASSISTANCE General Provisions § 32.4 Discrimination prohibited. (a) General. No... denied the benefits of, or otherwise be subjected to discrimination under any program or activity which...
34 CFR 32.10 - Deductions process.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Deductions process. 32.10 Section 32.10 Education Office of the Secretary, Department of Education SALARY OFFSET TO RECOVER OVERPAYMENTS OF PAY OR ALLOWANCES FROM DEPARTMENT OF EDUCATION EMPLOYEES § 32.10 Deductions process. (a) Debts must be collected in...
29 CFR 32.12 - Discrimination prohibited.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Discrimination prohibited. 32.12 Section 32.12 Labor Office... § 32.12 Discrimination prohibited. (a) General. (1) No qualified handicapped individual shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which...
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Collections. 175.32 Section 175.32 Indians BUREAU OF..., Payments, and Collections § 175.32 Collections. The utility shall attempt collection on checks returned by... for each collection action taken by the utility other than court proceedings. An unredeemed check...
19 CFR 111.32 - False information.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false False information. 111.32 Section 111.32 Customs... CUSTOMS BROKERS Duties and Responsibilities of Customs Brokers § 111.32 False information. A broker must... procure the giving of, any false or misleading information or testimony in any matter pending before the...
10 CFR 19.32 - Discrimination prohibited.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Discrimination prohibited. 19.32 Section 19.32 Energy... § 19.32 Discrimination prohibited. No person shall on the grounds of sex be excluded from participation in, be denied a license, be denied the benefit of, or be subjected to discrimination under any...
Yoo, Ji-Sun; Oh, Gyeong-Seok; Ryoo, Sungweon; Roe, Jung-Hye
2016-01-01
Antibiotic-producing streptomycetes are rich sources of resistance mechanisms against endogenous and exogenous antibiotics. An ECF sigma factor ?R (SigR) is known to govern the thiol-oxidative stress response in Streptomyces coelicolor. Amplification of this response is achieved by producing an unstable isoform of ?R called ?R?. In this work, we present evidence that antibiotics induce the SigR regulon via a redox-independent pathway, leading to antibiotic resistance. The translation-inhibiti...
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false State. 32.665 Section 32.665 Transportation Office... ASSISTANCE) Definitions § 32.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...
29 CFR 1904.32 - Annual summary.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Annual summary. 1904.32 Section 1904.32 Labor Regulations... Requirements § 1904.32 Annual summary. (a) Basic requirement. At the end of each calendar year, you must: (1... deficiencies identified; (2) Create an annual summary of injuries and illnesses recorded on the OSHA 300 Log...
International Nuclear Information System (INIS)
Strange, J.R.; Williamson, G.D.; Fletcher, D.J.
1975-01-01
A study of the Flat Creek Embayment of Lake Sidney Lanier near Gainesville, Georgia revealed three genera of algae, Chlorococcum, Fragillaria and Nostoc, to be prominent in this eutrophic region of the lake. The algae was grown in phosphate-rich media and subsequently labelled with P-32. All species incorporated luxury amounts of phosphorus as determined by the uptake of P-32. The results indicate that the P-32 uptake is proportional to the surface-per-volume ratio. The higher surface-per-volume ratio resulted in greater uptake of P-32
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Advertising. 10.32 Section 10... of Professional Responsibility § 10.32 Advertising. (a) Subject to § 10.31, a practitioner may advertise services through public media, including a telephone directory, legal directory, newspaper, or...
International Nuclear Information System (INIS)
Morgenstern, U.
2006-01-01
Useful tools for determining absolute ages of sediments deposited within the last c. 100 years include 210 Pb, 137 Cs, and bomb radiocarbon. Cosmogenic 32 Si, with a half life of c. 140 years, can be applied in the age range 30-1000 years and is ideally suited for this time period. Detection of 32 Si is, however, very difficult due to its extremely low natural specific activity, and the vast excess of stable silicon (i.e. low 32 Si/Si ratio). 23 refs
2010-07-01
... ASSISTANCE General Provisions § 32.1 Purpose. Section 504 of the Rehabilitation Act of 1973 prohibits... purpose of this part is to implement section 504 with respect to receiving Federal financial assistance... 29 Labor 1 2010-07-01 2010-07-01 true Purpose. 32.1 Section 32.1 Labor Office of the Secretary of...
A possible interaction between spin-1/2 and spin-3/2 fields
International Nuclear Information System (INIS)
Fleury, N.; Lopes, J.L.
1984-01-01
A straighforward extension of the standard Weinberg-Salam model to Rarita-Schwinger formalism, is a heuristic way to obtain electroweak currents for spin-3/2 leptons. A new interaction between spin-1/2 and spin-3/2 particles that maintains the SU(2) x U(1) gauge invariance is postulated and a possible form for the interaction involving these two types of particles and the gauge fields is obtained. This takes place through a coupling which involves derivatives of the electromagnetic field and the corresponding coupling constant is inversely proportional to the mass of spin-3/2 particles. Several reactions are possible with this new interaction such as the radiative decay of a charged Rarita-Schwinger particle. Other reactions are corrections to well-known processes: for instance, in the usual Compton effect, the fermionic virtual line can be replaced by the corresponding spin-3/2 one. But, due to the large mass of the spin-3/2 lepton, these corrections are significantly non negligible only at ultra relativistic energies. On the other hand, in the low energy limit this correction gives fortunately no contribution to the Thomson cross section because the coupling 3/2 - 1/2 - γ is proportional to the photon's momentum. If it is considered all the possible couplings of these fields, one can combine them in diagrams of lowest orders whose theoretical predictions have to be submitted to experimental pressure. (Author) [pt
Gastrointestinal linear foreign bodies in 32 dogs: a retrospective evaluation and feline comparison
International Nuclear Information System (INIS)
Evans, K.L.; Smeak, D.D.; Biller, D.S.
1994-01-01
Hospital records of 32 dogs undergoing surgery for gastrointestinal linear foreign bodies (LFBs) were reviewed to evaluate clinical signs, laboratory abnormalities, radiographic signs, surgical procedures, andcomplications associated with this condition. Information potentiallyrelating to prognosis was evaluated statistically. Clinical data derived from this study was compared to the information available in the literature regarding LFBs in cats. Linear foreign bodies were rarely discovered under the tongue during physical examination of affected dogs(2/32; 6%), and most were lodged at the pylorus (28/32; 87%). The types of LFB removed were more variable in the dog; fabric, carpet, pantyhose, string, and plastic were the most common. Fabric and plastic materials had an increased probability of causing peritonitis. Peritonitis was evident at surgery in 13/32 (41%) dogs; of these, 9/32 (31%) hadgross contamination through intestinal perforations. Intestinal resection and anastomosis was required in 13/32 dogs (41%). Intussusceptions concurrently were found in 8/32 (25%) dogs having LFBs. The presenceof perforations or peritonitis increased the probability of death. The probability of peritonitis and death as a result of LFB in dogs is nearly double that of cats as described in previous reports
A study of 32P-phosphate uptake in a plant by a real-time RI imaging system
International Nuclear Information System (INIS)
Yamawaki, M.; Kanno, S.; Ishibashi, H.; Noda, A.; Hirose, A.; Tanoi, K.; Nakanishi, T.M.
2011-01-01
It is very important to visualize the process of nutrient absorption and distribution to study the physiological activity of the plant. We developed a real-time radioisotope (RI) imaging system, where RI tracers were applied to the plant sample. This system allowed the quantitative measurement concerning the uptake of nutrients labeled with radioisotopes, such as 45 Ca, 35 S, 32 P and 14 C as long as several days. The β-rays emitted from the sample were converted to light by a CsI(Tl) scintillator and were guided to a highly sensitive CCD camera. The scintillator surface was covered with an Al plate to avoid LED light penetration but allow selected β-ray penetration. We employed Lotus japonicus for the plant sample and observed the 32 P-phosphate absorption in roots and the accumulation to the aboveground part of the plant. The environment condition of daytime and night was simulated by the ON/OFF of LED timer and the accumulation manner of the 32 P-phosphate in roots and leaves during daytime and night was analyzed. The accumulation of 32 P-phosphate in leaves was highly dependant on light irradiation and higher when the LEDs was turned on, whereas the absorption of 32 P-phosphate in root was higher when the LEDs was turned off. The transfer function concerning the transportation of phosphate within the plant during the developmental stage was obtained from the analysis of 32 P uptake images. We are now trying to get specific moving images of each radioisotope when two kinds of isotopes, such as 32 P and 32 S, were applied at the same time to the plant, through an image analysis. (orig.)
48 CFR 32.104 - Providing contract financing.
2010-10-01
... financing. 32.104 Section 32.104 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.104 Providing contract financing. (a) Prudent contract financing can be a useful working tool in Government...
2010-07-01
... awarding agency. (d) Management requirements. Procedures for managing equipment (including replacement... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Equipment. 31.32 Section 31.32...
2010-01-01
... awarding agency. (d) Management requirements. Procedures for managing equipment (including replacement... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Equipment. 1273.32 Section 1273.32...
2010-07-01
... awarding agency. (d) Management requirements. Procedures for managing equipment (including replacement... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no... 29 Labor 4 2010-07-01 2010-07-01 false Equipment. 1470.32 Section 1470.32 Labor Regulations...
32 CFR 809a.10 - Military commanders' responsibilities.
2010-07-01
... authorities as soon as possible. (c) Military forces will ordinarily exercise police powers previously... 32 National Defense 6 2010-07-01 2010-07-01 false Military commanders' responsibilities. 809a.10... Disturbance Intervention and Disaster Assistance § 809a.10 Military commanders' responsibilities. (a...
Hard X-ray test and evaluation of a prototype 32x32 pixel gallium-arsenide array
International Nuclear Information System (INIS)
Erd, C.; Owens, A.; Brammertz, G.; Bavdaz, M.; Peacock, A.; Laemsae, V.; Nenonen, S.; Andersson, H.; Haack, N.
2002-01-01
We report X-ray measurements on a prototype 1.1 cm 2 , 32x32 GaAs pixel array with a pixel size of 350x350 μm 2 produced to assess the technological feasibility of making large area, almost Fano-limited arrays, which operate near room temperature. Measurements were carried out on four widely separated pixels both in our laboratories and using monochromatic X-ray pencil beams at the HASYLAB synchrotron research facility in Hamburg, Germany. The pixels were found to be very uniform both in their energy and spatial responses. For example, typical energy resolutions of ∼280 eV at 10.5 keV, rising to ∼560 eV at 60 keV were achieved. The corresponding resolutions measured under full-pixel illumination were found to be the same within statistics, indicating uniform crystallinity and stoichiometry. Likewise, by scanning a 15 keV, 15x15 μm 2 beam across the entire surface of each of the pixels, the gain uniformity across the pixels (and by implication the entire array) was determined to be statistically flat
2010-01-01
... awarding agency. (d) Management requirements. Procedures for managing equipment (including replacement... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Equipment. 143.32 Section 143.32...
2010-10-01
... awarding agency. (d) Management requirements. Procedures for managing equipment (including replacement... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no... 45 Public Welfare 1 2010-10-01 2010-10-01 false Equipment. 92.32 Section 92.32 Public Welfare...
2010-01-01
... awarding agency. (d) Management requirements. Procedures for managing equipment (including replacement... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Equipment. 24.32 Section 24.32...
2010-10-01
... REQUIREMENTS CONTRACT FINANCING Advance Payments for Non-Commercial Items 32.407 Interest. (a) Except as provided in paragraph (d) below, the contracting officer shall charge interest on the daily unliquidated... institution (depository) in which the special account (see 32.409-3) is established; or (2) The rate...
Natural 32Si as a tool for the study of glacier dynamics
International Nuclear Information System (INIS)
Morgenstern, U.
1998-01-01
Cosmogenic 32 Si (half-life ca. 140 years) can be applied to the study of environmental circulation processes in the time range 50 to 1000 years, within which no other dating method is readily available. Its non-gaseous nature and fairly constant production rate are favourable to quantify its behaviour in environmental processes. 32 Si is potentially useful in studies of glacier dynamics, sedimentation in lakes and oceans, groundwater flow and mixing processes, ocean circulation, and soil erosion. Global distribution of 32 Si was poorly known for a long time. However, we now know that the spatial and temporal distribution is very similar to other well-investigated cosmogenic radionuclides: latitude and seasonal variation, negative-correlation to solar activity, and a brief contribution from nuclear weapons testing. We have now measured the 32 Si deposition via rain in Kaitoke, near Wellington, giving the first data for Southern Hemisphere. Compared to Northern Hemisphere data, the measured 32 Si concentrations in Kaitoke rain are nearly a factor 2 higher. Concentrations in snow from NZ glaciers are higher by a factor of 5, allowing for better dating of NZ glaciers than is possible in Northern Hemisphere glaciers. The age information from the glacier ice can provide reliable information on glacier turnover times and ice velocities, and indicate the timespan of available environmental records in the glacier. The special value of 32 Si is to provide age information of environmental records within the past few centuries, which is a main goal of future international activities in climate change research. (author). 2 refs
MIMOSA. A 32 channel 40 MHz Camac scaler
International Nuclear Information System (INIS)
Beer, A.; Bourgeois, F.; Critin, G.
1981-01-01
This report describes a 32 channel, 24 bit, 40 MHz single width Camac scaler based on the memory increment technique. The characteristics of the module are given and its logic is briefly described. Circuit diagrams and component lists are given. (orig.)
A remarkable representation of the SO(3,2) Kac-Moody algebra
International Nuclear Information System (INIS)
Dobrev, V.K.; Sezgin, E.
1990-01-01
We construct a minimal representation of the SO(3,2) Kac-Moody algebra algebra which is based on the spin-zero singleton (the Rac) representation of SO(3,2). The representation is minimal in the sense that the central charge k of the SO(3,2) Kac-Moody algebra is chosen to take the special value of 5/2 which allows the imposition of maximum number of reducibility conditions. For the Rac, this is the unique choice for the remarkable property of maximum reducibility which is consistent with unitarity. To ensure unitarity, we furthermore impose invariance condition under the maximal compact subalgebra SO(3) x SO(2). (author). 19 refs, 1 fig
Chan, Derek V; Somani, Ally-Khan; Young, Andrew B; Massari, Jessica V; Ohtola, Jennifer; Sugiyama, Hideaki; Garaczi, Edina; Babineau, Denise; Cooper, Kevin D; McCormick, Thomas S
2011-01-01
Abstract Background Elevated numbers of regulatory T cells (Tregs) have been implicated in certain cancers. Depletion of Tregs has been shown to increase anti-tumor immunity. Tregs also play a critical role in the suppression of autoimmune responses. The study of Tregs has been hampered by a lack of adequate surface markers. Leucine Rich Repeat Containing 32 (LRRC32), also known as Glycoprotein A Repetitions Predominant (GARP), has been postulated as a novel surface marker of activated Tregs....
Identifikace a modelování regulačních sítí genové exprese v průběhu germinace streptomycet
Straková, Eva
2013-01-01
Streptomycetes have been studied mostly as producers of antibiotics and for fundamentals of complex bacterial cell development. Here, transcriptomic and proteomic approaches were applied to systems study of Streptomyces coelicolor germination as a developmental transition from dormancy to the vegetative stage. The time dynamics of the gene expression levels represented by mRNA and intracellular protein accumulation and synthesis were measured throughout 5.5 h of germination at 13 time points ...
22 CFR 212.32 - Identification of records.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Identification of records. 212.32 Section 212.32 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PUBLIC INFORMATION Access to Agency Records § 212.32 Identification of records. The request for a record by a member of the public must contain a...
DEFF Research Database (Denmark)
Mekasha, Sophanit; Toupalová, Hana; Linggadjaja, Eka
2016-01-01
Enzymatic depolymerization of chitosan, a β-(1,4)-linked polycationic polysaccharide composed of D-glucosamine (GlcN) and N-acetyl-D-glucosamine (GlcNAc) provides a possible route to the exploitation of chitin-rich biomass. Complete conversion of chitosan to mono-sugars requires the synergistic...... action of endo- and exo- chitosanases. In the present study we have developed an efficient and cost-effective chitosan-degrading enzyme cocktail containing only two enzymes, an endo-attacking bacterial chitosanase, ScCsn46A, from Streptomyces coelicolor, and an exo-attacking glucosamine specific β...
Phosphorus-32 therapy for cystic craniopharyngiomas
International Nuclear Information System (INIS)
Barriger, Robert Bryan; Chang, Andrew; Lo, Simon S.; Timmerman, Robert D.; DesRosiers, Colleen; Boaz, Joel C.; Fakiris, Achilles J.
2011-01-01
Background and purpose: To examine control rates for predominantly cystic craniopharyngiomas treated with intracavitary phosphorus-32 (P-32). Material and methods: 22 patients with predominantly cystic craniopharyngiomas were treated at Indiana University between October 1997 and December 2006. Nineteen patients with follow-up of at least 6 months were evaluated. The median patient age was 11 years, median cyst volume was 9 ml, a median dose of 300 Gy was prescribed to the cyst wall, and median follow-up was 62 months. Results: Overall cyst control rate after the initial P-32 treatment was 67%. Complete tumor control after P-32 was 42%. Kaplan-Meier 1-, 3-, and 5-year initial freedom-from-progression rates were 68%, 49%, and 31%, respectively. Following salvage therapy, the Kaplan-Meier 1-, 3-, and 5-year ultimate freedom-from-progression rates were 95%, 95%, and 86%, respectively. All patients were alive at the last follow-up. Visual function was stable or improved in 81% when compared prior to P-32 therapy. Pituitary function remained stable in 74% of patients following P-32 therapy. Conclusions: Intracystic P-32 can be an effective and tolerable treatment for controlling cystic components of craniopharyngiomas as a primary treatment or after prior therapies, but frequently allows for progression of solid tumor components. Disease progression in the form of solid tumor progression, re-accumulation of cystic fluid, or development of new cysts may require further radiotherapy or surgical intervention for optimal long-term disease control.
Revealing a comet-like shape of the faint periphery of the nearby galaxy M 32
Georgiev, Ts. B.
2016-02-01
We performed BVRI photometry of the galaxy M 32 building images and isophote maps in magnitudes and in color indexes. While searching for the faint thick disk of M 32 we apply median filtering with aperture of 7.3 arcmin to detach the residual image of M 32 and its periphery above the surrounding magnitude or color background. The residual images in all photometric systems show that the periphery of M 32 possesses a comet-like shape with a tail oriented to SSE, in a direction opposite to the direction of M 110. The images calibrated in color indexes (b - v) and (b - v)+(r - i) show that the tail is redder than the local median background. The residual images in color indexes show that the red tail broadens and curves in direction towards S and SW. Simultaneously, the brightest part of M 32 occurs bounded from NW-NE-SE sides by a sickle-like formation with a significantly lower red color index. Generally, we do not find a faint thick disk of M 32. However, the comet-like shape on the periphery of M 32, especially as a formation with an increased red color index, provokes involuntarily the impression that the satellite M 32 overtakes the Andromeda galaxy. The redshifts show that the intimacy velocity of M 32 and Andromeda galaxy is about 100 km/s.
12 CFR 560.32 - Pass-through investments.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Pass-through investments. 560.32 Section 560.32 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY LENDING AND INVESTMENT Lending and Investment Powers for Federal Savings Associations § 560.32 Pass-through investments. (a) A...
2010-10-01
... adequate security; (ii) The advance payments will not exceed the unpaid contract price (see 32.410(b... REQUIREMENTS CONTRACT FINANCING Advance Payments for Non-Commercial Items 32.402 General. (a) A limitation on authority to grant advance payments under Pub. L. 85-804 (50 U.S.C. 1431-1435) is described at 50.102-3(b)(4...
Detection and properties of A-factor-binding protein from Streptomyces griseus
International Nuclear Information System (INIS)
Miyake, K.; Horinouchi, S.; Yoshida, M.; Chiba, N.; Mori, K.; Nogawa, N.; Morikawa, N.; Beppu, T.
1989-01-01
The optically active form of tritium-labeled A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone), a pleiotropic autoregulator responsible for streptomycin production, streptomycin resistance, and sporulation in Streptomyces griseus, was chemically synthesized. By using the radioactive A-factor, a binding protein for A-factor was detected in the cytoplasmic fraction of this organism. The binding protein had an apparent molecular weight of approximately 26,000, as determined by gel filtration. Scatchard analysis suggested that A-factor bound the protein in the molar ratio of 1:1 with a binding constant, Kd, of 0.7 nM. The number of the binding protein was roughly estimated to be 37 per genome. The inducing material virginiae butanolide C (VB-C), which has a structure very similar to that of A-factor and is essential for virginiamycin production in Streptomyces virginiae, did not inhibit binding. In addition, no protein capable of specifically binding 3 H-labeled VB-C was found in S. griseus. Together with the observation that VB-C had almost no biological activity on the restoration of streptomycin production or sporulation in an A-factor-deficient mutant of S. griseus, these results indicated that the binding protein had a strict ligand specificity. Examination for an A-factor-binding protein in Streptomyces coelicolor A3(2) and Streptomyces lividans showed the absence of any specifically binding protein
32 CFR 776.33 - Client under a disability.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Client under a disability. 776.33 Section 776.33... of Professional Conduct § 776.33 Client under a disability. (a) Client under a disability: (1) When a client's ability to make adequately considered decisions in connection with the representation is...
45 CFR 81.32 - Signature of documents.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Signature of documents. 81.32 Section 81.32 Public... UNDER PART 80 OF THIS TITLE Form, Execution, Service and Filing of Documents § 81.32 Signature of documents. The signature of a party, authorized officer, employee or attorney constitutes a certificate that...
22 CFR 62.32 - Summer work travel.
2010-04-01
...-secondary students the opportunity to work and travel in the United States for a four month period during... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Summer work travel. 62.32 Section 62.32 Foreign... Provisions § 62.32 Summer work travel. (a) Introduction. These regulations govern program participation in...
40 CFR 60.32c - Designated facilities.
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Designated facilities. 60.32c Section 60.32c Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Solid Waste Landfills § 60.32c Designated facilities. (a) The designated facility to which the...
47 CFR 32.2220 - Operator systems.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Operator systems. 32.2220 Section 32.2220 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.2220 Operator systems...
29 CFR 32.26 - Discrimination prohibited.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Discrimination prohibited. 32.26 Section 32.26 Labor Office... RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 32.26 Discrimination prohibited. No qualified... discrimination under any program or activity to which this part applies. ...
3D modelling of the pathogenic Leptospira protein LipL32: A bioinformatics approach.
Kumaran, Sharmilah Kumari; Bakar, Mohd Faizal Abu; Mohd-Padil, Hirzahida; Mat-Sharani, Shuhaila; Sakinah, S; Poorani, K; Alsaeedy, Hiba; Peli, Amira; Wei, Teh Seoh; Ling, Mok Pooi; Hamat, Rukman Awang; Neela, Vasantha Kumari; Higuchi, Akon; Alarfaj, Abdullah A; Rajan, Mariappan; Benelli, Giovanni; Arulselvan, Palanisamy; Kumar, S Suresh
2017-12-01
Leptospirosis is a widespread zoonotic disease caused by pathogenic Leptospira species (Leptospiraceae). LipL32 is an abundant lipoprotein from the outer membrane proteins (OMPs) group, highly conserved among pathogenic and intermediate Leptospira species. Several studies used LipL32 as a specific gene to identify the presence of leptospires. This research was aimed to study the characteristics of LipL32 protein gene code, to fill the knowledge gap concerning the most appropriate gene that can be used as antigen to detect the Leptospira. Here, we investigated the features of LipL32 in fourteen Leptospira pathogenic strains based on comparative analyses of their primary, secondary structures and 3D modeling using a bioinformatics approach. Furthermore, the physicochemical properties of LipL32 in different strains were studied, shedding light on the identity of signal peptides, as well as on the secondary and tertiary structure of the LipL32 protein, supported by 3D modelling assays. The results showed that the LipL32 gene was present in all the fourteen pathogenic Leptospira strains used in this study, with limited diversity in terms of sequence conservation, hydrophobic group, hydrophilic group and number of turns (random coil). Overall, these results add basic knowledge to the characteristics of LipL32 protein, contributing to the identification of potential antigen candidates in future research, in order to ensure prompt and reliable detection of pathogenic Leptospira species. Copyright © 2017 Elsevier B.V. All rights reserved.
32 CFR Appendix A to Part 153 - Guidelines
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Guidelines A Appendix A to Part 153 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE REGULATIONS PERTAINING TO MILITARY...—Guidelines (a) Civilians employed by the Armed Forces outside the United States who commit felony offenses...
International Nuclear Information System (INIS)
Scheidhauer, J.; Chabidon, M.
1963-01-01
The problem of fast neutron dosimetry using activation is studied from the radio-protection point of view. The practical development of methods for analyzing phosphorus 32 produced by the activation of sulphur 32 in human hair by the reaction 32 S(n, p) 32 P is described. The sensitivity obtained is 5 rad. A preliminary study was made of the variations in the natural sulphur and phosphorus concentrations. (authors) [fr
49 CFR 32.635 - Drug-free workplace.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Drug-free workplace. 32.635 Section 32.635 Transportation Office of the Secretary of Transportation GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 32.635 Drug-free workplace. Drug-free workplace means a site for the...
47 CFR 32.6613 - Product advertising.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Product advertising. 32.6613 Section 32.6613... FOR TELECOMMUNICATIONS COMPANIES Instructions for Expense Accounts § 32.6613 Product advertising. This... the purchase of products and services. This excludes nonproduct-related advertising, such as corporate...
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Mediation. 35.32 Section 35.32 Labor Office of the Secretary... Mediation. (a) Referral to mediation. CRC will promptly refer to the Federal Mediation and Conciliation Service or the mediation agency designated by the Secretary of Health and Human Services under 45 CFR part...
2010-10-01
... shotshells while in the field (see § 32.2(k)). C. Big Game Hunting. [Reserved] D. Sport Fishing. We allow... condition: You may only possess approved nontoxic shotshells while in the field (see § 32.2(k)). C. Big Game... Game Hunting. [Reserved] D. Sport Fishing. [Reserved] Deer Flat National Wildlife Refuge A. Migratory...
45 CFR 98.32 - Parental complaints.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Parental complaints. 98.32 Section 98.32 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION CHILD CARE AND DEVELOPMENT FUND Program Operations (Child Care Services)-Parental Rights and Responsibilities § 98.32 Parental complaints...
28 CFR 104.32 - Eligibility review.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Eligibility review. 104.32 Section 104.32 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) SEPTEMBER 11TH VICTIM COMPENSATION FUND OF 2001 Claim Intake, Assistance, and Review Procedures § 104.32 Eligibility review. Any claimant deemed...
47 CFR 32.2112 - Motor vehicles.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Motor vehicles. 32.2112 Section 32.2112... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.2112 Motor vehicles. This account shall include the original cost of motor vehicles of the type which are designed and...
34 CFR 101.32 - Signature of documents.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Signature of documents. 101.32 Section 101.32 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF EDUCATION... Documents § 101.32 Signature of documents. The signature of a party, authorized officer, employee or...
SIGNALS AND REGULATORS THAT GOVERN STREPTOMYCES DEVELOPMENT
McCormick, Joseph R.; Flärdh, Klas
2012-01-01
Streptomyces coelicolor is the genetically best characterized species of a populous genus belonging to the Gram-positive Actinobacteria. Streptomycetes are filamentous soil organisms, well known for the production of a plethora of biologically active secondary metabolic compounds. The Streptomyces developmental life cycle is uniquely complex, and involves coordinated multicellular development with both physiological and morphological differentiation of several cell types, culminating in production of secondary metabolites and dispersal of mature spores. This review presents a current appreciation of the signaling mechanisms used to orchestrate the decision to undergo morphological differentiation, and the regulators and regulatory networks that direct the intriguing development of multigenomic hyphae, first to form specialized aerial hyphae, and then to convert them into chains of dormant spores. This current view of S. coelicolor development is destined for rapid evolution as data from “-omics” studies shed light on gene regulatory networks, new genetic screens identify hitherto unknown players, and the resolution of our insights into the underlying cell biological processes steadily improve. PMID:22092088
7 CFR 1221.32 - United States.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1221.32 Section 1221.32 Agriculture... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Definitions § 1221.32 United States. United States or U.S. means collectively the 50 States, the District of Columbia, the Commonwealth of...
Development of the fast reactor group constant set JFS-3-J3.2R based on the JENDL-3.2
Chiba, G
2002-01-01
It is reported that the fast reactor group constant set JFS-3-J3.2 based on the newest evaluated nuclear data library JENDL3.2 has a serious error in the process of applying the weighting function. As the error affects greatly nuclear characteristics, and a corrected version of the reactor constant set, JFS-3-J3.2R, was developed, as well as lumped FP cross sections. The use of JFS-3-J3.2R improves the results of analyses especially on sample Doppler reactivity and reaction rate in the blanket region in comparison with those obtained using the JFS-3-J3.2.
6 CFR 13.32 - Location of hearing.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Location of hearing. 13.32 Section 13.32 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.32 Location of hearing. (a) The hearing may be held: (1) In any judicial district of the United...
A possible interaction between spin-1/2 and spin-3/2 fields
International Nuclear Information System (INIS)
Fleury, N.; Leite Lopes, J.
1984-01-01
A straightforward extension of the standard Weinberg-Salam model to Rarita-Schwinger formalism, is a heuristic way to obtain electroweak currents for spin-3/2 leptons. We postulate a new interaction between spin-1/2 and spin-3/2 particles that maintains the SU(2) x U(1) gauge invariance, and we obtain a possible form for the interaction involving these two types of particles and the gauge fields. This takes place through a coupling which involves derivatives of the electromagnetic field and the corresponding coupling constant is inversely proportional to the mass of spin-3/2 particles. Several reactions are possible with this new interaction such as the radiative decay of a charged Rarita-Schwinger particle. Other reactions are corrections to well-known processes: for instance, in the usual Compton effect, the fermionic virtual line can be replaced by the corresponding spin-3/2 one. But, due to the large mass of the spin-3/2 lepton, these corrections are significantly non negligible only at ultra relativistic energies. On the other hand, in the low energy limit this correction gives fortunately no contribution to the Thomson cross section because the coupling 3/2-1/2-γ is proportional to the photon's momentum. If one considers all the possible couplings of these fields, one can combine them in diagrams of lowest orders whose theoretical predictions have to be submitted to experimental pressure
7 CFR 160.32 - Marking containers.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Marking containers. 160.32 Section 160.32 Agriculture... STANDARDS FOR NAVAL STORES Analysis, Inspection, and Grading on Request § 160.32 Marking containers. The interested person shall provide any labor necessary for marking the containers, after the contents have been...
29 CFR 1915.32 - Toxic cleaning solvents.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Toxic cleaning solvents. 1915.32 Section 1915.32 Labor... Preservation § 1915.32 Toxic cleaning solvents. (a) When toxic solvents are used, the employer shall employ one or more of the following measures to safeguard the health of employees exposed to these solvents. (1...
76 FR 16845 - Administrator's Line of Succession Designation, No. 1-A, Revision 32
2011-03-25
... SMALL BUSINESS ADMINISTRATION Administrator's Line of Succession Designation, No. 1-A, Revision 32 This document replaces and supersedes ``Line of Succession Designation No. 1-A, Revision 31.'' Line of Succession Designation No. 1-A, Revision 32 Effective immediately, the Administrator's Line of Succession...
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false New Mexico. 32.50 Section 32.50 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED) THE... § 32.50 New Mexico. The following refuge units have been opened for hunting and/or fishing, and are...
39 CFR 3.2 - Compensation of Board.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Compensation of Board. 3.2 Section 3.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE BOARD OF GOVERNORS (ARTICLE III) § 3.2 Compensation of Board. Section 202(a)(1) of title 39 provides for the compensation of...
PFM2: a 32 × 32 processor for X-ray diffraction imaging at FELs
International Nuclear Information System (INIS)
Manghisoni, M.; Re, V.; Traversi, G.; Fabris, L.; Ratti, L.; Grassi, M.; Lodola, L.; Malcovati, P.; Vacchi, C.; Pancheri, L.; Benkechcache, M. E. A.; Dalla Betta, G.-F.; Xu, H.; Verzellesi, G.; Ronchin, S.; Boscardin, M.; Batignani, G.; Bettarini, S.; Casarosa, G.; Forti, F.
2016-01-01
This work is concerned with the design of a readout chip for application to experiments at the next generation X-ray Free Electron Lasers (FEL). The ASIC, named PixFEL Matrix (PFM2), has been designed in a 65 nm CMOS technology and consists of 32 × 32 pixels. Each cell covers an area of 110 × 110 μm 2 and includes a low-noise charge sensitive amplifier (CSA) with dynamic signal compression, a time-variant shaper used to process the preamplifier output signal, a 10-bit successive approximation register (SAR) analog-to-digital converter (ADC) and digital circuitry for channel control and data readout. Two different solutions for the readout channel, based on different versions of the time-variant filter, have been integrated in the chip. Both solutions can be operated in such a way to cope with the high frame rate (exceeding 1 MHz) foreseen for future X-ray FEL machines. The ASIC will be bump bonded to a slim/active edge pixel sensor to form the first demonstrator for the PixFEL X-ray imager. This work has been carried out in the frame of the PixFEL project funded by Istituto Nazionale di Fisica Nucleare (INFN), Italy.
48 CFR 32.005 - Consideration for contract financing.
2010-10-01
... financing. 32.005 Section 32.005 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 32.005 Consideration for contract financing. (a) Requirement. When a contract financing clause is included at the inception of a contract, there shall be no...
A 32-channel 840Msps TDC based on Altera Cyclone III FPGA
International Nuclear Information System (INIS)
Grigoriev, D.N.; Kasyanenko, P.V.; Kravchenko, E.A.; Shamov, A.G.; Talyshev, A.A.
2017-01-01
In this work we present a newly developed TDC (Time-to-Digital Converter) board in the VME-32 standard. The 32-channel TDC board is based on a single FPGA Altera Cyclone III chip. The main parameters of the TDC are as follows: a resolution of 1.19 ns, a dead time of 4.76 ns, and a maximal time interval of 19 504 ns.
47 CFR 32.3100 - Accumulated depreciation.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Accumulated depreciation. 32.3100 Section 32... Accumulated depreciation. (a) This account shall include the accumulated depreciation associated with the... with depreciation amounts concurrently charged to Account 6561, Depreciation expense—telecommunications...
International Nuclear Information System (INIS)
Slama, N.; Lazim, H.; Barkallah, Insaf; Abbassi, M.; Ben Hassen, A.; Limam, F.
2009-01-01
Streptomycetes are gram-positive, soil-inhabiting bacteria of the order Actinomycetales. These organisms exhibit an unusual, developmentally complex life cycle and produce many economically important secondary metabolites, such as antibiotics, immunosuppressants, insecticides, and antitumor agents. Streptomyces species have been the subject of genetic investigation for over 50 years, with many studies focusing on the production of bioactives compounds. The protoplast formation and regeneration are important processes, and they are a major step following genetic manipulations such as fusion and DNA-mediated transformation, which can improve antibiotic production. The protoplast fusion, transformation and improved fermentation features can be used to regenerate strains with increased antibiotic activity. Local Streptomyces spp. CN207 produce a broad range of secondary metabolites which is active against bacteria and fungi. This strain was used as a donor and S. coelicolor strain M145 was used as a recipient host for protoplast fusion. The protoplast fusion resulted in increased isolation of variants with higher antibiotic activity. Recombinant Streptomyces coelicolor PF04 was increased 10 times more than the wild strain. The antimicrobial activity from PF04 strain was studied using the disc method agar. TLC analysis confirmed that the Rf of cell extract for PF04 strain is identical to antimicrobial compound of Streptomyces CN207. Our results confirm the possibility of transferring antibiotics cluster genes by fusion. In fact, many of the selective markers such as Ticarcillin, Cefalotin, Oxacillin and Cefotaxim were transferred during the protoplast fusion. PFGE analysis and DNA-hybridization confirmed the presence of homologous fragments between a wild-type Streptomyces CN207 and a recombinant S. coelicolor PF04
28 CFR 20.32 - Includable offenses.
2010-07-01
... Exchange of Criminal History Record Information § 20.32 Includable offenses. (a) Criminal history record... vehicular manslaughter, driving under the influence of drugs or liquor, and hit and run), when unaccompanied by a § 20.32(a) offense. These exclusions may not be applicable to criminal history records...
32 CFR 700.1056 - Command of a ship.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Command of a ship. 700.1056 Section 700.1056 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY UNITED STATES NAVY REGULATIONS AND OFFICIAL RECORDS UNITED STATES NAVY REGULATIONS AND OFFICIAL RECORDS Precedence, Authority and Command Detail to Duty § 700.1056 Command of a...
Investigation of the reactions 31P(n, γ)32P and 32S(n, γ)33S
Middelkoop, G. van; Spilling, P.
1965-01-01
The γ radiation following capture of thermal neutrons in 31P and 32S was investigated with scintillation-spectrometer techniques. Measurements of single and coincidence spectra and of γ-γ angular correlations yield the following spins in 32P: J(0.52) = 0, J(1.32) = (2), J(4.04) = 1, J(4.88) = 1,
32 CFR 700.710 - Organization of a staff.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Organization of a staff. 700.710 Section 700.710... Commanders Staffs of Commanders § 700.710 Organization of a staff. (a) The term “staff” means those officers... operation of his or her command. (b) The officer detailed as chief of staff and aide to a fleet admiral or...
International Nuclear Information System (INIS)
Seo, Jungho; Kim, Jinyoung; Lim, Hyunwoo; Park, Jingoo; Lee, Songjun; Kim, Bonghoe; Jeon, Sungchae; Huh, Young
2010-01-01
A Si-PIN X-ray detector for digital x-ray imaging with single photon counting capability has been fabricated and characterized. It consists of an array of 32 x 32 pixels with an area of 80 x 80 μm 2 . An extrinsic gettering process was performed to reduce the leakage current by removing the impurities and defects from the X-ray detector's Si substrate. Multiple guard-rings (MGRs) and metal filed plates (MFPs) techniques were adopted to reduce the leakage current and to improve the breakdown performance. The simulation verified that the breakdown voltage was improved with the MGRs and that the leakage current was significantly reduced with the MFPs. The electrical properties, such as the leakage current and the breakdown voltage, of the Si-PIN X-ray detector were characterized. The extrinsic gettering process played a significant role in reducing the leakage current, and a leakage current lower than 60 pA could be achieved at 100 V dc .
Bion M1. Peculiarities of life activities of microbes in 30-day spaceflight
Viacheslav, Ilyin; Korshunov, Denis; Morozova, Julia; Voeikova, Tatiana; Tyaglov, Boris; Novikova, Liudmila; Krestyanova, Irina; Emelyanova, Lydia
The aim of this work was to analyze the influence of space flight factors ( SFF) to microorganism strains , exposed inside unmanned spacecraft Bion M-1 during the 30- day space flight. Objectives of the work - the study of the influence of the SFF exchange chromosomal DNA in crosses microorganisms of the genus Streptomyces; the level of spontaneous phage induction of lysogenic strains fS31 from Streptomyces lividans 66 and Streptomyces coelicolor A3 ( 2 ) on the biosynthesis of the antibiotic tylosin strain of Streptomyces fradiae; survival electrogenic bacteria Shewanella oneidensis MR- 1 is used in the microbial fuel cell As a result of this work it was found that the SFF affect the exchange of chromosomal DNA by crossing strains of Streptomyces. Was detected polarity crossing , expressed in an advantageous contribution chromosome fragment of one of the parent strains in recombinant offspring. This fact may indicate a more prolonged exposure of cells in microgravity and , as a consequence, the transfer of longer fragments of chromosomal DNA This feature is the transfer of genetic material in microgravity could lead to wider dissemination and horizontal transfer of chromosomal and plasmid DNA of symbiotic microflora astronauts and other strains present in the spacecraft. It was shown no effect on the frequency of recombination PCF and the level of mutation model reversion of auxotrophic markers to prototrophy It was demonstrated that PCF increase the level of induction of cell actinophage fS31 lysogenic strain of S. lividans 66, but did not affect the level of induction of this phage cells S. coelicolor A3 ( 2). It is shown that the lower the level of synthesis PCF antibiotic aktinorodina (actinorhodin) in lysogenic strain S. coelicolor A3 ( 2). 66 Strains of S. lividans and S. coelicolor A3 ( 2 ) can be used as a biosensor for studying the effect on microorganisms PCF It is shown that the effect of the PCF reduces synthesis of tylosin and desmicosyn S. fradiae at
GH32 family activity: a topological approach through protein contact networks.
Cimini, Sara; Di Paola, Luisa; Giuliani, Alessandro; Ridolfi, Alessandra; De Gara, Laura
2016-11-01
The application of Protein Contact Networks methodology allowed to highlight a novel response of border region between the two domains to substrate binding. Glycoside hydrolases (GH) are enzymes that mainly hydrolyze the glycosidic bond between two carbohydrates or a carbohydrate and a non-carbohydrate moiety. These enzymes are involved in many fundamental and diverse biological processes in plants. We have focused on the GH32 family, including enzymes very similar in both sequence and structure, each having however clear specificities of substrate preferences and kinetic properties. Structural and topological differences among proteins of the GH32 family have been here identified by means of an emerging approach (Protein Contact network, PCN) based on the formalization of 3D structures as contact networks among amino-acid residues. The PCN approach proved successful in both reconstructing the already known functional domains and in identifying the structural counterpart of the properties of GH32 enzymes, which remain uncertain, like their allosteric character. The main outcome of the study was the discovery of the activation upon binding of the border (cleft) region between the two domains. This reveals the allosteric nature of the enzymatic activity for all the analyzed forms in the GH32 family, a character yet to be highlighted in biochemical studies. Furthermore, we have been able to recognize a topological signature (graph energy) of the different affinity of the enzymes towards small and large substrates.
Papilloma of lip associated with human papilloma viruses-32 infection in a child.
Sabeena, Sasidharanpillai; Pallade, Sadashiva Rao; Kamath, Nutan; Mathew, Mary; Arunkumar, Govindakarnavar
2016-01-01
Squamous papilloma is the most common benign oral epithelial lesion, and it is well known to be associated with human papilloma virus 6 and 11. Here, we report a case of squamous papilloma associated with human papilloma viruses (HPV)-32 in a 4-year-old boy who presented with a verrucous lesion on the lower lip. HPV-32 is often associated with a rare benign condition focal epithelial hyperplasia (FEH). A limited number of lesions and the absence of characteristic histology ruled out FEH in our patient. To the best of our knowledge, the association of oral squamous papilloma with HPV-32 is hitherto unreported.
The Resolved Stellar Populations of M 32
Monachesi, A.; Trager, S. C.; Lauer, T. R.; Freedman, W.; Dressler, A.; Grillmair, C.; Mighell, K.; Koleva, M; Prugniel, P; Vauglin,
We present the deepest optical CMD to date of M 32, obtained from HST ACS/HRC images. The dominant feature is the RC, whose CMD location suggests a, mean age between 8 and 10 Gyr for [Fe/H] = -0.2 in M 32. We detect for the first time the RGB and AGB bumps in M 32 which constrain its mean age to be
48 CFR 32.605 - Final decisions.
2010-10-01
... REQUIREMENTS CONTRACT FINANCING Contract Debts 32.605 Final decisions. (a) The contracting officer shall issue a final decision as required by 33.211 if— (1) The contracting officer and the contractor are unable... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Final decisions. 32.605...
42 CFR 423.32 - Enrollment process.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Enrollment process. 423.32 Section 423.32 Public... Enrollment process. (a) General rule. A Part D eligible individual who wishes to enroll in a PDP may enroll... approved by CMS. (c) Timely process an individual's enrollment request. A PDP sponsor must timely process...
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Equipment. 3016.32 Section 3016.32 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND COOPERATIVE AGREEMENTS TO STATE AND LOCAL...
36 CFR 910.32 - Historic preservation.
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Historic preservation. 910.32... DEVELOPMENT AREA Standards Uniformly Applicable to the Development Area § 910.32 Historic preservation... Preservation Plan of the Corporation, are specified for preservation, shall be acomplished (a) in accordance...
Design and construction of a prototype for the obtention of 32 P
International Nuclear Information System (INIS)
Alanis M, J.
2003-12-01
In the National Institute of Nuclear Research (ININ) it was designed, built and proved a prototype to obtain 32 P in form of H 3 32 PO 4 , starting from irradiated Sα. The beginning of the prototype it is based on a distillation system in dry of the Sα in nitrogen atmosphere, and in the formation of the ion 32 PO 4 3- in acid solution. Due to the handling of radioactive material during the process, the prototype is inside a hot cell and it has a cylindrical oven that opens up lengthwise to the half, with controller of temperature and with a system of empty air for to transport reagents and products. The air-vacuum system is provided of filters and traps. The tests showed a recovery from 14 to 15% of the activity obtained during the irradiation. (Author)
2010-04-01
... contemplated by Federal statute. (4) When acquiring replacement equipment, the grantee or subgrantee may use.... Procedures for managing equipment (including replacement equipment), whether acquired in whole or in part... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Equipment. 437.32 Section 437.32 Employees...
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Districts. 947.32 Section 947.32 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... consideration to (1) the relative importance of new areas of production, (2) changes in the relative position of...
48 CFR 32.113 - Customary contract financing.
2010-10-01
... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...
43 CFR 7.32 - Supplemental definitions.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Supplemental definitions. 7.32 Section 7... RESOURCES Department of the Interior Supplemental Regulations § 7.32 Supplemental definitions. For purposes of this subpart, the following definitions will be used: (a) Site of religious or cultural importance...
Software for Minsk-32 display station
International Nuclear Information System (INIS)
Belyaeva, L.M.; Gangrskaya, O.G.; Manno, I.; Fefilov, B.V.; Ehsenski, J.
1976-01-01
The mathematical provision is described of the Minsk-32 display station. Described is the application of editing program DOSE, assembler translator SLANG and program display-focal. Program DOSE permits to edit the texts with the aid of a rester display on Minsk-32 magnetic tape. The program system permits to use a disk monitor system
Jankowitsch, Frank; Schwarz, Julia; Rückert, Christian; Gust, Bertolt; Szczepanowski, Rafael; Blom, Jochen; Pelzer, Stefan; Kalinowski, Jörn
2012-01-01
Streptomyces davawensis JCM 4913 synthesizes the antibiotic roseoflavin, a structural riboflavin (vitamin B2) analog. Here, we report the 9,466,619-bp linear chromosome of S. davawensis JCM 4913 and a 89,331-bp linear plasmid. The sequence has an average G+C content of 70.58% and contains six rRNA operons (16S-23S-5S) and 69 tRNA genes. The 8,616 predicted protein-coding sequences include 32 clusters coding for secondary metabolites, several of which are unique to S. davawensis. The chromosome contains long terminal inverted repeats of 33,255 bp each and atypical telomeres. Sequence analysis with regard to riboflavin biosynthesis revealed three different patterns of gene organization in Streptomyces species. Heterologous expression of a set of genes present on a subgenomic fragment of S. davawensis resulted in the production of roseoflavin by the host Streptomyces coelicolor M1152. Phylogenetic analysis revealed that S. davawensis is a close relative of Streptomyces cinnabarinus, and much to our surprise, we found that the latter bacterium is a roseoflavin producer as well. PMID:23043000
Le, Anh Q; Taylor, Jeremy; Dong, Winnie; McCloskey, Rosemary; Woods, Conan; Danroth, Ryan; Hayashi, Kanna; Milloy, M-J; Poon, Art F Y; Brumme, Zabrina L
2015-12-03
Rare individuals homozygous for a naturally-occurring 32 base pair deletion in the CCR5 gene (CCR5∆32/∆32) are resistant to infection by CCR5-using ("R5") HIV-1 strains but remain susceptible to less common CXCR4-using ("X4") strains. The evolutionary dynamics of X4 infections however, remain incompletely understood. We identified two individuals, one CCR5wt/wt and one CCR5∆32/∆32, within the Vancouver Injection Drug Users Study who were infected with a genetically similar X4 HIV-1 strain. While early-stage plasma viral loads were comparable in the two individuals (~4.5-5 log10 HIV-1 RNA copies/ml), CD4 counts in the CCR5wt/wt individual reached a nadir of 250 cells/mm(3) in the CCR5∆32/∆32 individual. Ancestral phylogenetic reconstructions using longitudinal envelope-V3 deep sequences suggested that both individuals were infected by a single transmitted/founder (T/F) X4 virus that differed at only one V3 site (codon 24). While substantial within-host HIV-1 V3 diversification was observed in plasma and PBMC in both individuals, the CCR5wt/wt individual's HIV-1 population gradually reverted from 100% X4 to ~60% R5 over ~4 years whereas the CCR5∆32/∆32 individual's remained consistently X4. Our observations illuminate early dynamics of X4 HIV-1 infections and underscore the influence of CCR5 genotype on HIV-1 V3 evolution.
Das, Subha Narayan; Wagenknecht, Martin; Nareddy, Pavan Kumar; Bhuvanachandra, Bhoopal; Niddana, Ramana; Balamurugan, Rengarajan; Swamy, Musti J.; Moerschbacher, Bruno M.; Podile, Appa Rao
2016-01-01
We report here the role and mechanism of specificity of a family 32 carbohydrate binding module (CBM32) of a glycoside hydrolase family 8 chitosanase from Paenibacillus elgii (PeCsn). Both the activity and mode of action of PeCsn toward soluble chitosan polymers were not different with/without the CBM32 domain of P. elgii (PeCBM32). The decreased activity of PeCsn without PeCBM32 on chitosan powder suggested that PeCBM32 increases the relative concentration of enzyme on the substrate and thereby enhanced enzymatic activity. PeCBM32 specifically bound to polymeric and oligomeric chitosan and showed very weak binding to chitin and cellulose. In isothermal titration calorimetry, the binding stoichiometry of 2 and 1 for glucosamine monosaccharide (GlcN) and disaccharide (GlcN)2, respectively, was indicative of two binding sites in PeCBM32. A three-dimensional model-guided site-directed mutagenesis and the use of defined disaccharides varying in the pattern of acetylation suggested that the amino groups of chitosan and the polar residues Glu-16 and Glu-38 of PeCBM32 play a crucial role for the observed binding. The specificity of CBM32 has been further elucidated by a generated fusion protein PeCBM32-eGFP that binds to the chitosan exposing endophytic infection structures of Puccinia graminis f. sp. tritici. Phylogenetic analysis showed that CBM32s appended to chitosanases are highly conserved across different chitosanase families suggesting their role in chitosan recognition and degradation. We have identified and characterized a chitosan-specific CBM32 useful for in situ staining of chitosans in the fungal cell wall during plant-fungus interaction. PMID:27405759
46 CFR 32.90-1 - Pilot boarding equipment.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Pilot boarding equipment. 32.90-1 Section 32.90-1... REQUIREMENTS Pilot Boarding Equipment § 32.90-1 Pilot boarding equipment. (a) This section applies to each... must have suitable pilot boarding equipment available for use on each side of the vessel. If a vessel...
47 CFR 32.5003 - Cellular mobile revenue.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular mobile revenue. 32.5003 Section 32... SYSTEM OF ACCOUNTS FOR TELECOMMUNICATIONS COMPANIES Instructions For Revenue Accounts § 32.5003 Cellular mobile revenue. This account shall include message revenue derived from cellular mobile...
Aberrant activity of NKL homeobox gene NKX3-2 in a T-ALL subset
Meyer, Corinna; Kaufmann, Maren; Zaborski, Margarete; MacLeod, Roderick A. F.; Drexler, Hans G.
2018-01-01
T-cell acute lymphoblastic leukemia (T-ALL) is a hematopoietic malignancy originating from T-cell progenitors in which differentiation is blocked at early stages. Physiological expression of specific NKL homeobox genes obeys a hematopoietic NKL-code implicated in the process of lymphopoiesis while in differentiated T-cells these genes are silenced. We propose that this developmental expression pattern underlies the observation that NKL homeobox genes are the most ubiquitous group of transcription factors deregulated in T-ALL, including TLX1, TLX3, NKX2-5 and NKX3-1. Here, we describe a novel member of the NKL homeobox gene subclass, NKX3-2 (BAPX1), which is aberrantly activated in 18% of pediatric T-ALL patients analyzed while being normally expressed in developing spleen. Identification of NKX3-2 expression in T-ALL cell line CCRF-CEM qualified these cells to model its deregulation and function in a leukemic context. Genomic and chromosomal analyses demonstrated normal configuration of the NKX3-2 locus at chromosome 4p15, thus excluding cytogenetic dysregulation. Comparative expression profiling analysis of NKX3-2 patient data revealed deregulated activity of BMP- and MAPK-signalling. These candidate pathways were experimentally confirmed to mediate aberrant NKX3-2 expression. We also show that homeobox gene SIX6, plus MIR17HG and GATA3 are downstream targets of NKX3-2 and plausibly contribute to the pathogenesis of this malignancy by suppressing T-cell differentiation. Finally, NKL homeobox gene NKX2-5 was activated by NKX3-2 in CCRF-CEM and by FOXG1 in PEER, representing mutually inhibitory activators of this translocated oncogene. Together, our findings reveal a novel oncogenic NKL homeobox gene subclass member which is aberrantly expressed in a large subset of T-ALL patients and participates in a deregulated gene network likely to arise in developing spleen. PMID:29746601
42 CFR 433.32 - Fiscal policies and accountability.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Fiscal policies and accountability. 433.32 Section 433.32 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Administration Provisions § 433.32 Fiscal policies and accountability. A State plan must provide that the...
Natural 32Si as environmental tracer
International Nuclear Information System (INIS)
Morgenstern, U.
2005-01-01
There is a pressing need for an effective dating tool to cover the historical past. Cosmogenic 32 Si, with a half-life of ca. 140 years, is ideally suited to provide time information in the range 50-1000 years. Detection of 32 Si is, however, very difficult due to extremely low natural concentrations and isotopic ratios. (author). 2 refs
Modification of synthesis nucleotides [γ-32P] ATP
International Nuclear Information System (INIS)
Wira Y Rahman; Endang Sarmini; Herlina; Triyanto; Hambali; Abdul Mutalib; Santi Nurbaiti
2013-01-01
In molecular biology, radionuclides in the form of radiolabeled compounds have been widely used as deoxyribonucleic acid (DNA) / ribonucleic acid (RNA) tracer in order to explore a wide range of physiological and pathological processes. One of such compounds is [γ- 32 P]-adenosine triphosphate {[γ- 32 P]-ATP} [γ- 32 P]-ATP which has been widely used in the biotechnology research. In order to support the biotechnology research in Indonesia in this project, [γ- 32 P]- ATP had been synthesized by enzymatic reactions with modifying the method of synthesis using the precursor DL-glyceraldehyde 3-phosphate, nucleotides Adenosine Diphosphate (ADP) and H 3 32 PO 4 and enzymes glyceraldehyde 3-phosphate dehydrogenase, 3-phosphoroglyceric phosphokinase and lactate dehydrogenase. The purification of the synthesized [γ- 32 P]-ATP, by using DEAE Sephadex column chromatography. The synthesis and purification process that had been performed were able in producing of [γ- 32 P]-ATP with radioactivity of 1,175 mCi and radiochemical purity of 99,49%.. Having successfully prepared the [γ- 32 P]-ATP and application, in the near future the Radioisotopes and Radiopharmaceuticals Centre is expected to be able in providing the above-mentioned radiolabeled nucleotide for biotechnology research in Indonesia. (author)
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Hawaii. 32.30 Section 32.30 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED) THE NATIONAL... Hawaii. The following refuge units have been opened for hunting and/or fishing, and are listed in...
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Motions. 17.32 Section 17.32 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL CIVIL MONEY PENALTIES... shall be filed with the Division of Dockets Management (HFA-305), Food and Drug Administration, 5630...
48 CFR 32.203 - Determining contract financing terms.
2010-10-01
... financing terms. 32.203 Section 32.203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 32.203 Determining contract financing terms. When the criteria in 32.202-1(b) are met, the contracting officer may either...
28 CFR 32.34 - PSOB Office determination.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false PSOB Office determination. 32.34 Section 32.34 Judicial Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE BENEFIT CLAIMS Educational Assistance Benefit Claims § 32.34 PSOB Office determination...
29 CFR 32.7 - Designation of responsible employee.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Designation of responsible employee. 32.7 Section 32.7 Labor Office of the Secretary of Labor NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 32.7 Designation of responsible employee. A...
45 CFR 99.32 - Decisions following hearing.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Decisions following hearing. 99.32 Section 99.32 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Posthearing Procedures, Decisions § 99.32 Decisions following...
28 CFR 32.31 - Scope of subpart.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Scope of subpart. 32.31 Section 32.31 Judicial Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE BENEFIT CLAIMS Educational Assistance Benefit Claims § 32.31 Scope of subpart. Consistent with...
Directory of Open Access Journals (Sweden)
Almira Zada
2014-01-01
Full Text Available We present a 20-year-old female patient from Indonesia with intellectual disability (ID, proportionate short stature, motor delay, feeding problems, microcephaly, facial dysmorphism, and precocious puberty who was previously screened normal for conventional karyotyping, fragile X testing, and subtelomeric MLPA analysis. Subsequent genome wide array analysis was performed on DNA from blood and revealed a 1.1 Mb deletion in 14q32.2q32.31 (chr14:100,388,343-101,506,214; hg19. Subsequent carrier testing in the parents by array showed that the deletion had occurred de novo in the patient and that her paternal 14q32 allele was deleted. The deleted region encompasses the DLK1/GTL2 imprinted gene cluster which is consistent with the maternal UPD(14-like phenotype of the patient. This rare, recurrent microdeletion was recently shown not to be mediated by low copy repeats, but by expanded TGG repeats, flanking the 14q32.2q32.21 deletion boundaries, a novel mechanism of recurrent genomic rearrangement. This is another example how the application of high resolution genome wide testing provides an accurate genetic diagnosis, thereby improving the care for patients and optimizing the counselling for family.
33 CFR 385.32 - Comprehensive Plan Modification Report
2010-07-01
... Implementation Reports. It is not the intent of this section to require a continual cycle of report writing for... Report 385.32 Section 385.32 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY... Incorporating New Information Into the Plan § 385.32 Comprehensive Plan Modification Report Whenever the Corps...
Fast uncooled module 32×32 array of polycrystalline PbSe used for muzzle flash detection
Kastek, Mariusz; Dulski, Rafał; Trzaskawka, Piotr; Bieszczad, Grzegorz
2011-06-01
The paper presents some aspects of muzzle flash detection using low resolution polycrystalline PbSe uncooled 32×32 detectors array. This system for muzzle flash detection works in MWIR (3 - 5 microns) region and it is based on VPD (Vapor Phase Deposition) technology. The low density uncooled 32×32 array is suitable for being used in low cost IR imagers sensitive in the MWIR band with frame rates exceeding 1.000 Hz. The FPA detector, read-out electronics and processing electronics (allowing the implementation of some algorithms for muzzle flash detection) has been presented. The system has been tested at field test ground. Results of detection range measurement with two types of optical systems (wide and narrow field of view) have been shown. The initial results of testing of some algorithms for muzzle flash detection have been also presented.
Re-measurement of $^{32}$Ar to test the IMME
The Isobaric Multiplet Mass Equation (IMME) has been subject to extensive studies in the low-mass region. Especially at the A = 32 quintet, the predicted quadratic form could not be confirmed, possible explanations being the insufficient accuracy of input parameters or higher-order interactions within the nucleon. For this quintet, the uncertainty on the mass-excess values of four of the five T = 2 multiplet members is extremely low: 0.6 keV for $^{32}$Cl, 0.3 keV for $^{32}$S, 0.2 keV for $^{32}$P, and 0.7 keV for $^{32}$Si. In the case of $^{32}$Ar, however, the uncertainty is as large as 1.8 keV. State-of-the-art high-precision Penning-trap mass spectrometry makes it possible to decrease this uncertainty. We propose to remeasure the mass of $^{32}$Ar at the Penning-trap mass spectrometer ISOLTRAP thus decreasing the uncertainty by a factor of 3-5. The proposed measurement is part of an experimental collaboration with JYFLTRAP, where the remaining masses of the T = 2 isospin quintet at A = 32 will be remeas...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Reports. 287.9 Section 287.9 National Defense... PROGRAM DEFENSE INFORMATION SYSTEMS AGENCY FREEDOM OF INFORMATION ACT PROGRAM § 287.9 Reports. An annual report will be furnished to the FOIA Officer by the field activities by 15 October IAW 32 CFR part 286. ...
Czech Academy of Sciences Publication Activity Database
Skálová, Tereza; Dušková, Jarmila; Hašek, Jindřich; Štěpánková, Andrea; Kovaľ, Tomáš; Ostergaard, L. H.; Dohnálek, Jan
2011-01-01
Roč. 67, č. 1 (2011), s. 27-32 ISSN 1744-3091 R&D Projects: GA ČR GA305/07/1073; GA AV ČR IAA500500701 Institutional research plan: CEZ:AV0Z40500505; CEZ:AV0Z10100521 Keywords : laccase * potassium hexacyanoferrate * X-ray diffraction Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.506, year: 2011
Design and construction of a prototype for the obtention of 32P
International Nuclear Information System (INIS)
Duarte A, C.
2003-01-01
The 32 P are a pure emitting radioisotope of maximum energy of 1.71 MeV with half life of 14.28 days that he has applications in the industry, in agriculture, in medicine, in biology and in ecology (6,11,12,13,17,21,22,23,24,25,26,27,28,29,30,31,32 33).The 32 P can be used in the industry like radiotracer in the investigation of some operations and processes and as element of measurement of some industrial meters. In agriculture is used as radiotracer (29) in the investigation of diverse biological processes that have to do with the production of diverse nutritious products. In medicine has uses but very therapeutic mainly in the treatment of some become cancerous (28, 31, 25, 27) in the diagnosis of blood disorders (24) and like part of materials of production of aortic prosthesis (6). The 32 P are also used in the molecular investigation in biology and in genetics (33), and in studies of ecosystems (32) and of DNA (22). One can obtain the 32 P by means of diverse nuclear reactions depending on the material used as matter it prevails, since it doesn't exist in the nature. But anyone in the ways of obtaining it it should imply a process of radiochemical separation that involves so many steps like they are required, depending on the material used as matter prevails, of the purity with which he wants himself to obtain and of the resources that it has available. The objective of this work was design, to build and to prove a prototype to obtain the 32 P to leave of the irradiation of S α with fast neutrons at experimental level, which implies also to design a process that contemplates diverse stages and procedures for each one of them. The process was outlined in five stages: matter purification prevails, preparation of irradiation capsules, irradiation of irradiation capsules, transport and opening capsules of irradiation and radiochemical separation. In the last stage it was where uses the prototype of radiochemical separation in basis to the outlined process and
7 CFR 6.32 - Globalization of licenses.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Globalization of licenses. 6.32 Section 6.32 Agriculture Office of the Secretary of Agriculture IMPORT QUOTAS AND FEES Dairy Tariff-Rate Import Quota Licensing § 6.32 Globalization of licenses. If the Licensing Authority determines that entries of an article...
42 CFR 32.88 - Examinations and treatment.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Examinations and treatment. 32.88 Section 32.88... Hansen's Disease § 32.88 Examinations and treatment. Patients will be provided necessary clinical examinations which may be required for the diagnosis of primary or secondary conditions, and such treatment as...
Fornaro, Michele; Elassy, Mai; Mounir, Mina; Abd-Elmoneim, Noran; Ashour, Hala; Hamed, Rania; Al-Shehri, Abdullah; Bedir, Samir; Rashed, Ibrahem; Amer, Noha; Mohammed, Talal A; De Berardis, Domenico; Mazza, Monica; Pino, Mariachiara; Koshy, Ann Sarah; De Pasquale, Concetta; Okasha, Tarek; Angst, Jules
2015-05-01
To assess the psychometric properties of the Arabic adaptation of the Hypomania-Check-List 32-item, second revision (HCL-32-R2) for the detection of bipolarity in major depressive disorder (MDD) inpatients suffering a current major depressive episode (MDE). The "Bipolar Disorders: Improving Diagnosis, Guidance, and Education" Arabic module of the HCL-32-R2 was administered to mother-tongue Arabic MDE inpatients between March 2013 and October 2014. Diagnostic and Statistical Manual Fourth edition (DSM-IV) diagnoses were made adopting the mini-international neuropsychiatric interview, using bipolar disorder (BD) patients as controls. In our sample (n=500, of whom, BD-I=329; BD-II=70; MDD=101), using a cut-off of 17 allowed the HCL-32-R2 to discriminate DSM-IV-defined MDD patients between "true unipolar" (HCL-32-R2(-)) and "sub-threshold bipolar depression" (HCL-32-R2(+)) with sensitivity=82% and specificity=77%. Area under the curve was .883; positive and negative predictive values were 93.44% and 73.23% respectively. Owing to clinical interpretability considerations and consistency with previous adaptations of the HCL-32, a two-factor solution (F1="hyperactive/elated" vs. F2="irritable/distractible/impulsive") was preferred using exploratory and confirmatory factors analyses. Item n.33 ("I gamble more") and n.34 ("I eat more") introduced in the R2 version of the HCL-32 loaded onto F1, though very slightly. Cronbach's alphas were F1=.86 and F2=.60. No cross-validation with any additional validated screening tool. Inpatients only sample; recall bias; no systematic evaluation of eventual medical/psychiatric comorbidities, current/lifetime pharmacological history, or record of severity of current MDE. In our sample, the HCL-32 fairly discriminated between MDD and BD-I but not BD-II, therefore soliciting for replication studies for use in Arabic-speaking depressed inpatients. Copyright © 2015. Published by Elsevier Inc.
Properties of possible leptons at spin 3/2
International Nuclear Information System (INIS)
Spehler, D.
1982-01-01
Possible properties of spin 3/2 leptons are investigated. Results are presented on production cross sections of spin 3/2 leptons by means of electromagnetic interaction and weak current couplings. Characteristic angular correlations and leptons spectral distribution are indicated in weak decays. A charged spin 3/2 lepton may in particular contribute to the 3 muon events [fr
19 CFR 145.32 - Bona-fide gifts.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Bona-fide gifts. 145.32 Section 145.32 Customs... (CONTINUED) MAIL IMPORTATIONS Special Classes of Merchandise § 145.32 Bona-fide gifts. The port director... as bona-fide gifts from persons in foreign countries to persons in the United States having an...
Performance of a 64-channel, 3.2×3.2 cm2 SiPM tile for TOF-PET application
International Nuclear Information System (INIS)
Ferri, Alessandro; Acerbi, Fabio; Gola, Alberto; Piemonte, Claudio; Paternoster, Giovanni; Zorzi, Nicola
2016-01-01
In this work, we present a new 3.2×3.2 cm 2 detector tile, composed of 8×8 single SiPMs, having a regular 4 mm pitch in both the X and Y directions. The tile fill factor is 85%. We produced two versions of the tile with different SiPM technologies: RGB-HD and NUV. The first one features square micro-cells with 25 µm pitch, a PDE peaked at 550 nm and a DCR of 300 kHz/mm 2 , at 20 °C and at maximum detection efficiency. The second one features micro-cells with 40 µm pitch and a PDE peaked in the blue part of the spectrum. The dark count rate at 20 °C and at maximum PDE is 100 kHz/mm 2 . In this work, we show the energy and timing resolution measurements at 511 keV obtained coupling the two tiles to an 8×8 LYSO array with a pixel size of 4×4×22 mm 3 , perfectly matching the photo-detector array.
48 CFR 32.102 - Description of contract financing methods.
2010-10-01
... financing methods. 32.102 Section 32.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.102 Description of contract financing methods. (a) Advance payments are advances of money by the Government to a...
DARPP-32, Jack of all trades… master of which?
Directory of Open Access Journals (Sweden)
Marion eYger
2011-09-01
Full Text Available DARPP-32 (PPP1R1B was discovered as a substrate of cAMP-dependent protein kinase (PKA enriched in dopamine-innervated brain areas. It is one of 3 related PKA-regulated inhibitors of protein phosphatase-1 (PP1. These inhibitors seem to have appeared in early vertebrate ancestors, possibly Gnathostomes. DARPP-32 has additional important biochemical properties including inhibition of PKA when phosphorylated by Cdk5 and regulation by casein kinases 1 and 2. It is highly enriched in specific neuronal populations, especially striatal medium-size spiny neurons. As PP1 inhibitor DARPP-32 amplifies and/or mediates many actions of PKA at the plasma membrane and in the cytoplasm, with a broad spectrum of targets and functions. DARPP-32 also undergoes a continuous and tightly regulated cytonuclear shuttling. This trafficking is controlled by phosphorylation of Ser-97, which is necessary for nuclear export. When phosphorylated on Thr-34 and dephosphorylated on Ser-97, DARPP-32 can inhibit PP1 in the nucleus and modulate signaling pathways involved in the regulation of chromatin response. Recent work with multiple transgenic and knockout mutant mice has allowed the dissection of DARPP-32 function in striatonigral and striatopallidal neurons. It is implicated in the action of therapeutic and abused psychoactive drugs, in prefrontal cortex function, and in sexual behavior. However, the contribution of DARPP-32 in human behavior remains poorly understood. Post-mortem studies in humans suggest possible alterations of DARPP-32 levels in schizophrenia and bipolar disorder. Genetic studies have revealed a polymorphism with possible association with psychological and psychopathological traits. In addition, a short isoform of DARPP-32, t-DARPP, plays a role in cancer, indicating additional signaling properties. Thus, DARPP-32 is a non-essential but tightly regulated signaling hub molecule which may improve the general performance of the neuronal circuits in which it
Assay of /sup 32/Si by liquid scintillation counting
Energy Technology Data Exchange (ETDEWEB)
Cumming, J B [Brookhaven National Lab., Upton, NY (USA)
1983-10-03
Application of the radioactivity of /sup 32/Si to problems of interest in geo- and cosmo-chemistry has been hampered by uncertainties in the half-life of this nuclide. A procedure for the stimulation assay of /sup 32/Si and its /sup 32/P daughter utilizing a liquid scintillation detector in association with a pulse height analyzer is described. The results indicate that /sup 32/Si can be assayed to an accuracy of a few percent by liquid scintillation counting techniques which do not require the preparation of an organic Si derivative. Combination of the mean specific activity with the /sup 32/Si abundance determined by accelerator-based mass spectrometry gave the reported 101+-18 year half-life.
32 CFR 644.495 - Donation to a public body.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Donation to a public body. 644.495 Section 644.495 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) REAL... Land) § 644.495 Donation to a public body. A public body, as defined by GSA for this purpose, means any...
32 CFR 700.1054 - Command of a naval base.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Command of a naval base. 700.1054 Section 700.1054 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY UNITED STATES NAVY... Command Detail to Duty § 700.1054 Command of a naval base. The officer detailed to command a naval base...
Lin, Pei-Chun; Shen, Chien-Chang; Liao, Chih-Kai; Jow, Guey-Mei; Chiu, Chi-Ting; Chung, Tun-Hui; Wu, Jiahn-Chun
2013-05-01
HYS-32 [4-(3,4-dimethoxyphenyl)-3-(naphthalen-2-yl)-2(5H)-furanone] is a new analogue of the anti-tumor compound combretastatin A-4 containing a cis-stilbene moiety. In this study, we investigated its effects on Cx43 gap junction intercellular communication (GJIC) and the signaling pathway involved in rat primary astrocytes. Western blot analyses showed that HYS-32 dose- and time-dependently upregulated Cx43 expression. A confocal microscopic study and scrape-loading/dye transfer analyses demonstrated that HYS-32 (5μM) induced microtubule coiling, accumulation of Cx43 in gap junction plaques, and increased GJIC in astrocytes. The HYS-32-induced microtubule coiling and Cx43 accumulation in gap junction plaques was reversed when HYS-32 was removed. Treatment of astrocytes with cycloheximide resulted in time-dependent degradation of by co-treatment with HYS-32 by increasing the half-life of Cx43. Co-treatment with HYS-32 also prevented the LPS-induced downregulation of Cx43 and inhibition of GJIC in astrocytes. HYS-32 induced activation of PKC, ERK, and JNK, and co-treatment with the PKC inhibitor Go6976 or the ERK inhibitor PD98059, but not the JNK inhibitor SP600125, prevented the HYS-32-induced increase in Cx43 expression and GJIC. Go6976 suppressed the HYS-32-induced PKC phosphorylation and increase in phospho-ERK levels, while PD98059 did not prevent the HYS-32-induced increase in phospho-PKC levels, suggesting that PKC is an upstream effector of ERK. In conclusion, our results show that HYS-32 increases the half-life of Cx43 and enhances Cx43 expression and GJIC in astrocytes via a PKC-ERK signaling cascade. These novel biological effects of HYS-32 on astrocyte gap junctions support its potential for therapeutic use as a protective agent for the central nervous system. Copyright © 2013 Elsevier Ltd. All rights reserved.
A DDI3.2 Style for Data and Metadata Extracted from SAS
Hoyle, Larry
2014-01-01
Earlier work by Wackerow and Hoyle has shown that DDI can be a useful medium for interchange of data and metadata among statistical packages. DDI 3.2 has new features which enhance this capability, such as the ability to use UserAttributePairs to represent custom attributes. The metadata from a statistical package can also be represented in DDI3.2 using several different styles – embedded in a StudyUnit, in a Resource Package, or in a set of Fragments. The DDI Documentation for a Fragment sta...
32 CFR 700.1053 - Commander of a task force.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Commander of a task force. 700.1053 Section 700... Command Detail to Duty § 700.1053 Commander of a task force. (a) A geographic fleet commander, and any other naval commander, may detail in command of a task force, or other task command, any eligible...
Bioaccumulation of P-32 in bluegill and catfish
International Nuclear Information System (INIS)
Kahn, B.; Turgeon, K.S.; Martini, D.K.; Dunkerly, S.J.; El-Shinawy, R.M.K.; Wilson, M.D.; Hammond, R.A.; Uribe, R.; Mizner, A.A.
1985-02-01
Bluegill and catfish were fed P-32 at a constant feeding rate per body weight to determine the bioaccummulation factor (BF/sub r/) for P-32 in muscle relative to water. The fish were maintained in flow-through tanks at two feeding levels. The bluegill accumulated P-32 for 51 days, followed by depuration for 28 days. The catfish study had to be teminated after 11 days. Fish were analyzed in triplicte for P-32 and phosphorus at intervals of 1 to 8 days. Additional aquaria experiments were performed to determine the effects of water temperature, feeding rate, and type of food (worms vs. pellets) on P-32 uptake, and to observe P-32 uptake from water by unfed fish (including fish with blocked esophagus). A simple calculational model was used to determine the phosphorus turnover constant from the specific activity in tissue relative to food. This ratio at steady state approaches the BF/sub r/BF ratio (where BF is the phosphorus bioaccumulation factor) if P-32 transfers rapidly from water to food. The bluegill showed a weight gain of 0.2 %/d, a phosphorous turnover constant in muscle of 0.43 %/d, and a BF/sub r//BF ratio of 0.081 at the higher feeding rate, and 0.05 %/d, 0.34 %/d, and 0.064 at the lower feeding rate. Hence, respective P-32 BF/sub r/ values are 6000 and 4000 at a phosphorus BF of 70,000. The BF/sub r/ values for catfish were approximately twice as high. The aquarium experiments suggest that the higher factors are due to a much higher phosphorus intake, higher water temperature, higher retention from pellets than from worms, and possible higher retention by catfish than bluegill under the same conditions. 36 references, 15 figures, 22 tables
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Oath of office. 3.2 Section 3.2 Accounts GOVERNMENT ACCOUNTABILITY OFFICE PERSONNEL SYSTEM EMPLOYMENT § 3.2 Oath of office. The provisions of subchapter II of chapter 33 of title 5, U.S. Code, and Office of Personnel Management implementing regulations apply to...
Energy Technology Data Exchange (ETDEWEB)
Shibata, Keiichi; Narita, Tsutomu [eds.; Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-02-01
The second revision of JENDL-3 (JENDL-3.2) was released in 1994. The library contains evaluated neutron nuclear data for 340 nuclides which are needed for the design of fission and fusion reactors and for shielding calculation. This report presents a brief description of the evaluation method which is given in the File-1 part of JENDL-3.2. (author)
International Nuclear Information System (INIS)
Morgenstern, U.
2004-01-01
Brief explanation of the use of 32 Si in the dating of sediments. 32 Si , with a half-life of c.140 years, can be applied in the age range 30-1000 years. An appropriate dating tool for that time range is essential because it includes three very important epochs: the impact of human colonisation and industrialisation during the last 150 years, the Little Ice Age between about 1650 AD and 1850 AD, and the last part of the Medieval Climatic Optimum. 23 refs
Phosphorus-32: practical radiation protection
International Nuclear Information System (INIS)
Ballance, P.E.; Morgan, J.
1987-01-01
This monograph offers practical advice to Radiation Protection Advisors, Radiation Protection Supervisors and Research Supervisors, together with research workers, particularly those in the field of molecular biological research. The subject is dealt with under the following headings: physical properties, radiation and measurement methods, radiation units, phosphorus metabolism and health risks, protection standards and practical radiation protection, administrative arrangements, accidents, decontamination, emergency procedures, a basic written system for radiochemical work, with specialised recommendations for 32 P, and guidance notes of accident situations involving 32 P. (U.K.)
A review on the current status and production technology of 32,33P-orthophosphoric acid
International Nuclear Information System (INIS)
Park, Ul Jae; Han, Hyun Soo; Cho, Woon Kap; Kuznetsov, Rostislav A.
2000-10-01
The current status of 32 , 33 P-Orthophosphoric acid production technology is reviewed. The following aspects of the technology are covered: - production of phosphorus-32 and phosphorus-33 using various nuclear reactions; - chemical properties of sulfur and phosphorus effecting the technology of radioactive phosphorus production; - chemical state of 32 , 33 P in neutron irradiated sulfur; - the technology of radioactive phosphorus isolation from neutron irradiated target and orthophosphoric acid production; - purification of 32 , 33 P-orthophosphoric acid from impurities and some related problems, like the nature of impurities, the storage of the final product, etc. - the quality control procedures of carrier-free ( 32 , 33 P)-orthophosphoric acid preparations
32P and acute leukemia: development of leukemia in a patient with hemoglobin Yakima
International Nuclear Information System (INIS)
Bagby, G.C. Jr.; Richert-Boe, K.; Koler, R.D.
1978-01-01
In 1954 a then 31-yr-old male was found to have erythrocytosis. Over the ensuing decade he received 72 mCi 32 P. In 1964 his daughters were found to have erythrocytosis. Further investigation led to the discovery of hemoglobin Yakima, a variant with high oxygen affinity. He received no further therapy and was well until 1975, when he developed the preleukemic syndrome. Within 12 mo he developed acute nonlymphocytic leukemia accompanied by fetal erythropoiesis. Because the initial discovery of this type of hemoglobinopathy came 27 yr after the introduction of 32 P for use in the treatment of polycythemia vera, and because there are now known to be more than 39 different high-oxygen-affinity hemoglobins, we anticipate that more patients such as ours have been exposed to 32 P. The exposed population should be closely followed, since this will likely permit assessment of the risk of 32 P-induced leukemia in a nonneoplastic condition
47 CFR 32.1406 - Nonregulated investments.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Nonregulated investments. 32.1406 Section 32.1406 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM... Nonregulated investments. This account shall include the carrier's investment in nonregulated activities...
Engineered coryneform bacteria as a bio-tool for arsenic remediation.
Villadangos, Almudena F; Ordóñez, Efrén; Pedre, Brandán; Messens, Joris; Gil, Jose A; Mateos, Luis M
2014-12-01
Despite current remediation efforts, arsenic contamination in water sources is still a major health problem, highlighting the need for new approaches. In this work, strains of the nonpathogenic and highly arsenic-resistant bacterium Corynebacterium glutamicum were used as inexpensive tools to accumulate inorganic arsenic, either as arsenate (As(V)) or arsenite (As(III)) species. The assays made use of "resting cells" from these strains, which were assessed under well-established conditions and compared with C. glutamicum background controls. The two mutant As(V)-accumulating strains were those used in a previously published study: (i) ArsC1/C2, in which the gene/s encoding the mycothiol-dependent arsenate reductases is/are disrupted, and (ii) MshA/C mutants unable to produce mycothiol, the low molecular weight thiol essential for arsenate reduction. The As(III)-accumulating strains were either those lacking the arsenite permease activities (Acr3-1 and Acr3-2) needed in As(III) release or recombinant strains overexpressing the aquaglyceroporin genes (glpF) from Corynebacterium diphtheriae or Streptomyces coelicolor, to improve As(III) uptake. Both genetically modified strains accumulated 30-fold more As(V) and 15-fold more As(III) than the controls. The arsenic resistance of the modified strains was inversely proportional to their metal accumulation ability. Our results provide the basis for investigations into the use of these modified C. glutamicum strains as a new bio-tool in arsenic remediation efforts.
Liao, Cheng-Heng; Xu, Ya; Rigali, Sébastien; Ye, Bang-Ce
2015-12-01
The GntR-family transcription regulator, DasR, was previously identified as pleiotropic, controlling the primary amino sugar N-acetylglucosamine (GlcNAc) and chitin metabolism in Saccharopolyspora erythraea and Streptomyces coelicolor. Due to the remarkable regulatory impact of DasR on antibiotic production and development in the model strain of S. coelicolor, we here identified and characterized the role of DasR to secondary metabolite production and morphological development in industrial erythromycin-producing S. erythraea. The physiological studies have shown that a constructed deletion of dasR in S. erythraea resulted in antibiotic, pigment, and aerial hyphae production deficit in a nutrient-rich condition. DNA microarray assay, combined with quantitative real-time reverse transcription PCR (qRT-PCR), confirmed these results by showing the downregulation of the genes relating to secondary metabolite production in the dasR null mutant. Notably, electrophoretic mobility shift assays (EMSA) showed DasR as being the first identified regulator that directly regulates the pigment biosynthesis rpp gene cluster. In addition, further studies indicated that GlcNAc, the major nutrient signal of DasR-responsed regulation, blocked secondary metabolite production and morphological development. The effects of GlcNAc were shown to be caused by DasR mediation. These findings demonstrated that DasR is an important pleiotropic regulator for both secondary metabolism and morphological development in S. erythraea, providing new insights for the genetic engineering of S. erythraea with increased erythromycin production.
flp-32 Ligand/receptor silencing phenocopy faster plant pathogenic nematodes.
Atkinson, Louise E; Stevenson, Michael; McCoy, Ciaran J; Marks, Nikki J; Fleming, Colin; Zamanian, Mostafa; Day, Tim A; Kimber, Michael J; Maule, Aaron G; Mousley, Angela
2013-02-01
Restrictions on nematicide usage underscore the need for novel control strategies for plant pathogenic nematodes such as Globodera pallida (potato cyst nematode) that impose a significant economic burden on plant cultivation activities. The nematode neuropeptide signalling system is an attractive resource for novel control targets as it plays a critical role in sensory and motor functions. The FMRFamide-like peptides (FLPs) form the largest and most diverse family of neuropeptides in invertebrates, and are structurally conserved across nematode species, highlighting the utility of the FLPergic system as a broad-spectrum control target. flp-32 is expressed widely across nematode species. This study investigates the role of flp-32 in G. pallida and shows that: (i) Gp-flp-32 encodes the peptide AMRNALVRFamide; (ii) Gp-flp-32 is expressed in the brain and ventral nerve cord of G. pallida; (iii) migration rate increases in Gp-flp-32-silenced worms; (iv) the ability of G. pallida to infect potato plant root systems is enhanced in Gp-flp-32-silenced worms; (v) a novel putative Gp-flp-32 receptor (Gp-flp-32R) is expressed in G. pallida; and, (vi) Gp-flp-32R-silenced worms also display an increase in migration rate. This work demonstrates that Gp-flp-32 plays an intrinsic role in the modulation of locomotory behaviour in G. pallida and putatively interacts with at least one novel G-protein coupled receptor (Gp-flp-32R). This is the first functional characterisation of a parasitic nematode FLP-GPCR.
flp-32 Ligand/receptor silencing phenocopy faster plant pathogenic nematodes.
Directory of Open Access Journals (Sweden)
Louise E Atkinson
2013-02-01
Full Text Available Restrictions on nematicide usage underscore the need for novel control strategies for plant pathogenic nematodes such as Globodera pallida (potato cyst nematode that impose a significant economic burden on plant cultivation activities. The nematode neuropeptide signalling system is an attractive resource for novel control targets as it plays a critical role in sensory and motor functions. The FMRFamide-like peptides (FLPs form the largest and most diverse family of neuropeptides in invertebrates, and are structurally conserved across nematode species, highlighting the utility of the FLPergic system as a broad-spectrum control target. flp-32 is expressed widely across nematode species. This study investigates the role of flp-32 in G. pallida and shows that: (i Gp-flp-32 encodes the peptide AMRNALVRFamide; (ii Gp-flp-32 is expressed in the brain and ventral nerve cord of G. pallida; (iii migration rate increases in Gp-flp-32-silenced worms; (iv the ability of G. pallida to infect potato plant root systems is enhanced in Gp-flp-32-silenced worms; (v a novel putative Gp-flp-32 receptor (Gp-flp-32R is expressed in G. pallida; and, (vi Gp-flp-32R-silenced worms also display an increase in migration rate. This work demonstrates that Gp-flp-32 plays an intrinsic role in the modulation of locomotory behaviour in G. pallida and putatively interacts with at least one novel G-protein coupled receptor (Gp-flp-32R. This is the first functional characterisation of a parasitic nematode FLP-GPCR.
47 CFR 32.102 - Nonregulated investments.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Nonregulated investments. 32.102 Section 32.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS... investments. Nonregulated investments shall include the investment in nonregulated activities that are...
47 CFR 32.2321 - Customer premises wiring.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Customer premises wiring. 32.2321 Section 32... Customer premises wiring. (a) This account shall include all amounts transferred from the former Account 232, Station Connections, inside wiring subclass. (b) Embedded Customer Premises Wiring is that...
47 CFR 32.2124 - General purpose computers.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false General purpose computers. 32.2124 Section 32... General purpose computers. (a) This account shall include the original cost of computers and peripheral... financial, statistical, or other business analytical reports; preparation of payroll, customer bills, and...
9 CFR 78.32 - Brucellosis exposed swine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucellosis exposed swine. 78.32... AGRICULTURE INTERSTATE TRANSPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS BRUCELLOSIS Restrictions on Interstate Movement of Swine Because of Brucellosis § 78.32 Brucellosis exposed swine. (a...
Energy Technology Data Exchange (ETDEWEB)
Xiao, Kang [Division of Life Science, The Hong Kong University of Science and Technology, Clear Water Bay, Kowloon, Hong Kong (China); Wang, Yinyin; Chang, Zhijie [School of Medicine, Tsinghua University, Beijing (China); Lao, Yuanzhi, E-mail: laurence_ylao@163.com [School of Pharmacy, Shanghai University of Traditional Chinese Medicine, Shanghai (China); Chang, Donald C., E-mail: bochang@ust.hk [Division of Life Science, The Hong Kong University of Science and Technology, Clear Water Bay, Kowloon, Hong Kong (China)
2014-08-22
Highlights: • p32 binds to Mcl-1. • p32 affects apoptosis. • p32 and Mcl-1 regulate mitochondrial Ca{sup 2+}. - Abstract: Mcl-1 is a major anti-apoptotic Bcl-2 family protein. It is well known that Mcl-1 can interact with certain pro-apoptotic Bcl-2 family proteins in normal cells to neutralize their pro-apoptotic functions, thus prevent apoptosis. In addition, it was recently found that Mcl-1 can also inhibit mitochondrial calcium uptake. The detailed mechanism, however, is still not clear. Based on Yeast Two-Hybrid screening and co-immunoprecipitation, we identified a mitochondrial protein p32 (C1qbp) as a novel binding partner of Mcl-1. We found that p32 had a number of interesting properties: (1) p32 can positively regulate UV-induced apoptosis in HeLa cells. (2) Over-expressing p32 could significantly promote mitochondrial calcium uptake, while silencing p32 by siRNA suppressed it. (3) In p32 knockdown cells, Ruthenium Red treatment (an inhibitor of mitochondrial calcium uniporter) showed no further suppressive effect on mitochondrial calcium uptake. In addition, in Ruthenium Red treated cells, Mcl-1 also failed to suppress mitochondrial calcium uptake. Taken together, our findings suggest that p32 is part of the putative mitochondrial uniporter that facilitates mitochondrial calcium uptake. By binding to p32, Mcl-1 can interfere with the uniporter function, thus inhibit the mitochondrial Ca{sup 2+} uploading. This may provide a novel mechanism to explain the anti-apoptotic function of Mcl-1.
48 CFR 32.109 - Termination financing.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Termination financing. 32... CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.109 Termination financing. To encourage contractors to invest their own funds in performance despite the susceptibility of...
47 CFR 32.7400 - Nonoperating taxes.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Nonoperating taxes. 32.7400 Section 32.7400 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS... property, gross receipts, franchise and capital stock taxes. This account shall also reflect subsequent...
48 CFR 32.003 - Simplified acquisition procedures financing.
2010-10-01
... procedures financing. 32.003 Section 32.003 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 32.003 Simplified acquisition procedures financing. Unless agency regulations otherwise permit, contract financing shall not be provided for...
Energy Technology Data Exchange (ETDEWEB)
Alanis M, J. [ININ, Departamento de Materiales Radiactivos, 52045 Ocoyoacac, Estado de Mexico (Mexico)
2003-12-15
In the National Institute of Nuclear Research (ININ) it was designed, built and proved a prototype to obtain {sup 32}P in form of H{sub 3} {sup 32}PO{sub 4}, starting from irradiated S{alpha}. The beginning of the prototype it is based on a distillation system in dry of the S{alpha} in nitrogen atmosphere, and in the formation of the ion {sup 32}PO{sub 4}{sup 3-} in acid solution. Due to the handling of radioactive material during the process, the prototype is inside a hot cell and it has a cylindrical oven that opens up lengthwise to the half, with controller of temperature and with a system of empty air for to transport reagents and products. The air-vacuum system is provided of filters and traps. The tests showed a recovery from 14 to 15% of the activity obtained during the irradiation. (Author)
Software for the Minsk-32 display station
International Nuclear Information System (INIS)
Ehsenski, J.
1976-01-01
The software for the combined work of two computers is described. the TRA-1 with a raster display working as a display station for Minsk-32. Due to the two-way communication between the computers each of them acts as two external devices for the other one. The Minsk-32 complex consists of the computer, of an operative magnetic memory (OMM) with capacity of 32K, punch card input device, punch card output device, magnetic tape memory , an alphabetic-digital information type-writer and an electronic timer. The TRA-1 complex consists of a processor, an OMM with capaciti of 16K, a teletype, a punch card input device, a magnetic disc with capacity of 64K and a raster display. Minsk-32 is capable of multiprogram work (its OMM can contain 4 programs at once); the work according to one program may be accompanied by information exchange with the external devices. The composing of the system is described, as well as its basic programs, i.e. the residence and the MONITOR
Isothermal phase equilibria for the (HFC-32 + HFC-134a) mixed-gas hydrate system
International Nuclear Information System (INIS)
Miyauchi, Hiroshi; Yasuda, Kenjiro; Matsumoto, Yuuki; Hashimoto, Shunsuke; Sugahara, Takeshi; Ohgaki, Kazunari
2012-01-01
Highlights: ► Structural phase transition results in the heterogeneous azeotropic-like behaviour. ► HFC-134a molecules, in spite of an s-II former, occupy the large cages of s-I. ► Negative azeotropic-like behaviour becomes more remarkable at higher temperatures. - Abstract: Isothermal phase equilibria (pressure-composition relations in hydrate, gas, and aqueous phases) in the {difluoromethane (HFC-32) + 1,1,1,2-tetrafluoroethane (HFC-134a)} mixed-gas hydrate system were measured at the temperatures 274.15 K, 279.15 K, and 283.15 K. The heterogeneous azeotropic-like behaviour derived from the structural phase transition of (HFC-32 + HFC-134a) mixed-gas hydrates appears over the whole temperature range of the present study. In addition to the heterogeneous azeotropic-like behaviour, the isothermal phase equilibrium curves of the (HFC-32 + HFC-134a) mixed-gas hydrate system exhibit the negative homogeneous azeotropic-like behaviour at temperatures 279.15 K and 283.15 K. The negative azeotropic-like behaviour, which becomes more remarkable at higher temperatures, results in the lower equilibrium pressure of (HFC-32 + HFC-134a) mixed-gas hydrates than those of both simple HFC-32 and HFC-134a hydrates. Although the HFC-134a molecule forms the simple structure-II hydrate at the temperatures, the present findings reveal that HFC-134a molecules occupy a part of the large cages of the structure-I mixed-gas hydrate.
Energy Technology Data Exchange (ETDEWEB)
Shrestha, Som [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sharma, Vishaldeep [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Abdelaziz, Omar [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2014-02-18
This report investigates the tested performance of lower - GWP candidate refrigerant, 94.07 wt% R - 32 + 5.93 wt % R - 134 a mixture (hereafter referred to as R - 32/134a), as an alternative to baseline refrigerant R - 410 A using a 36,000 Btu/hr compressor calorimeter located at the Heat Exchanger Advanced Testing Facility at Oak Ridge National Laboratory . These tests were conducted during May and August 2013. R - 410A is a near - azeotropic blend of R - 32 and R - 125 with 0.5/0.5 mass fraction and has a GWP 100 of 2100. R - 32 and R - 134a are pure refrigerants and have GWP 100 of 716 and 1370 1, respectively. Based on the GWP 100 values of pure refrigerants and their mass fraction in the blend, GWP 100 of R - 32/134a, which is under development by National Refrigerant, is 755. This report compares various performance parameters, such as cooling capacity, compressor power, refrigerant mass flow rate, EER, isentropic efficiency and discharge temperature of the alternative refrigerant to that of R - 410 A.
9 CFR 355.32 - Labeling required.
2010-01-01
... CERTIFICATION CERTIFIED PRODUCTS FOR DOGS, CATS, AND OTHER CARNIVORA; INSPECTION, CERTIFICATION, AND... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Labeling required. 355.32 Section 355.32 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY...
Cyto- and receptor architecture of area 32 in human and macaque brains.
Palomero-Gallagher, Nicola; Zilles, Karl; Schleicher, Axel; Vogt, Brent A
2013-10-01
Human area 32 plays crucial roles in emotion and memory consolidation. It has subgenual (s32), pregenual (p32), dorsal, and midcingulate components. We seek to determine whether macaque area 32 has subgenual and pregenual subdivisions and the extent to which they are comparable to those in humans by means of NeuN immunohistochemistry and multireceptor analysis of laminar profiles. The macaque has areas s32 and p32. In s32, layer IIIa/b neurons are larger than those of layer IIIc. This relationship is reversed in p32. Layer Va is thicker and Vb thinner in s32. Area p32 contains higher kainate, benzodiazepine (BZ), and serotonin (5-HT)1A but lower N-methyl-D-aspartate (NMDA) and α2 receptor densities. Most differences were found in layers I, II, and VI. Together, these differences support the dual nature of macaque area 32. Comparative analysis of human and macaque s32 and p32 supports equivalences in cyto- and receptor architecture. Although there are differences in mean areal receptor densities, there are considerable similarities at the layer level. Laminar receptor distribution patterns in each area are comparable in the two species in layers III-Va for kainate, NMDA, γ-aminobutyric acid (GABA)B , BZ, and 5-HT1A receptors. Multivariate statistical analysis of laminar receptor densities revealed that human s32 is more similar to macaque s32 and p32 than to human p32. Thus, macaque 32 is more complex than hitherto known. Our data suggest a homologous neural architecture in anterior cingulate s32 and p32 in human and macaque brains. © 2013 Wiley Periodicals, Inc.
Borovykh, M. A.; Chikova, O. A.; Tsepelev, V. S.; V'yukhin, V. V.
2017-03-01
The resistivity of liquid 32G2 and 32G1 steels are measured using the rotating magnetic field method to obtain information on their liquid structures. The technique of measurements is described and the influence of self-induction and viscosity on the resistivity is estimated. The results are discussed in the framework of a microheterogeneous structure of a metallic melt. A conclusion is made about the character of the influence of slag inclusions detected by magnetic powder and ultrasonic methods on the temperature dependences of the resistivities of liquid 32G2 and 32G1 steels. The change in the temperature coefficient of the resistivity of the melt on heating to 1700°C is interpreted using the Nagel-Tauc model.
47 CFR 32.2001 - Telecommunications plant in service.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Telecommunications plant in service. 32.2001 Section 32.2001 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32...
17 CFR 32.7 - Books and recordkeeping.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Books and recordkeeping. 32.7... COMMODITY OPTION TRANSACTIONS § 32.7 Books and recordkeeping. (a) Each person which accepts any money... least include all orders (filled, unfilled or cancelled), signature cards, books of records, journals...
48 CFR 32.501-3 - Contract price.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contract price. 32.501-3... REQUIREMENTS CONTRACT FINANCING Progress Payments Based on Costs 32.501-3 Contract price. (a) For the purpose of making progress payments and determining the limitation on progress payments, the contract price...
Unraveling flp-11/flp-32 dichotomy in nematodes.
Atkinson, Louise E; Miskelly, Iain R; Moffett, Christy L; McCoy, Ciaran J; Maule, Aaron G; Marks, Nikki J; Mousley, Angela
2016-10-01
FMRFamide-like peptide (FLP) signalling systems are core to nematode neuromuscular function. Novel drug discovery efforts associated with nematode FLP/FLP receptor biology are advanced through the accumulation of basic biological data that can reveal subtle complexities within the neuropeptidergic system. This study reports the characterisation of FMRFamide-like peptide encoding gene-11 (flp-11) and FMRFamide-like peptide encoding gene-32 (flp-32), two distinct flp genes which encode the analogous peptide, AMRN(A/S)LVRFamide, in multiple nematode species - the only known example of this phenomenon within the FLPergic system of nematodes. Using bioinformatics, in situ hybridisation, immunocytochemistry and behavioural assays we show that: (i) flp-11 and -32 are distinct flp genes expressed individually or in tandem across multiple nematode species, where they encode a highly similar peptide; (ii) flp-11 does not appear to be the most widely expressed flp in Caenorhabditis elegans; (iii) in species expressing both flp-11 and flp-32, flp-11 displays a conserved, restricted expression pattern across nematode clades and lifestyles; (iv) in species expressing both flp-11 and flp-32, flp-32 expression is more widespread and less conserved than flp-11; (v) in species expressing only flp-11, the flp-11 expression profile is more similar to the flp-32 profile observed in species expressing both; and (vi) FLP-11 peptides inhibit motor function in multiple nematode species. The biological significance and evolutionary origin of flp-11 and -32 peptide duplication remains unclear despite attempts to identify a common ancestor; this may become clearer as the availability of genomic data improves. This work provides insight into the complexity of the neuropeptidergic system in nematodes, and begins to examine how nematodes may compensate for structural neuronal simplicity. From a parasite control standpoint, this work underscores the importance of basic biological data, and has
10 CFR 51.32 - Finding of no significant impact.
2010-01-01
... assessment is included, the finding need not repeat any of the discussion in the assessment but may... 10 Energy 2 2010-01-01 2010-01-01 false Finding of no significant impact. 51.32 Section 51.32... Section 102(2) Finding of No Significant Impact § 51.32 Finding of no significant impact. (a) A finding of...
Performance of a 64-channel, 3.2×3.2 cm{sup 2} SiPM tile for TOF-PET application
Energy Technology Data Exchange (ETDEWEB)
Ferri, Alessandro, E-mail: aleferri@fbk.eu; Acerbi, Fabio; Gola, Alberto; Piemonte, Claudio; Paternoster, Giovanni; Zorzi, Nicola
2016-07-11
In this work, we present a new 3.2×3.2 cm{sup 2} detector tile, composed of 8×8 single SiPMs, having a regular 4 mm pitch in both the X and Y directions. The tile fill factor is 85%. We produced two versions of the tile with different SiPM technologies: RGB-HD and NUV. The first one features square micro-cells with 25 µm pitch, a PDE peaked at 550 nm and a DCR of 300 kHz/mm{sup 2}, at 20 °C and at maximum detection efficiency. The second one features micro-cells with 40 µm pitch and a PDE peaked in the blue part of the spectrum. The dark count rate at 20 °C and at maximum PDE is 100 kHz/mm{sup 2}. In this work, we show the energy and timing resolution measurements at 511 keV obtained coupling the two tiles to an 8×8 LYSO array with a pixel size of 4×4×22 mm{sup 3}, perfectly matching the photo-detector array.
40 CFR 79.32 - Motor vehicle gasoline.
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Motor vehicle gasoline. 79.32 Section...) REGISTRATION OF FUELS AND FUEL ADDITIVES Designation of Fuels and Additives § 79.32 Motor vehicle gasoline. (a) The following fuels commonly or commercially known or sold as motor vehicle gasoline are hereby...
International Nuclear Information System (INIS)
Changotra, Harish; Turk, Susan M.; Artigues, Antonio; Thakur, Nagendra; Gore, Mindy; Muggeridge, Martin I.; Hutt-Fletcher, Lindsey M.
2016-01-01
The Epstein–Barr virus glycoprotein complex gMgN has been implicated in assembly and release of fully enveloped virus, although the precise role that it plays has not been elucidated. We report here that the long predicted cytoplasmic tail of gM is not required for complex formation and that it interacts with the cellular protein p32, which has been reported to be involved in nuclear egress of human cytomegalovirus and herpes simplex virus. Although redistribution of p32 and colocalization with gM was not observed in virus infected cells, knockdown of p32 expression by siRNA or lentivirus-delivered shRNA recapitulated the phenotype of a virus lacking expression of gNgM. A proportion of virus released from cells sedimented with characteristics of virus lacking an intact envelope and there was an increase in virus trapped in nuclear condensed chromatin. The observations suggest the possibility that p32 may also be involved in nuclear egress of Epstein–Barr virus. - Highlights: • The predicted cytoplasmic tail of gM is not required to complex with gN. • Cellular p32 can interact with the predicted cytoplasmic tail of EBV gM. • Knockdown of p32 recapitulates the phenotype of virus lacking the gNgM complex.
Energy Technology Data Exchange (ETDEWEB)
Changotra, Harish; Turk, Susan M. [Department of Microbiology and Immunology, Center for Molecular and Tumor Virology and Feist-Weiller Cancer Center, Louisiana State University Health Sciences Center, Shreveport, LA (United States); Artigues, Antonio [Department of Biochemistry, University of Kansas Medical Center, Kansas City, KS (United States); Thakur, Nagendra; Gore, Mindy; Muggeridge, Martin I. [Department of Microbiology and Immunology, Center for Molecular and Tumor Virology and Feist-Weiller Cancer Center, Louisiana State University Health Sciences Center, Shreveport, LA (United States); Hutt-Fletcher, Lindsey M., E-mail: lhuttf@lsuhsc.edu [Department of Microbiology and Immunology, Center for Molecular and Tumor Virology and Feist-Weiller Cancer Center, Louisiana State University Health Sciences Center, Shreveport, LA (United States)
2016-02-15
The Epstein–Barr virus glycoprotein complex gMgN has been implicated in assembly and release of fully enveloped virus, although the precise role that it plays has not been elucidated. We report here that the long predicted cytoplasmic tail of gM is not required for complex formation and that it interacts with the cellular protein p32, which has been reported to be involved in nuclear egress of human cytomegalovirus and herpes simplex virus. Although redistribution of p32 and colocalization with gM was not observed in virus infected cells, knockdown of p32 expression by siRNA or lentivirus-delivered shRNA recapitulated the phenotype of a virus lacking expression of gNgM. A proportion of virus released from cells sedimented with characteristics of virus lacking an intact envelope and there was an increase in virus trapped in nuclear condensed chromatin. The observations suggest the possibility that p32 may also be involved in nuclear egress of Epstein–Barr virus. - Highlights: • The predicted cytoplasmic tail of gM is not required to complex with gN. • Cellular p32 can interact with the predicted cytoplasmic tail of EBV gM. • Knockdown of p32 recapitulates the phenotype of virus lacking the gNgM complex.
Chemical effects of /sup 32/P recoil atom
Energy Technology Data Exchange (ETDEWEB)
Matsuura, N [Tokyo Univ. (Japan). Coll. of General Education
1975-06-01
Szilard-Chalmers' effect of /sup 32/P were reviewed. The concentration method using Szilard-Chalmers' effect in production of radioisotope, circumstances such as exposure time in an atomic pile, states of target substances and the yields by them were discussed. Many kinds of chemical effects, such as chemical effects of /sup 32/P recoil atom in phosphorated glass, studies of the effect of adducts, the threshold of ..gamma..-ray effect, the oxidation number of /sup 32/P in phosphorated glass by exposure time in the pile and the labelling position of /sup 32/P, are associated with caryotransformation (nuclear transformation) by environmental factors. The abovementioned articles were explained concerning /sup 32/P.
7 CFR 61.32 - No discrimination in sampling.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false No discrimination in sampling. 61.32 Section 61.32... FOR SALE FOR CRUSHING PURPOSES (INSPECTION, SAMPLING AND CERTIFICATION) Regulations Licensed Cottonseed Samplers § 61.32 No discrimination in sampling. Each licensed sampler, when requested, shall...
Directory of Open Access Journals (Sweden)
M. Masachs
2007-09-01
Full Text Available Introducción: la medida de la calidad de vida relacionada con la salud (CVRS tiene una reconocida importancia en la evaluación, el manejo y el seguimiento de la enfermedad inflamatoria intestinal. El instrumento de medida más utilizado es la versión de 32 ítems del Inflammatory Bowel Disease Questionnaire (IBDQ-32, que no está adaptado al español. Objetivo: traducir la versión del IBDQ-32 al español y determinar su validez, fiabilidad y sensibilidad tanto en la colitis ulcerosa como en la enfermedad de Crohn. Método: estudio prospectivo en dos fases: traducción y posterior validación del IBDQ-32 al español. La traducción se ha basado en la versión al español validada del IBDQ-36, y los ítems del IBDQ-32 no incluidos en el IBDQ-36 se tradujeron "de novo". Una vez terminada la traducción del IBDQ32, se aplicó un cuestionario específico de comprensión. Para determinar las propiedades psicométricas del IBDQ-32, un grupo de pacientes completó el IBDQ-36 ya validado al español y el IBDQ-32. Resultados: se han incluido 84 pacientes (53 con enfermedad de Crohn y 31 con colitis ulcerosa. La mediana de la puntuación global de ambos cuestionarios en los 84 pacientes no fue diferente (6,1 vs. 6,2, p = ns y su correlación de Spearman fue muy significativa (r = 0,97, p Introduction: the measurement of health-related quality of life (HRQoL has an established relevance in the assessment, management, and follow-up of inflammatory bowel disease. The most commonly used measuring instrument is the 32-item version of Inflammatory Bowel Disease Questionnaire (IBDQ-32, which has never been adapted to Spanish. Objective: to translate IBDQ-32 into Spanish, and to establish its validity, reliability, and sensitivity both in ulcerative colitis and Crohn's disease. Method: a prospective study in two phases -translation into Spanish and subsequent validation of IBDQ-32. Translation was based on the validated Spanish version of IBDQ-36, and IBDQ-32
International Nuclear Information System (INIS)
Tanaka, Satoshi; Saito, Kazuya; Yamamoto, Miho; Iida, Kenji; Bando, Mayumi; Saga, Kenji; Takahashi, Makoto; Matsuda, Michio.
1992-01-01
A 32-year-old woman in whom basal cell epithelioma (BCE) arose on the P-32 irradiated area is reported. At the age of 2, the patient had received superficial irradiation with P-32 for hemangioma simplex on the right precordial site. A black, ill-defined mass has occurred and gradually increased 3 years earlier. Chronic radiodermatitis characterized by teleangiectasis and skin atrophy was seen in the area surrounding the mass, which corresonded to that exposed to P-32. Histopathological examination leads to the diagnosis of BCE developing in part of chronic radiodermatitis. Review of the literature shows 3 cases of squamous cell carcinoma of the skin resulting from P-32 therapy. This is the first report on a patient with BCE resulting from irradiation with P-32. (N.K.)
Energy Technology Data Exchange (ETDEWEB)
Tanaka, Satoshi; Saito, Kazuya; Yamamoto, Miho; Iida, Kenji; Bando, Mayumi; Saga, Kenji; Takahashi, Makoto (Sapporo Medical Coll. (Japan)); Matsuda, Michio
1992-10-01
A 32-year-old woman in whom basal cell epithelioma (BCE) arose on the P-32 irradiated area is reported. At the age of 2, the patient had received superficial irradiation with P-32 for hemangioma simplex on the right precordial site. A black, ill-defined mass has occurred and gradually increased 3 years earlier. Chronic radiodermatitis characterized by teleangiectasis and skin atrophy was seen in the area surrounding the mass, which corresonded to that exposed to P-32. Histopathological examination leads to the diagnosis of BCE developing in part of chronic radiodermatitis. Review of the literature shows 3 cases of squamous cell carcinoma of the skin resulting from P-32 therapy. This is the first report on a patient with BCE resulting from irradiation with P-32. (N.K.).
Energy Technology Data Exchange (ETDEWEB)
Duarte A, C
2003-07-01
The {sup 32} P are a pure emitting radioisotope of maximum energy of 1.71 MeV with half life of 14.28 days that he has applications in the industry, in agriculture, in medicine, in biology and in ecology (6,11,12,13,17,21,22,23,24,25,26,27,28,29,30,31,32 33).The {sup 32} P can be used in the industry like radiotracer in the investigation of some operations and processes and as element of measurement of some industrial meters. In agriculture is used as radiotracer (29) in the investigation of diverse biological processes that have to do with the production of diverse nutritious products. In medicine has uses but very therapeutic mainly in the treatment of some become cancerous (28, 31, 25, 27) in the diagnosis of blood disorders (24) and like part of materials of production of aortic prosthesis (6). The {sup 32} P are also used in the molecular investigation in biology and in genetics (33), and in studies of ecosystems (32) and of DNA (22). One can obtain the {sup 32} P by means of diverse nuclear reactions depending on the material used as matter it prevails, since it doesn't exist in the nature. But anyone in the ways of obtaining it it should imply a process of radiochemical separation that involves so many steps like they are required, depending on the material used as matter prevails, of the purity with which he wants himself to obtain and of the resources that it has available. The objective of this work was design, to build and to prove a prototype to obtain the {sup 32} P to leave of the irradiation of S {alpha} with fast neutrons at experimental level, which implies also to design a process that contemplates diverse stages and procedures for each one of them. The process was outlined in five stages: matter purification prevails, preparation of irradiation capsules, irradiation of irradiation capsules, transport and opening capsules of irradiation and radiochemical separation. In the last stage it was where uses the prototype of radiochemical separation
New cryogenic temperature monitor: PLT-HPT-32
Viera Curbelo, Teodora Aleida; Martín-Fernández, Sergio Gonzáles; Hoyland, R.; Vega-Moreno, A.; Cozar Castellano, Juan; Gómez Reñasco, M. F.; Aguiar-González, M.; Pérez de Taoro, Angeles; Sánchez-de la Rosa, V.; Rubiño-Martín, J. A.; Génova-Santos, R.
2016-07-01
The PLT-HPT-32, a new cryogenic temperature monitor, has been developed by the Institute of Astrophysics of the Canary Islands (IAC) and an external engineering company (Sergio González Martín-Fernandez). The PLT-HPT-32 temperature monitor offers precision measurement in a wide range of cryogenic and higher-temperature applications with the ability to easily monitor up to 32 sensor channels. It provides better measurement performance in applications where researchers need to ensure accuracy and precision in their low cryogenic temperature monitoring. The PLT-HPT-32 supports PTC RTDs such as platinum sensors, and diodes such as the Lake Shore DT-670 Series. Used with silicon diodes, it provides accurate measurements in cryo-cooler applications from 16 K to above room temperature. The resolution of the measurement is less than 0.1K. Measurements can be displayed in voltage units or Kelvin units. For it, two different tables can be used. One can be programmed by the user, and the other one corresponds to Lake Shore DT670 sensor that comes standard. There are two modes of measuring, the instantaneous mode and averaged mode. In this moment, all channels must work in the same mode but in the near future it expected to be used in blocks of eight channels. The instantaneous mode takes three seconds to read all channels. The averaged mode takes one minute to average twenty samples in all channels. Alarm thresholds can be configured independently for each input. The alarm events, come from the first eight channels, can activate the unit's relay outputs for hard-wired triggering of other systems or audible annunciators. Activate relays on high, low, or both alarms for any input. For local monitoring, "Stand-Alone Mode", the front panel of the PLT-HPT-32 features a bright liquid crystal display with an LED backlight that shows up to 32 readings simultaneously. Plus, monitoring can be done over a network "Remote Control Mode". Using the Ethernet port on the PLT-HPT-32, you
48 CFR 32.1010 - Risk of loss.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Risk of loss. 32.1010... REQUIREMENTS CONTRACT FINANCING Performance-Based Payments 32.1010 Risk of loss. (a) Under the clause at 52.232... loss occurs in connection with property for which the contractor bears the risk, and the property is...
40 CFR 255.32 - Coordination with other programs.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Coordination with other programs. 255.32 Section 255.32 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Relationship to Other Programs § 255.32 Coordination with other programs. The region and agency identification...
The distribution of 32P in the rice plant applied to a single root and to the whole root system
International Nuclear Information System (INIS)
Sisworo, E.L.; Gandanegara, S.; Sisworo, W.H.; Rasyid, H.; Sumarna, Nana
1982-01-01
Two greenhouse experiments to study the distribution of 32 P applied to a single root and to the whole root system have been carried out. Data from experiment 1 showed that 32 P activity in shoots rose with the progress of time; where 32 P was applied to a single root 6 hours after isotope application the 32 P activity in the shoots of plants was higher than if the isotope was applied to the whole root system. Three hours after 32 P application, plants with 50% of roots had a higher 32 P activity than plants with no root cutting. Data from experiment 2 showed that 32 P activity of plants that received 32 P through a single root only was lower than those that received 32 P through the whole root system. This was in contradiction with the data obtained in experiment 1. Experiment 2 also showed that 32 P activity increased with time. Autoradiographs of plants in experiment 1 and 2 showed that 32 P was distributed through the whole plant, although when the isotope was only applied to a single root. (author)
46 CFR 32.40-35 - Hospital space-T/ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Hospital space-T/ALL. 32.40-35 Section 32.40-35 Shipping... REQUIREMENTS Accommodations for Officers and Crew § 32.40-35 Hospital space—T/ALL. (a) Each vessel which in the... crew of 12 or more, must be provided with a hospital space. This space must be situated with due regard...
Atmospheric Chemistry of (CF3)2CF-C≡N
DEFF Research Database (Denmark)
Andersen, Mads Peter Sulbæk; Kyte, Mildrid; Thirstrup Andersen, Simone
2017-01-01
FTIR/smog chamber experiments and ab initio quantum calculations were performed to investigate the atmospheric chemistry of (CF3)2CFCN, a proposed replacement compound for the industrially important sulfur hexafluoride, SF6. The present study determined k(Cl + (CF3)2CFCN) = (2.33 ± 0.87) × 10–17, k......(OH + (CF3)2CFCN) = (1.45 ± 0.25) × 10–15, and k(O3 + (CF3)2CFCN) ≤ 6 × 10–24 cm3 molecule–1 s–1, respectively, in 700 Torr of N2 or air diluent at 296 ± 2 K. The main atmospheric sink for (CF3)2CFCN was determined to be reaction with OH radicals. Quantum chemistry calculations, supported by experimental...
Directory of Open Access Journals (Sweden)
Lluís Carreras
2013-09-01
Full Text Available Objecte: L'aplicació de la NIC 32 en les cooperatives ha generat una important controvèrsia en els últims anys. Fins al moment, s'han realitzat diversos treballs que intenten preveure els possibles efectes de la seva aplicació. Aquest treball pretén analitzar l'impacte de la primera aplicació de la NIC 32 en el sector cooperatiu. Disseny/metodologia/enfocament: S'ha seleccionat una mostra de 98 cooperatives, i s'ha realitzat una anàlisi comparativa de la seva informació financera presentada abans i després de l'aplicació de la NIC 32, per a determinar les diferències existents. S’ha utilitzat la prova de la suma de rangs de Wilcoxon per comprovar si aquestes diferències són significatives. També s’ha utilitzat la prova de la U de Mann Whitney per comprovar si existeixen diferències significatives en l’impacte relatiu de l’aplicació de la NIC 32 entre diversos grups de cooperatives. Finalment, s'ha realitzat una anàlisi dels efectes de l'aplicació de la NIC 32 en la situació patrimonial i econòmica de les cooperatives, i en l'evolució dels seus actius intangibles, mitjançant l’ús de tècniques d’anàlisi econòmico-financera. Aportacions i resultats: Els resultats obtinguts confirmen que l'aplicació de la NIC 32 provoca diferències significatives en algunes partides del balanç de situació i el compte de pèrdues i guanys, així com en les ràtios analitzades. Les principals diferències es concreten en una reducció del nivell de capitalització i un augment de l'endeutament de les cooperatives, així com un empitjorament general dels ràtios de solvència i autonomia financera. Limitacions: Cal tenir en compte que el treball s'ha realitzat amb una mostra de cooperatives que estan obligades a auditar els seus comptes anuals. Per tant, els resultats obtinguts han d'interpretar-se en un context de cooperatives de tamany elevat. També cal tenir en compte que hem realitzat una anàlisi comparativa dels comptes
Psalm 32 as a wisdom intertext
Directory of Open Access Journals (Sweden)
Philippus (Phil J. Botha
2014-10-01
Full Text Available Psalm 32 is considered by the majority of investigators to be a psalm of thanksgiving with a mix of wisdom poetry. In this article, the thesis is defended that it was devised from the beginning as a wisdom-teaching psalm although it simulates the form of a psalm of thanksgiving in certain respects. The case for this is argued on the basis of the complete integration of its parts, as well as its similarity to Proverbs 28:13–14 and some other wisdom texts. The aim of the psalmist seems to have been to argue (on the basis of a personal experience that stubbornness in accepting the guilt of sin causes suffering, but that Yahweh is eager to restore an intimate relationship with those worshippers who confess their guilt and are willing to accept his guidance on the way of life.
7 CFR 550.32 - Project supervision and responsibilities.
2010-01-01
... Management of Agreements Program Management § 550.32 Project supervision and responsibilities. (a) The... with a project plan for use for external peer review. ... 7 Agriculture 6 2010-01-01 2010-01-01 false Project supervision and responsibilities. 550.32...
Rauschmayr, N
2013-01-01
x32-ABI is an application binary interface, which has been introduced in Linux kernel 3.4. This interface is based on the x86-64 instruction set but uses 32-bit as size for pointers and C-datatype long instead of 64-bit. Thus software can profit from lower memory footprint but also form faster system calls. Several Root-benchmarks have been evaluated in this context and results regarding memory consumption and CPU-time are shown.
A 32-bit NMOS microprocessor with a large register file
Sherburne, R. W., Jr.; Katevenis, M. G. H.; Patterson, D. A.; Sequin, C. H.
1984-10-01
Two scaled versions of a 32-bit NMOS reduced instruction set computer CPU, called RISC II, have been implemented on two different processing lines using the simple Mead and Conway layout rules with lambda values of 2 and 1.5 microns (corresponding to drawn gate lengths of 4 and 3 microns), respectively. The design utilizes a small set of simple instructions in conjunction with a large register file in order to provide high performance. This approach has resulted in two surprisingly powerful single-chip processors.
19 CFR 172.32 - Authority to accept offers.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Authority to accept offers. 172.32 Section 172.32 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE....32 Authority to accept offers. The authority to accept offers in compromise, subject to the...
[Synthesis and characterization of CO-3(2-) doping nano-hydroxyapatite].
Liao, Jian-Guo; Li, Yan-Qun; Duan, Xing-Ze; Liu, Qiong
2014-11-01
CO3(2-) doping is an effective method to increase the biological activity of nano-hydroxyapatite (n-HA). In the present study, calcium nitrate and trisodium phosphate were chosen as raw materials, with a certain amount of Na2CO3 as a source of CO-3(2-) ions, to synthesize nano-carbonate hydroxyapatite (n-CHA) slurry by solution precipitation method. The structure and micro-morphology of n-CHA were characterized by transmission electron microscope (TEM), X-ray diffraction (XRD), Fourier transform-infrared spectroscopy (FTIR) and Raman spectroscopy (RS). The results revealed that the synthetic n-HA crystals are acicular in nanometer scale and have a crystal size of 20-30 nm in diameter and 60-80 nm in length, which are similar to natural bone apatite. And the crystallinity of n-CHA crystals decreases to the increment of CO3(2-). Samples with more CO3(2) have composition and structure more similar to the bone apatite. The value of lattice parameters a decreases, value of c increases, and c/a value increases with the increase in the amount of CO3(2-), in accordance with crystal cell parameters change rule of type B replacement. In the AB mixed type (substitution OH- and PO4(3-)) CHA, IR characteristic peak of CO3(2-) out-of-plane bending vibration appears at 872 cm(-1), meanwhile, the asymmetry flexible vibration band is split into band at 1 454 cm(-1) and band at 1 420 cm(-1), while weak CO3(2)-peak appears at 1 540 cm(-1). CO3(2-) Raman peak of symmetric stretching vibration appears at 1 122 cm(-1). CO3(2-) B-type (substitution PO4(3-)) peak appeared at 1 071 cm(-1). Through the calculation of integral area ratio of PO4(3-)/ CO3(2-), OH-/CO3(2-), and PO4(3-)/OH-, low quantity CO3(2-) is B-type and high quantity CO3(2-) is A-type (substitution OH-). The results show that the synthesized apatite crystals are AB hybrid substitued nano-carbonate hydroxyapatite, however B-type replacement is the main substitute mode. Due to similarity inthe shape, size, crystal structure
43 CFR 32.6 - Request for grant.
2010-10-01
... Public Lands: Interior Office of the Secretary of the Interior GRANTS TO STATES FOR ESTABLISHING YOUNG ADULT CONSERVATION CORPS (YACC) PROGRAM § 32.6 Request for grant. (a) All States will be given an... States on the basis of total youth population as defined in § 32.2(o) of this part. (b) States may apply...
Elevated interleukin-32 expression is associated with Helicobacter pylori-related gastritis.
Directory of Open Access Journals (Sweden)
Liu-Sheng Peng
Full Text Available BACKGROUND: Interleukin-32 (IL-32 is a recently discovered proinflammatory cytokine involved in inflammatory diseases. We investigated the expression of IL-32 and its regulation mechanism in the inflammatory response of patients with Helicobacter pylori (H. pylori infection. DESIGN AND METHODS: IL-32 mRNA and protein expression in gastric tissues was detected by quantitative real-time PCR and immunohistochemistry. The regulation of IL-32 in human gastric epithelia cell line AGS was investigated by different cytokine stimulation and different H. pylori strain infection. RESULTS: Gastric IL-32 mRNA and protein expression were elevated in patients with H. pylori infection and positively correlated with gastritis. In H. pylori-infected patients, the mRNA level of IL-32 was also correlated with that of proinflammatory cytokines IL-1β and TNF-α. In vitro IL-1β and TNF-α could upregulate IL-32 mRNA and protein level in AGS cells, which was dependent on NF-κB signal pathway. The regulation of IL-32 expression in response to H. pylori-infection could be weakened by using neutralizing antibodies to block IL-1β and TNF-α. Moreover, H. pylori-infected AGS cells also induced IL-32 mRNA and protein expression, which was dependent on CagA. CONCLUSIONS: IL-32 level is elevated in patients with H. pylori infection and its expression is regulated by proinflammatory stimuli, suggesting that IL-32 may play a role in the pathogenesis of H. pylori-related gastritis.
Directory of Open Access Journals (Sweden)
Sandra Milena Leal Pinto
2009-12-01
Full Text Available Introducción: La leishmaniasis y la enfermedad de Chagas son consideradas como problemas de salud pública en varios países, y nuevas estrategias quimioterapéuticas son necesarias para el control de estas enfermedades. Objetivo: El objetivo de este trabajo fue evaluar in vitro la actividad antiparasitaria de 7 nuevas dihidrodibenzo[c,f]tiazolo[3,2-a]azepin-3(2H-onas contra Leishmania chagasi, Trypanosoma cruzi, y la citotoxicidad sobre las células de mamìfero Vero y THP-1. Materiales y métodos: La actividad antiparasitaria se determinó microscópicamente por conteo directo de parásitos vivos en comparación con el control no tratado, y la citotoxicidad en células de mamífero por el método colorimétrico de MTT. Las formas extracelulares e intracelulares de los parásitos utilizados así como las células de mamífero, fueron tratadas con diferentes concentraciones de los compuestos (0,3-600 μM por 3-5 días. Los resultados de actividad de los compuestos fueron expresados en concentración inhibitoria (CI50 y concentración citotóxica (CC50. Resultados: En T. cruzi, 4 compuestos (4a, 4b, 4d, 4g fueron activos contra epimastigotes con rangos de actividad de CI50 entre 11,28-32,66 μM, y tres (4a, 4c, 4g contra la forma intracelular (CI50= 18,42-23,62 μM, sin presentar toxicidad en células de mamífero. En L. chagasi, seis compuestos (4a-d, 4g fueron activos contra promastigotes con CI50 entre 8,27-28,59 μM. El compuesto 4d fue parcialmente activo contra amastigotes intracelulares de L. chagasi (CI50= 59,36 μM. Conclusiones: Los compuestos 4a y 4g presentaron actividad in vitro contra L. chagasi y T. cruzi y baja toxicidad en células de mamífero. Estudios posteriores con los compuestos activos encontrados, de genotoxicidad, mecanismos de acción y de evaluación de su actividad en modelos experimentales, son necesarios para establecer su posible uso como antiparasitarios. Salud UIS 2009; 41: 268-274Introduction: Leishmaniasis and
18 CFR 401.32 - Concept of 3.8.
2010-04-01
... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Concept of 3.8. 401.32 Section 401.32 Conservation of Power and Water Resources DELAWARE RIVER BASIN COMMISSION ADMINISTRATIVE MANUAL RULES OF PRACTICE AND PROCEDURE Project Review Under Section 3.8 of the Compact § 401.32 Concept...
Development of A 32P-Postlabeling Technic for Detection of the Initiation of Cancer
International Nuclear Information System (INIS)
Budiawan
2000-01-01
It is well know that the interaction between exogenous and also endogenous subs-trances with macromolecular biology (Protein or DNA) in human with in sublethal or lethal level can lead to the initiation of cancer (Auerbach, 1946, Phillips, 1981). In the assessment of carcinogen exposure (exo genus or endo genus), bio markers are chosen based on a knowledge of the internal interactions of carcinogen molecules/metabolites with cellular macromolecules such as DNA, i.e. formation DNA adduct. The 32 P-postlabeling assay is most sensitive, fast and applicability methods to structurally diverse classes of chemical. It has been developed to detect DNA adduct (Randerath at. All, 1993, Reddy, 1986). The 32 P-Postlabeling technic has emerged as the method of choice for qualitative detection and quantitation of carcinogen-DNA adducts in human. The result of detection of the Adduct will lead the understand of the mechanism reaction of the substance in human organ. The assay of the 32 P-Postlabeling involves a stepwise sequence of biochemical reaction entailing: Isolation DNA and following with cleavage by enzymatic hydrolyzed of intact DNA (Nucleotide) with phosphate in 3 position. Attachment of a 32 P- label to the 5-hydroxyl end of DNA (Nucleotide) creating a 3,5-biphosphate; following by separation and detection of adducts by high-regulation TLC and autoradiography respectively and quantitation of adducts by measurement of radioactivity. The 32 P-Postlabeling was used to detection of DNA adduct of Polycyclic aromatic and alpha, beta unsaturated carbonyl compound such crotonaldehyde, which is in this paper to discussed. We have investigated and developed the 32 P-Postlabeling for detection of modified DNA of crotonaldehyde in vitro and in vivo as markers for initiation of cancer. From the result of study were found the adduct the adduct in several organs of F-344 rast after gavage and persisted to a certain extent (Eder dan Budiawan, 1997)
Treatment of cystic craniopharyngioma with phosphorus-32 intracavitary irradiation
Zhao, Rong; Deng, Jinglan; Liang, Xiaoyan; Zeng, Jin; Chen, Xiaoyuan
2013-01-01
Purpose The aim of the study was to evaluate the effect of phosphorus-32 colloid ([32P]) intracavitary irradiation on the treatment of patients with cystic craniopharyngiomas. Methods Twenty patients with predominantly cystic craniopharyngiomas were admitted from 1981 to 2006. Eleven patients had [32P] intracavitary irradiation by stereotactic injection or Ommaya cyst instillation as the primary treatment, and the remaining nine had the same internal irradiation as an adjuvant treatment after tumor resection. A calculated irradiation dose of 400~500 Gy per once was delivered to the cyst wall. Conclusion The patients were followed up ranging from 36 to 336 months; no operative morbidity or mortality was found from [32P] intracavitary irradiation. Fourteen patients (70%) had tumor progression and required further two to four times intracavitary irradiation. All 20 cases achieved tumor shrinkage or stabilization with effective outcome 3–6 months after the last [32P] therapy. For patients with cystic craniopharyngioma, [32P] administration by stereo-tactic injection or Ommaya cyst instillation is a safe and helpful option, which could improve the life quality, prolong the life span, and enhance the survival rate of cystic craniopharyngioma patients. PMID:19904543
Cardiac cine imaging at 3 Tesla: initial experience with a 32-element body-array coil.
Fenchel, Michael; Deshpande, Vibhas S; Nael, Kambiz; Finn, J Paul; Miller, Stephan; Ruehm, Stefan; Laub, Gerhard
2006-08-01
We sought to assess the feasibility of cardiac cine imaging and evaluate image quality at 3 T using a body-array coil with 32 coil elements. Eight healthy volunteers (3 men; median age 29 years) were examined on a 3-T magnetic resonance scanner (Magnetom Trio, Siemens Medical Solutions) using a 32-element phased-array coil (prototype from In vivo Corp.). Gradient-recalled-echo (GRE) cine (GRAPPAx3), GRE cine with tagging lines, steady-state-free-precession (SSFP) cine (GRAPPAx3 and x4), and SSFP cine(TSENSEx4 andx6) images were acquired in short-axis and 4-chamber view. Reference images with identical scan parameters were acquired using the total-imaging-matrix (Tim) coil system with a total of 12 coil elements. Images were assessed by 2 observers in a consensus reading with regard to image quality, noise and presence of artifacts. Furthermore, signal-to-noise values were determined in phantom measurements. In phantom measurements signal-to-noise values were increased by 115-155% for the various cine sequences using the 32-element coil. Scoring of image quality yielded statistically significant increased image quality with the SSFP-GRAPPAx4, SSFP-TSENSEx4, and SSFP-TSENSEx6 sequence using the 32-element coil (P < 0.05). Similarly, scoring of image noise yielded a statistically significant lower noise rating with the SSFP-GRAPPAx4, GRE-GRAPPAx3, SSFP-TSENSEx4, and SSFP-TSENSEx6 sequence using the 32-element coil (P < 0.05). This study shows that cardiac cine imaging at 3 T using a 32-element body-array coil is feasible in healthy volunteers. Using a large number of coil elements with a favorable sensitivity profile supports faster image acquisition, with high diagnostic image quality even for high parallel imaging factors.
16 CFR 1018.32 - Compensation and travel expenses.
2010-01-01
... place of business, may be allowed travel expenses including per diem in lieu of expenses as authorized... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Compensation and travel expenses. 1018.32... MANAGEMENT Administration of Advisory Committees § 1018.32 Compensation and travel expenses. (a) A single...
Frequency of the CCRD32 allele in Brazilians: a study in colorectal cancer and in HTLV-I infection
Directory of Open Access Journals (Sweden)
Pereira Rinaldo W.
2000-01-01
Full Text Available The identification of a 32-bp deletion in the cc-chemokine receptor-5 gene (CCR5delta32 allele that renders homozygous individuals highly resistant to HIV infection has prompted worldwide investigations of the frequency of the CCR5delta32 allele in regional populations. It is important to ascertain if CCR5delta32 is a factor to be considered in the overall epidemiology of HIV in individual populations. With this in mind we determined the CCR5delta32 allele frequency in a large sample (907 individuals of the southeastern Brazilian urban population, stratified as follows: 322 healthy unrelated individuals, 354 unselected colorectal cancer patients, and 229 blood donors. The three groups displayed essentially identical allelic frequencies of CCR5delta32 and pairwise comparisons did not show significant differences. Thus, our results can be pooled to provide a reliable estimate of the CCR5delta32 allele frequency in the southeastern Brazil of 0.053 ± 0.005. The blood donors comprised 50 HTLV-I serologically negative individuals, 115 non-symptomatic individuals HTLV-I positive by ELISA but with indeterminate Western blot results, 49 healthy blood donors HTLV-I positive both at ELISA and Western blot and 15 patients with clinical spinal cord disease (HAM. A suggestive trend was observed, with the CCR5delta32 frequencies decreasing progressively in these four categories. However, when we applied Fischer's exact test no significant differences emerged. We believe that further studies in larger cohorts should be performed to ascertain whether the CCR5delta32 allele influences the chance of becoming infected or developing clinical symptoms of HTLV-I infection.
Atmospheric chemistry of (CF3)2CHOCH3, (CF3)2CHOCHO, and CF3C(O)OCH3
DEFF Research Database (Denmark)
Østerstrøm, Freja From; Wallington, Timothy J.; Andersen, Mads Peter Sulbæk
2015-01-01
Smog chambers with in situ FTIR detection were used to measure rate coefficients in 700 Torr of air and 296 ± 2 K of: k(Cl+(CF3)2CHOCH3) = (5.41 ± 1.63) × 10(-12), k(Cl+(CF3)2CHOCHO) = (9.44 ± 1.81) × 10(-15), k(Cl+CF3C(O)OCH3) = (6.28 ± 0.98) × 10(-14), k(OH+(CF3)2CHOCH3) = (1.86 ± 0.41) × 10(-1...
2010-10-01
... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.1170 Receivables. (a... of interest accrued to the date of the balance sheet on bonds, notes, and other commercial paper...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Scope of part. 32.0 Section 32.0 Judicial Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE...) Educational assistance benefits. [73 FR 76528, Dec. 17, 2008] ...
International Nuclear Information System (INIS)
Duda, A.; Murray, C.S.
1998-01-01
Recent progress in the development of high-performance, 0.6-eV Ga0.32In0.68As/InAs0.32P0.68 thermophotovoltaic (TPV) converters and monolithically interconnected modules (MIMs) is described. The converter structure design is based on using a lattice-matched InAs0.32P0.68/Ga0.32In0.68As/InAs0.32P0.68 double-heterostructure (DH) device, which is grown lattice-mismatched on an InP substrate, with an intervening compositionally step-graded region of InAsyP1-y. The Ga0.32In0.68As alloy has a room-temperature band gap of 0.6 eV and contains a p/n junction. The InAs0.32P0.68 layers have a room-temperature band gap of 0.96 eV and serve as passivation/confinement layers for the Ga0.32In0.68As p/n junction. InAsyP1-y step grades have yielded DH converters with superior electronic quality and performance characteristics. Details of the microstructure of the converters are presented. Converters prepared for this work were grown by atmospheric-pressure metalorganic vapor-phase epitaxy (APMOVPE) and were processed using a combination of photolithography, wet-chemical etching, and conventional metal and insulator deposition techniques. Excellent performance characteristics have been demonstrated for the 0.6-eV TPV converters. Additionally, the implementation of MIM technology in these converters has been highly successful
International Nuclear Information System (INIS)
Eijkern, F.E.H. van; Middelkoop, G. van; Sterrenburg, W.A.; Buijense, A.F.C.
1976-01-01
Spins, parities and transition probabilities of levels in 32 P at Esub(x)>3.5 MeV have been determined with the 29 Si(α, pγ) 32 P reaction at bombarding energies of Esub(α)=12.80, 12.93 and 16.30 MeV. Proton-gamma angular correlation experiments and DSA lifetime measurements lead to six unambiguous spin assignments and to many spin limitations. The measured mixing and branching ratios yield many transition strengths for dipole and electric quadrupole transitions. Five, sofar unknown, energy levels are reported. A doublet at 4.03 MeV excitation energy and a high-spin state (Esub(x)=4.27 MeV; Jsup(π)=5 - ) were observed. Shell-model predictions have been compared to the present experimental results. (Auth.)
Advanced Time-Delayed Coincidence Studies of $^{31,32}$Mg from the $\\beta$-decays of $^{31,32}$Na
Marechal, F; Plociennik, W A
2002-01-01
It is proposed to study the lifetime of the 2$_{1}^{+}$ 885.4 keV state in $^{32}$Mg by means of Advanced Time-Delayed $\\beta \\gamma \\gamma$(t) method with the precision in the half-life value of about $\\pm$ 1.5 ps. This would be an independent verification of the B(E2; 0$_{1}^{+} \\rightarrow$ 2$_{1}^{+}$) values obtained so far in a few studies using Coulomb excitations at intermediate beam energies. The advantage of time-delayed coincidence measurements is that they are free of corrections used in the Coulex studies, which strongly affect the deduced B(E2) results. In addition, we propose to study the lifetimes or lifetime limits of other states in nuclei populated in the decays of $^{31}$Na and $^{32}$Na, specifically focusing on the intruder negative parity band in $^{31}$Mg. As a side benefit to this investigation we expect high-quality $\\gamma \\gamma$ coincidences to reveal new excited states in both $^{31}$Mg and $^{32}$Mg. Our results from a brief test-measurement yield a lifetime of T$_{1/2}$ = 10.5(...
48 CFR 32.501-5 - Other protective terms.
2010-10-01
..., Advance Payments. (e) A provision, included in the solicitation and resultant contract when first article... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Other protective terms. 32... CONTRACTING REQUIREMENTS CONTRACT FINANCING Progress Payments Based on Costs 32.501-5 Other protective terms...
47 CFR 32.7240 - Operating other taxes.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Operating other taxes. 32.7240 Section 32.7240 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS..., gross receipts, franchise and capital stock taxes; this account shall also reflect subsequent...
Directory of Open Access Journals (Sweden)
Tutik Dwi Wahyuningsih
2010-06-01
Full Text Available -Carboline and its derivatives are significant due to their pharmacological importance. The synthesis of indolo[3,2-c]quinolines as a benzo analog of -carboline has been carried out via an oxime ether intermediate. Reaction of 2'-glyoxylic ester with hydroxylamine hydrochloride in the presence of sodium acetate afforded the oxime acetate in 82%. It was then treated with natrium and fluoro-2,4-dinitrobenzene in ethanol to give an orange solid of oxime ether acetate which is in subsequent treatment with a base yielded a pale yellow solid of indolo[3,2-c]carboline in 43%. Keywords: -carboline, oxime, indolo[3,2-c]quinoline.
31 CFR 356.32 - What tax rules apply?
2010-07-01
... political subdivision of a State, except for State estate or inheritance taxes and other exceptions as... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What tax rules apply? 356.32 Section...) Miscellaneous Provisions § 356.32 What tax rules apply? (a) General. Securities issued under this part are...
20 CFR 901.32 - Receipt of information concerning enrolled actuaries.
2010-04-01
... actuaries. 901.32 Section 901.32 Employees' Benefits JOINT BOARD FOR THE ENROLLMENT OF ACTUARIES REGULATIONS... Suspension or Termination of Enrollment § 901.32 Receipt of information concerning enrolled actuaries. If an... Guaranty Corporation, or a member of the Joint Board has reason to believe that an enrolled actuary has...
32 CFR 37.230 - May I use a TIA if a participant is to receive fee or profit?
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false May I use a TIA if a participant is to receive... Investment Agreements § 37.230 May I use a TIA if a participant is to receive fee or profit? In accordance with 32 CFR 22.205(b), you may not use a TIA if any participant is to receive fee or profit. Note that...
47 CFR 32.5060 - Other basic area revenue.
2010-10-01
... accounts in the settlement process. (See also § 32.4999(e)). To the extent that the charges and credits resulting from a settlement process can be identified by Local Network Services Revenue account they shall... SYSTEM OF ACCOUNTS FOR TELECOMMUNICATIONS COMPANIES Instructions For Revenue Accounts § 32.5060 Other...
Visual outcome in cystic craniopharyngiomas treated with intracavitary phosphorus-32
International Nuclear Information System (INIS)
Anderson, D.R.; Trobe, J.D.; Taren, J.A.; Gebarski, S.S.
1989-01-01
Seven patients with cystic craniopharyngiomas were treated with stereotactic instillation of radioactive phosphorus-32 (32P). Five patients had been previously treated with various combinations of surgery and external beam irradiation, whereas two had the 32 P instillation as a primary therapy. Visual acuity improved in 13 eyes and remained stable in 1. Visual fields normalized in three patients, improved in two, and remained stable in two. Two patients received single treatments with 32 P, whereas five required multiple instillations for recurrent cyst expansion
40 CFR 303.32 - Pre-payment offers.
2010-07-01
... 40 Protection of Environment 27 2010-07-01 2010-07-01 false Pre-payment offers. 303.32 Section 303.32 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SUPERFUND, EMERGENCY PLANNING, AND COMMUNITY RIGHT-TO-KNOW PROGRAMS CITIZEN AWARDS FOR INFORMATION ON CRIMINAL VIOLATIONS UNDER...
31 CFR 10.32 - Practice of law.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Practice of law. 10.32 Section 10.32... of law. Nothing in the regulations in this part may be construed as authorizing persons not members of the bar to practice law. ...
47 CFR 3.2 - Terms and definitions.
2010-10-01
... is subject to IMF's definition. One of the monetary units used to effect accounting settlements in... 47 Telecommunication 1 2010-10-01 2010-10-01 false Terms and definitions. 3.2 Section 3.2 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL AUTHORIZATION AND ADMINISTRATION OF ACCOUNTING...
A cytological analysis of the mutagenic action of 32P and 35S on the tea seeds
International Nuclear Information System (INIS)
Baratashvili, D.Sh.
1981-01-01
A cytologic analysis of mutagenic effect of 32 P and 35 S aqueous solutions (specific activity of 0.05 mCi/ml) on the seeds of the ''Kolchida'' tea, is carried out. Seed treatment with the above solutions within 12 hours causes the inhibition of mitoses, more pronounced in the case of 32 P effect. The maximum frequency of chromosomal aberrations is observed after 28 hours after the action (13.62% for 32 P and 11.20% for 35 S). Close to 180 hours, the frequency of aberrations reaches the level of control. A low amount of bridges as compared with the number of fragments is characteristic of 32 P effect; while 35 S effect causes the formation of a considerable number of bridges
45 CFR 1306.32 - Center-based program option.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Center-based program option. 1306.32 Section 1306... START PROGRAM HEAD START STAFFING REQUIREMENTS AND PROGRAM OPTIONS Head Start Program Options § 1306.32 Center-based program option. (a) Class size. (1) Head Start classes must be staffed by a teacher and an...
International Nuclear Information System (INIS)
Adegbola, Onikepe; Pasternack, Gary R.
2005-01-01
We have previously shown pp32 and the retinoblastoma protein interact. pp32 and the retinoblastoma protein are nuclear receptor transcriptional coregulators: the retinoblastoma protein is a coactivator for androgen receptor, the major regulator of prostate cancer growth, while pp32, which is highly expressed in prostate cancer, is a corepressor of the estrogen receptor. We now show pp32 increases androgen receptor-mediated transcription and the retinoblastoma protein modulates this activity. Using affinity purification and mass spectrometry, we identify members of the pp32-retinoblastoma protein complex as PSF and nonO/p54nrb, proteins implicated in coordinate regulation of nuclear receptor-mediated transcription and splicing. We show that the pp32-retinoblastoma protein complex is modulated during TPA-induced K562 differentiation. Present evidence suggests that nuclear receptors assemble multiprotein complexes to coordinately regulate transcription and mRNA processing. Our results suggest that pp32 and the retinoblastoma protein may be part of a multiprotein complex that coordinately regulates nuclear receptor-mediated transcription and mRNA processing
32 CFR Appendix A to Part 247 - Funded Newspapers and Magazines
2010-07-01
.... Funded publications shall not carry commercial advertising. As a service, the Funded newspaper may carry... 32 National Defense 2 2010-07-01 2010-07-01 false Funded Newspapers and Magazines A Appendix A to... (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt...
28 CFR 32.37 - Request for Hearing Officer determination.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Request for Hearing Officer determination. 32.37 Section 32.37 Judicial Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE BENEFIT CLAIMS Educational Assistance Benefit Claims § 32.37 Request...
46 CFR 32.40-50 - Heating and cooling-T/ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Heating and cooling-T/ALL. 32.40-50 Section 32.40-50... REQUIREMENTS Accommodations for Officers and Crew § 32.40-50 Heating and cooling—T/ALL. (a) All manned spaces must be adequately heated and cooled in a manner suitable to the purpose of the space. (b) The heating...
Non-Covalent Interactions in Hydrogen Storage Materials LiN(CH32BH3 and KN(CH32BH3
Directory of Open Access Journals (Sweden)
Filip Sagan
2016-03-01
Full Text Available In the present work, an in-depth, qualitative and quantitative description of non-covalent interactions in the hydrogen storage materials LiN(CH32BH3 and KN(CH32BH3 was performed by means of the charge and energy decomposition method (ETS-NOCV as well as the Interacting Quantum Atoms (IQA approach. It was determined that both crystals are stabilized by electrostatically dominated intra- and intermolecular M∙∙∙H–B interactions (M = Li, K. For LiN(CH32BH3 the intramolecular charge transfer appeared (B–H→Li to be more pronounced compared with the corresponding intermolecular contribution. We clarified for the first time, based on the ETS-NOCV and IQA methods, that homopolar BH∙∙∙HB interactions in LiN(CH32BH3 can be considered as destabilizing (due to the dominance of repulsion caused by negatively charged borane units, despite the fact that some charge delocalization within BH∙∙∙HB contacts is enforced (which explains H∙∙∙H bond critical points found from the QTAIM method. Interestingly, quite similar (to BH∙∙∙HB intermolecular homopolar dihydrogen bonds CH∙∙∙HC appared to significantly stabilize both crystals—the ETS-NOCV scheme allowed us to conclude that CH∙∙∙HC interactions are dispersion dominated, however, the electrostatic and σ/σ*(C–H charge transfer contributions are also important. These interactions appeared to be more pronounced in KN(CH32BH3 compared with LiN(CH32BH3.
10 CFR 420.32 - Program guidance/solicitation.
2010-01-01
... SEP and the participating programs in the Office of Energy Efficiency and Renewable Energy; and (2... 10 Energy 3 2010-01-01 2010-01-01 false Program guidance/solicitation. 420.32 Section 420.32 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION STATE ENERGY PROGRAM Implementation of Special Projects...
47 CFR 32.4080 - Other taxes-accrued.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Other taxes-accrued. 32.4080 Section 32.4080 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS..., franchise, capital stock, social security and unemployment taxes. (b) Taxes paid in advance of the period in...
Experiments on the Making(T32 work in progress)
DEFF Research Database (Denmark)
Carbone, Claudia
2017-01-01
of operation entails production of derivative variations accommodating a reading of differences in the material as well as in the space in between, facilitating possibilities of chance encounters, discoveries. The work is developed as a fragmented assemblage of representations of T32 (acronym – a road, 32......) of memories of the places of obliteration it exposes; the erasure of significance of the past, and possesses their validity in the present and the future.Methodological approaches explored in the contextual, the serial, relating to T32 its heterogeneous representations; the findings, the manipulated drawings...
Molecular Regulation of Antibiotic Biosynthesis in Streptomyces
Liu, Gang; Chandra, Govind; Niu, Guoqing
2013-01-01
SUMMARY Streptomycetes are the most abundant source of antibiotics. Typically, each species produces several antibiotics, with the profile being species specific. Streptomyces coelicolor, the model species, produces at least five different antibiotics. We review the regulation of antibiotic biosynthesis in S. coelicolor and other, nonmodel streptomycetes in the light of recent studies. The biosynthesis of each antibiotic is specified by a large gene cluster, usually including regulatory genes (cluster-situated regulators [CSRs]). These are the main point of connection with a plethora of generally conserved regulatory systems that monitor the organism's physiology, developmental state, population density, and environment to determine the onset and level of production of each antibiotic. Some CSRs may also be sensitive to the levels of different kinds of ligands, including products of the pathway itself, products of other antibiotic pathways in the same organism, and specialized regulatory small molecules such as gamma-butyrolactones. These interactions can result in self-reinforcing feed-forward circuitry and complex cross talk between pathways. The physiological signals and regulatory mechanisms may be of practical importance for the activation of the many cryptic secondary metabolic gene cluster pathways revealed by recent sequencing of numerous Streptomyces genomes. PMID:23471619
Bai, Feng-Yang; Jia, Zi-Man; Pan, Xiu-Mei
2018-06-01
In this work, a systematic investigation of the atmospheric oxidation mechanism of (CF3)2CXOCH3 and their oxidative products (CF3)2CXOCHO (X = H, F) initiated by OH radical or Cl atom is performed by density functional theory. This study reveals that the introduction of NO and O2 promotes the formation of organic nitrates, which are hygroscopic and are inclined to form secondary organic aerosols (SOA) and can affect the air quality. The rate constants of the individual reactions are found to be in agreement with the experimental results. One of the intriguing findings of this work is that the peroxynitrite of (CF3)2CHOCH2OONO formed from the subsequent reactions of (CF3)2CHOCH3 is more favorable to isomerize to organic nitrate (CF3)2CHOCH2ONO2 than to dissociate into alkoxy radical (CF3)2CHOCH2O and NO2 because of the lower energy barrier of isomerization. The second significant observation is that the organic nitrate can be degraded more favorably with the presence of NH3, CH3NH2, and CH3NHCH3 than its naked decomposition reaction (CF3)2CHOCH2ONO2→(CF3)2CHOCHO + HONO. The ammonium salt, a vital part of haze, is harmful to human health and can be formed in the existence of the NH3, CH3NH2, and CH3NHCH3. In addition, the toxic substance of peroxyalkyl nitrate (CF3)2CHOC(O)ONO2 which can reduce the visibility of the atmosphere is produced as the primary subsequent oxidation product of (CF3)2CHOCHO in a NO-rich environment. The main species detected experimentally are confirmed by this study. The computational results are crucial to risk assessment and pollution prevention of the volatile organic compounds (VOCs).
47 CFR 61.32 - Method of filing publications.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Method of filing publications. 61.32 Section 61...) TARIFFS General Rules for Dominant Carriers § 61.32 Method of filing publications. (a) Publications sent....” The date on which the publication is received by the Secretary of the Commission (or the Mail Room...
27 CFR 5.32 - Mandatory label information.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Mandatory label information. 5.32 Section 5.32 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS LABELING AND ADVERTISING OF DISTILLED SPIRITS Labeling Requirements for...
Development of EPICS IOC for TPLC-32 platform
International Nuclear Information System (INIS)
Jain, Sanjay Kumar; Bhamra, Ratna; Kavalan, P.K.; Vaidya, U.W.
2014-01-01
Experimental Physics and Industrial Control System (EPICS) SCADA software package is popular worldwide for deploying accelerator control systems. EPICS base allows building server applications that interact with EPICS compliant lower level hardware, embedded systems, commercial PLCs on one side and facilitates seamless connectivity with EPICS clients on the other side. Large number of such lower level (EPICS complaint) networked systems work in collaborative environment for physics experiment. RCnD has developed a PLC platform, Trombay Programmable Logic Controller TPLC-32 for deploying C and I systems of NPP and allied utilities. This platform is now also being used for deploying accelerator C and I systems. Hence the activity of developing TPLC-32 interface with EPICS was taken up in RCnD. This paper introduces the architecture of the EPICS Input Output Controller (IOC) and describes the implementation of the EPICS SoftIOC for TPLC-32. It also describes Operator Interface developed using MEDM EPICS client for LEHIPA vacuum control system built using TPLC-32. (author)
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Trading on a Registered Derivatives Transaction Execution Facility for Non-Institutional Customers. 4.32 Section 4.32 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION COMMODITY POOL OPERATORS AND COMMODITY TRADING...
2010-07-01
... MANAGEMENT Non-Federal Oil and Gas Rights § 9.32 Access. (a) No access on, across or through lands or waters... access is by foot, pack animal, or designated road. Persons using designated roads for access to such a...
Evaluation of Isotope 32P Method to Mark Culex pipiens (Diptera: Culicidae in a Laboratory
Directory of Open Access Journals (Sweden)
Chongxing Zhang
2016-01-01
Full Text Available Background: The aim of the current study was to develop a marking technique as an internal marker to mark post blood meal mosquitoes by using stable phosphate isotope 32P and determine the optimal concentration of it.Methods: An isotonic physiological saline solution, containing different concentration of radioactive isotope 32P-labeled disodium phosphate (Na2H32PO4 was injected into rabbits via the jugular vein in the laboratory. Emerged Cx. pipiens were marked after feeding on rabbit. At the same time, the labeled conditions of emerged Cx. pipiens were also measured by placing feces of No. 6 rabbit into containers with mosquito larvae and pupae inside.Results: According to the label condition of Cx. pipiens after taking blood and the effect of different dosage Na2H32PO4 on rabbit health, the optimal concentration of radioactive isotope was determined, that is, 0.1211 mCi/kg. By placing feces of No. 6 rabbit into containers with mosquito larvae and pupae inside, the emerged mosquitoes were also labeled. Therefore, feeding mosquitoes on the animal injected with radioactive Na2H32PO4 was more practical for detecting and tracing mosquitoes.Conclusion: The method was less time-consuming, more sensitive and safer. This marking method will facilitate post-bloodmeal studies of mosquitoes and other blood-sucking insects.
32 bit digital optical computer - A hardware update
Guilfoyle, Peter S.; Carter, James A., III; Stone, Richard V.; Pape, Dennis R.
1990-01-01
Such state-of-the-art devices as multielement linear laser diode arrays, multichannel acoustooptic modulators, optical relays, and avalanche photodiode arrays, are presently applied to the implementation of a 32-bit supercomputer's general-purpose optical central processing architecture. Shannon's theorem, Morozov's control operator method (in conjunction with combinatorial arithmetic), and DeMorgan's law have been used to design an architecture whose 100 MHz clock renders it fully competitive with emerging planar-semiconductor technology. Attention is given to the architecture's multichannel Bragg cells, thermal design and RF crosstalk considerations, and the first and second anamorphic relay legs.
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Individual. 26.655 Section 26.655 National... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 26.655 Individual. Individual means a natural person. ...
2010-01-01
... Administrative Enforcement Proceedings § 7.32 Appeal. (a) Right of appeal. Within ten days after receipt by... shall be based solely on the hearing record or those portions thereof cited by the parties to limit the...
International Nuclear Information System (INIS)
Blossom, J.M.; Hong, J.P.; Kellner, R.G.
1985-01-01
Los Alamos National Laboratory is building a 32-bit FASTBUS computer using the NATIONAL SEMICONDUCTOR 32032 central processing unit (CPU) and containing 16 million bytes of memory. The board can act both as a FASTBUS master and as a FASTBUS slave. It contains a custom direct memory access (DMA) channel which can perform 80 million bytes per second block transfers across the FASTBUS
A review on the current status and production technology of {sup 32,} {sup 33}P-orthophosphoric acid
Energy Technology Data Exchange (ETDEWEB)
Park, Ul Jae; Han, Hyun Soo; Cho, Woon Kap; Kuznetsov, Rostislav A
2000-10-01
The current status of {sup 32}, {sup 33}P-Orthophosphoric acid production technology is reviewed. The following aspects of the technology are covered: - production of phosphorus-32 and phosphorus-33 using various nuclear reactions; - chemical properties of sulfur and phosphorus effecting the technology of radioactive phosphorus production; - chemical state of {sup 32}, {sup 33}P in neutron irradiated sulfur; - the technology of radioactive phosphorus isolation from neutron irradiated target and orthophosphoric acid production; - purification of {sup 32}, {sup 33}P-orthophosphoric acid from impurities and some related problems, like the nature of impurities, the storage of the final product, etc. - the quality control procedures of carrier-free ({sup 32}, {sup 33}P)-orthophosphoric acid preparations.
46 CFR 32.15-10 - Sounding machines-T/OCL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Sounding machines-T/OCL. 32.15-10 Section 32.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY TANK VESSELS SPECIAL EQUIPMENT, MACHINERY, AND HULL REQUIREMENTS Navigation Equipment § 32.15-10 Sounding machines—T/OCL. All mechanically propelled vessels in...
50 CFR 36.32 - Taking of fish and wildlife.
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Taking of fish and wildlife. 36.32 Section 36.32 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR (CONTINUED) THE NATIONAL WILDLIFE REFUGE SYSTEM ALASKA NATIONAL WILDLIFE REFUGES Other Refuge Uses § 36.32...
Analysis of JUPITER critical experiments by JENDL-3.2
International Nuclear Information System (INIS)
Ishikawa, Makoto
1996-01-01
Applicability of the JENDL-3.2 library to large FBR cores was evaluated using JUPITER experimental data. The nuclear characteristics treated in the present report include criticality, reaction rate ratio, space dependency of C/E values, sodium void reactivity and Doppler reactivity. As a conclusion, JENDL-3.2 is judged to be a well-balanced library for prediction of large FBR core parameters. The unification of integral experimental information from JUPITER and differential nuclear data of JENDL-3.2 will enhance the accuracy and reliability of large FBR core design. (author)
18 CFR 415.32 - Permitted uses generally.
2010-04-01
... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Permitted uses generally. 415.32 Section 415.32 Conservation of Power and Water Resources DELAWARE RIVER BASIN COMMISSION... riding trails. (4) Uses such as lawns, gardens, parking areas and play areas. (b) Within the flood fringe...
ALMA CO(3-2) Observations of Star-forming Filaments in a Gas-poor Dwarf Spheroidal Galaxy
Consiglio, S. Michelle; Turner, Jean L.; Beck, Sara; Meier, David S.; Silich, Sergiy; Zhao, Jun-Hui
2017-11-01
We report ALMA observations of 12CO(3-2) and 13CO(3-2) in the gas-poor dwarf galaxy NGC 5253. These 0.″3(5.5 pc) resolution images reveal small, dense molecular gas clouds that are located in kinematically distinct extended filaments. Some of the filaments appear to be falling into the galaxy and may be fueling its current star formation. The most intense CO(3-2) emission comes from the central ˜100 pc region centered on the luminous radio-infrared H II region known as the supernebula. The CO(3-2) clumps within the starburst region are anti-correlated with Hα on ˜5 pc scales, but are well-correlated with radio free-free emission. Cloud D1, which enshrouds the supernebula, has a high 12CO/13CO ratio, as does another cloud within the central 100 pc starburst region, possibly because the clouds are hot. CO(3-2) emission alone does not allow determination of cloud masses as molecular gas temperature and column density are degenerate at the observed brightness, unless combined with other lines such as 13CO.
Atmospheric chemistry of (CF3)2CFOCH3
DEFF Research Database (Denmark)
Andersen, Lene Løffler; Østerstrøm, Freja From; Nielsen, Ole John
2014-01-01
FTIR smog chamber techniques were used to measure k(Cl + (CF 3)2CFOCH3) = (1.80 ± 0.42) × 10-13, k(Cl + (CF3)2CFOCHO) = (1.47 ± 0.56) × 10-14, and k(OH + (CF3) 2CFOCH3) = (1.55 ± 0.24) × 10-14 cm3 molecule-1 s-1. The chlorine-atom initiated oxidation of (CF3)2CFOCH3 in air in the absence of NOX r...
Leaf absorption of 32P in the pumpkin
International Nuclear Information System (INIS)
Chamel, Andre; Roux-Aubert, M.T.
1964-04-01
The author presents a method to study the influence of various factors of the absorption of 32 P applied under the form of phosphates by a plant cultivated in conditions ensuring a normal development. Experiments provided indications on leaf absorption and 32 P transport by pumpkin leaves: phosphor 32 is absorbed and then quickly transported into the different organs of the plant (24 hours after treatment, it is present in aerial and underground parts), the quantity of absorbed phosphor increases with phosphor concentration in the applied solution, atmosphere humidity is an important factor for phosphor penetration into the leaves, plants absorb phosphor in darkness as well as in light, and the absorption of phosphor is not modified when applied with low glucose concentrations [fr
Effect of Phosphorus-32 Incorporated into Chick Embryo
Energy Technology Data Exchange (ETDEWEB)
Szabo, L. D.; Antoni, F.; Koeteles, G. J.; Holland, J.; Hidvegi, E. J.; Varteresz, V. [Frederic Joliot-Curie National Research Institute for Radiobiology and Radiohygiene, Budapest (Hungary)
1968-06-15
The bilogical effects of {sup 32}P on the viability and development of chick embryo were studied. 200,100 and 50 {mu}Ci per egg killed the embryos during incubation. Growth retardation preceded their death. 25 {mu}Ci per egg, however, did not cause mortality until hatching. An attempt was made to correlate the observed effects with the radiation dose and the number of {sup 32}P atoms incorporated into DNA and therefore, the frequencies of radiophosphorus atoms in the polynucleotide chains of DNA and RNA were determined under various conditions. Some biochemical consequences of the decay of {sup 32}P incorporated into ribonucleic acids were demonstrated. Structural changes of RNA were observed. Parallel with structural changes, functional alterations of various kinds of RNA molecules were demonstrated in isolated ribosomal systems. The decrease in protein synthesis by liver ribosomes was found to be proportional to the number of decayed intramolecular {sup 32}P atoms. The structural and functional changes of ribonucleic acids observed on molecular and sub-cellular levels could be attributed to nuclear transmutation of {sup 32}P. (author)
Optimization time synthesis of nucleotide labelled [γ-32P]-ATP
International Nuclear Information System (INIS)
Rahman, Wira Y; Sarmini, Endang; Herlina; Lubis, Hotman; Triyanto; Hambali
2013-01-01
Adenosine triphosphate-labelled with γ- 32 P([γ- 32 p]-ATP) has been widely used in the biotechnology research, usually as a tracer to study aspects of physiological and pathological processes. In order to support biotechnology research in Indonesia, a process for production of [γ- 32 P]-ATP with enzymatic reaction was used as precursors DL-glyceraldehydde 3-phosphate, Adenosine Diphosphate (ADP) and H 3 32 PO 4 , and enzyme glyceraldehid 3-phosphate dehydrogenase, 3-phosphoglyceryc phosphokinase and lactate dehydrogenase. Optimization of incubation time labeled nucleotide synthesis process is performed to find the optimum conditions, in terms of the most advantageous time in the synthesis process. With the success of the synthesis and optimization is done incubation time of synthesis labeled nucleotide, the result suggested can be used for producing [γ- 32 P] -ATP to support the provision of radiolabeled nucleotide for biotechnology research in Indonesia. (author)
19 CFR 12.32 - Honeybees and honeybee semen.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Honeybees and honeybee semen. 12.32 Section 12.32... semen. (a) Honeybees from any country may be imported into the U.S. by the Department of Agriculture for.... (b) Honeybee semen may be imported into the U.S. only from countries determined by the Secretary of...
Anomolous, intensity dependent losses in Au(32+) beams
International Nuclear Information System (INIS)
Blaskiewicz, M.; Ahrens, L.; Calvani, H.
1997-01-01
The AGS Booster is a rapid cycling proton and heavy ion synchrotron. Anomolous, intensity dependent losses in Au(32+) beams have been observed in the AGS Booster. No collective signal is expected, or observed, but increasing the number of injected ions decreases the beam lifetime. The loss rates for Au(32+) are compared with those for Au(15+)
Integral-spin fields on (3+2)-de Sitter space
International Nuclear Information System (INIS)
Gazeau, J.; Hans, M.
1988-01-01
Nowadays, (3+2)-de Sitter (or anti-de Sitter space) appears as a very attractive possibility at several levels of theoretical physics. The Wigner definition of an elementary system as associated to a unitary irreducible representation of the Poincare group may be extended to the de Sitter group SO(3,2) [or ∼(SO(3,2))] without great difficulty. The constant curvature, as small as it can be, is a natural candidate to play the role of a regularization parameter with respect to the flat-space limit. Massless particles in (3+2)-de Sitter theory are composite (singletons). On the other hand, supergravity theories necessitate a (large) constant curvature. The content of this paper is group theoretical. It attempts to continue the ''a la Wigner'' program for SO(3,2), already largely broached by Fronsdal. Three recurrence formulas are presented. They permit one to build up the carrier states for representations with arbitrary integral spin. Two of them are valid for the ''massive'' representations whereas the third one is applicable to the indecomposable massless representations. In addition, other presumably indecomposable, though nonphysical, representations are studied, in relation to the existence of ''generalized'' gauge fields and divergences. The recurrence formulas also allow one to build up the invariant two-point functions or homogeneous propagators
29 CFR 20.32 - Liquidation of collateral.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Liquidation of collateral. 20.32 Section 20.32 Labor Office... collateral. An agency holding security or collateral which may be liquidated and the proceeds applied on... demand, unless the cost of disposing of the collateral will be disproportionate to its value or special...
27 CFR 18.32 - Change in name.
2010-04-01
... Original Establishment § 18.32 Change in name. The proprietor shall submit an amended application to cover any change in the individual, firm, or corporate name. (Approved by the Office of Management and... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Change in name. 18.32...
Cloning and Expression of Leptospira LipL32 Antigen as a Candidate for Rapid Diagnosis
Directory of Open Access Journals (Sweden)
Nooshin Sohrabi
2013-09-01
Full Text Available Background and Objective: Leptospirosis as an important emerging infectious zoonotic disease caused by spirochetes of the genus Leptospira. Given the low sensitivity and long duration of its culture, the diagnosis of leptospirosis is mainly based on serological methods. The microscopic agglutination test (MAT is considered as the reference method. Because of the complexity of the MAT, there is an urgent need for the development of new reliable and rapid screening tests for leptospirosis. Major leptospiral outer membrane proteins (OMPs, present only in pathologic strains, could be regarded as a good candidate for diagnostic studies. Here we report the cloning and expression of LipL32, as a prominent immunogenic protein, in a prokaryotic system. Materials and Methods: After the amplification of LipL32 gene, it was cloned into the pQE30 vector. The insertion of LipL32 gene into the vector was screened and confirmed with restriction analysis and sequencing. The recombinant plasmid was transformed into E. coli M15 strain, and the expressed protein was identified by SDS-PAGE and western blotting. This recombinant protein with 6× His-tagged sequence was purified using Ni-NTA affinity column chromatography. Results: The results revealed that the selected gene was successfully cloned in pQE30 vector and recombinant protein (rLipL32 of approximately ~32 kDa was produced, purified and confirmed by western blotting. Conclusion: This recombinant protein could be potentially used for the development of serodiagnosis tests for the diagnosis of leptospirosis in humans and animals.
Energy Technology Data Exchange (ETDEWEB)
Yu, Jianlin; Xu, Zong; Tian, Gaolei [Department of Refrigeration and Cryogenic Engineering, School of Energy and Power Engineering, Xi' an Jiaotong University, West Xianning Road, No. 28, Xianning West Road, Xi' an Shaanxi 710049 (China)
2010-12-15
In this study, a thermodynamic analysis on the performance of a transcritical cycle using azeotropic refrigerant mixtures of R32/R290 with mass fraction of 70/30 has been performed. The main purpose of this study is to theoretically verify the possibility of applying the chosen refrigerant mixture in small heat pumps for high temperature water heating applications. Performance evaluation has been carried out for a simple azeotropic mixture R32/R290 transcritical cycle by varying evaporator temperature, outlet temperature of gas cooler and compressor discharge pressure. Furthermore, the effects of an internal heat exchanger on the transcritical R32/R290 cycle have been presented at different operating conditions. The results show that high heating coefficient of performance (COP{sub h}) and volumetric heating capacity can be achieved by using this transcritical cycle. It is desirable to apply the chosen refrigerant mixture R32/R290 in small heat pump water heater for high temperature water heating applications, which may produce hot water with temperature up to 90 C. (author)
Determination of specific activity of phosphorus-32 labelled o-phosphoric acid
International Nuclear Information System (INIS)
Sane, S.U.
2015-01-01
Phosphorus-32 is one of the important radioisotopes used in therapeutic nuclear medicine. This work was aimed at developing a fast and sensitive procedure to determine trace amounts of 32 P which is present in various acidic chemical form thereby enabling to determine its specific activity. The method utilizes ammonium molybdate and metol for complexing with phosphorus in presence of sulphuric acid which was measured using UV-VIS spectrophotometer. The phosphate and molybdate ions form a stable complex which turns blue (molybdenum blue) by reduction with sulphuric acid. The absorbance of the complex thus formed was measured at 700 nm. Five batches of 32 P produced were analyzed using the procedure and specific activity was determined. It was found that radioactivity of 32 P did not interfere in absorbance measurements and the method could be successfully adopted for the determination of specific activity of 32 P. A scope of the method is to find the chemical purity of radioactive phosphorus ( 32 P) in quality control analysis. (author)
A molecular orbital study on the oxidative decomposition of HFC-32
International Nuclear Information System (INIS)
Mochizuki, Yuji
1999-03-01
A series of ab initio molecular orbital calculations, in which Hartree-Fock, second-order Moeller-Plesset perturbation, density functional (B3LYP and BHandHLYP) levels of theory were used, was performed on the elementary reactions related to the oxidative decomposition of HFC-32 (CH 2 F 2 ) by hydroxyl (OH) radicals in a supercritical water condition (so-called SCWO). The whole process is written as CH 2 F 2 + 4OH → CO 2 + 2H 2 O + 2HF and consists of (1) H abstraction by OH to form H 2 O, (2) OH coupling to C-center, and (3) HF leaving to form C=O bond. Molecular geometries were optimized at each level of theory. The HF leaving was found to be the rate-determining step, but its barrier height was lowered by the reactive solvation with an extra H 2 O. Calculations implied that the SCWO of HFC-32 can proceed efficiently. (author)
32 CFR 725.7 - Contents of a proper request or demand.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Contents of a proper request or demand. 725.7 Section 725.7 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL RELEASE... § 725.7 Contents of a proper request or demand. (a) Routine requests. If official information is sought...
Algebraic special functions and SO(3,2)
International Nuclear Information System (INIS)
Celeghini, E.; Olmo, M.A. del
2013-01-01
A ladder structure of operators is presented for the associated Legendre polynomials and the sphericas harmonics. In both cases these operators belong to the irreducible representation of the Lie algebra so(3,2) with quadratic Casimir equals to −5/4. As both are also bases of square-integrable functions, the universal enveloping algebra of so(3,2) is thus shown to be homomorphic to the space of linear operators acting on the L 2 functions defined on (−1,1)×Z and on the sphere S 2 , respectively. The presence of a ladder structure is suggested to be the general condition to obtain a Lie algebra representation defining in this way the “algebraic special functions” that are proposed to be the connection between Lie algebras and square-integrable functions so that the space of linear operators on the L 2 functions is homomorphic to the universal enveloping algebra. The passage to the group, by means of the exponential map, shows that the associated Legendre polynomials and the spherical harmonics support the corresponding unitary irreducible representation of the group SO(3,2). -- Highlights: •The algebraic ladder structure is constructed for the associated Legendre polynomials (ALP). •ALP and spherical harmonics support a unitary irreducible SO(3,2)-representation. •A ladder structure is the condition to get a Lie group representation defining “algebraic special functions”. •The “algebraic special functions” connect Lie algebras and L 2 functions
2010-10-01
... costs related to defaults in performance. (10) Breach of contract obligations concerning progress....601 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Contract Debts 32.601 General. (a) Contract debts are amounts that— (1) Have...
Mega-ampere submicrosecond generator GIT-32
International Nuclear Information System (INIS)
Kovalchuk, B. M.; Kharlov, A. V.; Kiselev, V. N.; Kumpyak, E. V.; Zorin, V. B.; Chupin, V. V.; Morozov, A. V.
2007-01-01
The GIT-32 current generator was developed for experiments with current carrying pulsed plasma. The main parts of the generator are capacitor bank, multichannel multigap spark switches, low inductive current driving lines, and central load part. The generator consists of four identical sections, connected in parallel to one load. The capacitor bank is assembled from 32 IEK-100-0.17 (0.17 μF, 40 nH, 100 kV) capacitors, connected in parallel. It stores ∼18 kJ at 80 kV charging voltage. Each two capacitors are commuted to a load by a multigap spark switch with eight parallel channels. Switches operate in ambient air at atmospheric pressure. The GIT-32 generator was tested with 10, 15, and 20 nH inductive loads. At 10 nH load and 80 kV of charging voltage it provides 1 MA of current amplitude and 490 ns rise time with 0.8 Ω damping resistors in discharge circuit of each capacitor and 1.34 MA/530 ns without resistors. The net generator inductance without a load was optimized to be as low as 12 nH, which results in extremely low self-impedance of the generator (∼0.05 Ω). It ensures effective energy coupling with low impedance loads like Z pinch. The generator operates reliably without any adjustments in 40-80 kV range of charging voltage. Maximum jitter (relative to a triggering pulse) at 40 kV charging voltage is about 7 ns and lower at higher charging voltages. Operation and handling are very simple, because no oil and no purified gases are required for the generator. The GIT-32 generator has dimensions of 3200x3200x400 mm 3 and total weight of about 2500 kg, thus manifesting itself as a simple, robust, and cost effective apparatus
12 CFR 925.32 - Official membership insignia.
2010-01-01
... the words “Member Federal Home Loan Bank System.” [58 FR 43542, Aug. 17, 1993. Redesignated at 61 FR... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Official membership insignia. 925.32 Section 925.32 Banks and Banking FEDERAL HOUSING FINANCE BOARD FEDERAL HOME LOAN BANK MEMBERS AND HOUSING...
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Periods of war. 3.2..., Compensation, and Dependency and Indemnity Compensation General § 3.2 Periods of war. This section sets forth the beginning and ending dates of each war period beginning with the Indian wars. Note that the term...
Experimental study on 32P uptake in vivo
International Nuclear Information System (INIS)
Yamazaki, Yoshiyuki
1978-01-01
Disturbances in the development of the teeth which were caused by internal irradiation of 32 P were studied using rats of Wister strain about one month old. The experiment with a dose of 7 μc/g of 32 P showed that 4 of 30 rats died within 90 days of observation. The experiment with a dose of 10 μc/g of 32 P showed that none of the rats survived longer than 18 days. Correlationship was found among increase and decrease of the body weight, myelogram of the femoral bone, and ability of the tooth development. The disturbances showed a peak about 20 days after the administration of 32 P and then subsided. As regards the relationship between the mechanisms of tooth formation and tooth eruption, reformation of the dentine was noted but no recovery of tooth eruption was noted 30 days after 32 P-administration. Some recovery from disturbance of the tooth formation could be observed after 30 days of the administration of 32 P. 90 days after the administration, dentin formation could still be noted in the apical part, while germ cells of the tooth had been destroyed completely and peridental tissues had also been destroyed remarkably. Persistent osteoid dentin, characteristic of disturbance of the incisor due to internal irradiation, proliferated in a shape of a belt along the dentin blastocytes in the labial side, gradually infiltrating into the center of the dental pulp. The osteoid dentin proliferated in a shape of lump in the dental germ of the lingual side. In the experiments with 7 μc/g, there was left a possibility of maintaining vital power of rats judging from their weights and myelogram of the femoral bone, while the dose had destructive effects on the incisors. This was substantiated by the fact that the absorbed dose of the incisor was highest among those of the hard tissues. (Ueda, J.)
Production of high specific activity silicon-32
International Nuclear Information System (INIS)
Phillips, D.R.; Brzezinski, M.A.
1998-01-01
This is the final report of a three-year, Laboratory Directed Research and Development Project (LDRD) at Los Alamos National Laboratory (LANL). There were two primary objectives for the work performed under this project. The first was to take advantage of capabilities and facilities at Los Alamos to produce the radionuclide 32 Si in unusually high specific activity. The second was to combine the radioanalytical expertise at Los Alamos with the expertise at the University of California to develop methods for the application of 32 Si in biological oceanographic research related to global climate modeling. The first objective was met by developing targetry for proton spallation production of 32 Si in KCl targets and chemistry for its recovery in very high specific activity. The second objective was met by developing a validated field-useable, radioanalytical technique, based upon gas-flow proportional counting, to measure the dynamics of silicon uptake by naturally occurring diatoms
Traveling-Wave Maser for 32 GHz
Shell, James; Clauss, Robert
2009-01-01
The figure depicts a traveling-wave ruby maser that has been designed (though not yet implemented in hardware) to serve as a low-noise amplifier for reception of weak radio signals in the frequency band of 31.8 to 32.3 GHz. The design offers significant improvements over previous designs of 32-GHz traveling-wave masers. In addition, relative to prior designs of 32-GHz amplifiers based on high-electron-mobility transistors, this design affords higher immunity to radio-frequency interference and lower equivalent input noise temperature. In addition to the basic frequency-band and low-noise requirements, the initial design problem included a requirement for capability of operation in a closed-cycle helium refrigerator at a temperature .4 K and a requirement that the design be mechanically simplified, relative to prior designs, in order to minimize the cost of fabrication and assembly. Previous attempts to build 32- GHz traveling-wave masers involved the use of metallic slow-wave structures comprising coupled transverse electromagnetic (TEM)-mode resonators that were subject to very tight tolerances and, hence, were expensive to fabricate and assemble. Impedance matching for coupling signals into and out of these earlier masers was very difficult. A key feature of the design is a slow-wave structure, the metallic portions of which would be mechanically relatively simple in that, unlike in prior slow-wave structures, there would be no internal metal steps, irises, or posts. The metallic portions of the slow-wave structure would consist only of two rectangular metal waveguide arms. The arms would contain sections filled with the active material (ruby) alternating with evanescent-wave sections. This structure would be transparent in both the signal-frequency band (the aforementioned range of 31.8 to 32.3 GHz) and the pump-frequency band (65.75 to 66.75 GHz), and would impose large slowing factors in both frequency bands. Resonant ferrite isolators would be placed in the
Directory of Open Access Journals (Sweden)
Adriano Tony Ramos
2009-06-01
Full Text Available The aim of this study was to evaluate the role of connexin 32 (Cx 32 during remyelination of the peripheral nervous system, through a local injection of either 0,1% ethidium bromide solution or saline in the sciatic nerve of Cx 32 knockout mice. Euthanasia was performed ranging from 1, 2, 3, 7, 15, 21 to 30 days after injection. Histochemical, immunohistochemical, immunofluorescence and transmission electron microscopical techniques were used to analyze the development of the lesions. Within the sciatic nerves, Schwann cells initially showed signs of intoxication and rejected their sheaths; after seven days, some thin newly formed myelin sheaths with uneven compactness and redundant loops (tomacula were conspicuous. We concluded that the regeneration of lost myelin sheaths within the PNS followed the pattern already reported for this model in other laboratory species. Therefore, these results suggest that absence of Cx 32 did not interfere with the normal pattern of remyelination in this model in young mice.Este estudo visou avaliar o papel da conexina 32 (Cx 32 durante a remielinização no sistema nervoso periférico. Uma injeção local de 0,1% de solução de brometo de etídio foi realizada no nervo ciático de camundongos deletados para a Cx 32, com eutanásia dos animais aos 1, 2, 3, 7, 15, 21 e 30 dias pós-injeção. Avaliações histoquímicas, imunoistoquímicas, por imunofluorescência e por microscopia eletrônica de transmissão foram utilizadas na análise do desenvolvimento das lesões. Nos nervos ciáticos, células de Schwann mostraram inicialmente sinais de intoxicação e rejeitaram suas bainhas. Após sete dias, observaram-se finas bainhas neoformadas, com compactação desigual e alças redundantes (tomácula. Conclui-se que a regeneração de bainhas de mielina perdidas no SNP seguiu o padrão já relatado deste modelo em outras espécies de laboratório. Portanto, estes resultados sugerem que a ausência da Cx 32 n
Silicon for ultra-low-level detectors and sup 32 Si
Energy Technology Data Exchange (ETDEWEB)
Plaga, R. (Max Planck Inst. fuer Kernphysik, Heidelberg (Germany))
1991-11-15
A recent dark matter experiment using a silicon diode detector confirms that the decay of {sup 32}Si is a dangerous background in ultra-low-level experiments using silicon as detector material or shielding. In this Letter we study the mechanism of how {sup 32}Si enters commercially available silicon. Ways to avoid this contamination are pointed out. Limits on the {sup 32}Si content of silicon from measurements with miniaturized low-level proportional counters are also given. (orig.).
36 CFR 1201.32 - What are NARA's procedures for salary offset?
2010-07-01
... for salary offset? 1201.32 Section 1201.32 Parks, Forests, and Public Property NATIONAL ARCHIVES AND RECORDS ADMINISTRATION GENERAL RULES COLLECTION OF CLAIMS Salary Offset § 1201.32 What are NARA's procedures for salary offset? (a) NARA will coordinate salary deductions under this subpart as appropriate...
32 CFR 2400.34 - Classification.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Classification. 2400.34 Section 2400.34 National... Government Information § 2400.34 Classification. (a) Foreign government information classified by a foreign government or international organization of governments shall retain its original classification designation...
2010-07-01
... Administration DEPARTMENT OF JUSTICE PUBLIC SAFETY OFFICERS' DEATH, DISABILITY, AND EDUCATIONAL ASSISTANCE BENEFIT CLAIMS Educational Assistance Benefit Claims § 32.33 Definitions. Application means claim (i.e., a...) In the relevant tax year (with respect to a claim by virtue of the officer's disability). Educational...
Designing embedded systems with 32-bit PIC microcontrollers and MikroC
Ibrahim, Dogan
2013-01-01
The new generation of 32-bit PIC microcontrollers can be used to solve the increasingly complex embedded system design challenges faced by engineers today. This book teaches the basics of 32-bit C programming, including an introduction to the PIC 32-bit C compiler. It includes a full description of the architecture of 32-bit PICs and their applications, along with coverage of the relevant development and debugging tools. Through a series of fully realized example projects, Dogan Ibrahim demonstrates how engineers can harness the power of this new technology to optimize their embedded design
2010-07-01
... Guidelines for Temporary Access § 147.32 Temporary eligibility for access at the top secret and SCI levels... 32 National Defense 1 2010-07-01 2010-07-01 false Temporary eligibility for access at the top secret and SCI levels and temporary eligibility for âQâ access authorization: For someone who is not the...
Genome-wide dynamics of a bacterial response to antibiotics that target the cell envelope
Directory of Open Access Journals (Sweden)
Tran Ngat
2011-05-01
Full Text Available Abstract Background A decline in the discovery of new antibacterial drugs, coupled with a persistent rise in the occurrence of drug-resistant bacteria, has highlighted antibiotics as a diminishing resource. The future development of new drugs with novel antibacterial activities requires a detailed understanding of adaptive responses to existing compounds. This study uses Streptomyces coelicolor A3(2 as a model system to determine the genome-wide transcriptional response following exposure to three antibiotics (vancomycin, moenomycin A and bacitracin that target distinct stages of cell wall biosynthesis. Results A generalised response to all three antibiotics was identified which involves activation of transcription of the cell envelope stress sigma factor σE, together with elements of the stringent response, and of the heat, osmotic and oxidative stress regulons. Attenuation of this system by deletion of genes encoding the osmotic stress sigma factor σB or the ppGpp synthetase RelA reduced resistance to both vancomycin and bacitracin. Many antibiotic-specific transcriptional changes were identified, representing cellular processes potentially important for tolerance to each antibiotic. Sensitivity studies using mutants constructed on the basis of the transcriptome profiling confirmed a role for several such genes in antibiotic resistance, validating the usefulness of the approach. Conclusions Antibiotic inhibition of bacterial cell wall biosynthesis induces both common and compound-specific transcriptional responses. Both can be exploited to increase antibiotic susceptibility. Regulatory networks known to govern responses to environmental and nutritional stresses are also at the core of the common antibiotic response, and likely help cells survive until any specific resistance mechanisms are fully functional.
32 CFR 776.23 - Communication.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Communication. 776.23 Section 776.23 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY MISCELLANEOUS RULES PROFESSIONAL CONDUCT... Professional Conduct § 776.23 Communication. (a) Communication: (1) A covered attorney shall keep a client...
32 CFR Appendix A to Part 45 - DD Form 214
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 214 A Appendix A to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. A Appendix A to Part 45—DD Form 214 EC23OC91.003 EC23OC91.004 EC23OC91.005 EC23OC91.006 [54 FR 9985, Mar. 9, 1989] ...
Cossu, Fabrizio
2014-07-28
By first-principles calculations we investigate the structural, electronic, and magnetic properties of the (LaMnO3)2/(SrTiO3)2 superlattice. We find that a monoclinic C2h symmetry is energetically favorable and that the spins order ferromagnetically. Under both compressive and tensile uniaxial strain the electronic structure of the superlattice shows a half-metallic character. In particular, a fully spin-polarized two-dimensional electron gas, which traces back to the Ti 3dxy orbitals, is achieved under compressive uniaxial strain. The (LaMnO3)2/(SrTiO3)2 superlattice is analysed with respect to its structure, magnetism, and electronic properties. Our results demonstrate that uniaxial strain in an experimentally accessible range, both tensile and compressive, can be used to induce half-metallicity. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
7 CFR 1700.32 - Program Accounting and Regulatory Analysis.
2010-01-01
... Administrator with respect to management, information systems, budgets, and other such matters. (a) The... 7 Agriculture 11 2010-01-01 2010-01-01 false Program Accounting and Regulatory Analysis. 1700.32... SERVICE, DEPARTMENT OF AGRICULTURE GENERAL INFORMATION Agency Organization and Functions § 1700.32 Program...
47 CFR 32.2003 - Telecommunications plant under construction.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Telecommunications plant under construction. 32.2003 Section 32.2003 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet...
47 CFR 32.4550 - Retained earnings.
2010-10-01
... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.4550 Retained earnings. (a) This account shall include the undistributed balance of retained earnings derived from the...
International Nuclear Information System (INIS)
Xu Shanghua; Jiang Hong; Li Gengshan; Jiang Xuejun; Li Xiaoyan; Chen Yuanxiu; Wang Hairong; Wu Kegui; Nie Xiaomin
2004-01-01
Objective: To assesses the efficiency of 32 P and diallyl trisulfide (DT)-coated coronary stents on neointimal proliferation in a canine model of restenosis. Methods: 32 P (740 kBq/stent), DT (210 μg/stent) alone and jointly coated stents were deployed with mild oversizing in both the left circumflex coronary artery (LCX) and the left anterior descending coronary artery (LAD) of 10 dogs. The implantation of protein-coated stents was used as the control. The therapeutic effect was assessed 6 months after the intervention. The dogs were sacrificed and the vessels were excised. For morphologic examinations the tissue sections were stained with HE and Van Gieson. Results: Compared with the control stents, the neointimal area reduced in stents coated with 32 P, DT alone and 32 P+DT [ 32 P: (2.63±0.48) mm 2 , DT: (2.50±0.49) mm 2 , 32 P+DT: (1.42±0.41) mm 2 vs control group: (4.87±0. 80) mm 2 , P=0.001]. 32 P+DT was more effective than either of them alone for reducing the neointimal area (P≤0.005). Both jointly and alone coated stents of 32 P, DT decreased the percent area stenosis [ 32 P: (32.48±4.79)%, DT: (30.04±5.43)%, 32 P+DT: (17.21±4.05)% vs control group: (54.62±6.82)%, P 32 P+DT group compared with 32 P or DT-coated stents group (P≤0.001). Angiographic restenosis (diameter stenosis) was lighter in stents coated with 32 P, DT and 32 P+DT compared with control stents (P 32 P+DT was more effective than 32 P or DT alone for reducing diameter stenosis (P≤0.005). No evidence of 'edge effect' was seen in adjacent, nonstented coronary segments. Conclusion: Coronary stents coated with 32 P plus DT produced a significantly reduced neointimal hyperplasia and restenosis rate in the canine LCX and LAD 6 months after stents implantation
Intraperitoneal P-32 for adjuvant and consolidative therapy in ovarian carcinoma
International Nuclear Information System (INIS)
Condra, Kellie S.; Mendenhall, William M.; Morgan, Linda S.; Freeman, Debra E.; Marcus, Robert B.; Hagan, Michael P.
1996-01-01
Purpose/Objective: To determine the role of intraperitoneal radioactive chromic phosphate (P-32) in the treatment of patients with ovarian carcinoma. Survival results, patterns of recurrence, and treatment morbidity are reported for patients treated adjuvantly after primary surgery and for patients treated with the intent of consolidation after second-look laparotomy. Materials and Methods: Between 1976 and 1993, 25 patients with ovarian carcinoma were treated with 15 mCi P-32 as adjuvant therapy and 43 patients received P-32 as consolidation after second-look laparotomy. The majority of patients (13 of 19) treated adjuvantly had high-risk early-stage disease (IAG 3, IBG 2-3, IC) or more advanced stages (6 patients). Thirty-nine patients received consolidative P-32 after negative second-look laparotomy (35 Stage II-IV and 4 Stage I) and 4 Stage III patients were treated after positive second-look laparotomy. All patients had 2-year minimum follow-up (median, 7.9 years). Results: Ten-year abdominal control and cause-specific survival rates for adjuvant P-32 were 83% and 82%, respectively. For patients treated with consolidative P-32, 5-year abdominal control and cause-specific survival rates were 65% and 78%, respectively. The 5-year cause-specific survival rate for 35 patients with Stage II-IV disease treated with consolidative P-32 after negative second-look laparotomy was 81%. A component of peritoneal failure was the primary mode of recurrence (15 of 22 failures). Four patients required surgical intervention for small-bowel obstruction. No patients died of treatment-related complications. Conclusion: P-32 is well tolerated with acceptable toxicity. In comparing our results to the literature, adjuvant P-32 appears to offer improved cause-specific survival compared with observation alone and equivalent cause-specific survival compared with adjuvant chemotherapy. Consolidative P-32 after negative second-look laparotomy resulted in improved 5-year cause
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Competence. 776.20 Section 776.20 National... Professional Conduct § 776.20 Competence. (a) Competence. A covered attorney shall provide competent, diligent.... Initial determinations as to competence of a covered USG attorney for a particular assignment shall be...
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...
Naturally occurring 32 Si and low-background silicon dark matter detectors
Energy Technology Data Exchange (ETDEWEB)
Orrell, John L.; Arnquist, Isaac J.; Bliss, Mary; Bunker, Raymond; Finch, Zachary S.
2018-05-01
The naturally occurring radioisotope Si-32 represents a potentially limiting background in future dark matter direct-detection experiments. We investigate sources of Si-32 and the vectors by which it comes to reside in silicon crystals used for fabrication of radiation detectors. We infer that the Si-32 concentration in commercial single-crystal silicon is likely variable, dependent upon the specific geologic and hydrologic history of the source (or sources) of silicon “ore” and the details of the silicon-refinement process. The silicon production industry is large, highly segmented by refining step, and multifaceted in terms of final product type, from which we conclude that production of Si-32-mitigated crystals requires both targeted silicon material selection and a dedicated refinement-through-crystal-production process. We review options for source material selection, including quartz from an underground source and silicon isotopically reduced in Si-32. To quantitatively evaluate the Si-32 content in silicon metal and precursor materials, we propose analytic methods employing chemical processing and radiometric measurements. Ultimately, it appears feasible to produce silicon-based detectors with low levels of Si-32, though significant assay method development is required to validate this claim and thereby enable a quality assurance program during an actual controlled silicon-detector production cycle.
Naturally occurring 32Si and low-background silicon dark matter detectors
Orrell, John L.; Arnquist, Isaac J.; Bliss, Mary; Bunker, Raymond; Finch, Zachary S.
2018-05-01
The naturally occurring radioisotope 32Si represents a potentially limiting background in future dark matter direct-detection experiments. We investigate sources of 32Si and the vectors by which it comes to reside in silicon crystals used for fabrication of radiation detectors. We infer that the 32Si concentration in commercial single-crystal silicon is likely variable, dependent upon the specific geologic and hydrologic history of the source (or sources) of silicon "ore" and the details of the silicon-refinement process. The silicon production industry is large, highly segmented by refining step, and multifaceted in terms of final product type, from which we conclude that production of 32Si-mitigated crystals requires both targeted silicon material selection and a dedicated refinement-through-crystal-production process. We review options for source material selection, including quartz from an underground source and silicon isotopically reduced in 32Si. To quantitatively evaluate the 32Si content in silicon metal and precursor materials, we propose analytic methods employing chemical processing and radiometric measurements. Ultimately, it appears feasible to produce silicon detectors with low levels of 32Si, though significant assay method development is required to validate this claim and thereby enable a quality assurance program during an actual controlled silicon-detector production cycle.
Observation of the new isomer 32mAl
International Nuclear Information System (INIS)
Robinson, M.; Halse, P.; Lewitowicz, M.; Saint-Laurent, M.G.
1995-01-01
A new isomer in the neutron-rich isotope 32 Al has been identified among the fragmentation products of a 40 Ar 16+ beam using the LISE spectrometer at GANIL. The population of the isomeric state was inferred from the detection of γ-radiation following its decay in coincidence with its respective heavy-ion implantation signal. The half-life of 32m Al was determined to be 240 ± 30 ns. (author)
Michiue, Yuichi; Kimizuka, Noboru; Kanke, Yasushi; Mori, Takao
2012-06-01
The structure of (Ga(2)O(3))(2)(ZnO)(13) has been determined by a single-crystal X-ray diffraction technique. In the monoclinic structure of the space group C2/m with cell parameters a = 19.66 (4), b = 3.2487 (5), c = 27.31 (2) Å, and β = 105.9 (1)°, a unit cell is constructed by combining the halves of the unit cell of Ga(2)O(3)(ZnO)(6) and Ga(2)O(3)(ZnO)(7) in the homologous series Ga(2)O(3)(ZnO)(m). The homologous series (Ga(2)O(3))(2)(ZnO)(2n + 1) is derived and a unified description for structures in the series is presented using the (3+1)-dimensional superspace formalism. The phases are treated as compositely modulated structures consisting of two subsystems. One is constructed by metal ions and another is by O ions. In the (3 + 1)-dimensional model, displacive modulations of ions are described by the asymmetric zigzag function with large amplitudes, which was replaced by a combination of the sawtooth function in refinements. Similarities and differences between the two homologous series (Ga(2)O(3))(2)(ZnO)(2n + 1) and Ga(2)O(3)(ZnO)(m) are clarified in (3 + 1)-dimensional superspace. The validity of the (3 + 1)-dimensional model is confirmed by the refinements of (Ga(2)O(3))(2)(ZnO)(13), while a few complex phenomena in the real structure are taken into account by modifying the model.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Diligence. 776.22 Section 776.22 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY MISCELLANEOUS RULES PROFESSIONAL CONDUCT... Professional Conduct § 776.22 Diligence. (a) Diligence. A covered attorney shall act with reasonable diligence...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Organization. 298.2 Section 298.2 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) FREEDOM OF... Organization. (a) The DIS organization includes a Headquarters located in Alexandria, Virginia; four Regions...
`elyon as hypostasis of Ahura Mazda – a reading of Dt 32.8-9
Directory of Open Access Journals (Sweden)
Osvaldo Luiz Ribeiro
2016-12-01
Full Text Available The paper postulates the hypothesis of reading of Dt 32.8-9 as monolatrous and post-exilic narrative, written in context of political and cultural subordination to the Persian hegemony, whose Empire depends relentlessly on the restoration and preservation of Judah. Dt 32,1-43 would answer for the sui generis characterization of the theology of the text that, despite the monolatrous theology embodied in the passage and the expressed horror at the idea of the nation of Yahweh to worship other gods. The textual composition is compelled to assume the thesis that Yahweh's exclusive ownership of Judahis due to the determination of `elyôn, which is then interpreted, as the hypostasis of Ahura Mazda and that, in geopolitical terms, embodies the very Persian Empire. It is assumed therefore that Dt 32.8-9 is a political-theological passage of legitimation of Judahite political-theological system in the light of the Persian geopolitical system.
Standardization of {sup 32}P radioactive solution
Energy Technology Data Exchange (ETDEWEB)
Marques, Caio Pinheiros; Koskinas, Marina Fallone; Almeida, Jamille da Silveira; Yamazaki, Ione M.; Dias, Mauro da Silva, E-mail: cpmarques@usp.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2016-07-01
The standardization of {sup 32}P radioactive solution using three different methods is presented. The disintegration rate was determined by the CIEMAT/NIST and TDCR methods in liquid scintillator systems and self-absorption extrapolation method using 4π(PC)-β system. The results obtained for the activity of the {sup 32}P solution were compared and they agree within the experimental uncertainties. (author)
CD-ROM storing JENDL-3.2 plots and data
Energy Technology Data Exchange (ETDEWEB)
Fukahori, Tokio; Iwamoto, Osamu; Nakagawa, Tsuneo; Shibata, Keiichi; Narita, Tsutomu; Katakura, Jun-ichi; Hasegawa, Akira [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-01-01
Numerical data and graphs of Japanese Evaluated Nuclear Data Library, Version 3, Revision 2 (JENDL-3.2) have been stored into CD-ROM. JENDL-3.2 is an evaluated nuclear data library which is highly rated in the world, and consists of neutron nuclear data and secondary gamma-ray data for 340 nuclides. JENDL-3.2 has been already released through World Wide Web (WWW, http://cracker.tokai.jaeri.go.jp). For users` convenience and to promote further utilization, this CD-ROM has been produced. The data stored in CD-ROM are the original data and point-wise data (0 K and 300 K) of JENDL-3.2 and graphs of cross sections in gif, PostScript and PDF formats. These data can be retrieved by users` personal computers and engineering workstations, and also can be seen by using WWW browsers. This CD-ROM makes user completely free from downloading, which takes a lot of time, and tedious management such a treating big amount of data. (author)
ALMA Detects CO(3-2) within a Super Star Cluster in NGC 5253
Turner, Jean L.; Consiglio, S. Michelle; Beck, Sara C.; Goss, W. M.; Ho, Paul. T. P.; Meier, David S.; Silich, Sergiy; Zhao, Jun-Hui
2017-09-01
We present observations of CO(3-2) and 13CO(3-2) emission near the supernebula in the dwarf galaxy NGC 5253, which contains one of the best examples of a potential globular cluster in formation. The 0.″3 resolution images reveal an unusual molecular cloud, “Cloud D1,” that is coincident with the radio-infrared supernebula. The ˜6 pc diameter cloud has a linewidth, Δ v = 21.7 {km} {{{s}}}-1, that reflects only the gravitational potential of the star cluster residing within it. The corresponding virial mass is 2.5 × 105 {M}⊙ . The cluster appears to have a top-heavy initial mass function, with M * ≳ 1-2 {M}⊙ . Cloud D1 is optically thin in CO(3-2), probably because the gas is hot. Molecular gas mass is very uncertain but constitutes <35% of the dynamical mass within the cloud boundaries. In spite of the presence of an estimated ˜1500-2000 O stars within the small cloud, the CO appears relatively undisturbed. We propose that Cloud D1 consists of molecular clumps or cores, possibly star-forming, orbiting with more evolved stars in the core of the giant cluster.
45 CFR 233.32 - Payment and budget months (AFDC).
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Payment and budget months (AFDC). 233.32 Section... CONDITIONS OF ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.32 Payment and budget months (AFDC). A State... period used to determine that payment (budget month) and whether it adopts (a) a one-month or two-month...
The case for selection at CCR5-Delta32.
Directory of Open Access Journals (Sweden)
2005-11-01
Full Text Available The C-C chemokine receptor 5, 32 base-pair deletion (CCR5-Delta32 allele confers strong resistance to infection by the AIDS virus HIV. Previous studies have suggested that CCR5-Delta32 arose within the past 1,000 y and rose to its present high frequency (5%-14% in Europe as a result of strong positive selection, perhaps by such selective agents as the bubonic plague or smallpox during the Middle Ages. This hypothesis was based on several lines of evidence, including the absence of the allele outside of Europe and long-range linkage disequilibrium at the locus. We reevaluated this evidence with the benefit of much denser genetic maps and extensive control data. We find that the pattern of genetic variation at CCR5-Delta32 does not stand out as exceptional relative to other loci across the genome. Moreover using newer genetic maps, we estimated that the CCR5-Delta32 allele is likely to have arisen more than 5,000 y ago. While such results can not rule out the possibility that some selection may have occurred at C-C chemokine receptor 5 (CCR5, they imply that the pattern of genetic variation seen atCCR5-Delta32 is consistent with neutral evolution. More broadly, the results have general implications for the design of future studies to detect the signs of positive selection in the human genome.
The case for selection at CCR5-Delta32.
Directory of Open Access Journals (Sweden)
Pardis C Sabeti
2005-11-01
Full Text Available The C-C chemokine receptor 5, 32 base-pair deletion (CCR5-Delta32 allele confers strong resistance to infection by the AIDS virus HIV. Previous studies have suggested that CCR5-Delta32 arose within the past 1,000 y and rose to its present high frequency (5%-14% in Europe as a result of strong positive selection, perhaps by such selective agents as the bubonic plague or smallpox during the Middle Ages. This hypothesis was based on several lines of evidence, including the absence of the allele outside of Europe and long-range linkage disequilibrium at the locus. We reevaluated this evidence with the benefit of much denser genetic maps and extensive control data. We find that the pattern of genetic variation at CCR5-Delta32 does not stand out as exceptional relative to other loci across the genome. Moreover using newer genetic maps, we estimated that the CCR5-Delta32 allele is likely to have arisen more than 5,000 y ago. While such results can not rule out the possibility that some selection may have occurred at C-C chemokine receptor 5 (CCR5, they imply that the pattern of genetic variation seen at CCR5-Delta32 is consistent with neutral evolution. More broadly, the results have general implications for the design of future studies to detect the signs of positive selection in the human genome.
32 CFR 842.121 - Referring a claim to the US Attorney.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Referring a claim to the US Attorney. 842.121 Section 842.121 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE CLAIMS AND... to the US Attorney. Only HQ USAF/JACC authorizes referral of a claim to the US Attorney. The base SJA...
DEFF Research Database (Denmark)
Iversen, Astrid K N; Christiansen, Claus Bohn; Attermann, Jørn
2003-01-01
The relationship among CCR5 genotype, cytomegalovirus infection, and disease progression and death was studied among 159 human immunodeficiency virus (HIV)-infected patients with hemophilia. One patient (0.6%) had the CCR5Delta32/CCR5Delta32 genotype (which occurs in approximately 2% of the Scand......The relationship among CCR5 genotype, cytomegalovirus infection, and disease progression and death was studied among 159 human immunodeficiency virus (HIV)-infected patients with hemophilia. One patient (0.6%) had the CCR5Delta32/CCR5Delta32 genotype (which occurs in approximately 2...
2010-07-01
... awarding agency. (d) Management requirements. Procedures for managing equipment (including replacement... return. (e) Disposition. When original or replacement equipment acquired under a grant or subgrant is no... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Equipment. 43.32 Section...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Relationships. 395.5 Section 395.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) ORGANIZATIONAL CHARTERS DEFENSE LEGAL SERVICES AGENCY § 395.5 Relationships. (a) In performance of assigned...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Advertising. 196.540 Section 196.540 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...
Reactor production and separation of no-carrier added 32P for medical applications
International Nuclear Information System (INIS)
Vimalnath, K.V.; Shetty, P.; Rajeswari, A.; Chirayil, V.; Chakraborty, S.; Dash, A.
2014-01-01
Phosphorous-32 is an attractive and widely used therapeutic radionuclide owing to its favorable nuclear characteristics. The major application of 32 P is the treatment option for a distinct subgroup of elderly patients with polycythemia vera and leukemia. The tremendous prospects associated with the use of 32 P along with the challenge of providing 32 P of acceptable specific activity and purity amenable for in vivo therapy, led to development of a 32 P production strategy. The 32 S(n,p) 32 P route of production provide the scope of obtaining high specific activities or no carrier added (NCA) 32 P. In a typical batch of 14 nos. of neutron irradiated Al containers, each containing 18 g of sulphur, were processed. In the quest for an effective separation method to isolate micro gram of 32 P formed during the neutron irradiation of sulphur, the prospect of using distillation under reduced pressure to achieve complete removal of sulfur seemed to be an effective proposition and motivated us to adopt. The experimental parameters that influence the distillation were identified and a careful control has been exercised to ensure complete removal of sulphur from 32 P within reasonable time period. The 32 P remained in the distillation flask was quantitatively collected by leaching with 0.05 N HCl with gentle heating at 80℃ for 3 hours. In the light of the perceived need to remove cationic impurities from the 32 P leachate, it was passed through an ion-exchange chromatography column containing a cation exchange resin (Dowex 50 x 8 H + , 100-200 mesh) wherein all the cationic impurities get trapped and H 3 32 PO 4 solution was collected as effluent. Recognizing the fact that H 3 32 PO 4 produced is to be used for clinical applications, a thorough quality assessment was carried out. Radionuclidic purity was ascertained by a measurement of its half-life. In order to establish the absence of extraneous gamma emitting radionuclide impurities, gamma spectrum of the appropriately