Measuring Dilution and Wear for Laser Cladding of Stellite 6 Produced on a P91 Steel Substrate using Two Different Heat Inputs

Directory of Open Access Journals (Sweden)

Kusmoko Alain

2016-01-01

Full Text Available Stellite 6 was deposited by laser cladding on a P91 substrate with energy inputs of 1 kW (P91-1 and 1.8 kW (P91–1.8. The chemical compositions, microstructures and surface roughnesses of these coatings were characterized by atomic absorption spectroscopy, scanning electron microscopy and atomic force microscopy. The microhardness of the coatings was measured and the wear mechanism of the coatings was evaluated using a pin-on-plate (reciprocating wear testing machine. The results showed less cracking and pore development for Stellite 6 coatings applied to the P91 steel substrate with the lower heat input (P91–1. Further, the Stellite coating for P91-1 was significantly harder than that obtained for P91–1.8. The wear test results indicated that the weight loss for P91–1 was much lower than for P91–1.8. The surface topography data indicated that the surface roughness for P91-1 was much lower than for P91–1.8. The measurements of dilution and carbon content showed that P91–1 has lower dilution and higher concentration of carbon than P91–1.8. It is concluded that the lower hardness of the coating for P91–1.8, together with the softer underlying substrate structure, markedly reduced the wear resistance of the Stellite 6 coating and the lower hardness of the coating for P91-1.8 was due to higher level of dilution and lower concentration of carbon.

Cavitation Erosion of Electro Spark Deposited Nitinol vs. Stellite Alloy on Stainless Steel Substrate

Science.gov (United States)

2015-07-15

lower proportion of carbon. The lower carbon content of SS-316L allows lower carbide precipitation for welding . Online Metals SS-2205 Duplex ...erosion, per ASTM G32. As a comparison, a known erosion-resistant, weld -friendly alloy called Stellite 6® was ESD’d and its cavitation erosion resistance...Microscopy was conducted to examine the metallurgical bond established by the ESD process. As a comparison, a known erosion resistant, weld

Critical size of defaults inducing fast fracture of deposit stellite on a valve gate

International Nuclear Information System (INIS)

Boneh, B.; Gilles, P.; Champomier, F.; Abisror, A.

1986-10-01

The present study has been made to determine if, in the case of a valve gate, transversal cracks are the result of fatigue propagation or the result of fast fracture. The author shows that only a transversal crack, with a size up to 0.7 mm, induces a fast fracture and shows also that, at equal size, a crack located under the stellite is not also injurious than a transversal crack [fr

Microstructure and sliding wear properties of HVOF sprayed, laser remelted and laser clad Stellite 6 coatings

Czech Academy of Sciences Publication Activity Database

Houdková, Š.; Pala, Zdeněk; Smazalová, E.; Vostřák, M.; Česánek, Z.

2017-01-01

Roč. 318, May (2017), s. 129-141 ISSN 0257-8972. [International Meeting on Thermal Spraying (RIPT)/7./. Limoges, 09.12.2015-11.12.2015] Institutional support: RVO:61389021 Keywords : Stellite 6 * HVOF * Laser remelting * Laser clad * Wear * Phase transformation Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Coating and films Impact factor: 2.589, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0257897216308817

Laser Clad and HVOF-Sprayed Stellite 6 Coating in Chlorine-Rich Environment with KCl at 700 °C.

Czech Academy of Sciences Publication Activity Database

Pala, Z.; Bai, M.; Lukáč, František; Hussain, T.

2017-01-01

Roč. 88, 5-6 (2017), s. 749-771 ISSN 0030-770X Institutional support: RVO:61389021 Keywords : Stellite 6 * KCl * High-temperature corrosion * HVOF * Laser cladding Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Coating and films Impact factor: 1.196, year: 2016 https://link.springer.com/article/10.1007/s11085-017-9776-7

Estimation of the Thickness and the Material Combination of the Thermal Stress Control Layer (TSCL) for the Stellite21 Hardfaced STD61 Hot Working Tool Steel Using Three-Dimensional Finite Element Analysis

International Nuclear Information System (INIS)

Park, Na-Ra; Ahn, Dong-Gyu; Oh, Jin-Woo

2014-01-01

The research on a thermal stress control layer (TSCL) begins to undertake to reduce residual stress and strain in the vicinity of the joined region between the hardfacing layer and the base part. The goal of this paper is to estimate the material combination and the thickness of TSCL for the Stellite21 hardfaced STD61 hot working tool steel via three-dimensional finite element analysis (FEA). TSCL is created by the combination of Stellite21 and STD61. The thickness of TSCL ranges from 0.5 mm to 1.5 mm. The influence of the material combination and the thickness of TSCL on temperature, thermal stress and thermal strain distributions of the hardfaced part have been investigated. The results of the investigation have been revealed that a proper material combination of TSCL is Stellite21 of 50 % and STD61 of 50 %, and its appropriate thickness is 1.0 mm

Level structures in 156Pm from 156Nd β - decay

International Nuclear Information System (INIS)

Sood, P.C.; Gowrishankar, R.; Sainath, M.; Singh, B.

2012-01-01

Level energies in two-quasiparticle (2qp) structures in 156 61 Pm 95 are evaluated using the phenomenological rotor-particle model for odd-odd deformed nuclei with the inclusion of the residual p-n interaction contribution. Using these results as location guides, the experimental data from a recent 156 Nd decay study are used to construct a level scheme for 156 Pm with excitation energies upto 550 keV, wherein 26 (out of 30) γ's reported in 156 Nd decay are incorporated. Spin-parities and configuration assignments are suggested for 15 levels, in addition to the two isomers, in this energy domain. These investigations point to the need for information on higher-energy γ's and on β-γ and γ-γ coincidence data from 156 Nd β-decay to confirm these assignments. (orig.)

9 CFR 156.2 - Definitions.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Definitions. 156.2 Section 156.2 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VOLUNTARY INSPECTION AND CERTIFICATION SERVICE VOLUNTARY INSPECTION AND CERTIFICATION SERVICE § 156.2...

Arabidopsis mutant sk156 reveals complex regulation of SPL15 in a miR156-controlled gene network.

Science.gov (United States)

Wei, Shu; Gruber, Margaret Y; Yu, Bianyun; Gao, Ming-Jun; Khachatourians, George G; Hegedus, Dwayne D; Parkin, Isobel A P; Hannoufa, Abdelali

2012-09-18

The Arabidopsis microRNA156 (miR156) regulates 11 members of the SQUAMOSA PROMOTER BINDING PROTEIN LIKE (SPL) family by base pairing to complementary target mRNAs. Each SPL gene further regulates a set of other genes; thus, miR156 controls numerous genes through a complex gene regulation network. Increased axillary branching occurs in transgenic Arabidopsis overexpressing miR156b, similar to that observed in loss-of-function max3 and max4 mutants with lesions in carotenoid cleavage dioxygenases. Arabidopsis miR156b was found to enhance carotenoid levels and reproductive shoot branching when expressed in Brassica napus, suggesting a link between miR156b expression and carotenoid metabolism. However, details of the miR156 regulatory network of SPL genes related to carotenoid metabolism are not known. In this study, an Arabidopsis T-DNA enhancer mutant, sk156, was identified due to its altered branching and trichome morphology and increased seed carotenoid levels compared to wild type (WT) ecovar Columbia. Enhanced miR156b expression due to the 35S enhancers present on the T-DNA insert was responsible for these phenotypes. Constitutive and leaf primodium-specific expression of a miR156-insensitive (mutated) SPL15 (SPL15m) largely restored WT seed carotenoid levels and plant morphology when expressed in sk156. The Arabidopsis native miR156-sensitive SPL15 (SPL15n) and SPL15m driven by a native SPL15 promoter did not restore the WT phenotype in sk156. Our findings suggest that SPL15 function is somewhat redundant with other SPL family members, which collectively affect plant phenotypes. Moreover, substantially decreased miR156b transcript levels in sk156 expressing SPL15m, together with the presence of multiple repeats of SPL-binding GTAC core sequence close to the miR156b transcription start site, suggested feedback regulation of miR156b expression by SPL15. This was supported by the demonstration of specific in vitro interaction between DNA-binding SBP domain of SPL15

Arabidopsis mutant sk156 reveals complex regulation of SPL15 in a miR156-controlled gene network

Directory of Open Access Journals (Sweden)

Wei Shu

2012-09-01

Full Text Available Abstract Background The Arabidopsis microRNA156 (miR156 regulates 11 members of the SQUAMOSA PROMOTER BINDING PROTEIN LIKE (SPL family by base pairing to complementary target mRNAs. Each SPL gene further regulates a set of other genes; thus, miR156 controls numerous genes through a complex gene regulation network. Increased axillary branching occurs in transgenic Arabidopsis overexpressing miR156b, similar to that observed in loss-of-function max3 and max4 mutants with lesions in carotenoid cleavage dioxygenases. Arabidopsis miR156b was found to enhance carotenoid levels and reproductive shoot branching when expressed in Brassica napus, suggesting a link between miR156b expression and carotenoid metabolism. However, details of the miR156 regulatory network of SPL genes related to carotenoid metabolism are not known. Results In this study, an Arabidopsis T-DNA enhancer mutant, sk156, was identified due to its altered branching and trichome morphology and increased seed carotenoid levels compared to wild type (WT ecovar Columbia. Enhanced miR156b expression due to the 35S enhancers present on the T-DNA insert was responsible for these phenotypes. Constitutive and leaf primodium-specific expression of a miR156-insensitive (mutated SPL15 (SPL15m largely restored WT seed carotenoid levels and plant morphology when expressed in sk156. The Arabidopsis native miR156-sensitive SPL15 (SPL15n and SPL15m driven by a native SPL15 promoter did not restore the WT phenotype in sk156. Our findings suggest that SPL15 function is somewhat redundant with other SPL family members, which collectively affect plant phenotypes. Moreover, substantially decreased miR156b transcript levels in sk156 expressing SPL15m, together with the presence of multiple repeats of SPL-binding GTAC core sequence close to the miR156b transcription start site, suggested feedback regulation of miR156b expression by SPL15. This was supported by the demonstration of specific in vitro

20 CFR 655.156 - Recruitment report.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Recruitment report. 655.156 Section 655.156... FOREIGN WORKERS IN THE UNITED STATES Labor Certification Process for Temporary Agricultural Employment in the United States (H-2A Workers) Post-Acceptance Requirements § 655.156 Recruitment report. (a...

40 CFR 156.64 - Signal word.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Signal word. 156.64 Section 156.64... REQUIREMENTS FOR PESTICIDES AND DEVICES Human Hazard and Precautionary Statements § 156.64 Signal word. (a... signal word, reflecting the highest Toxicity Category (Category I is the highest toxicity category) to...

Dicty_cDB: AFK156 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFK156 (Link to dictyBase) - - - - AFK156P (Link to Original s...ite) AFK156F 599 AFK156Z 448 AFK156P 1047 - - Show AFK156 Library AF (Link to library) Clone ID AFK156 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t...4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... tolerance against environmental stress. 92 7e-24 3 AY342298 |AY342298.1 Ictaluru

9 CFR 156.6 - Certificates.

Science.gov (United States)

2010-01-01

... products, if the inspector finds that the requirements as stated in the certification have been met. The... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Certificates. 156.6 Section 156.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

9 CFR 156.1 - Meaning of words.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Meaning of words. 156.1 Section 156.1 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VOLUNTARY INSPECTION AND CERTIFICATION SERVICE VOLUNTARY INSPECTION AND CERTIFICATION SERVICE § 156.1...

27 CFR 28.156 - Losses.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses. 28.156 Section 28... Exportation or Transfer to a Foreign-Trade Zone § 28.156 Losses. Where there has been a loss of specially... or a foreign-trade zone, the exporter shall file claim for allowance of the loss in accordance with...

Multiple band structure in 156Er

International Nuclear Information System (INIS)

Sunyar, A.W.; Der Mateosian, E.; Kistner, O.C.; Johnson, A.; Lumpkin, A.H.; Thieberger, P.

1976-01-01

The 142 Nd( 18 O,4n) 156 Er reaction at 90-95 MeV was used to study 156 Er high-spin states to spin 24. In addition to the background ground-state band, two well developed off-spin side bands, one of each parity, were observed. (Auth.)

21 CFR 156.145 - Tomato juice.

Science.gov (United States)

2010-04-01

...). The food is preserved by heat sterilization (canning), refrigeration, or freezing. When sealed in a... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Tomato juice. 156.145 Section 156.145 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

29 CFR 1915.156 - Foot protection.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Foot protection. 1915.156 Section 1915.156 Labor... comply with any of the following consensus standards: (i) ASTM F-2412-2005, “Standard Test Methods for... effective as protective footwear that is constructed in accordance with one of the above consensus standards...

7 CFR 1900.156 - Special handling-processing.

Science.gov (United States)

2010-01-01

... 7 Agriculture 12 2010-01-01 2010-01-01 false Special handling-processing. 1900.156 Section 1900... BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE... Assistance to Employees, Relatives, and Associates § 1900.156 Special handling—processing. (a) [Reserved] (b...

42 CFR 423.156 - Consumer satisfaction surveys.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Consumer satisfaction surveys. 423.156 Section 423.156 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Cost Control and Quality...

Metallurgical and mechanical properties of Inconel 600 and stellite; Estudio del comportamiento mecanico-metalurgico de alceacion inconel 600 y estelita

Energy Technology Data Exchange (ETDEWEB)

Cstillo, Martin; Villa, Gabriel; Vite, Manuel [Instituto Politecnico Nacional, Mexico D.F. (Mexico); Palacios, Francisco [Instituto Nacional de Investigacion Nuclear (ININ), Estado de Mexico (Mexico); Hernandez, Luis H; Urriolagoita, Guillermo [Instituto Politecnico Nacional, Mexico D.F. (Mexico)

2005-01-15

The present work studies the metallurgical and mechanical properties of two alloys, Inconel 600 and stellite, which are within the group of high hardness alloys or superalloys, which are deposited through the electrical weld process to the metallic arc with coated electrode (SMAW) and thereinafter analyzed through electron microscopy, diffractometry and abrasion, Impact and hardness test. The relationship between the microstructure and the final properties of the coating (hardness and abrasion wear resistance) was observed. [Spanish] Este trabajo presenta el estudio sobre las propiedades metalurgicas y mecanicas de dos aleaciones, inconel 600 y estelita, clasificadas dentro del grupo de aleaciones de alta dureza o superaleaciones; las cuales fueron depositadas mediante el proceso de soldadura electrica al arco metalico con electrodo revestido (SMAW) y fueron analizadas mediante microscopia electronica (SEM), difractometria pruebas de abrasion, impacto y dureza. Se observo la relacion entre la microstructura y las propiedades del recubrimiento, como son: dureza, resistencia a la abrasion, resistencia al impacto, ente otras.

Search for neutrinoless double-electron capture of 156Dy

Science.gov (United States)

Finch, S. W.; Tornow, W.

2015-12-01

Background: Multiple large collaborations are currently searching for neutrinoless double-β decay, with the ultimate goal of differentiating the Majorana-Dirac nature of the neutrino. Purpose: Investigate the feasibility of resonant neutrinoless double-electron capture, an experimental alternative to neutrinoless double-β decay. Method: Two clover germanium detectors were operated underground in coincidence to search for the de-excitation γ rays of 156Gd following the neutrinoless double-electron capture of 156Dy. 231.95 d of data were collected at the Kimballton underground research facility with a 231.57 mg enriched 156Dy sample. Results: No counts were seen above background and half-life limits are set at O (1016-1018) yr for the various decay modes of 156Dy. Conclusion: Low background spectra were efficiently collected in the search for neutrinoless double-electron capture of 156Dy, although the low natural abundance and associated lack of large quantities of enriched samples hinders the experimental reach.

9 CFR 156.3 - Kind of service; records.

Science.gov (United States)

2010-01-01

... the products intended for certification. The inspector shall keep such records of the temperatures... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Kind of service; records. 156.3 Section 156.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF...

17 CFR 230.156 - Investment company sales literature.

Science.gov (United States)

2010-04-01

... literature. 230.156 Section 230.156 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. (a) Under the federal securities laws, including section 17(a) of the Securities Act of 1933 (15... of any means or instrumentality of interstate commerce or of the mails, to use sales literature which...

27 CFR 25.156 - Determination of tax on keg beer.

Science.gov (United States)

2010-04-01

... keg beer. 25.156 Section 25.156 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Tax on Beer Determination of Tax § 25.156 Determination of tax on keg beer. (a) In determining the tax on beer removed in kegs, a barrel is regarded as a...

33 CFR 110.156 - Randall Bay, Freeport, Long Island, N.Y.

Science.gov (United States)

2010-07-01

... Island, N.Y. 110.156 Section 110.156 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.156 Randall Bay, Freeport, Long Island, N.Y. (a) The anchorage grounds. Southward of a line 312 feet south of and parallel to the south side...

10 CFR 431.156 - Energy and water conservation standards and effective dates.

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Energy and water conservation standards and effective dates. 431.156 Section 431.156 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY EFFICIENCY PROGRAM... Standards § 431.156 Energy and water conservation standards and effective dates. Each commercial clothes...

32 CFR 644.156 - Definition.

Science.gov (United States)

2010-07-01

... Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) REAL PROPERTY REAL ESTATE HANDBOOK Acquisition Acquisition of Rights-Of-Entry § 644.156 Definition. A right-of-entry is a bare...-controlled property without acquiring any estate or interest therein. The principal effect of a right-of...

Microstructure and wear behavior of stellite 6 cladding on 17-4 PH stainless steel

Energy Technology Data Exchange (ETDEWEB)

Gholipour, A. [Department of Materials Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of); Shamanian, M., E-mail: shamanian@cc.iut.ac.ir [Department of Materials Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of); Ashrafizadeh, F. [Department of Materials Engineering, Isfahan University of Technology, Isfahan 84156-83111 (Iran, Islamic Republic of)

2011-04-07

Research highlights: > The microstructure of the surface layer consisted of carbides embedded in a Co-rich solid solution with dendritic structure. Primary phases formed during the process were identified as Co(FCC) and lamellar eutectic phases (M{sub 23}C{sub 6}, M{sub 6}C, Cr{sub 7}C{sub 3}). > Microhardness profiles showed that hardness increases from interface to the coating surface. This is due to the finer size of the grains at coating surface in comparison to that at interface and also diffusion of Fe adjacent to the interface. > The delamination was suggested as the dominant mechanism of the wear. In this regard, plate-like wear debris consisted of voids and cracks. In addition, due to increase in surface temperature, Cr{sub 2}O{sub 3} oxide phase was formed during wear tests. - Abstract: This paper deals with the investigation of the microstructure and wear behavior of the stellite 6 cladding on precipitation hardening martensitic stainless steel (17-4PH) using gas tungsten arc welding (GTAW) method. 17-4 PH stainless steel is widely used in oil and gas industries. Optical metallography, scanning electron microscopy (SEM) and energy dispersive spectroscopy (EDS) were employed to study the microstructure and wear mechanisms. X-ray diffraction analysis was also used to identify phases formed in the coating. The results showed that the microstructure of the surface layer consisted of carbides embedded in a Co-rich solid solution with a dendritic structure. In addition, the dendritic growth in the coating was epitaxial. Primary phases formed during the process were Co (fcc), Co (hcp), lamellar eutectic phases, M{sub 23}C{sub 6} and Cr{sub 7}C{sub 3} type carbides. The results of the wear tests indicated that the delamination was the dominant mechanism. So, it is necessary to apply an inter-layer between the substrate and top coat.

21 CFR 133.156 - Low-moisture mozzarella and scamorza cheese.

Science.gov (United States)

2010-04-01

....156 Section 133.156 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... this section, or by any other procedure which produces a finished cheese having the same physical and... bacterial culture. One or more of the clotting enzymes specified in paragraph (b)(2) of this action is added...

29 CFR 1952.156 - Where the plan may be inspected.

Science.gov (United States)

2010-07-01

... inspected and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.156 Section 1952.156..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS North Carolina § 1952...

Levels in Gd156 excited in the decay of 5.6 d Tb156

DEFF Research Database (Denmark)

Hansen, P.Gregers; Nielsen, O.B.; Sheline, R.K.

1959-01-01

The decay of 5.6 day Tb156 has been studied by means of a six gap β-ray spectrometer, scintillation spectrometers, and coincidence techniques. Conversion electron and γ-ray coincidence measurements have been used extensively for obtaining quantitative estimates of γ-ray intensities. A description...... for transitions to a rotational band are observed. These features are discussed in terms of a probable mixing of the rotational bands....

47 CFR 80.303 - Watch on 156.800 MHz (Channel 16).

Science.gov (United States)

2010-10-01

... Section 80.303 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Safety Watch Requirements and Procedures Coast Station Safety... maintain a safety watch on the frequency 156.800 MHz except when transmitting on 156.800 MHz. (b) A coast...

9 CFR 381.156 - Poultry meat content standards for certain poultry products.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Poultry meat content standards for certain poultry products. 381.156 Section 381.156 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY...

Recent experiments at Brookhaven: level structure of N = 86 isotones 156Yb and 150Gd

International Nuclear Information System (INIS)

Sunyar, A.W.

1980-01-01

States of the N = 86 isotones 156 Yb and 150 Gd have been studied by means of the 144 Sm( 16 O,4n) 156 Yb, 113 In( 46 Ti,p2n) 156 Yb, and 124 Sn( 30 Si,4n) 150 Gd reactions. Levels have been established to spin 36 h-bar and over 12.5 MeV in excitation in 150 Gd and to beyond spin 25 h-bar in 156 Yb. The systematics of levels in the N = 86 isotones from 150 Gd to 156 Yb are described, and the near-spherical shell model description for states in this region to near spin 30 h-bar is discussed. A T/sub 1/2/ = 6 ns, 72-keV isomeric transition in 156 Yb has been discovered, and an E1 multipolarity is assigned to this transition. The spin-parity of the isomeric state is established as 11 - . 6 figures

Improved hardness of laser alloyed X12CrNiMo martensitic stainless steel

CSIR Research Space (South Africa)

Adebiyi, DI

2011-07-01

Full Text Available The improvement in hardness of X12CrNiMo martensitic stainless steel laser alloyed with 99.9% pure titanium carbide, stellite 6 and two cases of premixed ratio of titanium carbide and stellite 6 [TiC (30 wt.%)- stellite 6 (70 wt.%) and TiC (70 wt...

33 CFR 156.111 - Incorporation by reference.

Science.gov (United States)

2010-07-01

... (CONTINUED) POLLUTION OIL AND HAZARDOUS MATERIAL TRANSFER OPERATIONS Oil and Hazardous Material Transfer... follows: Oil Companies International Marine Forum (OCIMF) 15th Floor, 96 Victoria Street, London SW1E 5JW, England. Ship to Ship Transfer Guide (Petroleum), Second Edition, 1988—156.330. International Chamber of...

40 CFR 156.68 - First aid statement.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false First aid statement. 156.68 Section... aid statement. (a) Product as sold and distributed. Each product must bear a first aid statement if... with water prior to use, the label may also include a statement describing how the first aid measures...

Low-lying dipole strength in the well-deformed nucleus {sup 156}Gd

Energy Technology Data Exchange (ETDEWEB)

Tamkas, M. [ExtreMe Matter Institute (EMMI), GSI, Darmstadt (Germany); Graduate School of Natural and Applied Sciences, Yildiz Technical University, Istanbul (Turkey); Isaak, J.; Silva, J. [ExtreMe Matter Institute (EMMI), GSI, Darmstadt (Germany); Frankfurt Institute for Advanced Studies (FIAS), Frankfurt (Germany); Savran, D. [ExtreMe Matter Institute (EMMI), GSI, Darmstadt (Germany); GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Loeher, B. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Aciksoz, E. [Department of Physics, Akdeniz University (Turkey); Beck, T.; Beller, J.; Gayer, U.; Pietralla, N.; Romig, C.; Werner, V.; Zweidinger, M. [Institut fuer Kernphysik, Technische Universitaet, Darmstadt (Germany); Tornow, W.; Weller, H. [Department of Physics, Duke University, TUNL, Durham (United States); Zilges, A. [Institut fuer Kernphysik, Universitaet zu Koeln (Germany)

2016-07-01

In this study the dipole strength has been investigated in the well-deformed nucleus {sup 156}Gd using the method of Nuclear Resonance Fluorescence (NRF). The NRF experiment was performed at the High Intensity vector γ-ray Source at Duke University in combination with the γ{sup 3} setup using a mono-energetic and linearly polarised beam. The dipole strength of {sup 156}Gd has been studied with photon beam energies between 3 MeV and 6.2 MeV. The parity quantum numbers of J=1 states have been determined for the energy region above ∝3 MeV for the first time. Recent results of the {sup 156}Gd(vector γ,γ') experiment are presented and discussed.

30 CFR 206.156 - Transportation allowances-general.

Science.gov (United States)

2010-07-01

... any sales type code be reduced to zero. (d) If, after a review or audit, MMS determines that a lessee... MANAGEMENT PRODUCT VALUATION Federal Gas § 206.156 Transportation allowances—general. (a) Where the value of gas has been determined pursuant to § 206.152 or § 206.153 of this subpart at a point (e.g., sales...

Recubrimiento de Stellite 6 sobre acero inoxidable realizado con láser de CO₂ para válvulas de escape de motores diesel

Directory of Open Access Journals (Sweden)

Cadenas, M.

2002-12-01

Full Text Available To reduce the recovery or the replacement costs of diesel engine exhaust valves, they are manufactured with an economic base material, and a coating which is deposited on the seat valve in order to reach high hardness and good impact, corrosion and high temperature wear resistance (>550 °C and without lubrication. In this work, appropriate laser cladding parameters have been determined to obtain Stellite 6 coatings over AISI 304 steel (as plane test specimens and SAE EV8 steel (as valves substrates. One and two superimposed tracks were deposited on the seat valves, and modifying the laser power as a function of the rotated angle at the beginning and the end of the circular tracks, pores and cracks have been minimized and the thickness of the track were made uniform. Hardness, dilution and final microstructure of the different coatings have been analysed. A 10 % dilution and 550 HV in the tracks over plane test specimens was observed, while valves with one track showed 25 % and 430 HV respectively. With two superimposed tracks the hardness was up to 470 HV in the upper track.

Para abaratar el coste de recuperación o sustitución de válvulas de escape en motores diesel, estas se fabrican con un material base económico, recubriéndose el asiento de la válvula con otro material al que se exigirá elevada dureza y buena resistencia al impacto, a la corrosión y al desgaste erosivo en caliente (>550 °C y sin lubricación. Partiendo de esta idea, en el presente trabajo se han determinado los parámetros adecuados para realizar, mediante la técnica de plaqueado láser, un recubrimiento con Stellite 6, sobre sustratos de acero AISI 304 (probetas planas y SAE EV8 (válvulas reales. Sobre las válvulas, se depositaron uno y dos cordones superpuestos, se minimizó la presencia de poros y grietas, modificando el grado de solape inicial y final de los cordones circulares y la potencia en función del ángulo girado. Así, se

Antimalarial Activity of KAF156 in Falciparum and Vivax Malaria.

Science.gov (United States)

White, Nicholas J; Duong, Tran T; Uthaisin, Chirapong; Nosten, François; Phyo, Aung P; Hanboonkunupakarn, Borimas; Pukrittayakamee, Sasithon; Jittamala, Podjanee; Chuthasmit, Kittiphum; Cheung, Ming S; Feng, Yiyan; Li, Ruobing; Magnusson, Baldur; Sultan, Marc; Wieser, Daniela; Xun, Xiaolei; Zhao, Rong; Diagana, Thierry T; Pertel, Peter; Leong, F Joel

2016-09-22

KAF156 belongs to a new class of antimalarial agents (imidazolopiperazines), with activity against asexual and sexual blood stages and the preerythrocytic liver stages of malarial parasites. We conducted a phase 2, open-label, two-part study at five centers in Thailand and Vietnam to assess the antimalarial efficacy, safety, and pharmacokinetic profile of KAF156 in adults with acute Plasmodium vivax or P. falciparum malaria. Assessment of parasite clearance rates in cohorts of patients with vivax or falciparum malaria who were treated with multiple doses (400 mg once daily for 3 days) was followed by assessment of the cure rate at 28 days in a separate cohort of patients with falciparum malaria who received a single dose (800 mg). Median parasite clearance times were 45 hours (interquartile range, 42 to 48) in 10 patients with falciparum malaria and 24 hours (interquartile range, 20 to 30) in 10 patients with vivax malaria after treatment with the multiple-dose regimen and 49 hours (interquartile range, 42 to 54) in 21 patients with falciparum malaria after treatment with the single dose. Among the 21 patients who received the single dose and were followed for 28 days, 1 had reinfection and 7 had recrudescent infections (cure rate, 67%; 95% credible interval, 46 to 84). The mean (±SD) KAF156 terminal elimination half-life was 44.1±8.9 hours. There were no serious adverse events in this small study. The most common adverse events included sinus bradycardia, thrombocytopenia, hypokalemia, anemia, and hyperbilirubinemia. Vomiting of grade 2 or higher occurred in 2 patients, 1 of whom discontinued treatment because of repeated vomiting after receiving the single 800-mg dose. More adverse events were reported in the single-dose cohort, which had longer follow-up, than in the multiple-dose cohorts. KAF156 showed antimalarial activity without evident safety concerns in a small number of adults with uncomplicated P. vivax or P. falciparum malaria. (Funded by Novartis and

42 CFR 84.156 - Airflow resistance test; Type C supplied-air respirator, demand class; minimum requirements.

Science.gov (United States)

2010-10-01

... C supplied-air respirator, demand class; minimum requirements. (a) Inhalation resistance shall not... 42 Public Health 1 2010-10-01 2010-10-01 false Airflow resistance test; Type C supplied-air respirator, demand class; minimum requirements. 84.156 Section 84.156 Public Health PUBLIC HEALTH SERVICE...

Microscopic analysis of wobbling excitations in 156Dy and 162Yb

International Nuclear Information System (INIS)

Nazmitdinov, R. G.; Kvasil, J.

2007-01-01

In the cranked Nilsson-plus-random-phase approximation, we study low-lying quadrupole excitations of positive parity and negative signature in 156 Dy and 162 Yb at high spins. Special attention is paid to a consistent description of wobbling excitations and their identification among excited states. A good agreement between the available experimental data and the results of calculations is obtained. We find that the lowest odd-spin γ-vibrational states in 156 Dy transform into wobbling excitations after the backbending associated with the transition from an axially symmetric shape to a nonaxial shape. Similar results are predicted for 162 Yb. The analysis of electromagnetic transitions uniquely determines the sign of the γ deformation in both nuclei after the transition point

Viscosity, fission time scale and deformation of Dy-156

NARCIS (Netherlands)

van't Hof, G; Bacelar, JCS; Dioszegi, [No Value; Harakeh, MN; Hesselink, WHA; Kalantar-Nayestanaki, N; Kugler, A; van der Ploeg, H; Plompen, AJM; van Schagen, JPS

1998-01-01

In the fusion-fission reaction Ar-40 + Cd-116 --> Dy-156*, fission, at E-b = 216 MeV and 238 MeV, gamma-rays were measured in coincidence with fission fragments. The interpretation of the gamma-ray spectra is done with the help of a modified version of the statistical-model code CASCADE. The spectra

7 CFR 985.156 - Transfer of excess oil by producers.

Science.gov (United States)

2010-01-01

... “Marketing percentage” regulations (e.g., sections .200 through .299) which are in effect for a year or less... 985.156 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE MARKETING...

7 CFR 3015.156 - Application for Federal assistance (short form).

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false Application for Federal assistance (short form). 3015... Application for Federal Assistance § 3015.156 Application for Federal assistance (short form). Governments shall use the Application for Federal Assistance (Short Form) form prescribed by Circular A-102 in...

Threshold-dependent repression of SPL gene expression by miR156/miR157 controls vegetative phase change in Arabidopsis thaliana.

Directory of Open Access Journals (Sweden)

Jia He

2018-04-01

Full Text Available Vegetative phase change is regulated by a decrease in the abundance of the miRNAs, miR156 and miR157, and the resulting increase in the expression of their targets, SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL transcription factors. To determine how miR156/miR157 specify the quantitative and qualitative changes in leaf morphology that occur during vegetative phase change, we measured their abundance in successive leaves and characterized the phenotype of mutations in different MIR156 and MIR157 genes. miR156/miR157 decline rapidly between leaf 1&2 and leaf 3 and decrease more slowly after this point. The amount of miR156/miR157 in leaves 1&2 greatly exceeds the threshold required to specify their identity. Subsequent leaves have relatively low levels of miR156/miR157 and are sensitive to small changes in their abundance. In these later-formed leaves, the amount of miR156/miR157 is close to the threshold required to specify juvenile vs. adult identity; a relatively small decrease in the abundance of miR156/157 in these leaves produces a disproportionately large increase in SPL proteins and a significant change in leaf morphology. miR157 is more abundant than miR156 but has a smaller effect on shoot morphology and SPL gene expression than miR156. This may be attributable to the inefficiency with which miR157 is loaded onto AGO1, as well as to the presence of an extra nucleotide at the 5' end of miR157 that is mis-paired in the miR157:SPL13 duplex. miR156 represses different targets by different mechanisms: it regulates SPL9 by a combination of transcript cleavage and translational repression and regulates SPL13 primarily by translational repression. Our results offer a molecular explanation for the changes in leaf morphology that occur during shoot development in Arabidopsis and provide new insights into the mechanism by which miR156 and miR157 regulate gene expression.

Overexpression of herbaceous peony miR156e-3p improves anthocyanin accumulation in transgenic Arabidopsis thaliana lateral branches.

Science.gov (United States)

Zhao, Daqiu; Xia, Xing; Wei, Mengran; Sun, Jing; Meng, Jiasong; Tao, Jun

2017-12-01

microRNAs (miRNAs) play critical regulatory roles in plant growth and development. In the present study, the function of herbaceous peony ( Paeonia lactiflora Pall.) miR156e-3p in the regulation of color formation has been investigated. Firstly, P. lactiflora miR156e-3p precursor sequence (pre-miR156e-3p) was isolated. Subsequently, the overexpression vector of pre-miR156e-3p was constructed and transformed into Arabidopsis thaliana . Moreover, the medium screening, GUS staining, polymerase chain reaction (PCR) of the GUS region and real-time quantitative PCR (qRT-PCR) of miR156e-3p all confirmed that the purpose gene had been successfully transferred into Arabidopsis plants and expressed, which resulted in apparent purple lateral branches. And this change in color was caused by the improved anthocyanin accumulation. In addition, expression analysis had shown that the level of miR156e-3p transcript was increased, while transcription level of target gene squamosa promoter binding protein-like gene ( SPL1 ), encoding SPL transcription factor that negatively regulated anthocyanin accumulation, was repressed in miR156e-3p-overexpressing transgenic plants, and its downstream gene dihydroflavonol 4-reductase gene ( DFR ) that was directly involved in anthocyanin biosynthesis was strongly expressed, which resulted in anthocyanin accumulation of Arabidopsis lateral branches. These findings would improve the understanding of miRNAs regulation of color formation in P. lactiflora .

75 FR 58012 - 30-Day Notice of Proposed Information Collection: DS-156E Nonimmigrant Treaty Trader/Investor...

Science.gov (United States)

2010-09-23

... Information Collection: DS-156E Nonimmigrant Treaty Trader/Investor Application ACTION: Notice of request for... Collection: Nonimmigrant Treaty Trader/Investor Application. OMB Control Number: 1405-0101. Type of Request... State (CA/VO). Form Number: DS-156E. Respondents: Nonimmigrant treaty trader/investor visa applicants...

33 CFR 157.156 - COW operations: Meeting manual requirements.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false COW operations: Meeting manual... CARRYING OIL IN BULK Crude Oil Washing (COW) System on Tank Vessels Cow Operations § 157.156 COW operations... COW system under §§ 157.10(e), 157.10a(a)(2), or 157.10c(b)(2) that has the Crude Oil Washing...

Second proton and neutron alignments in the doubly-odd nuclei 154,156Tb

International Nuclear Information System (INIS)

Hartley, D.J.; Allen, J.L.; Brown, T.B.; Kondev, F.G.; Pfohl, J.; Riley, M.A.; Fischer, S.M.; Janssens, R.V.; Nisius, D.T.; Fallon, P.; Ma, W.C.; Simpson, J.

1999-01-01

High-spin states in the doubly-odd nuclei 154,156 Tb have been populated in two separate experiments using the 36 S+ 124 Sn reaction at different beam energies (160 and 175 MeV). The yrast structures of both nuclei were extended to much higher spin (I≤48ℎ) than previously known and several quasiparticle alignments have been identified. These include the second neutron alignment and a clear delineation of the second proton crossing in 156 Tb. Systematics of these crossings for odd-Z nuclei and comparisons with results of cranked shell model calculations are discussed. thinsp copyright 1999 The American Physical Society

Azacytidine and miR156 promote rooting in adult but not in juvenile Arabidopsis tissues.

Science.gov (United States)

Massoumi, Mehdi; Krens, Frans A; Visser, Richard G F; De Klerk, Geert-Jan M

2017-01-01

Poor adventitious root (AR) formation is a major obstacle in micropropagation and conventional vegetative propagation of many crops. It is affected by many endogenous and exogenous factors. With respect to endogenous factors, the phase change from juvenile to adult has a major influence on AR formation and rooting is usually much reduced or even fully inhibited in adult tissues. It has been reported that the phase change is characterized by an increase in DNA-methylation and a decrease in the expression of microRNA156 (miR156). In this paper, we examined the effect of azacytidine (AzaC) and miR156 on AR formation in adult and juvenile Arabidopsis tissues. To identify the ontogenetic state researchers have used flowering or leaf morphology. We have used the rootability which allows - in contrast with both other characteristics- to examine the ontogenetic state at the cellular level. Overexpression of miR156 promoted only the rooting of adult tissues indicating that the phase change-associated loss in tissues' competence to develop ARs is also under the control of miR156. Azacytidine inhibits DNA methylation during DNA replication. Azacytidine treatment also promoted AR formation in nonjuvenile tissues but had no or little effect in juvenile tissues. Its addition during seedling growth (by which all tissues become hypomethylated) or during the rooting treatment (by which only those cells become hypomethylated that are generated after taking the explant) are both effective in the promotion of rooting. An AzaC treatment may be useful in tissue culture for crops that are recalcitrant to root. Copyright © 2016 Elsevier GmbH. All rights reserved.

Genetic improvement of the shoot architecture and yield in soya bean plants via the manipulation of GmmiR156b.

Science.gov (United States)

Sun, Zhengxi; Su, Chao; Yun, Jinxia; Jiang, Qiong; Wang, Lixiang; Wang, Youning; Cao, Dong; Zhao, Fang; Zhao, Qingsong; Zhang, Mengchen; Zhou, Bin; Zhang, Lei; Kong, Fanjiang; Liu, Baohui; Tong, Yiping; Li, Xia

2018-05-05

The optimization of plant architecture in order to breed high-yielding soya bean cultivars is a goal of researchers. Tall plants bearing many long branches are desired, but only modest success in reaching these goals has been achieved. MicroRNA156 (miR156)-SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) gene modules play pivotal roles in controlling shoot architecture and other traits in crops like rice and wheat. However, the effects of miR156-SPL modules on soya bean architecture and yield, and the molecular mechanisms underlying these effects, remain largely unknown. In this study, we achieved substantial improvements in soya bean architecture and yield by overexpressing GmmiR156b. Transgenic plants produced significantly increased numbers of long branches, nodes and pods, and they exhibited an increased 100-seed weight, resulting in a 46%-63% increase in yield per plant. Intriguingly, GmmiR156b overexpression had no significant impact on plant height in a growth room or under field conditions; however, it increased stem thickness significantly. Our data indicate that GmmiR156b modulates these traits mainly via the direct cleavage of SPL transcripts. Moreover, we found that GmSPL9d is expressed in the shoot apical meristem and axillary meristems (AMs) of soya bean, and that GmSPL9d may regulate axillary bud formation and branching by physically interacting with the homeobox gene WUSCHEL (WUS), a central regulator of AM formation. Together, our results identify GmmiR156b as a promising target for the improvement of soya bean plant architecture and yields, and they reveal a new and conserved regulatory cascade involving miR156-SPL-WUS that will help researchers decipher the genetic basis of plant architecture. © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Review and retrospective analysis of degenerative lumbosacral stenosis in 156 dogs treated by dorsal laminectomy.

Science.gov (United States)

Suwankong, N; Meij, B P; Voorhout, G; de Boer, A H; Hazewinkel, H A W

2008-01-01

The medical records of 156 dogs with degenerative lumbosacral stenosis (DLS) that underwent decompressive surgery were reviewed for signalment, history, clinical signs, imaging and surgical findings. The German Shepherd Dog (GSD) was most commonly affected (40/156, 25.6%). Pelvic limb lameness, caudal lumbar pain and pain evoked by lumbosacral pressure were the most frequent clinical findings. Radiography showed lumbosacral step formation in 78.8% (93/118) of the dogs which was associated with elongation of the sacral lamina in 18.6% (22/118). Compression of the cauda equina was diagnosed by imaging (epidurography, CT, or MRI) in 94.2% (147/156) of the dogs. Loss of the bright nucleus pulposus signal of the L7-S1 disc was found on T2-weighted MR images in 73.5% (25/34) of the dogs. The facet joint angle at L7-S1 was significantly smaller, and the tropism greater in GSD than in the other dog breeds. The smaller facet joint angle and higher incidence of tropism seen in the GSD may predispose this breed to DLS. Epidurography, CT, and MRI allow adequate visualization of cauda equina compression. During surgery, disc protrusion was found in 70.5% (110/156) of the dogs. Overall improvement after surgery was recorded in the medical records in 79.0% (83/105) of the dogs. Of the 38 owners that responded to questionnaires up to five years after surgery, 29 (76%) perceived an improvement.

Test of E1-radiative strength function and level density models by 155 Gd (n,2γ) 156 Gd reaction

International Nuclear Information System (INIS)

Voinov, A.V.

1996-01-01

The information about the level density of 156 Gd nucleus and strength functions of γ transitions extracted from two γ-cascade spectra of the 155 Gd (n,2γ) 156 Gd reaction is analyzed. The method of statistical simulation of γ-cascade intensity is applied for calculation of the main parameters of experimental spectra. The method is used to extract the information on the E1-radiative strength function of γ transitions and level density in the 156 Gd nucleus. It is shown that at an excitation energy above 3 MeV the level density of 156 Gd nucleus must decrease in comparison with that calculated within the Fermi gas model. Its is concluded that possible explanation of the observed effect is connected with the influence of pairing correlations on the level density in nuclei

76 FR 36578 - 156th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

Science.gov (United States)

2011-06-22

... DEPARTMENT OF LABOR Employee Benefits Security Administration 156th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 156th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; (also known as...

miR156a Mimic Represses the Epithelial-Mesenchymal Transition of Human Nasopharyngeal Cancer Cells by Targeting Junctional Adhesion Molecule A.

Directory of Open Access Journals (Sweden)

Yunhong Tian

Full Text Available MicroRNAs (miRNAs have been documented as having an important role in the development of cancer. Broccoli is very popular in large groups of the population and has anticancer properties. Junctional adhesion molecule A (JAMA is preferentially concentrated at tight junctions and influences cell morphology and migration. Epithelial-mesenchymal transition (EMT is a developmental program associated with cancer progression and metastasis. In this study we aimed to investigate the role of miRNAs from broccoli in human nasopharyngeal cancer (NPC. We demonstrated that a total of 84 conserved miRNAs and 184 putative novel miRNAs were found in broccoli by sequencing technology. Among these, miR156a was expressed the most. In addition, synthetic miR156a mimic inhibited the EMT of NPC cells in vitro. Furthermore, it was confirmed that JAMA was the target of miR156a mimic as validated by 3' UTR luciferase reporter assays and western blotting. Knockdown of JAMA was consistent with the effects of miR156a mimic on the EMT of NPC, and the up-regulation of JAMA could partially restore EMT repressed by miR156a mimic. In conclusion, these results indicate that the miR156a mimic inhibits the EMT of NPC cells by targeting the 3' UTR of JAMA. These miRNA profiles of broccoli provide a fundamental basis for further research. Moreover, the discovery of miR156a may have clinical implications for the treatment of patients with NPC.

miR156a Mimic Represses the Epithelial-Mesenchymal Transition of Human Nasopharyngeal Cancer Cells by Targeting Junctional Adhesion Molecule A.

Science.gov (United States)

Tian, Yunhong; Cai, Longmei; Tian, Yunming; Tu, Yinuo; Qiu, Huizhi; Xie, Guofeng; Huang, Donglan; Zheng, Ronghui; Zhang, Weijun

2016-01-01

MicroRNAs (miRNAs) have been documented as having an important role in the development of cancer. Broccoli is very popular in large groups of the population and has anticancer properties. Junctional adhesion molecule A (JAMA) is preferentially concentrated at tight junctions and influences cell morphology and migration. Epithelial-mesenchymal transition (EMT) is a developmental program associated with cancer progression and metastasis. In this study we aimed to investigate the role of miRNAs from broccoli in human nasopharyngeal cancer (NPC). We demonstrated that a total of 84 conserved miRNAs and 184 putative novel miRNAs were found in broccoli by sequencing technology. Among these, miR156a was expressed the most. In addition, synthetic miR156a mimic inhibited the EMT of NPC cells in vitro. Furthermore, it was confirmed that JAMA was the target of miR156a mimic as validated by 3' UTR luciferase reporter assays and western blotting. Knockdown of JAMA was consistent with the effects of miR156a mimic on the EMT of NPC, and the up-regulation of JAMA could partially restore EMT repressed by miR156a mimic. In conclusion, these results indicate that the miR156a mimic inhibits the EMT of NPC cells by targeting the 3' UTR of JAMA. These miRNA profiles of broccoli provide a fundamental basis for further research. Moreover, the discovery of miR156a may have clinical implications for the treatment of patients with NPC.

High miR156 Expression Is Required for Auxin-Induced Adventitious Root Formation via MxSPL26 Independent of PINs and ARFs in Malus xiaojinensis

Directory of Open Access Journals (Sweden)

Xiaozhao Xu

2017-06-01

Full Text Available Adventitious root formation is essential for the vegetative propagation of perennial woody plants. During the juvenile-to-adult phase change mediated by the microRNA156 (miR156, the adventitious rooting ability decreases dramatically in many species, including apple rootstocks. However, the mechanism underlying how miR156 affects adventitious root formation is unclear. In the present study, we showed that in the presence of the synthetic auxin indole-3-butyric acid (IBA, semi-lignified leafy cuttings from juvenile phase (Mx-J and rejuvenated (Mx-R Malus xiaojinensis trees exhibited significantly higher expression of miR156, PIN-FORMED1 (PIN1, PIN10, and rootless concerning crown and seminal roots-like (RTCS-like genes, thus resulting in higher adventitious rooting ability than those from adult phase (Mx-A trees. However, the expression of SQUAMOSA-PROMOTER BINDING PROTEIN-LIKE26 (SPL26 and some auxin response factor (ARF gene family members were substantially higher in Mx-A than in Mx-R cuttings. The expression of NbRTCS-like but not NbPINs and NbARFs varied with miR156 expression in tobacco (Nicotiana benthamiana plants transformed with 35S:MdMIR156a6 or 35S:MIM156 constructs. Overexpressing the miR156-resistant MxrSPL genes in tobacco confirmed the involvement of MxSPL20, MxSPL21&22, and MxSPL26 in adventitious root formation. Together, high expression of miR156 was necessary for auxin-induced adventitious root formation via MxSPL26, but independent of MxPINs and MxARFs expression in M. xiaojinensis leafy cuttings.

Bacillus cereus AR156 primes induced systemic resistance by suppressing miR825/825* and activating defense-related genes in Arabidopsis.

Science.gov (United States)

Niu, Dongdong; Xia, Jing; Jiang, Chunhao; Qi, Beibei; Ling, Xiaoyu; Lin, Siyuan; Zhang, Weixiong; Guo, Jianhua; Jin, Hailing; Zhao, Hongwei

2016-04-01

Small RNAs play an important role in plant immune responses. However, their regulatory function in induced systemic resistance (ISR) is nascent. Bacillus cereus AR156 is a plant growth-promoting rhizobacterium that induces ISR in Arabidopsis against bacterial infection. Here, by comparing small RNA profiles of Pseudomonas syringae pv. tomato (Pst) DC3000-infected Arabidopsis with and without AR156 pretreatment, we identified a group of Arabidopsis microRNAs (miRNAs) that are differentially regulated by AR156 pretreatment. miR825 and miR825* are two miRNA generated from a single miRNA gene. Northern blot analysis indicated that they were significantly downregulated in Pst DC3000-infected plants pretreated with AR156, in contrast to the plants without AR156 pretreatment. miR825 targets two ubiquitin-protein ligases, while miR825* targets toll-interleukin-like receptor (TIR)-nucleotide binding site (NBS) and leucine-rich repeat (LRR) type resistance (R) genes. The expression of these target genes negatively correlated with the expression of miR825 and miR825*. Moreover, transgenic plants showing reduced expression of miR825 and miR825* displayed enhanced resistance to Pst DC3000 infection, whereas transgenic plants overexpressing miR825 and miR825* were more susceptible. Taken together, our data indicates that Bacillus cereus AR156 pretreatment primes ISR to Pst infection by suppressing miR825 and miR825* and activating the defense related genes they targeted. © 2015 Institute of Botany, Chinese Academy of Sciences.

Optical model studies of 6Li elastic scattering at 156 MeV

International Nuclear Information System (INIS)

Cook, J.; Gils, H.J.; Rebel, H.; Klewe-Nebenius, H.

1981-11-01

Differential cross sections for 6 Li elastic scattering at 156 MeV from 12 C, 40 Ca 90 Zr and 208 Pb are presented. The sensitivity to various potential forms is established by using Saxon Woods, Saxon-Woods-squred, density independent and density dependent folded potentials. The extent to which the experimental data determine the potentials and related quantities is discussed. (orig.) [de

miR156-Targeted SBP-Box Transcription Factors Interact with DWARF53 to Regulate TEOSINTE BRANCHED1 and BARREN STALK1 Expression in Bread Wheat.

Science.gov (United States)

Liu, Jie; Cheng, Xiliu; Liu, Pan; Sun, Jiaqiang

2017-07-01

Genetic and environmental factors affect bread wheat ( Triticum aestivum ) plant architecture, which determines grain yield. In this study, we demonstrate that miR156 controls bread wheat plant architecture. We show that overexpression of tae-miR156 in bread wheat cultivar Kenong199 leads to increased tiller number and severe defects in spikelet formation, probably due to the tae-miR156-mediated repression of a group of SQUAMOSA PROMOTER BINDING PROTEIN-LIKE ( SPL ) genes. Furthermore, we found that the expression of two genes TEOSINTE BRANCHED1 ( TaTB1 ) and BARREN STALK1 ( TaBA1 ), whose orthologous genes in diverse plant species play conserved roles in regulating plant architecture, is markedly reduced in the tae-miR156-OE bread wheat plants. Significantly, we demonstrate that the strigolactone (SL) signaling repressor DWARF53 (TaD53), which physically associates with the transcriptional corepressor TOPLESS, can directly interact with the N-terminal domains of miR156-controlled TaSPL3/17. Most importantly, TaSPL3/17-mediated transcriptional activation of TaBA1 and TaTB1 can be largely repressed by TaD53 in the transient expression system. Our results reveal potential association between miR156-TaSPLs and SL signaling pathways during bread wheat tillering and spikelet development. © 2017 American Society of Plant Biologists. All Rights Reserved.

Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.

Science.gov (United States)

Xu, Mingli; Hu, Tieqiang; Zhao, Jianfei; Park, Mee-Yeon; Earley, Keith W; Wu, Gang; Yang, Li; Poethig, R Scott

2016-08-01

Correct developmental timing is essential for plant fitness and reproductive success. Two important transitions in shoot development-the juvenile-to-adult vegetative transition and the vegetative-to-reproductive transition-are mediated by a group of genes targeted by miR156, SQUAMOSA PROMOTER BINDING PROTEIN (SBP) genes. To determine the developmental functions of these genes in Arabidopsis thaliana, we characterized their expression patterns, and their gain-of-function and loss-of-function phenotypes. Our results reveal that SBP-LIKE (SPL) genes in Arabidopsis can be divided into three functionally distinct groups: 1) SPL2, SPL9, SPL10, SPL11, SPL13 and SPL15 contribute to both the juvenile-to-adult vegetative transition and the vegetative-to-reproductive transition, with SPL9, SP13 and SPL15 being more important for these processes than SPL2, SPL10 and SPL11; 2) SPL3, SPL4 and SPL5 do not play a major role in vegetative phase change or floral induction, but promote the floral meristem identity transition; 3) SPL6 does not have a major function in shoot morphogenesis, but may be important for certain physiological processes. We also found that miR156-regulated SPL genes repress adventitious root development, providing an explanation for the observation that the capacity for adventitious root production declines as the shoot ages. miR156 is expressed at very high levels in young seedlings, and declines in abundance as the shoot develops. It completely blocks the expression of its SPL targets in the first two leaves of the rosette, and represses these genes to different degrees at later stages of development, primarily by promoting their translational repression. These results provide a framework for future studies of this multifunctional family of transcription factors, and offer new insights into the role of miR156 in Arabidopsis development.

Colorimetry of the diffuse nebulas S 156, S 157A, S 158, and NGC 7635

International Nuclear Information System (INIS)

Parsamian, E.S.; Petrosian, V.M.

1984-01-01

The results of a colorimetric investigation of the diffuse nebulas S 156, S 157A, S 158, and NGC 7635, which are excited by O stars, are presented. The nebulas S 156, S 157A, and NGC 7635 are very bright in U due to the presence in them of strong ultraviolet doublet forbidden O II 3727 A. These values correspond effectively to the monochromatic image of the nebulas at this wavelength. The measurements show that the B-V color index does not change significantly with distance from the star except for S 158, where a weak dependence is observed. The results indicate that the physical properties of these nebulas differ little. It is concluded that the gas masses in this association are remnants of star formation that have a common origin with the stars. The age of the association is estimated at 100,000-1,000,000 yr. 13 references

Investigation of the reaction 6Li + 40Ca at 156 MeV in a coincidence experiment

International Nuclear Information System (INIS)

Freindl, L.; Grotowski, K.; Uniwersytet Jagiellonski, Krakow; Planeta, R.; Klewe-Nebenius, H.; Neumann, B.; Buschmann, J.; Gils, H.J.; Rebel, H.; Zagromski, S.

1983-12-01

The cross sections for inelastic break up have been studied for the 6 Li + 40 Ca reaction at Esub(Li) = 156 MeV. For this, gamma ray spectra from the heavy residual nuclei were measured in coincidence with beam velocity projectile fragments. The cross sections were found to be: 34 +- 9 14 mb for protons, 30 +- 7 12 mb for deuterons, and 78 +- 41 142 mb for α-particles, respectively. These values are small when compared to total break up cross sections. A comparison of the cross section sum of all known reaction paths induced by 6 Li + 40 Ca at 156 MeV with total reaction cross section indicates a missing cross section of the order of a few hundred millibarns. It is discussed whether this cross section may be attributed to pick up reactions. (orig.) [de

RA Reactor operation and maintenance (I-IX), part VIII, Task 3.08/05, Decontamination of the reactor

International Nuclear Information System (INIS)

Zecevic, V.

1963-12-01

Permanent increase of radiation in the heavy water system was noticed during first three year of the RA reactor operation, even when the reactor was shutdown. It was found that there was no failure of the fuel element cladding. Radioactive cobalt was found in the heavy water which was rather strange. During repair of the heavy water system, it has been found that stellite was used for coating the heavy water pumps. Since stellite is a cobalt alloy, this could have been the source of radioactive cobalt in the heavy water. The stellite coating was damaged due to friction and particle of cobalt appeared in the coolant, they were activated since they were in the core. decontamination of the heavy water and the heavy water coolant loop was a must . Beside the detailed report on the contamination and decontamination of the heavy water system this volume includes 14 annexes describing the investigation of the event and the whole procedure of decontamination

RA Reactor operation and maintenance (I-IX), part VIII, Task 3.08/05, Decontamination of the reactor; Pogon i odrzavanje reaktora (I-IX), VIII Deo, Zadatak 3.08/05 Dekontaminacija reaktora

Energy Technology Data Exchange (ETDEWEB)

Zecevic, V [Institute of Nuclear Sciences Boris Kidric, Reaktor RA, Vinca, Beograd (Serbia and Montenegro)

1963-12-15

Permanent increase of radiation in the heavy water system was noticed during first three year of the RA reactor operation, even when the reactor was shutdown. It was found that there was no failure of the fuel element cladding. Radioactive cobalt was found in the heavy water which was rather strange. During repair of the heavy water system, it has been found that stellite was used for coating the heavy water pumps. Since stellite is a cobalt alloy, this could have been the source of radioactive cobalt in the heavy water. The stellite coating was damaged due to friction and particle of cobalt appeared in the coolant, they were activated since they were in the core. decontamination of the heavy water and the heavy water coolant loop was a must . Beside the detailed report on the contamination and decontamination of the heavy water system this volume includes 14 annexes describing the investigation of the event and the whole procedure of decontamination.

Comparative metallurgical study of thick hard coatings without cobalt

International Nuclear Information System (INIS)

Clemendot, F.; Van Duysen, J.C.; Champredonde, J.

1992-07-01

Wear and corrosion of stellite type hard coatings for valves of the PWR primary system raise important problems of contamination. Substitution of these alloys by cobalt-free hard coatings (Colmonoy 4 and 4.26, Cenium 36) should allow to reduce this contamination. A comparative study (chemical, mechanical, thermal, metallurgical), as well as a corrosion study of these coatings were carried out. The results of this characterization show that none of the studied products has globally characteristics as good as those of grade 6 Stellite currently in service

抽动障碍156例临床治疗效果观察%Clinical effect on treatment of 156 tic disorder cases

Institute of Scientific and Technical Information of China (English)

鲁曼; 李晓伟

2008-01-01

目的 探讨治疗儿童抽动障碍(Tic disorder,TD)的最佳治疗方法.方法 确诊为抽动障碍的患儿156例,随机分为三组,各组采用不同方法治疗,进行疗效对比分析.结果 泰必利组有效率56%,脑电生物反馈组治疗有效率46%,综合组有效率81%,明显高于泰必利组和脑电生物反馈组(P<0.01).结论 对TD以综合治疗即药物治疗加脑电生物反馈治疗效果最佳.

75 FR 25910 - 60-Day Notice of Proposed Information Collection: DS-156E, Nonimmigrant Treaty Trader/Investor...

Science.gov (United States)

2010-05-10

..., Nonimmigrant Treaty Trader/Investor Application, OMB Control Number 1405-0101 ACTION: Notice of request for...: Nonimmigrant Treaty Trader/Investor Application. OMB Control Number: 1405-0101. Type of Request: Extension of a...) Form Number: DS-156E. Respondents: Nonimmigrant treaty trader/investor visa applicants. Estimated...

Optimización del proceso de aporte de recubrimientos anticorrosión de Stellite 6 producidos mediante plaqueado láser

Directory of Open Access Journals (Sweden)

Vicario, I.

2009-02-01

mediante la técnica de plaqueado láser para producir recubrimientos anti-corrosión empleando aleación de Co Stellite 6 en polvo sobre un substrato de acero C45 (AISI 1045. Posteriormente, se lleva a cabo un estudio de las características frente a la corrosión del recubrimiento final obtenido y de su correlación con los parámetros de aporte empleados.

Specific gravity and other properties of wood and bark for 156 tree species found in North America

Science.gov (United States)

Patrick D. Miles

2009-01-01

This paper reports information for the estimation of biomass for 156 tree species found in North America for use in national forest inventory applications. We present specific gravities based on average green volume as well as 12 percent moisture content volume for calculation of oven-dry biomass....

Entrance channel dependent light-charged particle emission of the 156Er compound

International Nuclear Information System (INIS)

Liang, J.F.; Bierman, J.D.; Kelly, M.P.; Sonzogni, A.A.; Vandenbosch, R.; van Schagen, J.P.S.

1996-01-01

Light-charged particle decay from the 156 Er compound nucleus, populated by 12 C+ 144 Sm and 60 Ni+ 96 Zr at the same excitation energy, were measured in coincidence with the evaporation residues. The high energy slope of charged particle spectra for the 60 Ni-induced reaction is steeper than for the 12 C-induced reaction. Model calculations including particle evaporation during compound nucleus formation result in good agreement with the data. This suggests that the difference in the charged particle spectra between the two entrance channels is due to a longer formation time in the 60 Ni-induced reaction. 14 refs., 3 figs

NMR studies of Costa-type organocobalt compounds. Structural characterization of several 1,5,6-trimethylbenzimidazole complexes

International Nuclear Information System (INIS)

Parker, W.O. Jr.; Zangrando, E.; Bresciani-Pahor, N.; Marzilli, P.A.; Randaccio, E.; Marzilli, L.G.

1988-01-01

The structure of L exchange data have been examined for Costa models containing 1,5,6-trimethylbenzimidazole, the base most appropriate for comparison with cobaltamines. The crystal structure and 1 H and 13 C NMR data for the complexes are also presented. The 1 H and 13 C NMR data are compared with data available for cobaloximes. 45 references, 5 figures, 16 tables

Signature inversion in πh{sub 11/2} x νi{sub 13/2} band of {sup 152}Eu and {sup 154,156}Tb

Energy Technology Data Exchange (ETDEWEB)

Kumar, Sushil [Akal University, Department of Physics, Talwandi Sabo (India); Maharishi Markandeshwar University, Department of Physics, Mullana (India); Singh, Sukhjeet [Akal University, Department of Physics, Talwandi Sabo (India); Sharma, Vandana; Sharma, J.K. [Maharishi Markandeshwar University, Department of Physics, Mullana (India)

2017-04-15

The phenomenon of signature inversion observed in the πh{sub 11/2} x νi{sub 13/2} band of {sup 152}Eu and {sup 156}Tb nuclides is revisited through the axially symmetric two quasiparticle plus rotor model approach. The magnitude of experimentally observed signature splitting and point of signature inversion, which could not be explicitly reproduced in the earlier calculations, is successfully reproduced in the present study. Some of the critical issues, such as violation of the well-established Gallagher Moszkowski (GM) rule for eight GM doublets appearing in the basis space of earlier calculations of {sup 152}Eu and {sup 156}Tb, are fixed and also the ambiguity regarding spin assignment to this band observed in {sup 156}Tb is resolved. These calculations are further extended to the same band (πh{sub 11/2} x νi{sub 13/2}) observed in {sup 154}Tb nuclide and signature inversion observed in this band is successfully reproduced. (orig.)

Md-miR156ab and Md-miR395 Target WRKY Transcription Factors to Influence Apple Resistance to Leaf Spot Disease.

Science.gov (United States)

Zhang, Qiulei; Li, Yang; Zhang, Yi; Wu, Chuanbao; Wang, Shengnan; Hao, Li; Wang, Shengyuan; Li, Tianzhong

2017-01-01

MicroRNAs (miRNAs) are key regulators of gene expression that post-transcriptionally regulate transcription factors involved in plant physiological activities. Little is known about the effects of miRNAs in disease resistance in apple ( Malus × domestica ). We globally profiled miRNAs in the apple cultivar Golden Delicious (GD) infected or not with the apple leaf spot fungus Alternaria alternaria f. sp. mali (ALT1), and identified 58 miRNAs that exhibited more than a 2-fold upregulation upon ALT1 infection. We identified a pair of miRNAs that target protein-coding genes involved in the defense response against fungal pathogens; Md-miR156ab targets a novel WRKY transcription factor, MdWRKYN1, which harbors a TIR and a WRKY domain. Md-miR395 targets another transcription factor, MdWRKY26, which contains two WRKY domains. Real-time PCR analysis showed that Md-miR156ab and Md-miR395 levels increased, while MdWRKYN1 and MdWRKY26 expression decreased in ALT1-inoculated GD leaves; furthermore, the overexpression of Md-miR156ab and Md-miR395 resulted in a significant reduction in MdWRKYN1 and MdWRKY26 expression. To investigate whether these miRNAs and their targets play a crucial role in plant defense, we overexpressed MdWRKYN1 or knocked down Md-miR156ab activity, which in both cases enhanced the disease resistance of the plants by upregulating the expression of the WRKY-regulated pathogenesis-related (PR) protein-encoding genes MdPR3-1, MdPR3-2, MdPR4, MdPR5, MdPR10-1 , and MdPR10-2 . In a similar analysis, we overexpressed MdWRKY26 or suppressed Md-miR395 activity, and found that many PR protein-encoding genes were also regulated by MdWRKY26 . In GD, ALT-induced Md-miR156ab and Md-miR395 suppress MdWRKYN1 and MdWRKY26 expression, thereby decreasing the expression of some PR genes, and resulting in susceptibility to ALT1.

Report on the intercomparison run IAEA-156 radionuclides in clover

International Nuclear Information System (INIS)

Strachnov, V.; Valkovic, V.; Dekner, R.

1991-01-01

This report contains the results of the intercomparison IAEA-156 on the determination of radionuclides in clover. Initially participants were requested to determine the levels of 134 Cs, 137 Cs, 40 K, 90 Sr and invited to provide data for other radionuclides. The participants included 46 laboratories located in 25 countries, and statistical evaluation of their data yield recommended values for these four radionuclides. Additional radionuclides reported were 210 Pb, 239 Pu and 125 Sb; however, insufficient data exists to statistically determine recommended values for these radionuclides. The following are the recommended values, with confidence intervals, for the most frequently measured radionuclides (reference date: 1 August 1986): 134 Cs 132.1 Bq/kg (126.4-137.7); 137 Cs 264 Bq/kg (254-274); 40 K 657 Bq/kg (637-676); 90 Sr 14.8 Bq/kg (13.4-16.3). Figs and tabs

Decay heat and activity of the structural materials of the fuel and blanket assemblies of the second and third core of KNK II

International Nuclear Information System (INIS)

Winterhagen, D.

1986-06-01

The decay heat and activity caused by structural materials have been calculated for the fuel assemblies of KNK II (second and third core) with a residence time of 720 equivalent full-power days (efpd) and the blanket assemblies with 1880 efpd. The values are given for the different zones of the assemblies (head, active zone, fission gas plenum, foot and stellite area) for decay times from 1 to 20 years. For decay times beyond 2 years more than 80 % of the decay heat are caused by the Co60-decay, more than 60 % of which result from the stellite in the foot area [de

Fusion and nonfusion phenomena in the 6Li+40Ca reaction at 156 MeV

International Nuclear Information System (INIS)

Brzychczyk, J.; Freindl, L.; Grotowski, K.

1982-01-01

Reaction products from 6 Li-induced reactions on 40 Ca at 156 MeV have been studied using the dE x E identification as well as the inclusive γ-ray method. The complete fusion cross-section has been found to be σsub(f)=(77 +- 11)mb. The Z distribution of fusion evaporation residues is compared with statistical model predictions. The Z spectrum of reaction products shows a maximum at 15 6 Li break-up. (author)

Fusion and nonfusion phenomena in the 6Li+40Ca reaction at 156 MeV

International Nuclear Information System (INIS)

Brzychczyk, J.; Freindl, L.; Grotowski, K.; Majka, Z.; Micek, S.; Planeta, R.; Uniwersytet Jagiellonski, Krakow; Albinska, M.; Buschmann, J.; Klewe-Nebenius, H.; Gils, H.J.; Rebel, H.; Zagromski, S.

1984-01-01

Reaction products from 6 Li-induced reactions on 40 Ca at 156 MeV have been studied using the dExE idenitification as well as the inclusive γ-ray method. The complete fusion cross section has been found to be sigmasub(F)=67 +- 20 mb. The Z-distribution of fusion evaporation residues is compared with statistical model predictions. The Z-spectrum of reaction products shows a maximum at 15 6 Li-break-up processes. (orig.)

E 2 decay strength of the M 1 scissors mode of 156Gd and its first excited rotational state

Science.gov (United States)

Beck, T.; Beller, J.; Pietralla, N.; Bhike, M.; Birkhan, J.; Derya, V.; Gayer, U.; Hennig, A.; Isaak, J.; Löher, B.; Ponomarev, V. Yu.; Richter, A.; Romig, C.; Savran, D.; Scheck, M.; Tornow, W.; Werner, V.; Zilges, A.; Zweidinger, M.

2017-05-01

The E 2 /M 1 multipole mixing ratio δ1 →2 of the 1sc+→21+ γ -ray decay in 156Gd and hence the isovector E 2 transition rate of the scissors mode of a well-deformed rotational nucleus has been measured for the first time. It has been obtained from the angular distribution of an artificial quasimonochromatic linearly polarized γ -ray beam of energy 3.07(6) MeV scattered inelastically off an isotopically highly enriched 156Gd target. The data yield first direct support for the deformation dependence of effective proton and neutron quadrupole boson charges in the framework of algebraic nuclear models. First evidence for a low-lying Jπ=2+ member of the rotational band of states on top of the 1+ band head is obtained, too, indicating a significant signature splitting in the K =1 scissors mode rotational band.

E2 decay strength of the M1 scissors mode of ^{156}Gd and its first excited rotational state.

Science.gov (United States)

Beck, T; Beller, J; Pietralla, N; Bhike, M; Birkhan, J; Derya, V; Gayer, U; Hennig, A; Isaak, J; Löher, B; Ponomarev, V Yu; Richter, A; Romig, C; Savran, D; Scheck, M; Tornow, W; Werner, V; Zilges, A; Zweidinger, M

2017-05-26

The E2/M1 multipole mixing ratio δ_{1→2} of the 1_{sc}^{+}→2_{1}^{+} γ-ray decay in ^{156}Gd and hence the isovector E2 transition rate of the scissors mode of a well-deformed rotational nucleus has been measured for the first time. It has been obtained from the angular distribution of an artificial quasimonochromatic linearly polarized γ-ray beam of energy 3.07(6) MeV scattered inelastically off an isotopically highly enriched ^{156}Gd target. The data yield first direct support for the deformation dependence of effective proton and neutron quadrupole boson charges in the framework of algebraic nuclear models. First evidence for a low-lying J^{π}=2^{+} member of the rotational band of states on top of the 1^{+} band head is obtained, too, indicating a significant signature splitting in the K=1 scissors mode rotational band.

The optical potential for 6Li-6Li elastic scattering at 156 MeV

International Nuclear Information System (INIS)

Micek, S.; Majka, Z.; Klewe-Nebenius, H.; Rebel, H.; Gils, H.J.

1984-10-01

Elastic scattering of 6 Li from 6 Li has been studied for the beam energy of 156 MeV. The experimental differential cross section has been analysed on the basis of the optical model using various phenomenological forms. The spin-orbit interaction proves to be less significant. A semi-microscopic double-folding cluster model which generates the real part of the optical potential by an antisymmetrized d-α cluster wave function of 6 Li and α-α, d-d and d-α interactions is well able to describe the experimental data. (orig.) [de

Treatment Results Of Diaphyseal Forearm Fractures With Dynamique Compression Plate A Retrospective study of 156 Cases.

Directory of Open Access Journals (Sweden)

Hassan BOUSSAKRI

2015-12-01

Full Text Available This retrospective study addresses a series of 156 cases of forearm fractures. These 156 cases were managed in the trauma-orthopedic department (B4 of Fez University Hospital, Morocco, from May 2008 till January 2013. The purpose of this study is to analyze epidemiological and clinical factors of diaphyseal forearm fractures and the results of their treatment with dynamic compression plate (DCP, as well as the complications and therapeutic errors of this surgical technique. The frequency of hospitalization in the trauma-orthopedic department was 3,96%. Ages ranged between 16 and 83, the average age was 32. 132 patients were male (85%. 90% were managed at the day of trauma. Traffic accidents were the most frequent cause in 52% patients. The fracture was in the left forearm in 65% of patients. 53% of fracture lines were in the middle third of the forearm. 38 fractures were open, and 30 were admitted for polytrauma. Osteosynthesis was performed with dynamic compression plate for all patients. In comparison with the literature, our series shows the predominance of young male patients, with traffic accidents being the cause. Osteosynthesis with dynamic compression plate remains the treatment of choice that provides satisfactory results if the accuracy in this technique was respected.

Calibration of an isotopically enriched carbon-13 layer pressure sensor to 156 GPa in a diamond anvil cell

International Nuclear Information System (INIS)

Qiu Wei; Baker, Paul A.; Velisavljevic, Nenad; Vohra, Yogesh K.; Weir, Samuel T.

2006-01-01

An isotopically enriched 13 C homoepitaxial diamond layer of 6±1 μm thickness was grown on top of a brilliant cut diamond anvil by a microwave plasma chemical vapor deposition process for application as a pressure sensor. This isotopically enriched diamond tip was then used in conjunction with a natural isotopic abundance diamond anvil to generate high pressure on the sample. We provide a calibration for the 13 C Raman mode of this extremely thin epitaxial layer to 156 GPa using ruby fluorescence and the equation of state of copper as secondary pressure standards. The nonlinear calibration of the 13 C Raman mode pressure sensor is compared with similar calibrations of 12 C Raman edge and a good agreement is obtained. The Raman signal from the 13 C epitaxial layer remained a distinct singlet to 156 GPa, and pressure calibration is independent of sample mechanical strength or the diamond anvil geometry. The use of even thinner layer would allow calibration further into ultrahigh pressure regime where the use of other optical sensors has proven to be difficult

High-power noise-like pulse generation using a 1.56-µm all-fiber laser system.

Science.gov (United States)

Lin, Shih-Shian; Hwang, Sheng-Kwang; Liu, Jia-Ming

2015-07-13

We demonstrated an all-fiber, high-power noise-like pulse laser system at the 1.56-µm wavelength. A low-power noise-like pulse train generated by a ring oscillator was amplified using a two-stage amplifier, where the performance of the second-stage amplifier determined the final output power level. The optical intensity in the second-stage amplifier was managed well to avoid not only the excessive spectral broadening induced by nonlinearities but also any damage to the device. On the other hand, the power conversion efficiency of the amplifier was optimized through proper control of its pump wavelength. The pump wavelength determines the pump absorption and therefore the power conversion efficiency of the gain fiber. Through this approach, the average power of the noise-like pulse train was amplified considerably to an output of 13.1 W, resulting in a power conversion efficiency of 36.1% and a pulse energy of 0.85 µJ. To the best of our knowledge, these amplified pulses have the highest average power and pulse energy for noise-like pulses in the 1.56-µm wavelength region. As a result, the net gain in the cascaded amplifier reached 30 dB. With peak and pedestal widths of 168 fs and 61.3 ps, respectively, for the amplified pulses, the pedestal-to-peak intensity ratio of the autocorrelation trace remains at the value of 0.5 required for truly noise-like pulses.

New isomeric states in 152,154,156Nd produced by spontaneous fission of 252Cf

International Nuclear Information System (INIS)

Gautherin, C.; Houry, M.; Korten, W.; Le Coz, Y.; Lucas, R.; Phan, X.H.; Theisen, C.; Belier, G.; Girod, M.; Meot, V.; Peru, S.; Astier, A.; Ducroux, L.; Meyer, M.; Redon, N.

1998-01-01

Isomeric states have been observed in fission-fragments produced by spontaneous fission of 252 Cf. These states are found in neutron rich nuclei of different structure and deformations. About 50 isomeric nuclei have been observed using coincidences between γ-rays identified in EUROGAM II and fission fragments detected in photovoltaic cells (SAPhIR). Lifetimes in the range from 20 ns to 2μs have been measured. Presented calculations based on HFB+D1S force on new measured isomeric states in the 152,154,156 Nd show evidence for K-isomers. (orig.)

Study of the structure of the transition nuclei 152Dy, 154Dy and 156Er at high angular momentum

International Nuclear Information System (INIS)

Azgui, F.

1985-01-01

Measurements of feeding times of high spin yrast states in 152 Dy, 154 Dy and 156 Er were utilized to obtain information about possible spin dependent shape changes. Feeding times as well as lifetimes were determined with the recoil distance technique. In 152 Dy only long feeding times (> 10 ps) could be identified, indicating that the aligned-particle yrast states are fed through configuration of similar character, with little direct population from collective cascade in the continuum region. In 154 Dy discrete states with I ≤ 30 have lifetimes which are characteristically collective, whereas the preyrast cascade exhibit both fast ( 10 ps) feeding components. The latter imply a change with increasing spin from collective to aligned-particle character, signalling a prolate to oblate shape transition. In 156 Er the yrast states up to spin 20 ℎ were found to be collective. These levels are fed, however, from long-lived high spin states, causing time delay up to ∼ 100 ps, the existence of which is interpreted as a signature for an oblate shape at high spin [fr

Test of the X(5) symmetry in 156Dy and 178Os by measurement of electromagnetic transition probabilities

International Nuclear Information System (INIS)

Moeller, O.

2005-01-01

This work reports on results from two Recoil-Distance-Doppler-Shift lifetime measurements of excited states in 155 Dy and 178 Os. The experiments were carried out at the GASP spektrometer of the Laboratori Nazional i di Legnaro in combination with the Cologne plunger apparatus. The main purpose of the performed experiments was to test the predictions of the X(5) critical point symmetry in these two nuclei. In 156 Dy and 178 Os 29 lifetimes of excited states were derived using the Differential-Decay-Curve method. In weaker reaction channels the nuclei 155 Dy, 157 Dy and 177 Os were populated. In these nuclei 32 additional lifetimes were measured, most of them for the first time. In order to calculate absolute transition probabilities from the measured lifetimes of the first excited band in 156 Dy, essential branching ratios were derived from the measured data with a very small systematic error ( 178 Os confirm the consistency of a X(5) description in these nuclei. A comparision with the well established X(5)-like nuclei in the N=90 isotones gives an agreement with the X(5) description of at least the same quality. (orig.)

[The value of multimodal imaging by single photon emission computed tomography associated to X ray computed tomography (SPECT-CT) in the management of differentiated thyroid carcinoma: about 156 cases].

Science.gov (United States)

Mhiri, Aida; El Bez, Intidhar; Slim, Ihsen; Meddeb, Imène; Yeddes, Imene; Ghezaiel, Mohamed; Gritli, Saïd; Ben Slimène, Mohamed Faouzi

2013-10-01

Single photon emission computed tomography combined with a low dose computed tomography (SPECT-CT), is a hybrid imaging integrating functional and anatomical data. The purpose of our study was to evaluate the contribution of the SPECTCT over traditional planar imaging of patients with differentiated thyroid carcinoma (DTC). Post therapy 131IWhole body scan followed by SPECTCT of the neck and thorax, were performed in 156 patients with DTC. Among these 156 patients followed for a predominantly papillary, the use of fusion imaging SPECT-CT compared to conventional planar imaging allowed us to correct our therapeutic approach in 26.9 % (42/156 patients), according to the protocols of therapeutic management of our institute. SPECT-CT is a multimodal imaging providing better identification and more accurate anatomic localization of the foci of radioiodine uptake with impact on therapeutic management.

Prevention of crack initiation in valve bodies under thermal shock

Energy Technology Data Exchange (ETDEWEB)

Delmas, J.; Coppolani, P.

1996-12-01

On site and testing experience has shown that cracking in valves affects mainly the stellite hardfacing on seats and discs but may also be a concern for valve bodies. Metallurgical investigations conducted by EDF laboratories on many damaged valves have shown that most of the damage had either a chemical, manufacturing, or operating origin with a strong correlation between the origins and the type of damage. The chemical defects were either excess ferritic dilution of stellite or excess carburizing. Excess carburizing leads to a too brittle hardfacing which cracks under excessive stresses induced on the seating surfaces, via the stem, by too high operating thrusts. The same conditions can also induce cracks of the seats in the presence, in the hardfacing, of hidden defects generated during the welding process. Reduction of the number of defects results first from controls during manufacturing, mainly in the thickness of stellite. On the other hand, maintenance must be fitted to the type of defect. In-situ lapping may lead to release of cobalt, resulting in contamination of the circuit. Furthermore, it is ineffectual in the case of a crack through the seating surface, as is often found on globe valves. The use of new technologies of valves with removable seats and cobalt-free alloys solves permanently this kind of problem.

Tribological study of hard coatings without cobalt intended to isolation components of PWR primary cooling system; Etude tribologique de revetements durs sans cobalt destines aux organes d`isolement du circuit primaire des REP

Energy Technology Data Exchange (ETDEWEB)

Cachon, L.

1995-10-18

The objective is to qualify coatings without cobalt to replace ``Stellites`` coatings in isolation valves of PWR primary cooling system, as Co is activated when passing in the reactor core and contaminated the cooling loop. Three families of coatings were tested: PVD thin films from 1 to 8 {mu}m monolayers of Cr/C{sub x} with x varying between 1.6 and 9.5 at% or multilayers of pure chromium and Cr/C{sub 1.6} at%, coatings with a thickness between 100 and 200 {mu}m of cermets NiCr{sub y} (y varying from 5 to 35 at%) matrix binding chromium or tungsten carbides, and thick coatings 2 mm thickness of cermets Nitronic 60 or Inconel 625 matrix binding 10, 20 or 30% titanium or niobium carbides. Stellite 6 (2 mm) is the reference coating for tribology. Coatings were qualified and selected by thermal shocks, corrosion and plane friction. The thin film and the thick families were disqualified by their destruction or by their high friction coefficient. Then coatings between 100 and 200 {mu}m were used in a valve mock-up working in PWR primary cooling system pressure and temperature conditions. Tests show that these coatings have better wear or tightness performances than stellite 6, except for a slightly higher friction coefficient. (A.B.).

Internal friction behaviours in Zr57Al10Ni12.4Cu15.6Nb5 bulk metallic glass

International Nuclear Information System (INIS)

Zhang Bo; Zu Fangqiu; Zhen Kang; Shui Jiapeng; Wen Ping

2002-01-01

The internal friction patterns of Zr 57 Al 10 Ni 12.4 Cu 15.6 Nb 5 bulk metallic glass (BMG) were investigated with different frequencies and heating rates. An internal friction peak with extremely large magnitude is observed in the internal friction curves as a function of temperature (Q -1 -T curves). The internal friction peak was fitted by an equation Q -1 =AX(T)/η, where A is a constant, X(T) is the fraction of the glass/supercooled liquid and the viscosity η obeys the Vogel-Fulcher-Tammann relation. We confirm that the internal friction peak originates from both of the glass transition and crystallization. The anomalous behaviours of the peak suggest that Zr 57 Al 10 Ni 12.4 Cu 15.6 Nb 5 BMG has a wide supercooled liquid region and the magnitude of the peak can be used to judge the glass forming ability (GFA) of the glass forming alloys. In addition, the internal friction technique proved to be a new powerful tool for studying structural relaxation and phase transition as well as the GFA of BMG. (author)

Arg156 in the AP2-domain exhibits the highest binding activity among the 20 individuals to the GCC box in BnaERF-B3-hy15, a mutant ERF transcription factor from Brassica napus

Directory of Open Access Journals (Sweden)

Jing Zhuang

2016-10-01

Full Text Available To develop mutants of the ERF factor with more binding activities to the GCC box, we performed in vitro directed evolution by using DNA shuffling and screened mutants through yeast one-hybrid assay. Here, a series of mutants were obtained and used to reveal key amino acids that induce changes in the DNA binding activity of the BnaERF-B3 protein. With the BnaERF-B3-hy15 as the template, we produced 12 mutants which host individual mutation of potential key residues. We found that amino acid 156 is the key site, and the other 18 mutants host the 18 corresponding individual amino acid residues at site 156. Among the 20 individuals comprising WT (Gly156, Mu3 (Arg156, and 18 mutants with other 18 amino acid residues, Arg156 in the AP2-domain is the amino acid residue with the highest binding activity to the GCC box. The structure of the α-helix in the AP2-domain affects the binding activity. Other residues within AP2-domain modulated binding activity of ERF protein, suggesting that these positions are important for binding activity. Comparison of the mutant and wild-type transcription factors revealed the relationship of protein function and sequence modification. Our result provides a potential useful resource for understanding the trans-activation of ERF proteins.

International distribution and age estimation of the Portuguese BRCA2 c.156_157insAlu founder mutation

DEFF Research Database (Denmark)

Peixoto, Ana; Santos, Catarina; Pinheiro, Manuela

2011-01-01

The c.156_157insAlu BRCA2 mutation has so far only been reported in hereditary breast/ovarian cancer (HBOC) families of Portuguese origin. Since this mutation is not detectable using the commonly used screening methodologies and must be specifically sought, we screened for this rearrangement...... individuals requesting predictive testing living in France and in the USA, all being Portuguese immigrants. After performing an extensive haplotype study in carrier families, we estimate that this founder mutation occurred 558 +/- 215 years ago. We further demonstrate significant quantitative differences...... HBOC families from Portugal or with Portuguese ancestry are specifically tested for this rearrangement....

New isomeric states in {sup 152,154,156}Nd produced by spontaneous fission of {sup 252}Cf

Energy Technology Data Exchange (ETDEWEB)

Gautherin, C.; Houry, M.; Korten, W.; Le Coz, Y.; Lucas, R.; Phan, X.H.; Theisen, C. [Commissariat l`Energie Atomique de Saclay, Gif sur Yvette (France). DSM/DAPINA/SPhN; Badimon, C.; Barreau, G.; Doan, T.P.; Pedemay, G. [Centre d`Etudes Nucleaires de Bordeaux-Gradignan, Domaine du Haut Vigneau, F-33175 Gradignan (France); Belier, G.; Girod, M.; Meot, V.; Peru, S. [Commissariat a l`Energie Atomique de Bruyeres-le-Chatel, DAM/SPN, BP12, F-91680 Bruyeres-le-Chatel (France); Astier, A.; Ducroux, L.; Meyer, M.; Redon, N. [Institut de Physique Nucleaire de Lyon, F-69622 Villeurbanne Cedex (France)

1998-04-01

Isomeric states have been observed in fission-fragments produced by spontaneous fission of {sup 252}Cf. These states are found in neutron rich nuclei of different structure and deformations. About 50 isomeric nuclei have been observed using coincidences between {gamma}-rays identified in EUROGAM II and fission fragments detected in photovoltaic cells (SAPhIR). Lifetimes in the range from 20 ns to 2{mu}s have been measured. Presented calculations based on HFB+D1S force on new measured isomeric states in the {sup 152,154,156}Nd show evidence for K-isomers. (orig.) With 8 figs., 27 refs.

Test of the X(5) symmetry in {sup 156}Dy and {sup 178}Os by measurement of electromagnetic transition probabilities; Test der X(5)-Symmetrie in {sup 156}Dy und {sup 178}Os durch Messung elektromagnetischer Uebergangswahrscheinlichkeiten

Energy Technology Data Exchange (ETDEWEB)

Moeller, O.

2005-07-01

This work reports on results from two Recoil-Distance-Doppler-Shift lifetime measurements of excited states in {sup 155}Dy and {sup 178}Os. The experiments were carried out at the GASP spektrometer of the Laboratori Nazional i di Legnaro in combination with the Cologne plunger apparatus. The main purpose of the performed experiments was to test the predictions of the X(5) critical point symmetry in these two nuclei. In {sup 156}Dy and {sup 178}Os 29 lifetimes of excited states were derived using the Differential-Decay-Curve method. In weaker reaction channels the nuclei {sup 155}Dy, {sup 157}Dy and {sup 177}Os were populated. In these nuclei 32 additional lifetimes were measured, most of them for the first time. In order to calculate absolute transition probabilities from the measured lifetimes of the first excited band in {sup 156}Dy, essential branching ratios were derived from the measured data with a very small systematic error (<5%). The most important results can be summarized as mentioned below: Lifetimes measured in the first excited band, confirm that this nucleus can be located close to the critical point X(5). With model calculations, special criteria of the X(5) model were found that can be used to identify other X(5)-like nuclei. Using these criterias a new region of X(5)-like nuclei could be suggested within the osmium isotopes in the A=180 mass region. The measured lifetimes in {sup 178}Os confirm the consistency of a X(5) description in these nuclei. A comparision with the well established X(5)-like nuclei in the N=90 isotones gives an agreement with the X(5) description of at least the same quality. (orig.)

Residual stress and crack initiation in laser clad composite layer with Co-based alloy and WC + NiCr

International Nuclear Information System (INIS)

Lee, Changmin; Park, Hyungkwon; Yoo, Jaehong; Lee, Changhee; Woo, WanChuck; Park, Sunhong

2015-01-01

Highlights: • Major problem, clad cracking in laser cladding process, was researched. • Residual stress measurements were performed quantitatively by neutron diffraction method along the surface of specimens. • Relationship between the residual stress and crack initiation was showed clearly. • Ceramic particle effect in the metal matrix was showed from the results of residual stress measurements. • Initiation sites of generating clad cracks were specifically studied in MMC coatings. - Abstract: Although laser cladding process has been widely used to improve the wear and corrosion resistance, there are unwanted cracking issues during and/or after laser cladding. This study investigates the tendency of Co-based WC + NiCr composite layers to cracking during the laser cladding process. Residual stress distributions of the specimen are measured using neutron diffraction and elucidate the correlation between the residual stress and the cracking in three types of cylindrical specimens; (i) no cladding substrate only, (ii) cladding with 100% stellite#6, and (iii) cladding with 55% stellite#6 and 45% technolase40s. The microstructure of the clad layer was composed of Co-based dendrite and brittle eutectic phases at the dendritic boundaries. And WC particles were distributed on the matrix forming intermediate composition region by partial melting of the surface of particles. The overlaid specimen exhibited tensile residual stress, which was accumulated through the beads due to contraction of the coating layer generated by rapid solidification, while the non-clad specimen showed compressive. Also, the specimen overlaid with 55 wt% stellite#6 and 45 wt% technolase40s showed a tensile stress higher than the specimen overlaid with 100% stellite#6 possibly, due to the difference between thermal expansion coefficients of the matrix and WC particles. Such tensile stresses can be potential driving force to provide an easy crack path ways for large brittle fractures

Residual stress and crack initiation in laser clad composite layer with Co-based alloy and WC + NiCr

Energy Technology Data Exchange (ETDEWEB)

Lee, Changmin; Park, Hyungkwon; Yoo, Jaehong [Division of Materials Science and Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Lee, Changhee, E-mail: chlee@hanyang.ac.kr [Division of Materials Science and Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Woo, WanChuck [Neutron Science Division, Korea Atomic Energy Research Institute, Daejeon 305-353 (Korea, Republic of); Park, Sunhong [Research Institute of Industrial Science & Technology, Hyo-ja-dong, Po-Hang, Kyoung-buk, San 32 (Korea, Republic of)

2015-08-01

Highlights: • Major problem, clad cracking in laser cladding process, was researched. • Residual stress measurements were performed quantitatively by neutron diffraction method along the surface of specimens. • Relationship between the residual stress and crack initiation was showed clearly. • Ceramic particle effect in the metal matrix was showed from the results of residual stress measurements. • Initiation sites of generating clad cracks were specifically studied in MMC coatings. - Abstract: Although laser cladding process has been widely used to improve the wear and corrosion resistance, there are unwanted cracking issues during and/or after laser cladding. This study investigates the tendency of Co-based WC + NiCr composite layers to cracking during the laser cladding process. Residual stress distributions of the specimen are measured using neutron diffraction and elucidate the correlation between the residual stress and the cracking in three types of cylindrical specimens; (i) no cladding substrate only, (ii) cladding with 100% stellite#6, and (iii) cladding with 55% stellite#6 and 45% technolase40s. The microstructure of the clad layer was composed of Co-based dendrite and brittle eutectic phases at the dendritic boundaries. And WC particles were distributed on the matrix forming intermediate composition region by partial melting of the surface of particles. The overlaid specimen exhibited tensile residual stress, which was accumulated through the beads due to contraction of the coating layer generated by rapid solidification, while the non-clad specimen showed compressive. Also, the specimen overlaid with 55 wt% stellite#6 and 45 wt% technolase40s showed a tensile stress higher than the specimen overlaid with 100% stellite#6 possibly, due to the difference between thermal expansion coefficients of the matrix and WC particles. Such tensile stresses can be potential driving force to provide an easy crack path ways for large brittle fractures

International distribution and age estimation of the Portuguese BRCA2 c.156_157insAlu founder mutation

DEFF Research Database (Denmark)

Peixoto, Ana; Santos, Catarina; Pinheiro, Manuela

2011-01-01

The c.156_157insAlu BRCA2 mutation has so far only been reported in hereditary breast/ovarian cancer (HBOC) families of Portuguese origin. Since this mutation is not detectable using the commonly used screening methodologies and must be specifically sought, we screened for this rearrangement...... individuals requesting predictive testing living in France and in the USA, all being Portuguese immigrants. After performing an extensive haplotype study in carrier families, we estimate that this founder mutation occurred 558 ± 215 years ago. We further demonstrate significant quantitative differences...... HBOC families from Portugal or with Portuguese ancestry are specifically tested for this rearrangement....

Entrance- and exit-channel effects and the suppression of neutron emission from 64Ni+92Zr→/sup 156/Er/sup */

International Nuclear Information System (INIS)

Love, D.J.G.; Bishop, P.J.; Kirwan, A.; Nolan, P.J.; Thornley, D.J.; Nelson, A.H.; Twin, P.J.

1986-01-01

High--angular-momentum components have been found in the cross section for /sup 64/Ni+/sup 92/Zr→/sup 156/Er /sup */ by γ-ray spectroscopy. They are expected to influence the known low evaporation-neutron multiplicity. The feeding pattern rules out significant trapping in superdeformed states at low spin, an explanation previously advanced. Simple coupled-channels calculations are consistent with the observations. The statistical model with high-l fusion enhanced consistently with observation reproduces the neutron multiplicity satisfactorily

Aspects of a Co-free hardfacing Materials Development to Reduce the Radioactivity in NPPs

Energy Technology Data Exchange (ETDEWEB)

Kim, Joung Soo; Kim, Hong Pyo [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Suh, Jeong Hun [Inss Tek Co., Daejeon (Korea, Republic of)

2007-07-01

For the last one or two decades, active researches to develop Co-free hardfacing materials in order to replace Co-base stellite alloys have been done to reduce the radioactivity in the primary systems in nuclear power plants(NPPs). However, Co-free materials having superior mechanical properties to stellite alloys have not been developed up to now. There are two ways to increase the performance characteristics of the key parts needed to be coated with hardfacing materials, thus resulting in replacing the Co-base stellite alloys with superior mechanical properties; one of them is to develop new Co-free materials with a better quality in performance than that of satellite alloys. The other is to use new coating techniques developed to increase the coated surface properties of already developed Co-free materials. In this study, the aspect of newly developed Co-free materials is reviewed and the necessity of the development of new Co-free materials is emphasized for the replacement of Co-base satellite alloys. In addition, a new coating technique, which is called a laser hardfacing(cladding) technique(LHT), is introduced and its advantage and applicability to the key parts in NPPs are discussed using our experimental results to improve the properties of a surface coated with existing Co-free hardfacing materials. The coating technique using a laser beam having a high energy density has unique advantages to obtain various microstructures such as crystalline, amorphous, porous, and nano structures and also to get coating layers having high a hardness to result in an excellent resistance to erosion corrosion and wear.

Effect of Heat Treatment on the Microstructure and Properties of HVOF-Sprayed Co-Cr-W Coating

Czech Academy of Sciences Publication Activity Database

Houdková, Š.; Smazalová, E.; Pala, Zdeněk

2016-01-01

Roč. 25, č. 3 (2016), s. 546-557 ISSN 1059-9630 Institutional support: RVO:61389021 Keywords : ASTM * G-65ASTM * Co-Cr-W * heat treatment * HVOF * Stellite 6 * wear Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 1.488, year: 2016

Numerical simulations of the cascades of the nuclei {sup 152,154,156}Dy with self-consistent collective strength functions

Energy Technology Data Exchange (ETDEWEB)

Khoo, T.L.; Lauritsen, T.; Martin, V.; Egido, J.L. [Universidad Autonoma de Madrid (Spain)

1995-08-01

Mean-field theories predict phase transitions in nuclei, such as a transition from collective to oblate shapes. However, fluctuations in the finite nucleus smear out the transition, and it is an interesting problem in mesoscopic physics to search for a remnant signature of the phase transition. Temperature-dependent Hartree-Fock theory predicts that the collective-to-oblate phase transition boundaries occur in a domain that can be favorably probed in experiments in {sup 152,154,156}Dy. These calculations were motivated by our past measurements of the quasicontinuum E2 spectra in these nuclei.

Lupic nephropathy: a case control study in Medellín, Colombia Nefropatía lúpica: estudio de 156 casos

OpenAIRE

Fernando Zambrano; Javier Molina; Carmen E. Cerón

1989-01-01

By means of a case-control study we analyzed the cllnlcal histories of 297 patients with systemic erythematous lupus, that were seen at the out-patient section of the Rheumatology Service, Hospital Universitario San Vicente de Paúl, in Medellín, Colombia, between 1970 and 1987. Renal involvement was documented in 156 (52.5%) cases while in 94 (31.6%) there were alterations in the urinary sediment without clinica...

Liquid impact erosion mechanism and theoretical impact stress analysis in TiN-coated steam turbine blade materials

International Nuclear Information System (INIS)

Lee, M.K.; Kim, W.W.; Rhee, C.K.; Lee, W.J.

1999-01-01

Coating of TiN film was done by reactive magnetron sputter ion plating to improve the liquid impact erosion resistance of steam turbine blade materials, 12Cr steel and Stellite 6B, for nuclear power plant application. TiN-coated blade materials were initially deformed with depressions due to plastic deformation of the ductile substrate. The increase in the curvature in the depressions induced stress concentration with increasing number of impacts, followed by circumferential fracture of the TiN coating due to the circular propagation of cracks. The liquid impact erosion resistance of the blade materials was greatly improved by TiN coating done with the optimum ion plating condition. Damage decreased with increasing TiN coating thickness. According to the theoretical analysis of stresses generated by liquid impact, TiN coating alleviated the impact stress of 12Cr steel and Stellite 6B due to stress attenuation and stress wave reactions such as reflection and transmission at the coating-substrate interface

Liquid Impact Erosion Mechanism and Theoretical Stress Analysis in TiN-Coated Turbine Blade

International Nuclear Information System (INIS)

Lee, M. K.; Kim, W. W.; Kim, S. J.; Rhee, C. K.; Kim, Y. S.

2000-01-01

Coating of TiN film was done by reactive magnetron sputter ion plating to improve the liquid impact erosion resistance of steam turbine blade materials, 12Cr steel and Stellite 6B, for nuclear power plant application. TiN coated blade materials were initially deformed with depressions due to plastic deformation of the ductile substrate. The increase in the curvature in the depressions induced stress concentration with increasing number of impacts, followed by circumferential fracture of the TiN coating due to the circular propagation of cracks. The liquid impact erosion resistance of the blade materials was greatly improved by TiN coating done with the optimum ion plating condition. Damage decreased with increasing TiN coating thickness. According to the theoretical analysis of stresses generated by liquid impact, TiN coating alleviated the impact stress of 12Cr steel and Stellite 6B due to stress attenuation and stress wave reactions such as reflection and transmission at the coating substrate interface

Study of the (p,px) reaction at 156 MeV on some light nuclei; Etude de la reaction (p,px) a 156 Mev sur quelques noyaux legers

Energy Technology Data Exchange (ETDEWEB)

Bachelier, Daniel

1971-05-04

This research thesis reports the study of four quasi-elastic diffusion reactions of (p,px) type at 156 MeV: {sup 6}Li(p,pd ){sup 4}He, {sup 6}Li(p,pr){sup 3}H, {sup 7}Li(p,pt){sup 4}He and {sup 12}C(p,pd){sup 10}B. The objectives were to check the quasi-elastic character of these reactions and to describe them by pulse approximations with plane waves, to study their selection rules and to understand their angular correlations with respect to momentum distribution in the target nucleus of ejected substructures (clusters), to compare the probabilities of different configurations corresponding to different models, and, in the case of carbon, to compare the experimental energy spectrum with theoretical predictions. After a discussion of the theoretical expression of the cross-section of a quasi-elastic reaction, and a presentation of the different nuclear models which have been used for this reaction type, the author reports the study of the kinematics of these reactions by defining the conditions under which the knock-out mechanism is promoted. The author describes the beam, targets, detectors and electronic devices used for this study. He addresses the methods used to identify events and to analyse results. Experimental results are presented and compared with theoretical results and with other published experimental results.

Study of fish attraction by platform THE 156, BMCAL4-BA-Brazil; Estudo sobre a atracao de peixes na plataforma de perfuracao THE 156, BMCAL4-Ba-Brasil

Energy Technology Data Exchange (ETDEWEB)

Bertoncini, Athila A.; Jardweski, Cleiton F.; Daros, Felippe; Diogo, Hugo R.L.; Fraga, Adriana P.C. [SOMA, Belo Horizonte, MG (Brazil); Sampaio, Claudio L. [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil)

2008-07-01

To monitor the attraction effect of THE156 platform over the fisheries resources in shallow waters, close to coral reefs, at BM-CAL-4, underwater visual census (UVC) and video-census methods were used, along five reefs and the platform during three distinct moments: before, during and after the drilling operations. A total of 124 species were identified. The richest fish families were: Serranidae, Labridae, Haemulidae, Scaridae, Lutjanidae and Pomacentridae. Multi dimensional scaling analysis considering distinct moments and areas, pointed out three main groups. The largest, composed by natural reefs, and two other groups composed by the platform in distinct moments, before and after the operations. Since the template was left in the area after the drilling operations, this was the main factor contributing to create the latest group. This structure allowed an increment in abundance and species richness, creating a singular fish community, which inhabited the platform previously during its operation. The sampling design had as a hypothesis, an scale of impact in which if the platform could cause any impact over the fish communities, the closer reefs would be the first ones to be impacted. Considering this strategy, the differences found during the monitoring period, which occurred in the most southern reef area, do not characterize a direct impact of the platform over the natural reefs. (author)

156 Viviendas Industrializadas en Vitoria-Gasteiz

Directory of Open Access Journals (Sweden)

López del Corral, J. J.

2009-03-01

Full Text Available In 2004, VISESA announced a Grant for Research on Industrialized Housing Structures that was awarded to the Pich-Aguilera team. Their survey identified a series of energy-related, social and economic aspects in modern construction that could be optimized by system industrialization. * System assessed in the survey: – Facade cladding. – Frame (columns and beams. – Three-dimensional aspects (horizontal/vertical surfaces, standard rooms, modules. – Composite construction in frame, cladding and modules.* Analysis of construction contracting, associations and companies. * Comparative analysis of industrialized and traditional construction. Taking the theoretical data and conclusions of the survey funded by the grant as a basis, and in light of the industrialization strategy laid down in the Basque Country Regional Government’s Housing Guidelines and VISESA’s Strategic and Management Plans, concrete manufacturers in the Basque Country and surrounding autonomous communities were contacted to determine the industrial feasibility of a specific construction project. With these findings in hand, the research grant was extended to include a specific architectural design: 156 housing units on lot RC.33 in Sector 6 at Zabalgana, Vitoria-Gasteiz, whose main characteristics are: – G+8+penthouse, doubling the height of isostatic concrete buildings erected in Spain to date. – Industrialized structure and enclosures (3-storey columns, isostatic portal frames stiffened with steel tie rods and slab topping. – Curved steel roof and steel joints between columns (high strength bolts. – Industrialized construction system (process, not only as the sum of elements, but minimizing material and energy consumption, raising the guarantee of final finish quality and improving working conditions and site safety. The construction design (PICH-AGUILERA and structure by BOMA was concluded with construction solutions NOT dependent upon specific patents; the

Deposição por plasma com arco transferido Hardfacing by plasma transfer arc process

Directory of Open Access Journals (Sweden)

Víctor Vergara Díaz

2010-03-01

Full Text Available Em virtude do Processo de Soldagem Plasma com Alimentação de Pó ter similaridades com o Processo de Soldagem Plasma com Alimentação de Arame, foi realizado um estudo comparativo entre ambos os processos utilizando-se a liga a base de cobalto comercialmente conhecida como Stellite 6, como material de adição na forma de pó e arame. A pesquisa foi realizada com a expectativa de ser aplicada nas operações de revestimentos de superfícies, em especial em pás de turbinas hidráulicas desgastadas por cavitação. A seleção do material de adição a ser empregado depende da natureza do mecanismo de desgaste encontrado. No Labsolda, a liga Stellite 6 vem sendo uma das mais utilizadas, por apresentar uma excelente resistência ao desgaste erosivo por cavitação. Foi avaliada a influência da vazão de gás de plasma a partir dos valores de diluição, dimensões do cordão, dureza e microestrutura. O Processo de Soldagem Plasma com Alimentação de Pó foi o que produziu o melhor acabamento superficial, menor diluição, melhor molhamento e maior largura. Com isto abre-se uma nova perspectiva para revestimentos metálicos e neste contexto se insere a recuperação por soldagem de partes erodidas de turbinas hidráulicas.The Plasma powder transferred arc welding process, which uses feed stock in the powder form, has similarities with Plasma wire transferred arc welding. This work describes a comparative study of the two processes using a Cobalt-based alloy commercially known as Stellite 6. This Co-based alloy is recognized for its superior cavitation erosion resistance. The aim of this work is to investigate the potential of PTA coatings for the protection and refurbishiment hydraulic turbine blades. Coatings were evaluated for the influence of Plasma gas flow rate on coating dilution, geometry, hardness and microstructure. Coatings processed with the atomized Stellite 6 powder feestock showed a superior surface quality, lower dilution

Surface engineering with lasers : an application to Co-base materials

NARCIS (Netherlands)

de Hosson, J.T.M.; de Mol van Otterloo, J.L.; Boerstoel, B.M.; Huis in 't Veld, A.J.; Sarton, LAJ; Zeedijk, HB

1997-01-01

The present paper concentrates on the applications of CO2 laser treatments to enhance fretting wear properties of stainless steel. Stainless steel 316 is used as substrate material. Powder particles of the various stellites with sizes ranging between 45 and 125 mu m are fed onto the surface. It was

Synthesis and characterization of Bi{sub 1.56}Sb{sub 1.48}Co{sub 0.96}O{sub 7} pyrochlore sun-light-responsive photocatalyst

Energy Technology Data Exchange (ETDEWEB)

Naceur, Benhadria, E-mail: nacer1974@yahoo.fr [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria); Abdelkader, Elaziouti, E-mail: elaziouti_a@yahoo.com [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria); Dr Moulay Tahar University, Saida (Algeria); Nadjia, Laouedj, E-mail: nlaouedj@yahoo.fr [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria); Dr Moulay Tahar University, Saida (Algeria); Sellami, Mayouf, E-mail: Mourad7dz@yahoo.fr [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria); Noureddine, Bettahar, E-mail: nbettahar2001@yahoo.fr [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria)

2016-02-15

Graphical abstract: Heterogeneous photo Fenton process with dye sensitized mechanism of RhB by Bi{sub 1.56}Sb{sub 1.48}Co{sub 0.96}O{sub 7} compound. - Highlights: • Bi{sub 1.56}Sb{sub 1.48}Co{sub 0.96}O{sub 7} (BSCO) catalyst was synthesized by improved solid state reaction method. • BSCO/H{sub 2}O{sub 2}/UVA and BSCO/H{sub 2}O{sub 2}/SL catalyst systems exhibit excellent photocatalytic activities for rhodamine B. • The photocatalytic degradation was preceded via heterogeneous photo Fenton mechanism process. • ·OH radicals are the main reactive species for the degradation of RhB. - Abstract: Novel nanostructure pyrochlore Bi{sub 1.56}Sb{sub 1.48}Co{sub 0.96}O{sub 7} was successfully synthesized via solid state reaction method in air. The as-synthesized photocatalyst was characterized by X-ray diffraction, Scanning electron microscopy and UV–vis diffuse reflectance spectroscopy techniques. The results showed that the BSCO was crystallized with the pyrochlore-type structure, cubic crystal system and space group Fd3m. The average particle size and band gap for BSCO were D = 76.29 nm and E{sub g} = 1.50 eV respectively. Under the optimum conditions for discoloration of the dye: initial concentration of 20 mg L{sup −1} RhB, pH 7, 25 °C, 0.5 mL H{sub 2}O{sub 2} and BSCO/dye mass ration of 1 g L{sup −1}, 97.77 and 90.16% of RhB were removed with BSCO/H{sub 2}O{sub 2} photocatalytic system within 60 min of irradiation time under UVA- and SL irradiations respectively. Pseudo-second-order kinetic model gave the best fit, with highest correlation coefficients (R{sup 2} ≥ 0.99). On the base of these results, the mechanism of the enhancement of the discoloration efficiency was discussed. .

Photometric and Spectroscopic Survey of the Cluster [DBS2003] 156 Associated with the H II Region G331.1-0.5

Science.gov (United States)

Pinheiro, M. C.; Ortiz, R.; Abraham, Z.; Copetti, M. V. F.

2016-05-01

The Norma section of the Milky Way is especially interesting because it crosses three spiral arms: Sagittarius-Carina, Scutum-Crux and the Norma arm itself. Distance determinations of embedded young stellar clusters can contribute to define the spiral structure in this part of the Galaxy. However, spectrophotometric distances were obtained for only a few of these clusters in Norma. We present a photometric and spectroscopic study in the NIR of the [DBS2003] 156 stellar cluster, associated with the H II region G331.1-0.5. We aim to find the ionizing sources of the H II region and determine its distance. The cluster was observed in the J, H, and {K}{{s}} bands and eight potential massive stars were chosen among the detected sources according to color criteria; subsequent spectroscopy of these candidates was performed with the Ohio State Infrared Imager/Spectrometer spectrograph attached to the Southern Observatory for Astrophysical Research 4.1 m telescope. We identified and classified spectroscopically four early-type stars: IRS 176 (O8 V), IRS 308 (O-type), IRS 310 (O6 V), and IRS 71 (B1 Iab). Based on the proximity of IRS 176 and 308 with the radio continuum emission peaks and their relative positions with respect to the warm dust mid-infrared emission, we concluded that these two stars are the main ionizing sources of the H ii region G331.1-0.5. The mean spectrophotometric distance of IRS 176 and 310 of 3.38 ± 0.58 kpc is similar to that obtained in a previous work for two early-type stars of the neighbor cluster [DBS2003] 157 of 3.29 ± 0.58 kpc. The narrow range of radial velocities of radio sources in the area of the clusters [DBS2003] 156 and 157 and their similar visual extinction indicate that these clusters are physically associated. A common distance of 3.34 ± 0.34 kpc is derived for the system [DBS2003] 156 and 157. Based on observations obtained at the Southern Observatory for Astrophysical Research (SOAR), a joint project of the Ministério de Ci

Vitrification and determination of the crystallization time scales of the bulk-metallic-glass-forming liquid Zr58.5Nb2.8Cu15.6Ni12.8Al10.3

International Nuclear Information System (INIS)

Hays, C. C.; Schroers, J.; Johnson, W. L.; Rathz, T. J.; Hyers, R. W.; Rogers, J. R.; Robinson, M. B.

2001-01-01

The crystallization kinetics of Zr 58.5 Nb 2.8 Cu 15.6 Ni 12.8 Al 10.3 were studied in an electrostatic levitation (ESL) apparatus. The measured critical cooling rate is 1.75 K/s. Zr 58.5 Nb 2.8 Cu 15.6 Ni 12.8 Al 10.3 is the first bulk-metallic-glass-forming liquid that does not contain beryllium to be vitrified by purely radiative cooling in the ESL. Furthermore, the sluggish crystallization kinetics enable the determination of the time-temperature-transformation (TTT) diagram between the liquidus and the glass transition temperatures. The shortest time to reach crystallization in an isothermal experiment; i.e., the nose of the TTT diagram is 32 s. The nose of the TTT diagram is at 900 K and positioned about 200 K below the liquidus temperature

Contribution to the replacement of cobalt-free hardfacing coating by laser cladding in fast neutron reactors

International Nuclear Information System (INIS)

De-Tran, Van

2014-01-01

This thesis contributes to the replacement of the coating of Stellite 6 which is used in friction areas for the primary circuit of the fast neutron reactor. It contains three parts: 1) A literature review for selecting the materials and the deposition process 2) A parametric study to get healthy deposits (good adhesion with the substrate, little porosity, no cracks, low dilution) 3) A study wear behavior of deposits obtained, at high temperature (200 C) under an atmosphere inert gas, to determine the wear resistance of materials selected without the influence of an eventual oxidation layer. From the literature review, it appears the following choices implemented in our study: * the method laser cladding with advantages such as: - Good adhesion (metallurgical) - High cooling speed - Low dilution rate - Wide parametric range * two nickel-based alloys: Colmonoy-52 and Tribaloy-700. These alloys have good dry wear behavior and could be deposited by the laser. In the manufacturing part of the healthy deposit, firstly, we characterized the metal powder. Then, a parametric study was performed to look for a good parametric range that makes us getting a healthy deposit of Stellite 6 (reference) of Colmonoy-52 and Tribaloy-700. In this case, relationships among three main process parameters laser cladding (laser beam power, surface scanning speed, rate of powder) with the microstructure and chemical composition of the deposit are studied. In study the wear behavior, a pin-on-disc type of tribological was used and tests were carried out in argon at room temperature and 200 C. We investigated the wear mechanism of the best deposition of Stellite 6, Colmonoy-52 and Tribaloy-700. The wear resistance of these materials were thoroughly compared. (author) [fr

APPLICATION OF QC TOOLS FOR CONTINUOUS IMPROVEMENT IN AN EXPENSIVE SEAT HARDFACING PROCESS USING TIG WELDING

Directory of Open Access Journals (Sweden)

Mohammed Yunus

2016-09-01

Full Text Available The present study is carried out to improve quality level by identifying the prime reasons of the quality related problems in the seat hardfacing process involving the deposition of cobalt based super alloy in I.C. Engine valves using TIG welding process. During the Process, defects like stellite deposition overflow, head melt, non-uniform stellite merging, etc., are observed and combining all these defects, the rejection level was in top position in Forge shop. We use widely referred QC tools of the manufacturing field to monitor the complete operation and continuous progressive process improvement to ensure ability and efficiency of quality management system of any firm. The work aims to identify the various causes for the rejection by the detailed study of the operation, equipment, materials and the various process parameters that are very important to get defects-free products. Also, to evolve suitable countermeasures for reducing the rejection percentage using seven QC tools. To further understand and validate the obtained results, we need to address other studies related to motivations, advantages, and disadvantages of applying quality control tools.

Wear Test Results of Candidate Materials for the OK-542 Towed Array Handling Machine Level Winder

Science.gov (United States)

1994-12-29

10 6. Wear Testing Photograph B ....................................................... .11 7. Clad Inconel 625 ...interfere with this wear test. Other materials that were tested included Inconel 625 , Titanium, 304 Stainless, 316 Stainless, and Ni-Al-Br. All of these...Stainless Steel, Inconel 625 , Nickel-Aluminum-Bronze, and Titanium. The specialty materials: Inconel 625 , Monel, Stainless and Stellite, were clad-welded

Study of a new magnetic dipole mode in the heavy deformed nuclei 154Sm, 156Gd, 158Gd, 164Dy, 168Er, and 174Yb by high-resolution electron spectroscopy

International Nuclear Information System (INIS)

Bohle, D.

1985-01-01

By inelastic electron scattering with high energy resolution a new magnetic dipole mode in heavy, deformed nuclei could be detected. For this the nuclei 154 Sm, 156 Gd, 158 Gd, 164 Dy, 168 Er, and 174 Yb were studied at the Darmstadt electron linear accelerator (DALINAC) at small momentum transfer q ≤ 0.6 fm -1 and low excitation energies. A collective magnetic dipole excitation could be discovered in all nuclei at an excitation energy of E x ≅ 66 δA -1/3 MeV whereby δ means the mass deformation. The transition strength extends in the mean to B(M1)↑ ≅ 1.3 μ N 2 . A systematic study of the nucleus 156 Gd yielded hints to a strong fragmentation of the magnetic dipole strength. A comparison of electron scattering, proton scattering, and nuclear resonance fluorescence experiments shows that the new mode is a pure orbital mode. (orig./HSI) [de

Study of the (p,px) reaction at 156 MeV on some light nuclei

International Nuclear Information System (INIS)

Bachelier, Daniel

1971-01-01

This research thesis reports the study of four quasi-elastic diffusion reactions of (p,px) type at 156 MeV: 6 Li(p,pd ) 4 He, 6 Li(p,pr) 3 H, 7 Li(p,pt) 4 He and 12 C(p,pd) 10 B. The objectives were to check the quasi-elastic character of these reactions and to describe them by pulse approximations with plane waves, to study their selection rules and to understand their angular correlations with respect to momentum distribution in the target nucleus of ejected substructures (clusters), to compare the probabilities of different configurations corresponding to different models, and, in the case of carbon, to compare the experimental energy spectrum with theoretical predictions. After a discussion of the theoretical expression of the cross-section of a quasi-elastic reaction, and a presentation of the different nuclear models which have been used for this reaction type, the author reports the study of the kinematics of these reactions by defining the conditions under which the knock-out mechanism is promoted. The author describes the beam, targets, detectors and electronic devices used for this study. He addresses the methods used to identify events and to analyse results. Experimental results are presented and compared with theoretical results and with other published experimental results

Interpretation of bathymetric and magnetic data from the easternmost segment of Australian-Antarctic Ridge, 156°-161°E

Science.gov (United States)

Choi, H.; Kim, S.; Park, S.

2013-12-01

From 2011 to 2013, Korea Polar Research Institute (KOPRI) conducted a series of geophysical and geochemical expeditions on the longest and easternmost segment of Australian-Antarctic Ridge, located at 61°-63°S, and 156°-161°E. This ridge segment plays an important role in constraining the tectonics of the Antarctic plate. Using IBRV ARAON, the detailed bathymetric data and eleven total magnetic profiles were collected. The studied ridge has spread NNW-SSE direction and tends to be shallower to the west and deeper to the east. The western side of the ridge (156°-157.50°E) shows a broad axial high and a plenty of seamounts as an indicative of massive volcanism. Near the center of the ridge (158°-159°E), a seamount chain is formed stretching toward the south from the ridge. Also, the symmetric seafloor fabric is clearly observed at the eastern portion (158.50°-160°E) of the seamount chain. From the topographic change along the ridge axis, the western part of the ridge appears to have a sufficient magma supply. On the contrary, the eastern side of the ridge (160°-161°E) is characterized by axial valley and relatively deeper depth. Nevertheless, the observed total magnetic field anomalies exhibit symmetric patterns across the ridge axis. Although there have not been enough magnetic survey lines, the spreading rates of the ridge are estimated as the half-spreading rate of 37.7 mm/y and 35.3 mm/y for the western portion of the ridge and 42.3 mm/y for the eastern portion. The studied ridge can be categorized as an intermediate spreading ridge, confirming previous studies based on the spreading rate of global ridge system. Here we will present the preliminary results on bathymetric changes along the ridge axis and its relationship with melt supply distribution, and detailed magnetic properties of the ridge constrained by the observed total field anomalies.

Laser stereolithography by multilayer cladding of metal powders

Science.gov (United States)

Jendrzejewski, Rafal; Rabczuk, Grazyna T.; Zaremba, R.; Sliwinski, Gerard

1998-07-01

3D-structures obtained by means of laser cladding of the metal alloy powders: bronze B10 and stellite 6 and the process parameters are studied experimentally. The structures are made trace-on-trace by remelting of the metal powder injected into the focusing region of the 1.2 kW CO2 laser beam. For the powder and sample feeding rates of 8-22 g/min and 0.4-1.2 m/min, respectively, and the applied beam intensities not exceeding 2 X 105 W cm-2 the process is stable and regular traces connected via fusion zones are produced for each material. The thickness of these zones does not exceed several per cent of the layer height. The process results in the efficient formation of multilayer structures. From their geometry the effect of energy coupling and interaction parameters are deduced. Moreover, the microanalysis by means of SEM- and optical photographs of samples produced under different experimental conditions confirms the expected mechanical properties, low porosity and highly homogenous structure of the multilayers. In addition to the known material stellite 6 the bronze B10 is originally proposed for a rapid prototyping.

The Polymorphism of DNA Repair Gene ERCC2/XPD Arg156Arg and Susceptibility to Breast Cancer in a Chinese Population

DEFF Research Database (Denmark)

Yin, J. Y.; Liang, D. H.; Vogel, Ulla Birgitte

2009-01-01

Polymorphisms in DNA repair genes are good candidates for modifying cancer risk. ERCC2/XPD, a gene involved in nucleotide excision repair and basal transcription, may influence individual DNA repair capacity, particularly of bulky adducts. This is implicated in cancer susceptibility. To detect...... found between ERCC2/XPD Arg156Arg and risk of breast cancer (AA/AC versus CC: OR = 0.79, 95% CI = 0.49-1.28, P = 0.33; AA versus CC: OR = 0.89, 95% CI = 0.49-1.63, P = 0.72; AC versus CC: OR = 0.74, 95% CI = 0.44-1.24, P = 0.25). Breast cancer cases with the variant AA genotype were marginally younger...

The Diagnosis and Surgical Treatment for Solitary Pulmonary Metastases: A Report of 156 Cases

Directory of Open Access Journals (Sweden)

Hui ZHANG

2012-04-01

Full Text Available Background and objective In recent years, it has been proven that surgical treatment for solitary pulmonary metastases has achieved satisfactory results. Consequently, the study aims to investigate the diagnosis, indications for surgery, operative techniques, and prognostic factors of the surgical resection for solitary pulmonary metastases, and to improve the survival rate of patients with pulmonary metastases. Methods The medical records of 156 patients with surgical procedures at our institution were retrospectively reviewed. Results The primary tumors were verified as cancer in 134 cases, sarcoma in 21, and 1 contained unknown tissue. There was no perioperative mortality. A total of 153 patients returned for follow up. Follow-up time was 1 yr to 10 yr. The 5-year survival rates were 31.2%. The median survival time was 35.8 months. Systematic lymph node dissection was performed in 113 patients. The 5-year survival rates were 12.5% for lymph node-positive patients and 37.3% for lymph node–negative patients. The patients who underwent lobectomies had better survival rates, with a 5-year survival rate of 38.5%. Conclusion Surgery is recommended for patients with solitary pulmonary metastasis if they fulfill the surgical indications and favorable outcomes can be achieved. VATS can be chosen for the patients. Hilar and mediastinal lymph node involvement and the surgical approach are potentially important prognostic factors.

Chromium Elimination and Cannon Life Extension for Gun Tubes

Science.gov (United States)

2012-08-30

the use of hexavalent chromium (VI) in the production of cannon barrels by developing a cost effective environmentally friendly Explosive Bonding...erosion- resistant chrome cobalt alloy matrix with 15% tungsten. Stellite is used as M60 machine gun barrel liner. Tantalum Cobalt Tungsten...Grounds (YPG) Preliminary proof of principle endurance testing at YPG shows promising results when conducted side by side to a chrome plated

Cost Estimate for Gun Liner Emplacement

Science.gov (United States)

2011-08-01

excellent material to resist wear and erosion in gun tubes, it is applied by an electrolytic process that involves hexavalent chromium, a known carcinogen...A recent Department of Defense memorandum has strongly urged that, wherever possible, processes involving hexavalent chromium be eliminated from...might be affordable.) Other refractory metals, such as the Stellite series, BioDur CCM* (a cobalt, chrome , molybdenum alloy), or niobium are less

Report on measurements at the pump Avala - Annex 7

International Nuclear Information System (INIS)

Nikolic, M.

1963-01-01

Visual inspection and measuring results have shown that the surface of the upper pump bearing is much more worn-out than the lower radial bearing. This has proved that most of the cobalt (contained in the stellite alloy) came from the upper pump bearings. It could be stated that about 60 grams of cobalt from the upper pump bearings could come into the coolant system [sr

Hard alloys testing-machine for values of PWR primary coolant circuits

International Nuclear Information System (INIS)

Campan, J.L.; Sauze, A.

1980-01-01

Testing of valve parts or material used in valve fabrication and particularly seizing conditions in friction of plane surfaces coated with hard alloys of the type stellite. The testing equipment called Marguerite is composed of a hot pressurized water loop in conditions similar to PWR primary coolant circuits (320 0 C, 150 bars) and a testing-machine with measuring instruments. Testing conditions and samples are described [fr

ALARA efforts in nordic BWRs

Energy Technology Data Exchange (ETDEWEB)

Ingemansson, T.; Lundgren, K.; Elkert, J. [ABB Atom, Vaesteraes (Sweden)

1995-03-01

Some ALARA-related ABB Atom projects are currently under investigation. One of the projects has been ordered by the Swedish Radiation Protection Institute, and two others by the Nordic BWR utilities. The ultimate objective of the projects is to identify and develop methods to significantly decrease the future exposure levels in the Nordic BWRS. As 85% to 90% of the gamma radiation field in the Nordic BWRs originates from Co-60, the only way to significantly decrease the radiation doses is to effect Co and Co-60. The strategy to do this is to map the Co sources and estimate the source strength of Co from these sources, and to study the possibility to affect the release of Co-60 from the core surfaces and the uptake on system surfaces. Preliminary results indicate that corrosion/erosion of a relatively small number of Stellite-coated valves and/or dust from grinding of Stellite valves may significantly contribute to the Co input to the reactors. This can be seen from a high measured Co/Ni ratio in the feedwater and in the reactor water. If stainless steel is the only source of Co, the Co/Ni ratio would be less than 0.02 as the Co content in the steel is less than 0.2%. The Co/Ni ratio in the reactor water, however, is higher than 0.1, indicating that the major fraction of the Co originates from Stellite-coated valves. There are also other possible explanations for an increase of the radiation fields. The Co-60 inventory on the core surfaces increases approximately as the square of the burn-up level. If the burn-up is increased from 35 to 5 MWd/kgU, the Co-60 inventory on the core surfaces will be doubled. Also the effect on the behavior of Co-60 of different water chemistry and materials conditions is being investigated. Examples of areas studied are Fe and Zn injection, pH-control, and different forms of surface pre-treatments.

Superconductivity in La1.56Sr0.44CuO4/La2CuO4 Superlattices

International Nuclear Information System (INIS)

Bozovic, I.; Suter, A.; Morenzoni, E.; Prokscha, T.; Luetkens, H.; Wojek, B.M.; Logvenov, G.; Gozar, A.

2011-01-01

Superlattices of the repeated structure La 1.56 Sr 0.44 CuO 4 /La 2 CuO 4 (LSCO-LCO), where none of the constituents is superconducting, show a superconducting transition of T(prime) c 25 K. In order to elucidate the nature of the superconducting state we have performed a low-energy μSR study. By applying a magnetic field parallel (Meissner state) and perpendicular (vortex state) to the film planes, we could show that superconductivity is sheet like, resulting in a very anisotropic superconducting state. This result is consistent with a simple charge-transfer model, which takes into account the layered structure and the difference in the chemical potential between LCO and LSCO, as well as Sr interdiffusion. Using a pancake-vortex model we could estimate a strict upper limit of the London penetration depth to 380 nm in these superlattices. The temperature dependence of the muon depolarization rate in field cooling experiments is very similar to what is observed in intercalated BSCCO and suggests that vortex-vortex interaction is dominated by electromagnetic coupling but negligible Josephson interaction.

In silico Prediction, in vitro Antibacterial Spectrum, and Physicochemical Properties of a Putative Bacteriocin Produced by Lactobacillus rhamnosus Strain L156.4

Directory of Open Access Journals (Sweden)

Letícia de C. Oliveira

2017-05-01

Full Text Available A bacteriocinogenic Lactobacillus rhamnosus L156.4 strain isolated from the feces of NIH mice was identified by 16S rRNA gene sequencing and MALDI-TOF mass spectrometry. The entire genome was sequenced using Illumina, annotated in the PGAAP, and RAST servers, and deposited. Conserved genes associated with bacteriocin synthesis were predicted using BAGEL3, leading to the identification of an open reading frame (ORF that shows homology with the L. rhamnosus GG (ATCC 53103 prebacteriocin gene. The encoded protein contains a conserved protein motif associated a structural gene of the Enterocin A superfamily. We found ORFs related to the prebacteriocin, immunity protein, ABC transporter proteins, and regulatory genes with 100% identity to those of L. rhamnosus HN001. In this study, we provide evidence of a putative bacteriocin produced by L. rhamnosus L156.4 that was further confirmed by in vitro assays. The antibacterial activity of the substances produced by this strain was evaluated using the deferred agar-spot and spot-on-the lawn assays, and a wide antimicrobial activity spectrum against human and foodborne pathogens was observed. The physicochemical characterization of the putative bacteriocin indicated that it was sensitive to proteolytic enzymes, heat stable and maintained its antibacterial activity in a pH ranging from 3 to 9. The activity against Lactobacillus fermentum, which was used as an indicator strain, was detected during bacterial logarithmic growth phase, and a positive correlation was confirmed between bacterial growth and production of the putative bacteriocin. After a partial purification from cell-free supernatant by salt precipitation, the putative bacteriocin migrated as a diffuse band of approximately 1.0–3.0 kDa by SDS-PAGE. Additional studies are being conducted to explore its use in the food industry for controlling bacterial growth and for probiotic applications.

In silico Prediction, in vitro Antibacterial Spectrum, and Physicochemical Properties of a Putative Bacteriocin Produced by Lactobacillus rhamnosus Strain L156.4

Science.gov (United States)

Oliveira, Letícia de C.; Silveira, Aline M. M.; Monteiro, Andréa de S.; dos Santos, Vera L.; Nicoli, Jacques R.; Azevedo, Vasco A. de C.; Soares, Siomar de C.; Dias-Souza, Marcus V.; Nardi, Regina M. D.

2017-01-01

A bacteriocinogenic Lactobacillus rhamnosus L156.4 strain isolated from the feces of NIH mice was identified by 16S rRNA gene sequencing and MALDI-TOF mass spectrometry. The entire genome was sequenced using Illumina, annotated in the PGAAP, and RAST servers, and deposited. Conserved genes associated with bacteriocin synthesis were predicted using BAGEL3, leading to the identification of an open reading frame (ORF) that shows homology with the L. rhamnosus GG (ATCC 53103) prebacteriocin gene. The encoded protein contains a conserved protein motif associated a structural gene of the Enterocin A superfamily. We found ORFs related to the prebacteriocin, immunity protein, ABC transporter proteins, and regulatory genes with 100% identity to those of L. rhamnosus HN001. In this study, we provide evidence of a putative bacteriocin produced by L. rhamnosus L156.4 that was further confirmed by in vitro assays. The antibacterial activity of the substances produced by this strain was evaluated using the deferred agar-spot and spot-on-the lawn assays, and a wide antimicrobial activity spectrum against human and foodborne pathogens was observed. The physicochemical characterization of the putative bacteriocin indicated that it was sensitive to proteolytic enzymes, heat stable and maintained its antibacterial activity in a pH ranging from 3 to 9. The activity against Lactobacillus fermentum, which was used as an indicator strain, was detected during bacterial logarithmic growth phase, and a positive correlation was confirmed between bacterial growth and production of the putative bacteriocin. After a partial purification from cell-free supernatant by salt precipitation, the putative bacteriocin migrated as a diffuse band of approximately 1.0–3.0 kDa by SDS-PAGE. Additional studies are being conducted to explore its use in the food industry for controlling bacterial growth and for probiotic applications. PMID:28579977

Substitutions at NS3 Residue 155, 156, or 168 of Hepatitis C Virus Genotypes 2 to 6 Induce Complex Patterns of Protease Inhibitor Resistance

DEFF Research Database (Denmark)

Jensen, Sanne B.; Serre, Stephanie B. N.; Humes, Daryl G.

2015-01-01

to nine PIs (telaprevir, boceprevir, simeprevir, asunaprevir, vaniprevir, faldaprevir, paritaprevir, deldeprevir, and grazoprevir) in Huh7.5 cells. We found that most variants showed decreased fitness compared to original viruses. Overall, R155K-, A156G/S-, and D/Q168A/E/H/N/V-variants showed highest...... resistant. For the remaining PIs, most genotype 2-, 4-, 5-, and 6-, but not genotype 3-variants, showed varying resistance levels. Overall, grazoprevir (MK-5172) had the highest efficacy against original viruses and variants.This is the first comprehensive study revealing the impact of described key PI...

Effect of tungsten-187 in primary coolant on dose rate build-up in Vandellos 2

International Nuclear Information System (INIS)

Fernandez Lillo, E.; Llovet, R.; Boronat, M.

1994-01-01

The present work proposes a relationship between the Cobalt-60 piping deposited activity and the relatively high levels of Tungsten-187 in the coolant of Vandellos 2. The conclusions of this work can be applicable to other plants, since it proposes a tool to estimate and quantify the contribution of stellite to the generation of Cobalt-60 and the radiation dose build-up. (authors). 7 figs., 6 refs

Analysis of structure-tectonic pattern within the 'Degelen' massif conformably to conditions of radionuclide migration in ground water

International Nuclear Information System (INIS)

Gorbunova, Eh.M.; Ivanchenko, G.N.; Godunova, L.D.

2005-01-01

Major orientation of radiation monitoring on the Semipalatinsk test site lies in direction of common regularities for formation and distribution of radioactive contamination. Zones, within the 'Degelen' technical area. of hydrogeological active faults are patly subjected to impact of underground explosions. Data of computer-aided decryption of a stellite image by means of program package LESSA allow specification of para-genesis structures standing as probabilistic pathways of radionuclide migration. (author)

Room-Temperature Continuous-Wave Operation of InGaN-Based Blue-Violet Laser Diodes with a Lifetime of 15.6 Hours

International Nuclear Information System (INIS)

Zeng Chang; Zhang Shu-Ming; Ji Lian; Zhao De-Gang; Zhu Jian-Jun; Liu Zong-Shun; Jiang De-Sheng; Duan Li-Hong; Wang Hai; Shi Yong-Sheng; Liu Su-Ying; Yang Hui; Wang Huai-Bing; Cao Qing; Chong Ming; Chen Liang-Hui

2010-01-01

We report our recent progress of investigations on InGaN-based blue-violet laser diodes (LDs). The room-temperature (RT) cw operation lifetime of LDs has extended to longer than 15.6 h. The LD structure was grown on a c-plane free-standing (FS) GaN substrate by metal organic chemical vapor deposition (MOCVD). The typical threshold current and voltage of LD under RT cw operation are 78 mA and 6.8 V, respectively. The experimental analysis of degradation of LD performances suggests that after aging treatment, the increase of series resistance and threshold current can be mainly attributed to the deterioration of p-type ohmic contact and the decrease of internal quantum efficiency of multiple quantum well (MQW), respectively. (fundamental areas of phenomenology(including applications))

Replacement of Co-base alloy for radiation exposure reduction in the primary system of PWR

International Nuclear Information System (INIS)

Han, Jeong Ho; Nyo, Kye Ho; Lee, Deok Hyun; Lim, Deok Jae; Ahn, Jin Keun; Kim, Sun Jin

1996-01-01

Of numerous Co-free alloys developed to replace Co-base stellite used in valve hardfacing material, two iron-base alloys of Armacor M and Tristelle 5183 and one nickel-base alloy of Nucalloy 488 were selected as candidate Co-free alloys, and Stellite 6 was also selected as a standard hardfacing material. These four alloys were welded on 316SS substrate using TIG welding method. The first corrosion test loop of KAERI simulating the water chemistry and operation condition of the primary system of PWR was designed and fabricated. Corrosion behaviors of the above four kinds of alloys were evaluated using this test loop under the condition of 300 deg C, 1500 psi. Microstructures of weldment of these alloys were observed to identify both matrix and secondary phase in each weldment. Hardnesses of weld deposit layer including HAZ and substrate were measured using micro-Vickers hardness tester. The status on the technology of Co-base alloy replacement in valve components was reviewed with respect to the classification of valves to be replaced, the development of Co-free alloys, the application of Co-free alloys and its experiences in foreign NPPs, and the Co reduction program in domestic NPPs and industries. 18 tabs., 20 figs., 22 refs. (Author)

Modeling the Influence of Process Parameters and Additional Heat Sources on Residual Stresses in Laser Cladding

Science.gov (United States)

Brückner, F.; Lepski, D.; Beyer, E.

2007-09-01

In laser cladding thermal contraction of the initially liquid coating during cooling causes residual stresses and possibly cracks. Preweld or postweld heating using inductors can reduce the thermal strain difference between coating and substrate and thus reduce the resulting stress. The aim of this work is to better understand the influence of various thermometallurgical and mechanical phenomena on stress evolution and to optimize the induction-assisted laser cladding process to get crack-free coatings of hard materials at high feed rates. First, an analytical one-dimensional model is used to visualize the most important features of stress evolution for a Stellite coating on a steel substrate. For more accurate studies, laser cladding is simulated including the powder-beam interaction, the powder catchment by the melt pool, and the self-consistent calculation of temperature field and bead shape. A three-dimensional finite element model and the required equivalent heat sources are derived from the results and used for the transient thermomechanical analysis, taking into account phase transformations and the elastic-plastic material behavior with strain hardening. Results are presented for the influence of process parameters such as feed rate, heat input, and inductor size on the residual stresses at a single bead of Stellite coatings on steel.

Hard hardfacing by welding in the manufacture of valves; Problem Cobalt, alternatives, advantages, disadvantages

International Nuclear Information System (INIS)

Piquer Caballero, J.

2014-01-01

Alloys of recharge usually used in the field of the valves are base alloys cobalt (stellite), but in the field of nuclear power plants, due to radioactive activation of the cobalt, there is a growing trend to replace these alloys with other calls cobalt free . In this paper we will explore the most frequent and will be deducted the relevant advantages and disadvantages of these, in comparison with base alloys cobalt. (Author)

Hard hardfacing by welding in the manufacture of valves; Problem Cobalt, alternatives, advantages, disadvantages; Recargues Duros por Soldadura en la Fabricacion de Valvulas ; el Problema del Cobalto, alternativas, ventajas, inconvenientes

Energy Technology Data Exchange (ETDEWEB)

Piquer Caballero, J.

2014-07-01

Alloys of recharge usually used in the field of the valves are base alloys cobalt (stellite), but in the field of nuclear power plants, due to radioactive activation of the cobalt, there is a growing trend to replace these alloys with other calls cobalt free . In this paper we will explore the most frequent and will be deducted the relevant advantages and disadvantages of these, in comparison with base alloys cobalt. (Author)

Electrospark deposition for die repair

Directory of Open Access Journals (Sweden)

J. Tušek

2012-01-01

Full Text Available The electrospark deposition is a process for surfacing of hard metal alloys, e.g. carbides and stellites, on the surfaces of new or old machine elements. In this process, a high current is conducted through an oscillating electrode and a substrate for a very short period of time. In the paper, the process is described and the thickness of deposited layer, chemical composition, dilution rate and the layer roughness are determined.

Application of Moessbauer spectroscopy to study corrosion

International Nuclear Information System (INIS)

Ramshesh, V.; Ravichandran, K.; Venkateswarlu, K.S.

1976-01-01

The system components in a nuclear power station include steel, stainless steel and various alloys such as Monel, Inconel, Stellite etc. Usually water/heavy water used as the coolant flows at high temperatures and pressures. Under such conditions the interaction of system components with the coolant produces a host of corrosion products. The deposition of such products is essential. This report attempts to review the salient features of identification of such corrosion products using Moessbauer spectroscopy. (author)

Urolitíase em cães: avaliação quantitativa da composição mineral de 156 urólitos Canine urolithiasis: quantitative evaluation of mineral composition of 156 uroliths

Directory of Open Access Journals (Sweden)

Mônica Kanashiro Oyafuso

2010-02-01

Full Text Available O estudo teve como objetivo avaliar os casos de urolitíase canina em que a composição mineral dos urólitos foi analisada quantitativamente. Foi avaliada quantitativamente a composição mineral de 156 urólitos obtidos de cães (nefrólitos, ureterólitos, urocistólitos e uretrólitos. Desse total, 79,5% (n=124 eram simples, 18% (n=28 eram compostos e apenas 2,5% (n=4 eram mistos. A estruvita foi o tipo mineral mais frequente nos urólitos simples (47,6%; n=59, em todos os mistos (100%; n=4 e nas camadas núcleo e pedra de urólitos compostos (32,1 e 75%, respectivamente. O oxalato de cálcio foi o segundo mineral mais frequente dos urólitos simples (37,9%, n=47. Ao contrário do que é preconizado para os urólitos simples, as recomendações para o tratamento de urólitos compostos são mais complexas, tais como protocolos de tratamento de dissolução diferentes (se composto por minerais distintos e passíveis de dissolução como urato e estruvita. Além disso, a dissolução pode não ser viável, caso ocorra presença de material insolúvel envolvendo o urólito ou se este representar mais de 20% da camada. Vinte e dois urólitos compostos (78,7% apresentaram uma camada externa não passível de dissolução (oxalato de cálcio ou fosfato de cálcio; dois (7,1% apresentaram camadas externas passíveis de dissolução (estruvita ou urato, porém camadas mais internas não solúveis, o que permitiria apenas a dissolução parcial do urólito. Assim, o conhecimento da composição de todas as camadas que compõem o urólito é essencial para o entendimento da formação do cálculo e consequentemente para a indicação do tratamento adequado, assim como para prevenção de recidivas.The aim of this study was to evaluate dogs with urolithiasis in which mineral composition of calculi was quantitatively analyzed. Quantitative mineral composition was performed in 156 canine uroliths. Simple uroliths represented 79.5% (n=124 of the cases, 18

Physical properties and microstructure performance of ultrafine nanocrystals reinforced laser 3D print microlaminates

International Nuclear Information System (INIS)

Li, Jianing; Xia, Chunzhi; Liu, Peng; Pan, Guanghui; Wang, Congwei

2015-01-01

Highlights: • Ultrafine nanocrystals, nanorods and amorphous phases were produced in such LRP microlaminates. • The amorphous/nanocrystalline interface owned a high bonding energy. • Amorphous/nanocrystalline interface may retard growth of nanocrystals in a certain extent. • Due to production of amorphous, lots of microscale ASNPs were produced. • Ultrafine nanocrystals had the high interface energy, which became the driving force of the atomic motions. - Abstract: Rapid prototyping based on laser alloying was used to produce ultrafine nanocrystals (UN) reinforced three-dimensional microlaminates. Such microlaminates were fabricated on a TA1 alloy by laser rapid prototyping (LRP) of Stellite 20–TiN–B 4 C mixed powders to produce a bottom layer; then Stellite 20–TiN–B 4 C–Sb powders were deposited on such bottom-layer in order to form an upper-layer. There is an excellent metallurgical combination between such two layer; the upper-layer shows a better wear resistance than that of the bottom layer. The Sb addition promoted lots of UN to be produced, and lots of the nanorods were also produced in such microlaminates, their growth was retarded by agglomeration of UN in a certain extent. Such UN had the high interface energy, which became the driving force of atomic motions, favoring formation of a compact fine structure

Physical properties and microstructure performance of ultrafine nanocrystals reinforced laser 3D print microlaminates

Energy Technology Data Exchange (ETDEWEB)

Li, Jianing, E-mail: jn2369@163.com [School of Materials Science and Engineering, Shandong Jianzhu University, Jinan 250101 (China); Beijing Aeronautical Manufacturing Technology Research Institute, Beijing 100024 (China); Xia, Chunzhi [Provincial Laboratory of Advanced Welding Technology, Jiangsu University of Science and Technology, Zhenjiang 212003 (China); Liu, Peng; Pan, Guanghui; Wang, Congwei [School of Materials Science and Engineering, Shandong Jianzhu University, Jinan 250101 (China)

2015-10-05

Highlights: • Ultrafine nanocrystals, nanorods and amorphous phases were produced in such LRP microlaminates. • The amorphous/nanocrystalline interface owned a high bonding energy. • Amorphous/nanocrystalline interface may retard growth of nanocrystals in a certain extent. • Due to production of amorphous, lots of microscale ASNPs were produced. • Ultrafine nanocrystals had the high interface energy, which became the driving force of the atomic motions. - Abstract: Rapid prototyping based on laser alloying was used to produce ultrafine nanocrystals (UN) reinforced three-dimensional microlaminates. Such microlaminates were fabricated on a TA1 alloy by laser rapid prototyping (LRP) of Stellite 20–TiN–B{sub 4}C mixed powders to produce a bottom layer; then Stellite 20–TiN–B{sub 4}C–Sb powders were deposited on such bottom-layer in order to form an upper-layer. There is an excellent metallurgical combination between such two layer; the upper-layer shows a better wear resistance than that of the bottom layer. The Sb addition promoted lots of UN to be produced, and lots of the nanorods were also produced in such microlaminates, their growth was retarded by agglomeration of UN in a certain extent. Such UN had the high interface energy, which became the driving force of atomic motions, favoring formation of a compact fine structure.

Evaporation residue cross sections and average neutron multiplicities in the /sup 64/Ni+/sup 92/Zr and /sup 12/C+/sup 144/Sm reactions leading to /sup 156/Er

Energy Technology Data Exchange (ETDEWEB)

Janssens, R.V.F.; Holzmann, R.; Henning, W.; Khoo, T.L.; Lesko, K.T.; Stephans, G.S.F.; Radford, D.C.; Van den Berg, A.M.; Kuehn, W.; Ronningen, R.M.

1986-11-27

Evaporation residue cross sections and neutron multiplicity distributions have been measured for the /sup 12/C+/sup 144/Sm and /sup 64/Ni+/sup 92/Zr reactions leading to the same compound nucleous /sup 156/Er. Statistical model calculations can account for the data in the /sup 12/C-induced reaction. In contrast, the inhibition of neutron emission with respect to statistical model predictions seen in /sup 64/Ni+/sup 92/Zr cannot be explained even with the inclusion of the broad angular momentum distributions required to describe the fusion cross section data.

Online model evaluation of large-eddy simulations covering Germany with a horizontal resolution of 156 m

Science.gov (United States)

Hansen, Akio; Ament, Felix; Lammert, Andrea

2017-04-01

Large-eddy simulations have been performed since several decades, but due to computational limits most studies were restricted to small domains or idealised initial-/boundary conditions. Within the High definition clouds and precipitation for advancing climate prediction (HD(CP)2) project realistic weather forecasting like LES simulations were performed with the newly developed ICON LES model for several days. The domain covers central Europe with a horizontal resolution down to 156 m. The setup consists of more than 3 billion grid cells, by what one 3D dump requires roughly 500 GB. A newly developed online evaluation toolbox was created to check instantaneously for realistic model simulations. The toolbox automatically combines model results with observations and generates several quicklooks for various variables. So far temperature-/humidity profiles, cloud cover, integrated water vapour, precipitation and many more are included. All kind of observations like aircraft observations, soundings or precipitation radar networks are used. For each dataset, a specific module is created, which allows for an easy handling and enhancement of the toolbox. Most of the observations are automatically downloaded from the Standardized Atmospheric Measurement Database (SAMD). The evaluation tool should support scientists at monitoring computational costly model simulations as well as to give a first overview about model's performance. The structure of the toolbox as well as the SAMD database are presented. Furthermore, the toolbox was applied on an ICON LES sensitivity study, where example results are shown.

Observation of states beyond band termination in 156,157,158Er and strongly deformed structures in 173,174,175Hf

International Nuclear Information System (INIS)

Riley, M A; Djongolov, M K; Evans, A O

2006-01-01

High-spin terminating bands in heavy nuclei were first identified in nuclei around 158 Er 90 . While examples of terminating states have been identified in a number of erbium isotopes, almost nothing is known about the states lying beyond band termination. In the present work, the high-spin structure of 156,157,158 Er has been studied using the Gammasphere spectrometer. The subject of triaxial superdeformation and 'wobbling' modes in Lu nuclei has rightly attracted a great deal of attention. Very recently four strongly or superdeformed (SD) sequences have been observed in 174 Hf, and cranking calculations using the Ultimate Cranker code predict that such structures may have significant triaxial deformation. We have performed two experiments in an attempt to verify the possible triaxial nature of these bands. A lifetime measurement was performed to confirm the large (and similar) deformation of the bands. In addition, a high-statistics, thin-target experiment took place to search for linking transitions between the SD bands, possible wobbling modes, and new SD band structures

Optical and electrical properties of Mn1.56Co0.96Ni0.48O4 thin films

Science.gov (United States)

Gao, Y. Q.; Huang, Z. M.; Hou, Y.; Wu, J.; Chu, J. H.

2013-12-01

Mn1.56Co0.96Ni0.48O4 (MCN) films with different layers have been prepared on Al2O3 substrate by chemical solution deposition method. The microstructures, optical and electrical properties of the films are investigated. X-ray diffraction and microstructure analyses show good crystallization and both the crystalline quality and the grain size are improved with the increasing thickness of the films. Mid-infrared optical properties of MCN films have been investigated using transmission spectra. The results show the red shift of absorption with the increasing film thickness and the energy gap Eg decrease from 0.6422 eV to 0.6354 eV. All the MCN films show an exponential decrease in the resistivity with increasing temperature within the measured range. The temperature dependence resistivity can be described by the small polarons hopping model. Using this model, the characteristic temperature T0 and activation energy E of the MCN films were derived. With the film thickness increase, the T0 and E of the MCN films increase. The calculated room temperature coefficient of resistance (TCR) of MCN film with 100 layers is -3.5% K-1. The MCN films showed appropriate resistance and high value of TCR, these advantages make them very preponderant for thermal sensors.

P156

Directory of Open Access Journals (Sweden)

D. Kokova

2015-11-01

This research was supported by Federal Targeted Programme for Research and Development in Priority Areas of Development of the Russian Scientific and Technological Complex for 2014–2020, “Development of molecular signatures for early detection of lung cancer” (No. 14.575.21.0064 from 05.08.2014, RFMEFI57514X0064 and supported by Tomsk State University, Competitiveness Improvement Program”. Work was conducted with the application of the Tomsk regional common use center technical equipment acquired thanks to a grant of the Russian Ministry of the Agreement No.14.594.21.0001 (RFMEFI59414X0001.

Lupic nephropathy: a case control study in Medellín, Colombia Nefropatía lúpica: estudio de 156 casos

Directory of Open Access Journals (Sweden)

Fernando Zambrano

1989-03-01

Full Text Available

By means of a case-control study we analyzed the cllnlcal histories of 297 patients with systemic erythematous lupus, that were seen at the out-patient section of the Rheumatology Service, Hospital Universitario San Vicente de Paúl, in Medellín, Colombia, between 1970 and 1987. Renal involvement was documented in 156 (52.5% cases while in 94 (31.6% there were alterations in the urinary sediment without clinical evidence of renal lesions. Nephropathy was the first evidence of disease in 14 patients (4.70¡0 of the total group; in 48 of those with nephropathy proteinuria was in the nephrotic range; acute renal insufficiency was found in 19 patients (6.4% while in 15 (5.0% there was chronic renal insufficiency. Seventy nine renal biopsies were performed; their histological classification was as follows: mesangial glomerulonephritis 7 (8.9%; focal proliferative glomerulonephritis 17 (21.5%; diffuse proliferative glomerulonephritis 38 (48.1% and membranous glomerulonephrltls 9 (11.1 %. The frequency of the following clinical manifestations was significantly higher in patients with nephropathy: Iivido reticularis, vasculitis, oral ulcers, arthritis, thrombophlebitis, psychosis, headache and depression.

Por medio de un estudio de casos y controles se analizaron las historias de 297 pacientes con lupus eritematoso sistémico, atendidos en la consulta externa del Servicio de Reumatología del Hospital Universitario San Vicente de Paúl, en Medellín, Colombia, entre 1970 y 1987. Se documentó compromiso renal en 156 (52.5%. Hubo 94 que presentaron alteraciones en el sedimento urinario sin evidencia clínica de lesión renal. La nefropatía como primera manifestación de la enfermedad se encontró en 14 pacientes (4.7% del grupo total; en 48 de los que tenían neuropatía (30.8% se halló la proteinuria en

High power CO2 lasers and their applications in nuclear industry

International Nuclear Information System (INIS)

Nath, A.K.

2002-01-01

Carbon dioxide laser is one of the most popular lasers in industry for material processing applications. It has very high power capability and high efficiency, can be operated in continuous wave (CW), modulated and pulsed modes, and has relatively low cost. Due to these characteristics high power CO 2 lasers are being used worldwide in different industries for a wide variety of materials processing operations. In nuclear industry, CO 2 laser has made its way in many applications. Some of the tasks performed by multikilowatt CO 2 laser are cutting operations necessary to remove unprocessible hardware from reactor fuel assemblies, sealing/fixing/removing radioactive contaminations onto/from concrete surfaces and surface modification of engineering components for improved surface mechanical and metallurgical characteristics. We have developed various models of CW CO 2 lasers of power up to 12 kW and a high repetitive rate TEA (Transversely Excited Atmospheric pressure) CO 2 laser of 500 W average power operating at 500 Hz repetition rates. We have carried many materials processing applications of direct relevance to DAE. Recent work includes laser welding of end plug PFBR fuel tubes, martensitic stainless steel and titanium alloy, surface cladding of turbine blades made of Ni-super alloy with stellite 694, fabrication on graded material of stainless steel and stellite, and laser scabbling, drilling and cutting of concrete which have potential application in decontamination and decommissioning of nuclear facilities. A brief overview of these indigenous developments will be presented. (author)

Reactive Fabrication and Effect of NbC on Microstructure and Tribological Properties of CrS Co-Based Self-Lubricating Coatings by Laser Cladding.

Science.gov (United States)

Fang, Liuyang; Yan, Hua; Yao, Yansong; Zhang, Peilei; Gao, Qiushi; Qin, Yang

2017-12-28

The CrS/NbC Co-based self-lubricating composite coatings were successfully fabricated on Cr12MoV steel surface by laser clad Stellite 6, WS₂, and NbC mixed powders. The phase composition, microstructure, and tribological properties of the coatings ware investigated by means of X-ray diffraction (XRD), scanning electron microscopy (SEM), and energy dispersive spectrometer (EDS), as well as dry sliding wear testing. Based on the experimental results, it was found reactions between WS₂ and Co-based alloy powder had occurred, which generated solid-lubricant phase CrS, and NbC play a key role in improving CrS nuclear and refining microstructure of Co-based composite coating during laser cladding processing. The coatings were mainly composed of γ-Co, CrS, NbC, Cr 23 C₆, and CoC x . Due to the distribution of the relatively hard phase of NbC and the solid lubricating phase CrS, the coatings had better wear resistance. Moreover, the suitable balance of CrS and NbC was favorable for further decreasing the friction and improving the stability of the contact surfaces between the WC ball and the coatings. The microhardness, friction coefficient, and wear rate of the coating 4 (Clad powders composed of 60 wt % Stellite 6, 30 wt % NbC and 10 wt % WS₂) were 587.3 HV 0.5 , 0.426, and 5.61 × 10 -5 mm³/N·m, respectively.

Reactive Fabrication and Effect of NbC on Microstructure and Tribological Properties of CrS Co-Based Self-Lubricating Coatings by Laser Cladding

Directory of Open Access Journals (Sweden)

Liuyang Fang

2017-12-01

Full Text Available The CrS/NbC Co-based self-lubricating composite coatings were successfully fabricated on Cr12MoV steel surface by laser clad Stellite 6, WS2, and NbC mixed powders. The phase composition, microstructure, and tribological properties of the coatings ware investigated by means of X-ray diffraction (XRD, scanning electron microscopy (SEM, and energy dispersive spectrometer (EDS, as well as dry sliding wear testing. Based on the experimental results, it was found reactions between WS2 and Co-based alloy powder had occurred, which generated solid-lubricant phase CrS, and NbC play a key role in improving CrS nuclear and refining microstructure of Co-based composite coating during laser cladding processing. The coatings were mainly composed of γ-Co, CrS, NbC, Cr23C6, and CoCx. Due to the distribution of the relatively hard phase of NbC and the solid lubricating phase CrS, the coatings had better wear resistance. Moreover, the suitable balance of CrS and NbC was favorable for further decreasing the friction and improving the stability of the contact surfaces between the WC ball and the coatings. The microhardness, friction coefficient, and wear rate of the coating 4 (Clad powders composed of 60 wt % Stellite 6, 30 wt % NbC and 10 wt % WS2 were 587.3 HV0.5, 0.426, and 5.61 × 10−5 mm3/N·m, respectively.

Comparison of the portion size and frequency of consumption of 156 foods across seven European countries: insights from the Food4ME study.

Science.gov (United States)

Kirwan, L; Walsh, M C; Brennan, L; Gibney, E R; Drevon, C A; Daniel, H; Lovegrove, J A; Manios, Y; Martínez, J A; Saris, W H M; Traczyk, I; Mathers, J C; Gibney, M

2016-05-01

There are no standardised serving/portion sizes defined for foods consumed in the European Union (EU). Typical serving sizes can deviate significantly from the 100 g/100 ml labelling specification required by the EU legislation. Where the nutritional value of a portion is specified, the portion size is determined by the manufacturers. Our objective was to investigate the potential for standardising portion sizes for specific foods, thereby ensuring complementarity across countries. We compared portion size for 156 food items measured using a food frequency questionnaire across the seven countries participating in the Food4me study. The probability of consuming a food and the frequency of consumption differed across countries for 93% and 58% of the foods, respectively. However, the individual country mean portion size differed from the average across countries in only 16% of comparisons. Thus, although dietary choices vary markedly across countries, there is much less variation in portion sizes. Our results highlight the potential for standardisation of portion sizes on nutrition labels in the EU.

Modelling of residual stresses in valves Norem hard-facing alloys: a material characterization issue

International Nuclear Information System (INIS)

Mathieu, J.P.; Arnoldi, F.; Gauthier, E.; Beaurin, G.

2011-01-01

Replacement of cobalt-based hard-facing alloys (Stellite) is of high interest within the topic of reduction of human radiation exposure during field-work. Iron-based hard-facing alloys, such as Norem, are considered as good replacement candidates. Their wear characteristics are known to be quite equivalent to Stellite but are counter-balanced by lack of feedback in the field, especially about their resistance/toughness to brutal thermal shocks (60 C - 280 C for primary water). Norem alloys show a solid-solution strengthened austenitic dendrites matrix with a continuous network of eutectic and non-eutectic carbides at the grain boundaries. Toughness evaluation also requires information about residual stresses due to the welding (deposition) process: this work aims at furnishing tools for this purpose. First part of the work involved a microstructural study in order to compare the as-received material to other Norem samples previously observed in EDF's works and literature. A characterization of the different phase evolutions after heating and fast cooling of Norem is then made, in order to characterize whether metallurgical aspects have to be considered in the mechanical part during welding modelling: it appears that no strong solid-solid phase transformation may occur in welding situation. Tensile characterization is then performed on bulk PTAW (Plasma Transferred Arc Welding) specimens. A simplified welding simulation is eventually conducted on different axis-symmetric geometry and on real valve geometry in order to define a representative sample that will be used for further investigation on residual stresses. (authors)

Heavy water pumps; Pumpe D{sub 2}O

Energy Technology Data Exchange (ETDEWEB)

Zecevic, V; Nikolic, M

1963-12-15

Continuous increase of radiation intensity was observed on all the elements in the heavy water system during first three years of RA reactor operation. The analysis of heavy water has shown the existence of radioactive cobalt. It was found that cobalt comes from stellite, cobalt based alloy which was used for coating of the heavy water pump discs in order to increase resistance to wearing. Cobalt was removed from the surfaces due to friction, and transferred by heavy water into the reactor where it has been irradiated for 29 876 MWh up to 8-15 Ci/g. Radioactive cobalt contaminated all the surfaces of aluminium and stainless steel parts. This report includes detailed description of heavy water pumps repair, exchange of stellite coated parts, decontamination of the heavy water system, distillation of heavy water. [Serbo-Croat] U toku prve tri godine eksploatacije reaktora RA uocen je neprekidni porast intenziteta zracenja na svim elementima u teskovodnom sistemu. Analizom teske vode utvrdjeno je postojanje radioaktivnog kobalta. Ustanovljeno je da kobalt potice od stelita, legure na bazi kobalta kojim su presvuceni rukavci vratila teskovodnih pumpi radi otpornosi na habanje. Kobalt je trenjem skidan sa povrsina, u toku rada prenosen je teskom vodom u reaktor i ozracivan u toku 29 876 MWh do specificne aktivnosti 8-15 Ci/g. Radioaktivni kobalt je kontaminirao sve povrsine od aluminijuma i nerdjajuceg celika. Ovaj izvestaj sadrzi detaljan opis remonta pumpi, zamene delova teskovodnih pumpi novim delovima bez stelitnog sloja, dekontaminacije teskovodnog sistema, destilacije teske vode.

Effects of letrozole in combination with low-dose intramuscular injection of human menopausal gonadotropin on ovulation and pregnancy of 156 patients with polycystic ovary syndrome.

Science.gov (United States)

Chen, Zhihua; Zhang, Mengzhen; Qiao, Yuhuan; Yang, Junjuan

2016-01-01

To explore the effects of letrozole (LE) in combination with low-dose intramuscular injection of human menopausal gonadotropin (HMG) on the ovulation induction and pregnancy of patients with polycystic ovary syndrome (PCOS). A total of 156 patients with PCOS infertility were randomly divided into an LE group, a clomiphene citrate (CC) group and an LE + HMG group (n= 52). LE and CC were orally taken according to the prescribed dosage on the 3rd-5th days of menstruation respectively, and 75 IU HMG was given through intramuscular injection. The ovulation induction parameters and pregnancy outcomes were observed. The number of ovulation cycle of LE + HMG group was significantly higher than that of LE group (χ 2 =8.451, Pmedication cycle of clinically pregnant patients was (2.9 ± 0.3) weeks, which was significantly shorter than those of CC and LE groups (F=17.241, Pmedication cycle and high clinical pregnancy rate, which is promising for treating patients with PCOS infertility.

Optical properties of costal cartilage and their variation in the process of non-destructive action of laser radiation with the wavelength 1.56 μm

Energy Technology Data Exchange (ETDEWEB)

Yuzhakov, A V; Sviridov, A P; Shcherbakov, E M; Baum, O I; Sobol, E N [Institute on Laser and Information Technologies, Russian Academy of Sciences, Shatura, Moscow Region (Russian Federation)

2014-01-31

The optical properties of costal cartilage and their variation under the action of laser radiation with the wavelength 1.56 μm are studied. The laser action regime corresponds to that used for changing the cartilage shape. The dynamics of the passed scattered laser radiation was studied by means of the optical fibre system, and the optical properties of the cartilage tissue (on the basis of Monte Carlo modelling of light propagation) – using the setup with two integrating spheres. Under the influence of radiation, the characteristics of which corresponded to those used for the cartilage shape correction, no essential changes in the optical parameters were found. The results obtained in the course of studying the dynamics of optical signals in the process of costal cartilage irradiation can be used for developing control systems, providing the safety and efficiency of laser medical technologies. (biophotonics)

Friction and wear of ball bearings in liquid sodium environment. Pt. 1

International Nuclear Information System (INIS)

Kleefeldt, K.; Gering, G.

1975-07-01

This report describes sodium experiments with ball bearings, fabricated out of five different materials, i.e. tool steel (s-6-5-2), stainless high speed steel (BG 42), stellite, ferro-titanit (WF 13.5) and tungsten carbide/cobalt cermet (GT 10/20). With each material four cageless bearings of the type 6207 were tested in task 1 under the following test conditions, in order to determine the most promising material for further investigations: test temperature 400 0 C, axial load 300 kp, speed 200 min -1 , total revolutions 0.2 x 10 6 , oxygen concentration [de

Study on Co-free amorphous material cladding using a laser beam to improve the resistance of primary system parts in NPPs to wear/erosion-corrosion

International Nuclear Information System (INIS)

Kim, J. S.; Woo, S. S.; Seo, J. H.

2001-01-01

A study on Co-free amorphous material, ARMACOR M, cladding using a laser beam has been performed to improve resistance of the primary system main parts on nuclear power plants to wear/erosion-corrosion. The wear/erosion-corrosion properties of ARMACRO M cladded speciemens were characterized in air at room temperature and 300 .deg. C and in air at room temperature, and compared to those of other hardfacing materials, such as Stellite 6, NOREM 02, Deloro 50, TIG-welde or laer cladded. According to the results, ARMACOR M laser-cladded specimen showed to have the highest resistance to wear/erosion-corrosion

Elastic and inelastic proton-nucleus scattering at 156MeV: experimental study and analysis in impulse approximation

International Nuclear Information System (INIS)

Comparat, Vincent.

1975-01-01

In this work a high spatial resolution hodoscope is described. Scattered particles are detected in the image plane of a magnetic spectrometer by a proportional chamber with 96 wires of 1mm spacing. This hodoscope has been used for elastic and inelastic scattering experiments, of 156MeV protons, on 11 targets ranging from 12 C to 209 Bi. A phenomenological optical model calculation has been carried out to analyse the experimental elastic cross sections data. The dependance of the parameters as a function of the number of mass or the incident energy has been studied. The inelastic scattering results have been interpreted within the framework of the D.W.I.A. As the final results are dependant of the nucleon model, the optical potential parameters as well as the finite range approximation, several trials have been performed. Nevertheless, the DWIA seems to give about twice the experimental values for collective excitations in light or medium nuclei. The first order optical potential derived from the impulse approximation was calculated and the results compared to the experimental elastic cross sections. Several approximations were tested as non locality, off energy shell effects and the motion of the target nucleon. The usual approximation on these quantities are justified if the momentum transfer is less than 3fm -1 . The nucleon-nucleus transition matrix is obtained by solving the Lippmann-Schwinger equation, using the moment method. The first order optical potential derived from these calculations is not realistic. The intensity of the nucleon-nucleon transition is too important, and that explained the disagreement at low momentum transfers. This study shows that the multiple scattering expansion of the Lippmann-Schwinger equation, is not a good method to obtain the exact solution. It is better to do some approximations (i.e. of shell approximation) directly on the integral equation [fr

Measurements of the Coulomb dissociation cross section of 156 MeV 6Li projectiles at extremely low relative fragment energies of astrophysical interest

International Nuclear Information System (INIS)

Kiener, J.; Gils, H.J.; Rebel, H.; Zagromski, S.; Gsottschneider, G.; Heide, N.; Jelitto, H.; Wentz, J.; Baur, G.

1991-04-01

Coulomb dissociation of light nuclear projectiles in the electric field of heavy target nuclei has been experimentally investigated as an alternative access to radiative capture cross sections at low relative energies of the fragments, which are of astrophysical interest. As a pilot experiment the breakup of 156 MeV 6 Li-projectiles at 208 Pb with small emission angles of the a particle and deuteron fragments has been studied. Both fragments were coincidentally detected in the focal plane of a magnetic spectrograph at several reaction angles well below the grazing angle and with relative angles between the fragments of 0deg-2deg. The experimental cross sections have been analyzed on the basis of the Coulomb breakup theory. The results for the resonant breakup give evidence for the strong dominance of the Coulomb dissociation mechanism and the absence of nuclear distortions, while the cross section for the nonresonant breakup follow theoretical predictions of the astrophysical S-factor and extrapolations of corresponding radiative capture reaction cross section to very low c. m. energies of the a particle and deuterons. Various implications of the approach are discussed. (orig.) [de

Diffusion tensor microscopy data (15.6 μm in-plane of white matter tracts in the human, pig, and rat spinal cord with corresponding tissue histology

Directory of Open Access Journals (Sweden)

Jeremy J. Flint

2016-12-01

Full Text Available The following article contains nine diffusion tensor imaging (DTI datasets acquired with magnetic resonance microscopy (MRM, 15.6 μm in-plane. All data was collected in the region bordering the ventral horn and white matter of cross sections from the spinal cord enlargements along with each sample׳s corresponding tissue histology. These data are collected in fixed spinal cord sections of varying thicknesses taken from rat (2×21 direction DTI datasets, pig (1×21 direction DTI dataset, and human (5×21 direction DTI datasets + 1×6 direction DTI dataset tissue sources. Following MRM acquisition, the sections were histologically processed using Nissl or Black-Gold II (Histo-Chem Inc., 1BGII myelin stain and imaged again using light microscopy techniques. Methodological procedures are an amalgamation of protocol components described previously (doi:10.1016/j.neuroimage.2010.04.031 [1], doi:10.1016/j.neuroimage.2011.04.052 [2].

Experimental studies of the break-up of 156 MeV 6Li-ions at extreme forward angles using the Karlsruhe magnetic spectrograph 'Little John'

International Nuclear Information System (INIS)

Jelitto, H.

1987-05-01

6 Li-induced break-up reactions have been investigated at reaction angles in extreme forward direction including O 0 with the Karlsruhe Magnetic Spectrograph 'Little John'. The experiments were characterized by the minimization of the high experimental background that dominates at small emission angles. Inclusive alpha-particle and deuteron spectra from the bombardement of 12 C- and 208 Pb-targets with 156 MeV 6 Li-ions have been measured. Below the grazing angle the Coulomb interaction shows a distinct influence on the angular distributions of the fragments. A simple spectator-model and a more realistic description within the DWBA-formalism largely allows a reproduction of the data. In the light of the reverse reaction α + d → 6 Li + γ at small α-d-relative energies, which is of considerable interest for astrophysics, a particle-particle-coincidence measurement with θ α = 5 0 and θ d = -2 0 has been performed. The result could be reproduced reasonably well by a simple Monte-Carlo-simulation. Beside the treatment of a physical problem this work deals with the start-up of the magnetic spectrograph and the clarification of spectrograph specific questions concerning the data reduction. (orig.) [de

Inclusive measurements of the break-up of 156 MeV 6Li-ions at extreme forward angles and the quasi free break-up model

International Nuclear Information System (INIS)

Jellito, H.; Buschmann, J.; Gils, H.J.; Heide, N.; Kiener, J.; Rebel, H.; Zagromski, S.; Samanta, C.

1988-11-01

Inclusive alpha particle and deuteron spectra from collisions of 156 MeV 6 Li-ions with 12 C and 208 Pb were measured at extreme forward emission angles including zero degree. The measurements were performed with the Karlsruhe magnetic spectrograph 'Little John' and required an efficient reduction of the background from small-angle scattering. The observed double differential cross sections and angular distributions have been analysed on the basis of Serber's spectator break-up model. When going to angles smaller than grazing, where Coulomb effects are expected to the dominating, transitional features may appear. Corresponding effects probably associated with Coulomb break-up are observed with the 208 Pb-target and require a slight extension of the Serber approach. In the case of the 12 C-target the break-up cross sections in forward direction seem to reflect the shape of the internal momentum distribution of the alpha particle and deuteron cluster in the 6 Li-projectile and are in agreement with a 2S-type wave function. However, at larger angles the shape appears to be distorted, possibly by final state interactions. (orig.) [de

RA Reactor operation and maintenance (I-IX), part V, Task 3.08/04-06, Refurbishment of the heavy water pumps

International Nuclear Information System (INIS)

Zecevic, V.; Nikolic, M.; Milic, J.

1963-12-01

In addition to detailed instructions for maintenance and repair of the heavy water pumps at the RA reactor this document includes nine annexes. They are as follows: cleaning the heavy water pump Avala with distilled water; instructions for repair of the pump CEN-132 (two annexes); list of operating characteristics of the pumps before repair; conclusions of the experts concerning the worn out bearings of the heavy water pump Avala, with the analysis of the stellite layer; report on the completed repair actions on the pumps Avala and CEN-132; report on the measurements done on the pump Avala; and the certificate concerning inspection of the pump

RA Reactor operation and maintenance (I-IX), part V, Task 3.08/04-06, Refurbishment of the heavy water pumps; Pogon i odrzavanje reaktora RA (I-IX), V Deo, Zadatak 3.08/04-06 Remont teskovodnih pumpi

Energy Technology Data Exchange (ETDEWEB)

Zecevic, V; Nikolic, M; Milic, J [Institute of Nuclear Sciences Boris Kidric, Reaktor RA, Vinca, Beograd (Serbia and Montenegro)

1963-12-15

In addition to detailed instructions for maintenance and repair of the heavy water pumps at the RA reactor this document includes nine annexes. They are as follows: cleaning the heavy water pump Avala with distilled water; instructions for repair of the pump CEN-132 (two annexes); list of operating characteristics of the pumps before repair; conclusions of the experts concerning the worn out bearings of the heavy water pump Avala, with the analysis of the stellite layer; report on the completed repair actions on the pumps Avala and CEN-132; report on the measurements done on the pump Avala; and the certificate concerning inspection of the pump.

Occurrence of plant sensitivity among patients of photodermatoses: A control-matched study of 156 cases from New Delhi

Directory of Open Access Journals (Sweden)

Kar Hemanta

2009-01-01

Full Text Available Background: Photodermatitis is an abnormal response to ultraviolet radiation (UVR. The photoallergic contact dermatitis caused by plant allergens is a serious cause of morbidity in India. Airborne contact dermatitis is the classical presentation of plant-induced dermatosis, which may become difficult to differentiate from chronic actinic dermatitis in chronic cases. The rapid growth of parthenium weed in India and its ill effects on the population make it important to detect all cases of parthenium sensitivity, which in some cases might simulate photodermatitis. Aims: This study aims to detect the occurrence of plant sensitivity and photosensitivity in idiopathic-acquired photodermatoses, airborne contact dermatitis and general population taken as controls. Methods: One hundred and fifty six consecutive patients suffering from polymorphic light eruption (PMLE, chronic actinic dermatitis (CAD and airborne contact dermatitis (ABCD were enrolled in the study over a period of three years (June 2004 to May 2007. An equal number of age and sex matched healthy subjects were enrolled in the study as controls. All the patients were subjected to detailed history taking, clinical examination and histopathological examination for diagnosis. Patch and photopatch testing were perfomed in all the patients and healthy controls for detection of allergic and photoallergic reactions to parthenium, xanthium and chrysanthemum plant antigens and control antigens. Results: Out of 156 patients enrolled in the study, 78 (50% had CAD, 67 (42.9% had PMLE and 11 (7.05% had ABCD. The occurrence of parthenium/xanthium allergy and photoallergy, either to parthenium or both was most commonly found in ABCD (72.7%, followed by CAD (32%. In PMLE 4.5% cases showed photoallergy. Only 1.9% in the control group showed sensitivity to parthenium and xanthium. Conclusion: This study indicates that parthenium (and possibly xanthium may act as important environmental factors in the

Influence of the oxygen pressure on the preferred orientation and optical properties of the pulsed-laser deposited Mn{sub 1.56}Co{sub 0.96}Ni{sub 0.48}O{sub 4±δ} thin films

Energy Technology Data Exchange (ETDEWEB)

Kong, Wenwen [Key Laboratory of Functional Materials and Devices for Special Environments of CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics & Chemistry of CAS, Urumqi 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Gao, Bo [Key Laboratory of Functional Materials and Devices for Special Environments of CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics & Chemistry of CAS, Urumqi 830011 (China); Jiang, Chunping, E-mail: cpjiang2008@sinano.ac.cn [Key Laboratory of Functional Materials and Devices for Special Environments of CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics & Chemistry of CAS, Urumqi 830011 (China); Key Laboratory of Nanodevices and Applications, Suzhou Institute of Nano-Tech and Nano-Bionics of CAS, Suzhou 215123 (China); Chang, Aimin, E-mail: changam@ms.xjb.ac.cn [Key Laboratory of Functional Materials and Devices for Special Environments of CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics & Chemistry of CAS, Urumqi 830011 (China)

2015-11-25

Mn{sub 1.56}Co{sub 0.96}Ni{sub 0.48}O{sub 4±δ} (MCN) thin films with different oxygen pressures (in the range of 2 × 10{sup −4} to 2 Pa) are prepared on Si(100)/SiO{sub x} substrates by pulsed laser deposition technique. Effects of oxygen pressures on the microstructure and optical properties of the prepared thin films are investigated in detail. The grain sizes of films gradually decrease and the preferential orientation of the MCN films change from (400) to (113) as the oxygen pressure increases. The x-ray photoelectron spectroscopy results show that the composition of these films is proximity to that of the bulk material. In addition, the Mn{sup 3+}/Mn{sup 4+} pairs increase with an increase in the oxygen pressures increase. From spectroscopic ellipsometer spectroscopy, it is found that both the refractive index n and extinction coefficient k of the (400)-oriented films have no obvious peaks, whereas in the (113)-oriented films, peaks are exist. This feature typically originates from a change in the crystal structure as oxygen pressures increase. Furthermore, the Raman active mode (around ca. 650 cm{sup −1}) of (400) films almost disappears, whilst the active mode in (113) films remain. - Highlights: • The Mn{sub 1.56}Co{sub 0.96}Ni{sub 0.48}O{sub 4-δ} (MCN) spinel films are deposited by pulsed laser deposition process at different oxygen pressures. • The preferential orientation of the films changes from (400) plane to (113) as the oxygen pressure increases. • The E{sub g} of the (113) film is twice as large as that of the (400) film. • The Raman active mode (around ca. 650 cm{sup −1}) can be observed in the (113) films while not in the (400) film.

Relationship of microstructure to fracture topography in orthopedic alloys

International Nuclear Information System (INIS)

Gilbertson, L.N.

1976-01-01

Two major alloys used for orthopedic implants are 316L stainless steel and a cast cobalt--chromium--molybdenum alloy similar to Haynes Stellite 21. Another alloy that is just being introduced is Ti--6Al--4V. All three of these alloys are used in different conditions with different microstructures. Standard specimens with typical microstructures encountered in orthopedic applications were loaded to fracture in both overload and fatigue modes. Different rates of loading were also used in some cases. The fracture surfaces of these standard samples were analyzed in the Scanning Electron Microscope. An attempt was made to relate the fracture behavior, as evidenced by the fracture typography, to the microstructure of the alloy as revealed by metallography

Cobalt-60 control in Ontario Hydro reactors

International Nuclear Information System (INIS)

Lacy, C.S.

1988-01-01

This paper discusses the impact of specifying reduced Cobalt-59 in the primary heat transport circuit materials of construction on the radiation fields developed around the primary circuit. An eight-fold reduction in steam generator radiation fields due to Cobalt-60 has been observed for two identical sets of reactors, one with and one without Cobalt-59 control. The comparison is between eight reactors at the Pickering Nuclear Generating Station (PNGS). Units 5 to 8 (PNGS-B) are identical to Units 1 to 4 (PNGS-A) except that PNGS-B has reduced impurity Cobalt-59 in the alloys of construction and a reduced use of stellite. The effects of chemistry control are also discussed

Photoresponse and DFT studies of new synthesized 2-benzylidene-3-hydroxy -1-(5,6-diphenyl-1,2,4-triazine-3-yl)hydrazine and optical sensor application

Science.gov (United States)

Taha, A.; Farag, A. A. M.; Adly, O. M. I.; Roushdy, N.; Shebl, Magdy; Ahmed, H. M.

2017-08-01

A newly Schiff base,2-benzylidene-3-hydroxy-1-(5,6-diphenyl-1,2,4-triazine-3-yl)hydrazine] (HBDHT) was synthesized and characterized on the basis of micro-analytical and spectroscopic studies. Basic parameters of the combined compound HBDHT were ascertained on the premise of DFT level actualized on Gaussian 09. Thin films of HBDHT were successfully prepared by spin coating technique and confirmed by atomic force microscopy (AFM). The optical attributes of the studied films were considered utilizing spectrophotometric estimations in a wide spectral range of 200-2500 nm. Some important optical parameters such as extinction index, refractive index, dispersion energy, oscillator energy and high-frequency dielectric constant were extracted. Analysis of the absorption coefficient near the fundamental absorption edge confirms an indirectly allowed transition with an energy gap of 1.7eV. The refractive index dispersion was estimated on basis of single oscillator model expressed by Wemple-Didomenico. Current-voltage (I-V) characteristics were studied in dark and under illumination of 100 mW/cm2 to clarify the sensitivity to light. Moreover, the photo-transient properties were also investigated to confirm that the prepared heterojunction based HBDHT can be operated as a photodiode.

Optimization of the deposition process of corrosion resistant Stellite 6 coatings produced by laser cladding; Optimizacion del proceso de aporte de recubrimientos anticorrosion de Stellite 6 producidos mediante plaqueado laser

Energy Technology Data Exchange (ETDEWEB)

Vicario, I.; Soriano, C.; Sanz, C.; Bayon, R.; Leunda, J.

2009-07-01

Laser cladding is one of the most efficient surface treatment technologies in the industry. It uses a laser heat source to deposit a thin layer of a desired material on a moving substrate, whose properties have to be improved, achieving a metallurgical bonding between them with low heat affected zone and low dilution, compared to other conventional technologies such as PTA, TIG welding or thermal Spraying. In this sense, it is remarkable that there are 3 main application fields for laser cladding technology: restoration of refurbishment of damaged parts, surface coating against corrosion or wear, and rapid proto typing. the present work described a study of the optimization of the laser cladding of Co based coatings (Diamalloy 4060NS) on medium carbon steel C45 (AISI 1945). After laser treatment, the surface of the substrate materials is improved in terms of resistance against corrosion; this confirmed in the analysis performed afterwards. it is also shown that the corrosion barrier properties have direct correlation with the laser cladding variables. (Author) 10 refs.

Laser fabrication nanocrystalline coatings using simultaneous powders/wire feed

Science.gov (United States)

Li, Jianing; Zhai, Tongguang; Zhang, Yuanbin; Shan, Feihu; Liu, Peng; Ren, Guocheng

2016-07-01

Laser melting deposition (LMD) fabrication is used to investigate feasibilty of simultaneously feeding TC17 wire and the Stellite 20-Si3N4-TiC-Sb mixed powders in order to increase the utilization ratio of materials and also quality of LMD composite coatings on the TA1 substrate. SEM images indicated that such LMD coating with metallurgical joint to substrate was formed free of the obvious defects. Lots of the ultrafine nanocrystals (UNs) were produced, which distributed uniformly in some coating matrix location, retarding growth of the ceramics in a certain extent; UNs were intertwined with amorphous, leading the yarn-shape materials to be produced. Compared with substrate, an improvement of wear resistance was achieved for such LMD coating.

A 156 kyr smoothed history of the atmospheric greenhouse gases CO2, CH4, and N2O and their radiative forcing

Science.gov (United States)

Köhler, Peter; Nehrbass-Ahles, Christoph; Schmitt, Jochen; Stocker, Thomas F.; Fischer, Hubertus

2017-06-01

Continuous records of the atmospheric greenhouse gases (GHGs) CO2, CH4, and N2O are necessary input data for transient climate simulations, and their associated radiative forcing represents important components in analyses of climate sensitivity and feedbacks. Since the available data from ice cores are discontinuous and partly ambiguous, a well-documented decision process during data compilation followed by some interpolating post-processing is necessary to obtain those desired time series. Here, we document our best possible data compilation of published ice core records and recent measurements on firn air and atmospheric samples spanning the interval from the penultimate glacial maximum ( ˜ 156 kyr BP) to the beginning of the year 2016 CE. We use the most recent age scales for the ice core data and apply a smoothing spline method to translate the discrete and irregularly spaced data points into continuous time series. These splines are then used to compute the radiative forcing for each GHG using well-established, simple formulations. We compile only a Southern Hemisphere record of CH4 and discuss how much larger a Northern Hemisphere or global CH4 record might have been due to its interpolar difference. The uncertainties of the individual data points are considered in the spline procedure. Based on the given data resolution, time-dependent cutoff periods of the spline, defining the degree of smoothing, are prescribed, ranging from 5000 years for the less resolved older parts of the records to 4 years for the densely sampled recent years. The computed splines seamlessly describe the GHG evolution on orbital and millennial timescales for glacial and glacial-interglacial variations and on centennial and decadal timescales for anthropogenic times. Data connected with this paper, including raw data and final splines, are available at PANGAEA.871273" target="_blank">doi:10.1594/PANGAEA.871273.

33 CFR 156.330 - Operations.

Science.gov (United States)

2010-07-01

....330 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION... be conducted in accordance with the Oil Companies International Marine Forum Ship to Ship Transfer Guide (Petroleum), Second Edition, 1988, to the maximum extent practicable. (c) Helicopter operations...

18 CFR 156.5 - Exhibits.

Science.gov (United States)

2010-04-01

... any franchise or similar authorization which applicant has obtained from each of the municipalities in... section. (iv) Explanation of basic factors used in estimating future requirements, including, for example...

GPCR Interaction: 156 [GRIPDB[Archive

Lifescience Database Archive (English)

Full Text Available ation of V1a, V2 and OT homodimers. In addition, coexpressions of different pairs of receptors (V1a/V2, V1a/...one receptor to interact with another receptor) were identical whatever the pair of receptors coexpress...ed in the cells, which suggests that the proportion of homodimers and heterodimers depends on the relative expr...ents using chimeric V1a or V2 vasopressin or oxytocin and receptors labeled on the C-terminus with luciferas...ession of each receptor. 19896898 BRET NP_000697.1 ...

BDML Metadata: 156 [SSBD[Archive

Lifescience Database Archive (English)

Full Text Available Ce_KK_P002 BDML file for quantitative information about nuclear division dynamics o...f R08D7.1(RNAi) embryo quantitative information about nuclear division dynamics in R08D7.1(RNAi) embryo C. e

21 CFR 156.3 - Definitions.

Science.gov (United States)

2010-04-01

... distance of about 24 inches from the product. Electronic color meters may be used as an alternate means of determining the color of tomato juice. Such meters shall be calibrated to indicate that the color of the... kg (2.2 lb) but not more than 4.5 kg (10 lb) 2,400 or less 13 2 2,401 to 15,000 21 3 15,001 to 24,000...

17 CFR 156.1 - Definition.

Science.gov (United States)

2010-04-01

... trade shall include two or more contract market members with floor trading privileges, of whom at least one is acting as a floor broker, who: (1) Engage in floor brokerage activity on behalf of the same employer, (2) have an employer and employee relationship which relates to floor brokerage activity, (3...

156 | P a g e

African Journals Online (AJOL)

Fr. Ikenga

45 As the environment changes, individuals bearing traits produce their ..... documents of two different supranational organisations of Europe on the .... political and social unrest anywhere in the world, the right to life of innocent citizens is sacrificed as a ... government under his leadership lead to loss of lives of citizens.

Personalized mapping of the deep brain with a white matter attenuated inversion recovery (WAIR) sequence at 1.5-tesla: Experience based on a series of 156 patients.

Science.gov (United States)

Zerroug, A; Gabrillargues, J; Coll, G; Vassal, F; Jean, B; Chabert, E; Claise, B; Khalil, T; Sakka, L; Feschet, F; Durif, F; Boyer, L; Coste, J; Lemaire, J-J

2016-08-01

Deep brain mapping has been proposed for direct targeting in stereotactic functional surgery, aiming to personalize electrode implantation according to individual MRI anatomy without atlas or statistical template. We report our clinical experience of direct targeting in a series of 156 patients operated on using a dedicated Inversion Recovery Turbo Spin Echo sequence at 1.5-tesla, called White Matter Attenuated Inversion Recovery (WAIR). After manual contouring of all pertinent structures and 3D planning of trajectories, 312 DBS electrodes were implanted. Detailed anatomy of close neighbouring structures, whether gray nuclei or white matter regions, was identified during each planning procedure. We gathered the experience of these 312 deep brain mappings and elaborated consistent procedures of anatomical MRI mapping for pallidal, subthalamic and ventral thalamic regions. We studied the number of times the central track anatomically optimized was selected for implantation of definitive electrodes. WAIR sequence provided high-quality images of most common functional targets, successfully used for pure direct stereotactic targeting: the central track corresponding to the optimized primary anatomical trajectory was chosen for implantation of definitive electrodes in 90.38%. WAIR sequence is anatomically reliable, enabling precise deep brain mapping and direct stereotactic targeting under routine clinical conditions. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

47 CFR 80.379 - Maritime frequencies assignable to aircraft stations.

Science.gov (United States)

2010-10-01

....300 MHz (5) 156.375 MHz (5) 156.400 MHz (5) 156.425 MHz (5) 156.450 MHz (5) 156.625 MHz (5) 156.800... aircraft stations does not exceed 300 meters (1,000 feet), except for reconnaissance aircraft participating in icebreaking operations where an altitude of 450 meters (1,500 feet) is allowed; (ii) The mean...

A 156 kyr smoothed history of the atmospheric greenhouse gases CO2, CH4, and N2O and their radiative forcing

Directory of Open Access Journals (Sweden)

P. Köhler

2017-06-01

Full Text Available Continuous records of the atmospheric greenhouse gases (GHGs CO2, CH4, and N2O are necessary input data for transient climate simulations, and their associated radiative forcing represents important components in analyses of climate sensitivity and feedbacks. Since the available data from ice cores are discontinuous and partly ambiguous, a well-documented decision process during data compilation followed by some interpolating post-processing is necessary to obtain those desired time series. Here, we document our best possible data compilation of published ice core records and recent measurements on firn air and atmospheric samples spanning the interval from the penultimate glacial maximum ( ∼  156 kyr BP to the beginning of the year 2016 CE. We use the most recent age scales for the ice core data and apply a smoothing spline method to translate the discrete and irregularly spaced data points into continuous time series. These splines are then used to compute the radiative forcing for each GHG using well-established, simple formulations. We compile only a Southern Hemisphere record of CH4 and discuss how much larger a Northern Hemisphere or global CH4 record might have been due to its interpolar difference. The uncertainties of the individual data points are considered in the spline procedure. Based on the given data resolution, time-dependent cutoff periods of the spline, defining the degree of smoothing, are prescribed, ranging from 5000 years for the less resolved older parts of the records to 4 years for the densely sampled recent years. The computed splines seamlessly describe the GHG evolution on orbital and millennial timescales for glacial and glacial–interglacial variations and on centennial and decadal timescales for anthropogenic times. Data connected with this paper, including raw data and final splines, are available at doi:10.1594/PANGAEA.871273.

Multiple Genes Related to Muscle Identified through a Joint Analysis of a Two-stage Genome-wide Association Study for Racing Performance of 1,156 Thoroughbreds

Directory of Open Access Journals (Sweden)

Dong-Hyun Shin

2015-06-01

Full Text Available Thoroughbred, a relatively recent horse breed, is best known for its use in horse racing. Although myostatin (MSTN variants have been reported to be highly associated with horse racing performance, the trait is more likely to be polygenic in nature. The purpose of this study was to identify genetic variants strongly associated with racing performance by using estimated breeding value (EBV for race time as a phenotype. We conducted a two-stage genome-wide association study to search for genetic variants associated with the EBV. In the first stage of genome-wide association study, a relatively large number of markers (~54,000 single-nucleotide polymorphisms, SNPs were evaluated in a small number of samples (240 horses. In the second stage, a relatively small number of markers identified to have large effects (170 SNPs were evaluated in a much larger number of samples (1,156 horses. We also validated the SNPs related to MSTN known to have large effects on racing performance and found significant associations in the stage two analysis, but not in stage one. We identified 28 significant SNPs related to 17 genes. Among these, six genes have a function related to myogenesis and five genes are involved in muscle maintenance. To our knowledge, these genes are newly reported for the genetic association with racing performance of Thoroughbreds. It complements a recent horse genome-wide association studies of racing performance that identified other SNPs and genes as the most significant variants. These results will help to expand our knowledge of the polygenic nature of racing performance in Thoroughbreds.

Recent experience about the influence of primary coolant and shutdown chemistry on cobalt activity at Beznau NPP

International Nuclear Information System (INIS)

Mailand, I.; Venz, H.

2007-01-01

The Beznau nuclear power plant comprises two identical 380 MWe PWR units, commissioned in 1969 and 1971. The surfaces of the new steam generator tube material, Inconel 690, are the main source of 58 Co. The 60 Co originates predominantly from the Cobalt alloy, Stellite, which is installed in valves and pump bearings because of the very good hardness of this material. By means of optimised shutdown chemistry it is possible to reduce the amount of NiO on the fuel rods, leading to reduced Co-58 peaks in subsequent cycles. The optimised shutdown chemistry during the past few years and especially the strict separation of acid-reducing phase from the acid-oxidising phase as well as the results of studies and the resulting operational experiences are important basics for the actual operation mode of the Beznau NPP. (orig.)

Cladding using a 15 kW CO2 laser

International Nuclear Information System (INIS)

Vesely, E.J.; Verma, S.K.

1989-01-01

Laser alloying or cladding differs little in principle from the traditional forms of weld overlays, but lasers as a heat source offer some distinct advantages. With the selective heating attainable using high power lasers, good metallurgical bond of the clad layer, minimal dilution and typically, a very fine homogeneous microstructure can be obtained in the clad layer. This is a review of work in laser cladding using the 15 kW CO 2 laser. The authors discuss the ability of the laser clad surface to increase the high temperature oxidation resistance of a low-alloy carbon steel (4140). Examples of clads subjected to high- temperature thermal cycling of nickel-20% aluminum and TaC + 4140 clad low-alloy steel and straight high-temperature oxidation of Stellite 6-304L cladding on a 4140 substrate are given

40 CFR 82.156 - Required practices.

Science.gov (United States)

2010-07-01

... the additional time needed to conduct and complete repairs in a safe working environment will be... creating a safe working environment will require more than 30 weeks; (B) The operator notifies EPA within... the additional time needed to conduct and complete work in a safe environment will be permitted. (iii...

Translations on Environmental Quality, Number 156.

Science.gov (United States)

1978-01-06

MALAYSIA Industrial Effluents Killing Fish, Cockles (NEW STRAITS TIMES, 6, 7 Oct 77) 3 Fishermen Hit Twice, by Christopher Butterworth Action...Afghanistan a parad- ise for bird watchers from all over the world. CSO: 5000 MALAYSIA INDUSTRIAL EFFLUENTS KILLING FISH, COCKLES Fishermen Hit...that this hinders the oxidation of carbohydrates, consequently leading to obesity and skin problems. Ozdenoglu also added that the healthy

29 CFR 1910.156 - Fire brigades.

Science.gov (United States)

2010-07-01

... training schools as the Maryland Fire and Rescue Institute; Iowa Fire Service Extension; West Virginia Fire... University, Lamar University, Reno Fire School, or the Delaware State Fire School.) (4) The employer shall... laboratory oven at a temperature of 500 °F (260 °C) for a period of five minutes. After cooling to ambient...

40 CFR 156.62 - Toxicity Category.

Science.gov (United States)

2010-07-01

.... Acute Toxicity Categories for Pesticide Products Hazard Indicators I II III IV Oral LD50 Up to and including 50 mg/kg >50 thru 500 mg/kg >500 thru 5,000 mg/kg >5,000 mg/kg Dermal LD50 Up to and including 200 mg/kg >200 thru 2000 mg/kg >2000 thru 20,000 mg/kg >20,000 mg/kg Inhalation LC50 Up to and including...

Publications | Page 156 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Visit the IDRC Digital Library now. ... Use this search tool to locate a specific publication for your field of research. ... Sudan Workshop for building online knowledge networks : report for the period from March ... of the need to strengthen health systems in order to deliver already available, cost-effective health interventions.

156 ORIGINAL ARTICLE PREVALENCE OF BACTERIAL ...

African Journals Online (AJOL)

Dr Oboro VO

reproductive age with a prevalence of 9-37%, depending on the .... 82 (100). 161 (100). BV, bacterial vaginosis: score of 7-10; I, intermediate: score of 4-6; N, normal: score of 0-3 .... based study of reproductive tract infections among ever ...

40 CFR 156.10 - Labeling requirements.

Science.gov (United States)

2010-07-01

... statement is a complete analysis of the pesticide, the term “analysis” shall not be used as a heading for... treated. (iv) The target pest(s) associated with each site. (v) The dosage rate associated with each site and pest. (vi) The method of application, including instructions for dilution, if required, and type(s...

Reference: 156 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available dopsis thaliana . We demonstrate that loss of DEL1 function resulted in increased ploidy levels, whereas ectopic...nics. DEL1 inhibited the endoreduplication phenotype, but not the ectopic cell divisions that resulted from

Stellite failure on a P91 HP valve - failure investigation and modelling of residual stresses

DEFF Research Database (Denmark)

Thorborg, Jesper; Hald, John; Hattel, Jesper Henri

2006-01-01

, and this provides a tool for process modification in order to minimize the risk for future breakdown. Both classical time independent and time dependent plasticity models have been used to describe the different material behaviours during the different process steps. The description of the materials is highly...

Synthesis Of NiCrAlC alloys by mechanical alloying; Sintese de ligas NiCrAlC por moagem de alta energia

Energy Technology Data Exchange (ETDEWEB)

Silva, A.K.; Pereira, J.I.; Vurobi Junior, S.; Cintho, O.M., E-mail: alissonkws@gmail.co [Universidade Estadual de Ponta Grossa (UEPG), PR (Brazil)

2010-07-01

The purpose of the present paper is the synthesis of nickel alloys (NiCrAlC), which has been proposed like a economic alternative to the Stellite family Co alloys using mechanical alloying, followed by sintering heat treatment of milled material. The NiCrAlC alloys consist of a chromium carbides dispersion in a Ni{sub 3}Al intermetallic matrix, that is easily synthesized by mechanical alloying. The use of mechanical alloying enables higher carbides sizes and distribution control in the matrix during sintering. We are also investigated the compaction of the processed materials by compressibility curves. The milling products were characterized by X-ray diffraction, and the end product was featured by conventional metallography and scanning electronic microscopy (SEM), that enabled the identification of desired phases, beyond microhardness test, which has been shown comparable to alloys manufactured by fusion after heat treating. (author)

Absorptivity Measurements and Heat Source Modeling to Simulate Laser Cladding

Science.gov (United States)

Wirth, Florian; Eisenbarth, Daniel; Wegener, Konrad

The laser cladding process gains importance, as it does not only allow the application of surface coatings, but also additive manufacturing of three-dimensional parts. In both cases, process simulation can contribute to process optimization. Heat source modeling is one of the main issues for an accurate model and simulation of the laser cladding process. While the laser beam intensity distribution is readily known, the other two main effects on the process' heat input are non-trivial. Namely the measurement of the absorptivity of the applied materials as well as the powder attenuation. Therefore, calorimetry measurements were carried out. The measurement method and the measurement results for laser cladding of Stellite 6 on structural steel S 235 and for the processing of Inconel 625 are presented both using a CO2 laser as well as a high power diode laser (HPDL). Additionally, a heat source model is deduced.

Synthesis Of NiCrAlC alloys by mechanical alloying

International Nuclear Information System (INIS)

Silva, A.K.; Pereira, J.I.; Vurobi Junior, S.; Cintho, O.M.

2010-01-01

The purpose of the present paper is the synthesis of nickel alloys (NiCrAlC), which has been proposed like a economic alternative to the Stellite family Co alloys using mechanical alloying, followed by sintering heat treatment of milled material. The NiCrAlC alloys consist of a chromium carbides dispersion in a Ni 3 Al intermetallic matrix, that is easily synthesized by mechanical alloying. The use of mechanical alloying enables higher carbides sizes and distribution control in the matrix during sintering. We are also investigated the compaction of the processed materials by compressibility curves. The milling products were characterized by X-ray diffraction, and the end product was featured by conventional metallography and scanning electronic microscopy (SEM), that enabled the identification of desired phases, beyond microhardness test, which has been shown comparable to alloys manufactured by fusion after heat treating. (author)

Test methods for selection of materials of construction for high-level radioactive waste vitrification. Revision

International Nuclear Information System (INIS)

Bickford, D.F.; Corbett, R.A.; Morrison, W.S.

1986-01-01

Candidate materials of construction were evaluated for a facility at the Department of Energy's Savannah River Plant to vitrify high-level radioactive waste. Limited operating experience was available under the corrosive conditions of the complex vitrification process. The objective of the testing program was to provide a high degree of assurance that equipment will meet or exceed design lifetimes. To meet this objective in reasonable time and minimum cost, a program was designed consisting of a combination of coupon immersion and electrochemical laboratory tests and pilot-scale tests. Stainless steels and nickel-based alloys were tested. Alloys that were most resistant to general and local attack contained nickel, molybdenum (>9%), and chromium (where Cr + Mo > 30%). Alloy C-276 was selected as the reference material for process equipment. Stellite 6 was selected for abrasive service in the presence of formic acid. Alloy 690 and ALLCORR were selected for specific applications

Experimental evaluation of the wear of the PEC type fuel element base. Tribological experimental studies in Na at high temperature

International Nuclear Information System (INIS)

D'Agraives, B.C.; Volcan, A.; Bacchilega, A.

1978-01-01

Tribological studies in sodium, related to the PEC-type fuel element design are presented. They are aimed at the simulation of friction and wear phenomena which are expected to occur on the surface of fuel element components undergoing solid-solid contact situations with variable loads and/or variable motions. In this first paper, a description of the preparatory work is given. Then, results related to long-duration experiments are shown with respect to the contact between the centering spherical ring belonging to the lower extension of the subassembly, and the cylindrical sleeve of the grid in which it takes place. After 1000 hours under loaded and vibrated conditions, in sodium at 400 0 C, the wear effects suffered by both contacting samples, are observed and evaluated. The stellite surfaces of the samples are damaged to a not-negligible extent and material transfers from the cylindrical sleeve onto the spherical ring occur

VERTICAL ACCURACY COMPARISON OF DIGITAL ELEVATION MODEL FROM LIDAR AND MULTITEMPORAL SATELLITE IMAGERY

Directory of Open Access Journals (Sweden)

J. Octariady

2017-05-01

Full Text Available Digital elevation model serves to illustrate the appearance of the earth's surface. DEM can be produced from a wide variety of data sources including from radar data, LiDAR data, and stereo satellite imagery. Making the LiDAR DEM conducted using point cloud data from LiDAR sensor. Making a DEM from stereo satellite imagery can be done using same temporal or multitemporal stereo satellite imagery. How much the accuracy of DEM generated from multitemporal stereo stellite imagery and LiDAR data is not known with certainty. The study was conducted using LiDAR DEM data and multitemporal stereo satellite imagery DEM. Multitemporal stereo satellite imagery generated semi-automatically by using 3 scene stereo satellite imagery with acquisition 2013–2014. The high value given each of DEM serve as the basis for calculating high accuracy DEM respectively. The results showed the high value differences in the fraction of the meter between LiDAR DEM and multitemporal stereo satellite imagery DEM.

Conclusion of the commission for determining wear out of Avala heavy water pump bearings - Annex 1; Prilog1 - Zakljucak komisije za utvrdjivanje istrosenosti lezista teskovodne pumpe Avala

Energy Technology Data Exchange (ETDEWEB)

Nikolic, M; Bratic, A; Zaric, Z; Vidmar, M; Kirilin, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)

1963-12-15

After dismantling of the CEN-132 pump the findings of the Commission were: the wear-out of the surfaces of the pump bearings and one disc caused appearance of about 39 grams of cobalt in the heavy water system of the reactor. This report includes: results of chemical analysis of stellite taken form pump disc, results of measuring the wear-out of the upper pump bearing, drawing of the worn-out disc and upper cladding of the pump, and a photo of the upper surface of the disc. [Serbo-Croat] Posle demontaze pumpe CEN-132, pregleda detalja i izvrsenih merenja komisija je konstatovala da je zbog istrosenosti lezista diska pumpe i istrosenosti gornje caure u teskovodni sistem dospelo ukupno 39 grama kobalta. Ovaj dokument sadrzi i rezultate hemijske analize stelita skinutog sa diska pumpe, rezultate merenja istrosenosti gornjeg lezista teskovodne pumpe, crteze istrosnog diska skinutog sa pumpe, crteze gornje caure, fotografiju gornje povrsine diska.

Stem thrust prediction model for W-K-M double wedge parallel expanding gate valves

Energy Technology Data Exchange (ETDEWEB)

Eldiwany, B.; Alvarez, P.D. [Kalsi Engineering Inc., Sugar Land, TX (United States); Wolfe, K. [Electric Power Research Institute, Palo Alto, CA (United States)

1996-12-01

An analytical model for determining the required valve stem thrust during opening and closing strokes of W-K-M parallel expanding gate valves was developed as part of the EPRI Motor-Operated Valve Performance Prediction Methodology (EPRI MOV PPM) Program. The model was validated against measured stem thrust data obtained from in-situ testing of three W-K-M valves. Model predictions show favorable, bounding agreement with the measured data for valves with Stellite 6 hardfacing on the disks and seat rings for water flow in the preferred flow direction (gate downstream). The maximum required thrust to open and to close the valve (excluding wedging and unwedging forces) occurs at a slightly open position and not at the fully closed position. In the nonpreferred flow direction, the model shows that premature wedging can occur during {Delta}P closure strokes even when the coefficients of friction at different sliding surfaces are within the typical range. This paper summarizes the model description and comparison against test data.

Stem thrust prediction model for W-K-M double wedge parallel expanding gate valves

International Nuclear Information System (INIS)

Eldiwany, B.; Alvarez, P.D.; Wolfe, K.

1996-01-01

An analytical model for determining the required valve stem thrust during opening and closing strokes of W-K-M parallel expanding gate valves was developed as part of the EPRI Motor-Operated Valve Performance Prediction Methodology (EPRI MOV PPM) Program. The model was validated against measured stem thrust data obtained from in-situ testing of three W-K-M valves. Model predictions show favorable, bounding agreement with the measured data for valves with Stellite 6 hardfacing on the disks and seat rings for water flow in the preferred flow direction (gate downstream). The maximum required thrust to open and to close the valve (excluding wedging and unwedging forces) occurs at a slightly open position and not at the fully closed position. In the nonpreferred flow direction, the model shows that premature wedging can occur during ΔP closure strokes even when the coefficients of friction at different sliding surfaces are within the typical range. This paper summarizes the model description and comparison against test data

40 CFR 156.85 - Non-target organisms.

Science.gov (United States)

2010-07-01

... oral LD50 of 100 mg/kg or less, the statement, “This pesticide is toxic to wildlife” is required. (2) If a pesticide intended for outdoor use contains an active ingredient with a fish acute LC50 of 1 ppm... for outdoor use contains an active ingredient with an avian acute oral LD50 of 100 mg/kg or less, or a...

156 -- 15 Dec 2009 [final version].indd

African Journals Online (AJOL)

15 Des 2009 ... ABSTRACT. Intertextuality – encyclopedia and archaeology: Matthew's presentation of Jesus as saviour. This article aims to explore and to apply what Gérard Genette refers to as kinds of transtextual relationships and what Ulrich Luz, in his application of these insights to the Gospel of Matthew, calls the ...

33 CFR 156.120 - Requirements for transfer.

Science.gov (United States)

2010-07-01

... prevent kinking or other damage to the hose and strain on its coupling. (d) Each part of the transfer.... (cc) Smoking is not permitted in the facilities marine transfer area except in designated smoking areas. (dd) Welding, hot work operations and smoking are prohibited on vessels during the transfer of...

Search Results | Page 156 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Strengthening Mission 2007 through Demonstration of Social Enterprise Models, Products and Services. India's "Mission 2007 : Every Village Knowledge Centre" is a multistakeholder initiative that is top-down in its approach to technological connectivity but bottom-up in relation to content and knowledge management.

34 CFR 668.156 - Approved State process.

Science.gov (United States)

2010-07-01

... the success rate of students with high school diplomas; and (2) The State's process satisfies the... participating in the process to provide each student they admit without a high school diploma or its recognized... teachers and counselors regarding the student's classroom performance and satisfactory progress toward...

Rangifer 1981 Vol. 1 (1: 1-56

Directory of Open Access Journals (Sweden)

Sven Skjenneberg (ed.

1981-05-01

Full Text Available The first issue/volume of Rangifer was published in autumn 1981 and contained six articles, two of them in English. Besides the scientific contributions, the publication included information about the mandates of the Nordic Council for Reindeer Research (NOR and Rangifer. The aims of the journal were to give reindeer researchers possibilities for "high speed" publishing and to create a link between the researchers and the management/reindeer husbandry advisors to the best of the reindeer industry. Therefore abstracts were provided in several languages.

7 CFR 989.156 - Raisin diversion program.

Science.gov (United States)

2010-01-01

... not be limited to: Costs for picking, turning, rolling, boxing, paper trays, vineyard terracing... chain sawed at the base of the vine by July 31, 2002. Committee staff will verify that the vines have been removed or adequately chain sawed. Committee staff will re-inspect vines that have been chain...

32 CFR 156.2 - Applicability and scope.

Science.gov (United States)

2010-07-01

... Agency (NSA) in paragraph (b) of this section (hereafter referred to collectively as “the DoD Components”). (b) The NSA is exempt from the provisions of this Directive. The personnel security program for the NSA is implemented pursuant to DoD Directive 5210.45, 3 and internal regulations of the NSA. 3 See...

Effectiveness of combined use of imprint cytological and histological examination in CT-guided tissue-core biopsy

International Nuclear Information System (INIS)

Yamagami, Takuji; Yoshimatsu, Rika; Kajiwara, Kenji; Ishikawa, Masaki; Awai, Kazuo; Matsumoto, Tomohiro; Hasebe, Terumitsu; Kakizawa, Hideaki; Toyoda, Naoyuki

2014-01-01

This study evaluated the efficacy of the combination of imprint cytology and histology in tissue-core percutaneous biopsy under real-time computed tomography (CT) fluoroscopic guidance. Between October 2009 and June 2013, 156 percutaneous needle biopsies were performed in our institution. Those obtained by tissue-core biopsy underwent both imprint cytological and histological examinations routinely after touch imprint cytology was performed on site to evaluate the samples' sufficiency for cytological and pathological examination. Final diagnosis was confirmed by independent surgical pathology, independent culture results or clinical follow-up. Rates of adequate specimens and precise diagnosis, by combined cytological and histological examination were 100 % (156/156) and 96.2 % (150/156), by cytology 94.4 % (152/156) and 83.3 % (130/156) and by histology 99.3 % (155/156) and 92.3 % (144/156). Precise diagnosis was achieved by combined examinations in 94.7 % (89/94) of thoracic lesions, 97.6 % (40/41) of musculoskeletal lesions, and 100 % (21/21) of abdominal, pelvic and retroperitoneal lesions. In all 104 lesions diagnosed as malignant by CT-guided biopsy and in 30 of 52 diagnosed as benign, specific cell types could be proved by combined examinations. Combined imprint cytology and histology performed after on-site touch imprint cytological evaluation improved the diagnostic ability of CT fluoroscopically guided biopsy. (orig.)

Effectiveness of combined use of imprint cytological and histological examination in CT-guided tissue-core biopsy

Energy Technology Data Exchange (ETDEWEB)

Yamagami, Takuji; Yoshimatsu, Rika; Kajiwara, Kenji; Ishikawa, Masaki; Awai, Kazuo [Hiroshima University, Department of Diagnostic Radiology, Institute and Graduate School of Biomedical Sciences, Minami-Ku, Hiroshima (Japan); Matsumoto, Tomohiro; Hasebe, Terumitsu [Tokai University Hachioji Hospital, Tokai University School of Medicine, Department of Radiology, Hachioji, Tokyo (Japan); Kakizawa, Hideaki [Hiroshima University, Department of Diagnostic Radiology, Institute and Graduate School of Biomedical Sciences, Minami-Ku, Hiroshima (Japan); Hiroshima Red Cross Hospital and Atomic-bomb Survivors Hospital, Department of Diagnostic Radiology, Naka-Ku, Hiroshima (Japan); Toyoda, Naoyuki [Hiroshima University, Department of Diagnostic Radiology, Institute and Graduate School of Biomedical Sciences, Minami-Ku, Hiroshima (Japan); National Hospital Organisation Kure Medical Centre, Department of Diagnostic Radiology, Kure, Hiroshima (Japan)

2014-05-15

This study evaluated the efficacy of the combination of imprint cytology and histology in tissue-core percutaneous biopsy under real-time computed tomography (CT) fluoroscopic guidance. Between October 2009 and June 2013, 156 percutaneous needle biopsies were performed in our institution. Those obtained by tissue-core biopsy underwent both imprint cytological and histological examinations routinely after touch imprint cytology was performed on site to evaluate the samples' sufficiency for cytological and pathological examination. Final diagnosis was confirmed by independent surgical pathology, independent culture results or clinical follow-up. Rates of adequate specimens and precise diagnosis, by combined cytological and histological examination were 100 % (156/156) and 96.2 % (150/156), by cytology 94.4 % (152/156) and 83.3 % (130/156) and by histology 99.3 % (155/156) and 92.3 % (144/156). Precise diagnosis was achieved by combined examinations in 94.7 % (89/94) of thoracic lesions, 97.6 % (40/41) of musculoskeletal lesions, and 100 % (21/21) of abdominal, pelvic and retroperitoneal lesions. In all 104 lesions diagnosed as malignant by CT-guided biopsy and in 30 of 52 diagnosed as benign, specific cell types could be proved by combined examinations. Combined imprint cytology and histology performed after on-site touch imprint cytological evaluation improved the diagnostic ability of CT fluoroscopically guided biopsy. (orig.)

Dicty_cDB: Contig-U04090-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 2e-38 AB241243_1( AB241243 |pid:none) Symbiotic protist of Reticuliterme... 162 2...1( CR932504 |pid:none) Paramecium tetraurelia, Small GTPa... 159 8e-38 AB241242_1( AB241242 |pid:none) Symbiotic...romosome 3 ... 156 7e-37 AB241241_1( AB241241 |pid:none) Symbiotic protist of Reticuliterme... 156 7e-37 AF0..... 156 7e-37 AB241245_1( AB241245 |pid:none) Symbiotic protist of Reticuliterme... 156 9e-37 BT038097_1( BT0

Facultative Sterol Uptake in an Ergosterol-Deficient Clinical Isolate of Candida glabrata Harboring a Missense Mutation in ERG11 and Exhibiting Cross-Resistance to Azoles and Amphotericin B

Science.gov (United States)

Hull, Claire M.; Parker, Josie E.; Bader, Oliver; Weig, Michael; Gross, Uwe; Warrilow, Andrew G. S.; Kelly, Diane E.

2012-01-01

We identified a clinical isolate of Candida glabrata (CG156) exhibiting flocculent growth and cross-resistance to fluconazole (FLC), voriconazole (VRC), and amphotericin B (AMB), with MICs of >256, >256, and 32 μg ml−1, respectively. Sterol analysis using gas chromatography-mass spectrometry (GC-MS) revealed that CG156 was a sterol 14α-demethylase (Erg11p) mutant, wherein 14α-methylated intermediates (lanosterol was >80% of the total) were the only detectable sterols. ERG11 sequencing indicated that CG156 harbored a single-amino-acid substitution (G315D) which nullified the function of native Erg11p. In heterologous expression studies using a doxycycline-regulatable Saccharomyces cerevisiae erg11 strain, wild-type C. glabrata Erg11p fully complemented the function of S. cerevisiae sterol 14α-demethylase, restoring growth and ergosterol synthesis in recombinant yeast; mutated CG156 Erg11p did not. CG156 was culturable using sterol-free, glucose-containing yeast minimal medium (glcYM). However, when grown on sterol-supplemented glcYM (with ergosta 7,22-dienol, ergosterol, cholestanol, cholesterol, Δ7-cholestenol, or desmosterol), CG156 cultures exhibited shorter lag phases, reached higher cell densities, and showed alterations in cellular sterol composition. Unlike comparator isolates (harboring wild-type ERG11) that became less sensitive to FLC and VRC when cultured on sterol-supplemented glcYM, facultative sterol uptake by CG156 did not affect its azole-resistant phenotype. Conversely, CG156 grown using glcYM with ergosterol (or with ergosta 7,22-dienol) showed increased sensitivity to AMB; CG156 grown using glcYM with cholesterol (or with cholestanol) became more resistant (MICs of 2 and >64 μg AMB ml−1, respectively). Our results provide insights into the consequences of sterol uptake and metabolism on growth and antifungal resistance in C. glabrata. PMID:22615281

Bioluminescent system for dynamic imaging of cell and animal behavior

Energy Technology Data Exchange (ETDEWEB)

Hara-Miyauchi, Chikako [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Laboratory for Cell Function Dynamics, Brain Science Institute, RIKEN, Saitama 351-0198 (Japan); Department of Biophysics and Biochemistry, Graduate School of Health Care Sciences, Tokyo Medical and Dental University, Tokyo 113-8510 (Japan); Tsuji, Osahiko [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Department of Orthopedic Surgery, Keio University School of Medicine, Tokyo 160-8582 (Japan); Hanyu, Aki [Division of Biochemistry, The Cancer Institute of the Japanese Foundation for Cancer Research, Tokyo 135-8550 (Japan); Okada, Seiji [Department of Advanced Medical Initiatives, Faculty of Medical Sciences, Kyushu University, Fukuoka 812-8582 (Japan); Yasuda, Akimasa [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Department of Orthopedic Surgery, Keio University School of Medicine, Tokyo 160-8582 (Japan); Fukano, Takashi [Laboratory for Cell Function Dynamics, Brain Science Institute, RIKEN, Saitama 351-0198 (Japan); Akazawa, Chihiro [Department of Biophysics and Biochemistry, Graduate School of Health Care Sciences, Tokyo Medical and Dental University, Tokyo 113-8510 (Japan); Nakamura, Masaya [Department of Orthopedic Surgery, Keio University School of Medicine, Tokyo 160-8582 (Japan); Imamura, Takeshi [Department of Molecular Medicine for Pathogenesis, Ehime University Graduate School of Medicine, Toon, Ehime 791-0295 (Japan); Core Research for Evolutional Science and Technology, The Japan Science and Technology Corporation, Tokyo 135-8550 (Japan); Matsuzaki, Yumi [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Okano, Hirotaka James, E-mail: hjokano@jikei.ac.jp [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Division of Regenerative Medicine Jikei University School of Medicine, Tokyo 150-8461 (Japan); and others

2012-03-09

Highlights: Black-Right-Pointing-Pointer We combined a yellow variant of GFP and firefly luciferase to make ffLuc-cp156. Black-Right-Pointing-Pointer ffLuc-cp156 showed improved photon yield in cultured cells and transgenic mice. Black-Right-Pointing-Pointer ffLuc-cp156 enabled video-rate bioluminescence imaging of freely-moving animals. Black-Right-Pointing-Pointer ffLuc-cp156 mice enabled tracking real-time drug delivery in conscious animals. -- Abstract: The current utility of bioluminescence imaging is constrained by a low photon yield that limits temporal sensitivity. Here, we describe an imaging method that uses a chemiluminescent/fluorescent protein, ffLuc-cp156, which consists of a yellow variant of Aequorea GFP and firefly luciferase. We report an improvement in photon yield by over three orders of magnitude over current bioluminescent systems. We imaged cellular movement at high resolution including neuronal growth cones and microglial cell protrusions. Transgenic ffLuc-cp156 mice enabled video-rate bioluminescence imaging of freely moving animals, which may provide a reliable assay for drug distribution in behaving animals for pre-clinical studies.

Bioluminescent system for dynamic imaging of cell and animal behavior

International Nuclear Information System (INIS)

Hara-Miyauchi, Chikako; Tsuji, Osahiko; Hanyu, Aki; Okada, Seiji; Yasuda, Akimasa; Fukano, Takashi; Akazawa, Chihiro; Nakamura, Masaya; Imamura, Takeshi; Matsuzaki, Yumi; Okano, Hirotaka James

2012-01-01

Highlights: ► We combined a yellow variant of GFP and firefly luciferase to make ffLuc-cp156. ► ffLuc-cp156 showed improved photon yield in cultured cells and transgenic mice. ► ffLuc-cp156 enabled video-rate bioluminescence imaging of freely-moving animals. ► ffLuc-cp156 mice enabled tracking real-time drug delivery in conscious animals. -- Abstract: The current utility of bioluminescence imaging is constrained by a low photon yield that limits temporal sensitivity. Here, we describe an imaging method that uses a chemiluminescent/fluorescent protein, ffLuc-cp156, which consists of a yellow variant of Aequorea GFP and firefly luciferase. We report an improvement in photon yield by over three orders of magnitude over current bioluminescent systems. We imaged cellular movement at high resolution including neuronal growth cones and microglial cell protrusions. Transgenic ffLuc-cp156 mice enabled video-rate bioluminescence imaging of freely moving animals, which may provide a reliable assay for drug distribution in behaving animals for pre-clinical studies.

ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available jct: 1 ... MKFVLQKVKSASVKVDGQIVSSIGPGLLLLVGIRTDDVDSNSDYLVRKCLSIRLWPDESD 60 ... Query: 121 SHDPE...KIKTGCFGEEMEVSLVNDGPVTLILENNSKN 156 ... SHDPEKIKTGCFGEEMEVSLVNDGPVTLILENNSKN Sbjct: 121 SHDPEKIKTGCFGEEMEVSLVNDGPVTLILENNSKN 156

Molecular Characterization of SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL Gene Family in Betula luminifera

Directory of Open Access Journals (Sweden)

Xiu-Yun Li

2018-05-01

Full Text Available As a major family of plant-specific transcription factors, SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL genes play vital regulatory roles in plant growth, development and stress responses. In this study, 18 SPL genes were identified and cloned from Betula luminifera. Two zinc finger-like structures and a nuclear location signal (NLS segments were existed in the SBP domains of all BlSPLs. Phylogenetic analysis showed that these genes were clustered into nine groups (group I-IX. The intron/exon structure and motif composition were highly conserved within the same group. 12 of the 18 BlSPLs were experimentally verified as the targets of miR156, and two cleavage sites were detected in these miR156-targeted BlSPL genes. Many putative cis-elements, associated with light, stresses and phytohormones response, were identified in the promoter regions of BlSPLs, suggesting that BlSPL genes are probably involved in important physiological processes and developmental events. Tissue-specific expression analysis showed that miR156-targeted BlSPLs exhibited a more differential expression pattern, while most miR156-nontargeted BlSPLs tended to be constitutively expressed, suggesting the distinct roles of miR156-targeted and nontargeted BlSPLs in development and growth of B. luminifera. Further expression analysis revealed that miR156-targeted BlSPLs were dramatically up-regulated with age, whereas mature BlmiR156 level was apparently declined with age, indicating that miR156/SPL module plays important roles in vegetative phase change of B. luminifera. Moreover, yeast two-hybrid assay indicated that several miR156-targeted and nontargeted BlSPLs could interact with two DELLA proteins (BlRGA and BlRGL, which suggests that certain BlSPLs take part in the GA regulated processes through protein interaction with DELLA proteins. All these results provide an important basis for further exploring the biological functions of BlSPLs in B. luminifera.

An investigation of two-body abrasive wear of laser processed surfaces

International Nuclear Information System (INIS)

Abass, G.

1995-01-01

This paper reports two body abrasive wear studies of alloy and composite deposits produced with a 2 kW continuous wave CO/sub 2/ laser. Stellite alloy 6, Alloy 4815, Stainless steel and SiC powders were used to produce alloy and composite deposits on an En 3b mild steel substrate. The cladding material was injected into the laser produced melt pool by means of a pneumatic powder delivery system. In the present studies instead of using the conventional pin-on-disc method of wear measurement, a more realistic and practical wear testing procedure was adopted. The wear testing machine used was capable of measuring wear of three comparatively larger (30 x 30 x 10 mm) clad samples by abrading simultaneously against a revolving alumina disc. A comparative study of microstructure, hardness and wear of alloy and composite clads was made. The clad deposits were found sound and continuous. The hardness and wear resistance of the composites were markedly higher than that of the alloy clads. (author) 9 figs

Development of high-power CO2 lasers and laser material processing

Science.gov (United States)

Nath, Ashish K.; Choudhary, Praveen; Kumar, Manoj; Kaul, R.

2000-02-01

Scaling laws to determine the physical dimensions of the active medium and optical resonator parameters for designing convective cooled CO2 lasers have been established. High power CW CO2 lasers upto 5 kW output power and a high repetition rate TEA CO2 laser of 500 Hz and 500 W average power incorporated with a novel scheme for uniform UV pre- ionization have been developed for material processing applications. Technical viability of laser processing of several engineering components, for example laser surface hardening of fine teeth of files, laser welding of martensitic steel shroud and titanium alloy under-strap of turbine, laser cladding of Ni super-alloy with stellite for refurbishing turbine blades were established using these lasers. Laser alloying of pre-placed SiC coating on different types of aluminum alloy, commercially pure titanium and Ti-6Al-4V alloy, and laser curing of thermosetting powder coating have been also studied. Development of these lasers and results of some of the processing studies are briefly presented here.

Engineer, design construct, test, and evaluate a pressurized fluidized-bed pilot plant using high-sulfur coal for production of electric power: Phase I. Preliminary engineering; Phase II. Final design; Phase III. Construction. Annual report, March 1, 1979-February 29, 1980

Energy Technology Data Exchange (ETDEWEB)

1980-01-01

The extended test program on the SGT/PFB Technology Unit, previously placed in operation, was completed. Total operating time is 3378 which includes 2681 h burning coal and 1205 h total turbine engine operation. Significant performance and operational milestones, completed during the past year, included: over 2000 h on candidate heat exchanger tube materials at design temperature during which durability of iron-base alloy for PFB heat exchanger tubes was demonstrated; generated electric power with gas turbine operating on PFB coal combustion gas for 1000 h with no appreciable erosion or corrosion of turbine rotor blades and stator vanes; evaluated and improved hot gas cleanup system during which mean particle size of 1.3 Microns and a loading of 0.054 grains/Scf was achieved; and durability of hot/ash solids lock hopper valves for over 1000 h without leakage and stellite coated butterfly gas valve operating successfully for over 900 h in a highly erosive environment was demonstrated. Details of materials evolutions and corrosion rates, component performances and gaseous emission levels are presented.

Canned motor pumps at Heavy Water Project, Baroda [Paper No.: II-2

International Nuclear Information System (INIS)

Batra, R.K.; Waishampayan, S.G.

1981-01-01

Heavy Water Project, Baroda is having special canned motor pumps for pumping ammonia and potassium amide. These pumps work under a pressure of 640 kg/cm 2 and are lubricated and cooled by the same fluid. These pumps are having special bearings consisting of mating surfaces of tungsten carbine Vs ceramic or stellite Vs carbon depending upon application. The total number of such pumps installed in the plant is around 52. These pumps being installed in high pressure vessels working at a pressure of 640 kg/cm 2 have special maintenance problems and need special care during maintenance. Pumps once boxed up are completely out of reach for immediate maintenance if needed. The failure of these pumps may mean a down time of one to two months for the plant. Besides above, there are multistage barrel type ammonia pumps with 24 stages developing a pressure of 140 kg/cm 2 . All these equipments need special maintenance methods as the problems faced are varied and difficult to solve. This paper deals with general and unique type of problems faced on these pumps. (author)

UJI TOKSISITAS BEBERAPA EKSTRAK TANAMAN TERHADAP LARVA AEDES AEgYPTI VEKTOR DEMAM BERDARAH DENGUE

Directory of Open Access Journals (Sweden)

Hasan Boesri

2015-09-01

Full Text Available Mosquito vector control are still using insecticide  from pyrethroid, carbamates and organophosphates groups because they are effective, having fast result but having less concern for the negative impact to the environment. In order to solve the side effects the side effect, it was necessary to find bio-insecticides which are sustainable, accessible and effective to kill mosquitoes and larvae. In this study the extract of Nicotiana tabacum / tobacco with minimum concentration of 1,56 % was effective to kill larvae with of 100% mortality, with of LC90  0,628 %, LC50 0,194 %. The extract contain chemical dominant alkaloids, Euvodia gravolens / zodiac with minimum concentration 1,56 % the mortality effects 100%, is with LC90 0,628 %, and LC50 0,194 %, the extract concentration 1,56 %, the mortality effect is 100 %, is with LC90a of 0,628% and dominant chemical contains Evodiamine, Alpinia galanga/ of  / galanga with minimum concentration of 1,56 %, the mortality effects is 29,3% and LC90 8,216 %, LC50 2,980 % and dominant chemical contain flavonoids, Andropogon nardus/ lemongrass with minimum concentration of 1,56% the mortality effect is 68% and LC90 4,898 %, LC50 1,068 % and dominant chemical contain of vetivetate acid, rosemary ( Rosmarinus officinalis L with minimum concentration of 1,56% gives mortality effect 78,7% and LC90 3,175 %, LC50 0,659 %. The dominant contain of the chemical is alkaloid = Pengendalian  nyamuk vektor masih menggunakan bahan insektisida dari golongan piretroid, karbamat, dan organofosfat karena  efektif, cepat diketahui hasilnya, namun kurang memperhitungkan dampak negatif terhadap lingkungan. Oleh sebab itu perlu dicari insektisida alernatif, yaitu insektisida nabati yang ramah lingkungan, mudah diperoleh, efektif membunuh nyamuk dewasa dan pradewasa. Pada penelitian diperoleh hasil Nicotiana tabacum/tembakau konsentrasi ekstrak minimal 1,56%, mampu membunuh larva nyamuk sebesar 100 % dan LC90 0,628 %, LC50 0

42 CFR 483.156 - Registry of nurse aides.

Science.gov (United States)

2010-10-01

... the registry because they have performed no nursing or nursing-related services for a period of 24... individual was found not guilty in a court of law, or the State is notified of the individual's death. (2) The registry must remove entries for individuals who have performed no nursing or nursing-related...

40 CFR 156.140 - Identification of container types.

Science.gov (United States)

2010-07-01

....” (ii) “Once cleaned, some agricultural plastic pesticide containers can be taken to a container... example, this statement could be “Once cleaned, some agricultural plastic pesticide containers can be...) Pet collars or animal ear tags, such as cattle ear tags. (ix) One-time use semiochemical dispersion...

What we do | Page 156 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... solutions to local problems. encourage knowledge sharing with policymakers, researchers, and communities around the world. foster new talent by offering fellowships and awards. strive to get new knowledge into the hands of those who can use it. In doing so, we contribute to Canada's foreign policy, complementing the ...

29 CFR 1917.156 - Fuel handling and storage.

Science.gov (United States)

2010-07-01

...) Liquid fuel dispensing devices, such as pumps, shall be mounted either on a concrete island or be...) Containers shall be examined before recharging and again before reuse for the following: (A) Dents, scrapes...

40 CFR 156.212 - Personal protective equipment statements.

Science.gov (United States)

2010-07-01

... footwear Shoes Shoes Chemical-resistant gloves 2 Chemical-resistant gloves 2 Chemical-resistant gloves 2 No... and diluted solely with water for application, the glove statement shall specify: “waterproof gloves... specify: “waterproof gloves” instead of the statement in paragraph (f)(4) of this section. (4) Other...

Ceramic Power Extractor Design at 15.6 GHz

CERN Document Server

Smirnov, Alexei Yu; Yi, Rong; Yu, David

2005-01-01

Power extractor and coupler designs developed for an experiment planned at the 12th beam harmonic of the upgraded Advanced Wakefield Accelerator (AWA) facility is described. New features are an upstream HOM dielectric damper with additional tapering, and a single-port coupler considered in two variants. Performance analysis includes coupler geometric tolerances, overvoltage, dipole mode wake and BBU; and wakefield losses induced in the damper.

What we do | Page 156 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC supports research in developing countries to create real and lasting change. ... Women's Economic Rights and Entitlement on Separation and Divorce (India) ... East Asia, South Asia, Jordan, Lebanon, Malaysia, Syria, Yemen, Palestine ...

14 CFR 156.3 - Application and grant process.

Science.gov (United States)

2010-01-01

... Administrator. The State shall certify, in its written acceptance, that the acceptance complies with all applicable Federal and State law, that the acceptance constitutes a legal and binding obligation of the State...

26 CFR 1.56A-5 - Tax carryovers.

Science.gov (United States)

2010-04-01

... tax exemption (determined under § 1.58-1) for such year. For purposes of section 56(c) and this... the acquiring corporation's minimum tax exemption for such year as the items of tax preference... intervening taxable years. If such method is used, the minimum tax liability of the intervening year is not...

Dicty_cDB: SSE156 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available S71730 |S71730.1 influenza virus hemagglutinin 5' epitope tag=fusion protein {frame 1, multiple cloning site...} [Saccharomyces cerevisiae=yeast, cloning vector YCpIF15,16,17, Other Plasmid Sy...6 1 S71728 |S71728.1 truncated protein {frame 1, multiple cloning site} [Saccharomyces cerevisiae=yeast, cloning

156th Symposium of the International Astronomical Union

CERN Document Server

Kołaczek, Barbara

1993-01-01

In this review talk, I would like to report on the proper motion analysis, which has been recently carried out together with M. Soma and M. Yoshizawa: There has been a persistent demand in astronomy for accurate stellar positions and proper motions, which are represented by an inertial reference system constructed on the basis of a set of consistent astronomical constants. In the reference system the precessional constant plays a primary role. In a series of papers Fricke (1967a,b, 1977a,b) has deter­ mined the luni-solar precessional correction to Newcomb's value and the fictitious motion of the equinox, which have been adopted in the "IAU (1976) System of Astronomical Con­ stants". Based on the precessional correction and the equinoctial motion thus established, the fundamental reference system, the FK5 system (Fricke et al. 1988) for positions and proper motions, has been constructed. However, for several years geodetic VLBI (McCarthy & Luzum 1991) and LLR (Williams et at. 1991) observations have bee...

What we do | Page 156 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... sharing our knowledge with policymakers, researchers, and communities around the world;; fostering new talent by offering fellowships and awards; and; putting new knowledge into the hands of those who can use it best to address global challenges. Part of Canada's foreign affairs and development efforts, IDRC invests ...

Update on TAO moored ORG array

Science.gov (United States)

Freitag, H. Paul

1994-01-01

During the Coupled Ocean Atmosphere Response Experiment (COARE) six TAO moorings were equipped with optical rain gauges (ORG's). In late 1993 moorings deployed on the equator at 154E and 157.5E were recovered and not redeployed as they were augmentations to the TAO array for COARE only. In December 1993, four TAO moorings were equipped with ORG's: one each at 2N, 156E and 2S, 156E and ORG doublets on the equator at 0, 156E and 0, 165E. The 2N, 156E mooring has been lost. By the end of April all sites will have been serviced and six refurbished sensors will again be deployed in the same locations.

Insect symbionts as valuable grist for the biotechnological mill: an alkaliphilic silkworm gut bacterium for efficient lactic acid production.

Science.gov (United States)

Liang, Xili; Sun, Chao; Chen, Bosheng; Du, Kaiqian; Yu, Ting; Luang-In, Vijitra; Lu, Xingmeng; Shao, Yongqi

2018-04-07

Insects constitute the most abundant and diverse animal class and act as hosts to an extraordinary variety of symbiotic microorganisms. These microbes living inside the insects play critical roles in host biology and are also valuable bioresources. Enterococcus mundtii EMB156, isolated from the larval gut (gut pH >10) of the model organism Bombyx mori (Lepidoptera: Bombycidae), efficiently produces lactic acid, an important metabolite for industrial production of bioplastic materials. E. mundtii EMB156 grows well under alkaline conditions and stably converts various carbon sources into lactic acid, offering advantages in downstream fermentative processes. High-yield lactic acid production can be achieved by the strain EMB156 from renewable biomass substrates under alkaline pretreatments. Single-molecule real-time (SMRT) sequencing technology revealed its 3.01 Mbp whole genome sequence. A total of 2956 protein-coding sequences, 65 tRNA genes, and 6 rRNA operons were predicted in the EMB156 chromosome. Remarkable genomic features responsible for lactic acid fermentation included key enzymes involved in the pentose phosphate (PP)/glycolytic pathway, and an alpha amylase and xylose isomerase were characterized in EMB156. This genomic information coincides with the phenotype of E. mundtii EMB156, reflecting its metabolic flexibility in efficient lactate fermentation, and established a foundation for future biotechnological application. Interestingly, enzyme activities of amylase were quite stable in high-pH broths, indicating a possible mechanism for strong EMB156 growth in an alkaline environment, thereby facilitating lactic acid production. Together, these findings implied that valuable lactic acid-producing bacteria can be discovered efficiently by screening under the extremely alkaline conditions, as exemplified by gut microbial symbionts of Lepidoptera insects.

Progression of urothelial carcinoma in situ of the urinary bladder: a switch from luminal to basal phenotype and related therapeutic implications.

Science.gov (United States)

Barth, Isabella; Schneider, Ursula; Grimm, Tobias; Karl, Alexander; Horst, David; Gaisa, Nadine T; Knüchel, Ruth; Garczyk, Stefan

2018-05-01

The stratification of bladder cancer into luminal and basal tumors has recently been introduced as a novel prognostic system in patient cohorts of muscle-invasive bladder cancer or high-grade papillary carcinomas. Using a representative immunohistochemistry panel, we analyzed luminal and basal marker expression in a large case series (n = 156) of urothelial carcinoma in situ (CIS), a precancerous lesion that frequently progresses to muscle-invasive disease. The majority of CIS cases was characterized by a positivity for luminal markers (aberrant cytokeratin (CK) 20 85% (132/156), GATA3 median Remmele score (score of staining intensity (0-3) multiplied with percentage of positive cells (0-4)): 12, estrogen receptor (ER) β Remmele score > 2: 88% (138/156), human epidermal growth factor receptor 2 (Her2) Dako score 3+ 32% (50/156), Her2 Dako score 2+ 33% (51/156)), and marginal expression of basal markers (CK5/6+ 2% (3/156), CK14+ 1% (2/156)). To further investigate phenotypic stability during disease progression, we compared 48 pairs of CIS and invasive tumors from the same biopsy. A highly significant loss of luminal marker expression (p < 0.001) was observed in the course of progression whereas an increase of basal marker expression (p < 0.01) was noted in the invasive compartment. Importantly, 91% of CIS cases demonstrated a positivity for at least one of the two predictive markers Her2 and ERβ, indicating that the analysis of Her2 and ERβ may help to identify CIS-patient subgroups prone to more efficient targeted treatment strategies. Larger prospective and biomarker-embedded clinical trials are needed to confirm and validate our preliminary findings.

Étude de défaut trouvé dans des tubes centrifugés de stellite 6B

OpenAIRE

Villar Echeverría, Alejandro

2014-01-01

Les superalliages sont des alliages employés pour travailler à hautes températures tout en maintenant stabilité dimensionnelle et résistance mécanique et à la corrosion. Ils sont utilisés dans les domaines de l'aéronautique, l’industrie navale et médicale entre autres. Parmi les différents types de superalliages existants (base nickel, base cobalt et base nickel-fer), on travaillera dans cette étude avec des superalliages base cobalt. Ces alliages sont connus communément sous le nom de Stelli...

Anti-idiotypic antibodies against UV-induced tumor-specific CTL clones. Preparation in syngeneic combination

International Nuclear Information System (INIS)

Kuribayashi, K.; Tanaka, C.; Matsubayashi, Y.; Masuda, T.; Udono, H.; Abe, M.; Nakayama, E.; Shiku, H.

1988-01-01

In this study, we first established several CTL clones of (BALB/c x C57BL/6)F1 origin that were specific for either syngeneic UV female 1 or UV male 1 fibrosarcoma cell lines. All the CTL clones had Thy-1+ Lyt-2+ L3T4- phenotypes and showed Kd restriction when lysing the corresponding target cells. Sera obtained from syngeneic animals immunized with three CTL clones, 10B-5 for UV female 1, and CTL9 and CTL10 for UV male 1, showed specific inhibition of target cell lysis with the corresponding CTL clones. The inhibitory activities were found in sera of the majority of immunized animals. Because the inhibitory activity resides in protein A-binding fraction, mAb were produced by hybridizing spleen cells of hyperimmune animals. N1-56 was thus obtained from a mouse immunized with 10B-5 CTL clone reactive with UV female 1. N1-56 was clonotype specific, reacting with 10B-5 but not with other CTL lines or leukemia cell lines. No N1-56+ cells were detectable in thymocytes, lymph node cells, or spleen cells of either naive or UV female 1-immune CB6F1 mice. Immunoprecipitation showed that N1-56 reacts with 90,000 Mr molecules on 10B-5 CTL clone under nonreducing conditions and 45,000 Mr molecules under reducing conditions, indicating its reactivities with idiotypic determinants of TCR on the CTL clone. N1-56 inhibited lytic activity of 10B-5, but neither N1-56 nor alpha-10B-5 hyperimmune serum inhibited that of alpha-UV female 1 mixed lymphocyte tumor cell culture cells. N1-56 induced proliferation of 10B-5 without addition of Ag

Black Silicon Solar Cells with Black Ribbons

DEFF Research Database (Denmark)

Davidsen, Rasmus Schmidt; Tang, Peter Torben; Mizushima, Io

2016-01-01

We present the combination of mask-less reactive ion etch (RIE) texturing and blackened interconnecting ribbons as a method for obtaining all-black solar panels, while using conventional, front-contacted solar cells. Black silicon made by mask-less reactive ion etching has total, average...... in the range 15.7-16.3%. The KOH-textured reference cell had an efficiency of 17.9%. The combination of black Si and black interconnecting ribbons may result in aesthetic, all-black panels based on conventional, front-contacted silicon solar cells....... reflectance below 0.5% across a 156x156 mm2 silicon (Si) wafer. Black interconnecting ribbons were realized by oxidizing copper resulting in reflectance below 3% in the visible wavelength range. Screen-printed Si solar cells were realized on 156x156 mm2 black Si substrates with resulting efficiencies...

Reducing plant radiation fields by source term reduction - tracking cobalt and antimony to their sources at Gentilly-2

International Nuclear Information System (INIS)

Gauthier, P.; Guzonas, D.A.

2006-01-01

Gentilly-2 NGS is experiencing high radiation fields in the fuelling machine vaults. These high fields make maintenance outages more expensive and their management more complicated. As part of the station refurbishment project, a task group was created to identify the cause of the high fields and make recommendations to prevent their reoccurrence in the second (post-refurbishment) operating cycle. To identify the root cause of the problem, the task group decided to analyse the primary heat transport system (PHTS), the fuel handling system and their inter-relation. Gentilly-2 has had to manage a unique (to CANDU) problem arising from antimony released from the main heat transport pump seals. Antimony deposits on in-core surfaces, becomes activated, and subsequently can be released, especially under oxidizing coolant conditions. It then becomes incorporated into the magnetite deposits on PHTS piping, including the steam generators and inlet feeders. Gentilly-2 has focused a great deal of effort on managing antimony over the last 15 years. As a result of these initiatives, radioantimony fields have been quite effectively managed since 1997, resulting in a decrease in their relative contribution to the total fields. The decrease in radioantimony fields highlighted the significant contribution of 60 Co cobalt activity; the high levels of both radioantimony and 60 Co differentiate Gentilly-2 from other CANDU 6 plants. Two types of 59 Co sources are present in the CANDU PHTS. High surface area materials such as steam generator tubes and feeder pipes contain trace concentrations of 59 Co as an impurity, which can be released by corrosion. Low surface area materials such as Stellites contain high concentrations of 59 Co that can be released as either corrosion or wear products. After assessing potential cobalt sources, the task group concluded that PHTS materials were not likely the origin of the high 60 Co fields. The major PHTS components identified as cobalt sources have

Friction behavior of cobalt base and nickel base hardfacing materials in high temperature sodium

International Nuclear Information System (INIS)

Mizobuchi, Syotaro; Kano, Shigeki; Nakayama, Kohichi; Atsumo, Hideo

1980-01-01

A friction behavior of the hardfacing materials such as cobalt base alloy ''Stellite'' and nickel base alloy ''Colmonoy'' used in the sliding components of a sodium cooled fast breeder reactor was investigated in various sodium environments. Also, friction tests on these materials were carried out in argon environment. And they were compared with those in sodium environment. The results obtained are as follows: (1) In argon, the cobalt base hardfacing alloy showed better friction behavior than the nickel base hardfacing alloy. In sodium, the latter was observed to have the better friction behavior being independent of the sodium temperature. (2) The friction coefficient of each material tends to become lower by pre-exposure in sodium. Particularly, this tendency was remarkable for the nickel base hardfacing alloy. (3) The friction coefficient between SUS 316 and one of these hardfacing materials was higher than that between latter materials. Also, some elements of hardfacing alloys were recognized to transfer on the friction surface of SUS 316 material. (4) It was observed that each tested material has a greater friction coefficient with a decrease of the oxygen content in sodium. (author)

156 Functionality of the Town Planning Authorities in Effecting ...

African Journals Online (AJOL)

User

available in Nigeria, with specific reference to the new Lagos State. Urban and ... practices, and rules of conduct that are recognized as binding by the community. ..... The fact that the EPM has the frame work of the description of urban problem ...

Publications | Page 156 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

... and Community Diversity. La mer des Caraïbes est la deuxième au monde pour sa superficie et sa région englobe plus de 30 pays insulaires et continentaux où vivent près de 35 millions d'habitants. Outre son territoire fragmenté, cette région se caractérise par sa grande diversité linguistique et culturelle, ce phénomène.

All projects related to | Page 156 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Effect of Context on Performance of Think Tanks in Developing Countries .... SMALL ENTERPRISES, WOMEN, Economic and social development, ... Microwork and Virtual Production Networks in Sub-Saharan Africa and Southeast Asia.

26 CFR 1.56(g)-0 - Table of Contents.

Science.gov (United States)

2010-04-01

... effective dates. (3) Example. (q) Treatment of distributions of property to shareholders. (1) In general. (2... of change. (D) Treatment of additional tax liability. (iv) Election as method of accounting. (v...) Application to foreign corporations. (b) Depreciation allowed. (1) Property placed in service after 1989. (2...

40 CFR 417.156 - Pretreatment standards for new sources.

Science.gov (United States)

2010-07-01

... standard shall be: (1) For normal operation of spray drying towers above, the following values pertain.... Oil and grease Do. pH Do. (2) For air quality restricted operation of a spray drying tower, but only... GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Spray Dried...

40 CFR 159.156 - How information must be submitted.

Science.gov (United States)

2010-07-01

... to the Office of Pesticide Programs' Document Processing Desk at the appropriate address as set forth... registration number, date of transmittal to EPA, the type of study or incident being reported under §§ 159.165...

78 FR 42159 - Medicaid and Children's Health Insurance Programs: Essential Health Benefits in Alternative...

Science.gov (United States)

2013-07-15

... and 156 Medicaid and Children's Health Insurance Programs: Essential Health Benefits in Alternative... Secretary 45 CFR Parts 155 and 156 [CMS-2334-F] RIN 0938-AR04 Medicaid and Children's Health Insurance... Medicaid and the Children's Health Insurance Program (CHIP) eligibility notices, delegation of appeals, and...

76 FR 81826 - Drawbridge Operation Regulation; Pocomoke River, Pocomoke City, MD

Science.gov (United States)

2011-12-29

... Operation Regulation; Pocomoke River, Pocomoke City, MD AGENCY: Coast Guard, DHS. ACTION: Notice of... River, mile 15.6, at Pocomoke City, MD. The deviation restricts the operation of the draw span to... five hours advance notice is given. The Route 675 Bridge across Pocomoke River, mile 15.6 at Pocomoke...

76 FR 5686 - Drawbridge Operation Regulation; Pocomoke River, Pocomoke City, MD

Science.gov (United States)

2011-02-02

... Operation Regulation; Pocomoke River, Pocomoke City, MD AGENCY: Coast Guard, DHS. ACTION: Notice of... River, mile 15.6, at Pocomoke City, MD. The deviation restricts the operation of the draw span to.... The Route 675 Bridge across Pocomoke River, mile 15.6 at Pocomoke City MD, has a vertical clearance in...

Avaliação da silagem de sete genótipos de sorgo [(Sorghum bicolor (L Moench]. I. Características agronômicas

Directory of Open Access Journals (Sweden)

Brito A.F.

2000-01-01

Full Text Available Foram utilizados quatro genótipos de sorgo de porte alto, colmo suculento e com açúcar, BR601, CMSXS156 × CMSXS607, BR506 e CMSXS156 × CMSXS506, e três de porte baixo, colmo seco e sem açúcar, CMSXS156 × CMSXS227, CMSXS156 e CMSXS227, colhidos no estádio de grão leitoso/pastoso, com o objetivo de avaliar o número de plantas por hectare (NP/ha, as produções de matéria verde (MV e de matéria seca (MS em t/ha, as percentagens de colmo (%COL, de folha (%FOL, de panícula (%PAN e de folhas mortas (%FM em relação à planta inteira, à altura e à percentagem de acamamento das plantas (%ACM. Houve grande variação no NP/ha nos diferentes genótipos avaliados. As produções de MS foram de 8,6 t/ha para os genótipos de porte alto e de 4,4 t/ha para os de porte baixo. Observaram-se correlações positiva entre altura e %COL e negativas entre altura e %FOL e %PAN. Com relação à %ACM das plantas apenas o genótipo CMSXS156 × CMSXS607 apresentou esse problema.

Avaliação da silagem de sete genótipos de sorgo [(Sorghum bicolor (L Moench]. I. Características agronômicas

Directory of Open Access Journals (Sweden)

A.F. Brito

2000-08-01

Full Text Available Foram utilizados quatro genótipos de sorgo de porte alto, colmo suculento e com açúcar, BR601, CMSXS156 × CMSXS607, BR506 e CMSXS156 × CMSXS506, e três de porte baixo, colmo seco e sem açúcar, CMSXS156 × CMSXS227, CMSXS156 e CMSXS227, colhidos no estádio de grão leitoso/pastoso, com o objetivo de avaliar o número de plantas por hectare (NP/ha, as produções de matéria verde (MV e de matéria seca (MS em t/ha, as percentagens de colmo (%COL, de folha (%FOL, de panícula (%PAN e de folhas mortas (%FM em relação à planta inteira, à altura e à percentagem de acamamento das plantas (%ACM. Houve grande variação no NP/ha nos diferentes genótipos avaliados. As produções de MS foram de 8,6 t/ha para os genótipos de porte alto e de 4,4 t/ha para os de porte baixo. Observaram-se correlações positiva entre altura e %COL e negativas entre altura e %FOL e %PAN. Com relação à %ACM das plantas apenas o genótipo CMSXS156 × CMSXS607 apresentou esse problema.

Reprogramming of cell junction modules during stepwise epithelial to mesenchymal transition and accumulation of malignant features in vitro in a prostate cell model

International Nuclear Information System (INIS)

Ke, Xi-song; Li, Wen-cheng; Hovland, Randi; Qu, Yi; Liu, Run-hui; McCormack, Emmet; Thorsen, Frits; Olsen, Jan Roger; Molven, Anders; Kogan-Sakin, Ira; Rotter, Varda; Akslen, Lars A.; Oyan, Anne Margrete; Kalland, Karl-Henning

2011-01-01

Epithelial to mesenchymal transition (EMT) is pivotal in tumor metastasis. Our previous work reported an EMT model based on primary prostate epithelial cells (EP156T) which gave rise to cells with mesenchymal phenotype (EPT1) without malignant transformation. To promote prostate cell transformation, cells were maintained in saturation density cultures to select for cells overriding quiescence. Foci formed repeatedly following around 8 weeks in confluent EPT1 monolayers. Only later passage EPT1, but not EP156T cells of any passage, could form foci. Cells isolated from the foci were named EPT2 and formed robust colonies in soft agar, a malignant feature present neither in EP156T nor in EPT1 cells. EPT2 cells showed additional malignant traits in vitro, including higher ability to proliferate following confluence, higher resistance to apoptosis and lower dependence on exogenous growth factors than EP156T and EPT1 cells. Microarray profiling identified gene sets, many of which belong to cell junction modules, that changed expression from EP156T to EPT1 cells and continued to change from EPT1 to EPT2 cells. Our findings provide a novel stepwise cell culture model in which EMT emerges independently of transformation and is associated with subsequent accumulation of malignant features in prostate cells. Reprogramming of cell junction modules is involved in both steps.

Robust C–C bonded porous networks with chemically designed functionalities for improved CO2 capture from flue gas

Directory of Open Access Journals (Sweden)

Damien Thirion

2016-10-01

Full Text Available Effective carbon dioxide (CO2 capture requires solid, porous sorbents with chemically and thermally stable frameworks. Herein, we report two new carbon–carbon bonded porous networks that were synthesized through metal-free Knoevenagel nitrile–aldol condensation, namely the covalent organic polymer, COP-156 and 157. COP-156, due to high specific surface area (650 m2/g and easily interchangeable nitrile groups, was modified post-synthetically into free amine- or amidoxime-containing networks. The modified COP-156-amine showed fast and increased CO2 uptake under simulated moist flue gas conditions compared to the starting network and usual industrial CO2 solvents, reaching up to 7.8 wt % uptake at 40 °C.

75 FR 44094 - Update of the Federal Energy Regulatory Commission's Fees Schedule for Annual Charges for the Use...

Science.gov (United States)

2010-07-28

... Alabama Geneva 47.08 Alabama Greene 31.39 Alabama Hale 31.39 Alabama Henry 31.39 Alabama Houston 47.08... 62.78 Georgia Henry 156.94 Georgia Houston 62.78 Georgia Irwin 47.08 Georgia Jackson 156.94 Georgia Jasper 62.78 Georgia Jeff Davis......... 47.08 Georgia Jefferson 47.08 Georgia Jenkins 47.08 Georgia...

Negative regulation of humoral immunity due to interplay between the SLAMF1, SLAMF5, and SLAMF6 receptors

Directory of Open Access Journals (Sweden)

Ninghai eWang

2015-04-01

Full Text Available Whereas the SLAMF-associated protein (SAP is involved in differentiation of TFH cells and antibody responses, the precise requirements of SLAMF receptors in humoral immune responses are incompletely understood. By analyzing mice with targeted disruptions of the SLAMF1, SLAMF5 and SLAMF6 genes, we found that both T-dependent and T-independent antibody responses were twofold higher compared to those in single knockout mice. These data suggest a suppressive synergy of SLAMF1, SLAMF5 and SLAMF6 in humoral immunity, which contrasts the decreased antibody responses resulting from a defective GC reaction in the absence of the adapter SAP. In adoptive co-transfer assays, both [Slamf1+5+6]-/- B and T cells were capable of inducing enhanced antibody responses, but more pronounced enhancement was observed after adoptive transfer of [Slamf1+5+6]-/- B cells compared to that of [Slamf1+5+6]-/- T cells. In support of [Slamf1+5+6]-/- B cell intrinsic activity, [Slamf1+5+6]-/- mice also mounted significantly higher antibody responses to T-independent type 2 antigen. Furthermore, treatment of mice with anti-SLAMF6 monoclonal antibody results in severe inhibition of the development of TFH cells and GC B cells, confirming a suppressive effect of SLAMF6. Taken together, these results establish SLAMF1, SLAMF5 and SLAMF6 as important negative regulators of humoral immune response, consistent with the notion that SLAM family receptors have dual functions in immune responses.

Effect of heat treatment on the microstructure of Co-Cr-W alloy fabricated by laser additive manufacturing

Science.gov (United States)

Ren, Bo; Chen, Changjun; Zhang, Min

2018-04-01

Stellite 6 cobalt-based alloy powder was used to produce Co-Cr-W alloy using laser additive manufacturing technology, and then different heat treatment strategies were carried out on the deposited sample. The characteristics of microstructure under different heat treatment conditions were investigated using scanning electron microscopy with energy dispersive spectroscopy, transmission electron microscope, and x-ray diffraction. The results show that the as-deposited sample has few cracks or pores, and the microstructure is typical dendritic structure, and lamellar eutectic carbides are rich in Cr in interdendritic. The matrix mainly consists of γ phases and a few ɛ phases. Some γ phases transform into ɛ phases after 900°C/6 h aging treatment and lamellar eutectic carbides transform into blocky carbides presenting as a network, most of the carbides are rich in Cr and a few are rich in W. When heat treated at 1200°C/1 h followed by water cooling and then treated at 900°C/6 h followed by furnace cooling, it can be found that some γ phases transform into ɛ phases. The carbides transform into elliptical M23C6 carbides that are rich in Cr with the size of 1 to 3 μm and a part of W-rich carbides.

Production and Characterization of WC-Reinforced Co-Based Superalloy Matrix Composites

Science.gov (United States)

Özgün, Özgür; Dinler, İlyas

2018-05-01

Cobalt-based superalloy matrix composite materials were produced through the powder metallurgy technique using element powders at high purity and nano-sized wolfram carbide (WC) reinforcement in this study. An alloy that had the same chemical composition as the Stellite 6 alloy but not containing carbon was selected as the matrix alloy. The powder mixtures obtained as a result of mixing WC reinforcing member and element powders at the determined ratio were shaped by applying 300 MPa of pressure. The green components were sintered under argon atmosphere at 1240 °C for 120 minutes. The densities of the sintered components were determined by the Archimedes' principle. Microstructural characterization was performed via X-ray diffraction analysis, scanning electron microscope examinations, and energy-dispersive spectrometry. Hardness measurements and tensile tests were performed for determining mechanical characteristics. The relative density values of the sintered components increased by increasing the WC reinforcement ratio and they could almost reach the theoretical density. It was determined from the microstructural examinations that the composite materials consisted of fine and equiaxed grains and coarse carbides demonstrating a homogeneous dispersion along the microstructure at the grain boundaries. As it was the case in the density values, the hardness and strength values of the composites increased by increasing the WC ratio.

Hardfacing and packings for improved valve performance

International Nuclear Information System (INIS)

Aikin, J.A.; Patrick, J.N.F.; Inglis, I.

2003-01-01

The CANDU Owners Group (COG), Chemistry, Materials and Components (CMC) Program has supported an ongoing program on valve maintenance and performance for several years. An overview is presented of recent work on iron-based hardfacing, packing qualification, friction testing of polytetrafluoroethylene (PTFE) packings, and an investigation of re-torquing valve packing. Based on this program, two new valve-packing materials have been qualified for use in CANDU stations. By doing this, CANDU maintenance can avoid having only one packing qualified for station use, as well as assess the potential impact of the industry trend towards using lower gland loads. The results from corrosion tests by AECL and the coefficient of friction studies at Battelle' s tribology testing facilities on Delcrome 910, an iron-based hardfacing alloy, indicate it is an acceptable replacement for Stellite 6 under certain conditions. This information can be used to update in-line valve purchasing specifications. The renewed interest in friction characteristics, and environmental qualification (EQ) of packing containing PTFE has resulted in a new test program in these areas. The COG-funded valve programs have resulted in modifications to design specifications for nuclear station in-line valves and have led to better maintenance practices and valve reliability. In the end, this means lower costs and cheaper electricity. (author)

Steel pipelines standards for fittings and joint accessories

CERN Document Server

DIN

2013-01-01

Die 1. Auflage von DIN Handbook 15/6 erweitert die DIN Handbook-Reihe um den Themenbereich Fittings für verschiedene Montagetechniken. Es enthält in englischer Übersetzung die wesentlichen Normen über Lötfittings aus Kupfer, Temperguss-Fittings, Fittings aus Stahl und Kunststofffittings. Abgerundet wird der Inhalt durch ergänzende Normen, Begriffe und Grundnormen. Reihe DIN_Handbook - 15/6

18 CFR 156.3 - Applications; number of copies; general requirements.

Science.gov (United States)

2010-04-01

... section 2 of the Natural Gas Act; State under the laws of which applicant is incorporated, organized or... any certificate of public convenience and necessity, franchise or other authorization which applicant...

Résultats de recherche | Page 156 | CRDI - Centre de recherches ...

International Development Research Centre (IDRC) Digital Library (Canada)

Bien que l'on s'entende généralement pour dire que la Jamaïque ne réalise pas son plein potentiel, à peu près tout le monde a une théorie différente pour ... Les technologies d'information et de la communication (TIC) sont devenues un élément-clé des stratégies de développement économique et réduction de la pauvreté ...

42 CFR 441.156 - Team developing individual plan of care.

Science.gov (United States)

2010-10-01

... competence in child psychiatry, the team must be capable of— (1) Assessing the recipient's immediate and long... doctoral degree and a physician licensed to practice medicine or osteopathy; or (3) A physician licensed to practice medicine or osteopathy with specialized training and experience in the diagnosis and treatment of...

Résultats de recherche | Page 156 | CRDI - Centre de recherches ...

International Development Research Centre (IDRC) Digital Library (Canada)

... établissement de réseaux de TIC-D en Afrique centrale, de l'Est et de l'Ouest ... 2007 par l'essai de modèles, de produits et de services d'entreprises sociales ... le CRDI appuie l'AUCC et permet à sa Division des relations internationales ...

Nannoplankton from RC9-156 in the southeastern Arabian Sea

Digital Repository Service at National Institute of Oceanography (India)

Guptha, M.V.S.

that the age of the sediment is late Quaternary. The alternate fossiliferous and unfossiliferous bands encountered in the core is attributed to the fluctuations in the rate of sedimentation by the river Indus during glacial and interglacial periods...

156 A Study of the Concession Speech by President Goodluck ...

African Journals Online (AJOL)

Tracie1

when it is inevitable for candidates to persuade their listeners in order to win the election. ... represents a reaction to some attitudes to language summarized by Saeed ... changes in the institutional state of affairs. This act includes such ...

29 CFR 784.156 - Establishments exclusively devoted to named operations.

Science.gov (United States)

2010-07-01

... PROVISIONS OF THE FAIR LABOR STANDARDS ACT APPLICABLE TO FISHING AND OPERATIONS ON AQUATIC PRODUCTS... avoid segmentation and treat all employees of the establishment in the same manner (see Sen. Rep. No. 145, 87th Cong. first session, p. 33). Accordingly, where it can be demonstrated that an establishment...

miRNA control of vegetative phase change in trees.

Directory of Open Access Journals (Sweden)

Jia-Wei Wang

2011-02-01

Full Text Available After germination, plants enter juvenile vegetative phase and then transition to an adult vegetative phase before producing reproductive structures. The character and timing of the juvenile-to-adult transition vary widely between species. In annual plants, this transition occurs soon after germination and usually involves relatively minor morphological changes, whereas in trees and other perennial woody plants it occurs after months or years and can involve major changes in shoot architecture. Whether this transition is controlled by the same mechanism in annual and perennial plants is unknown. In the annual forb Arabidopsis thaliana and in maize (Zea mays, vegetative phase change is controlled by the sequential activity of microRNAs miR156 and miR172. miR156 is highly abundant in seedlings and decreases during the juvenile-to-adult transition, while miR172 has an opposite expression pattern. We observed similar changes in the expression of these genes in woody species with highly differentiated, well-characterized juvenile and adult phases (Acacia confusa, Acacia colei, Eucalyptus globulus, Hedera helix, Quercus acutissima, as well as in the tree Populus x canadensis, where vegetative phase change is marked by relatively minor changes in leaf morphology and internode length. Overexpression of miR156 in transgenic P. x canadensis reduced the expression of miR156-targeted SPL genes and miR172, and it drastically prolonged the juvenile phase. Our results indicate that miR156 is an evolutionarily conserved regulator of vegetative phase change in both annual herbaceous plants and perennial trees.

Windows of Opportunity: East Timor and Australian Strategic Decision Making (1975-1999)

Science.gov (United States)

2014-06-01

global power. Abraham Maslow argues that when you have the world’s largest hammer, every problem looks like a nail. 33 The US had the world’s...Terror,” 156. 32 Tanter, Bitter Flowers, Sweet Flowers, 156. 33 Abraham H. Maslow , The Psychology of Science: A Reconnaissance (Maurice Bassett, 2004...Some Critical Comments.” Australian Journal of International Affairs 54, no. 2 (2000). Maslow , Abraham H. The Psychology of Science: A

29 CFR 776.20 - “Goods.”

Science.gov (United States)

2010-07-01

..., 162 F. 2d 555 (C.A. 3) and Bozant v. Bank of New York, 156 F. 2d 787 (C.A. 2) which suggest that such.... 26 Bozant v. Bank of New York, 156 F. 2d 787 (C.A. 2). 27 Walling v. Haile Gold Mines, 136 F. 2d 102... which fall within the definition of “goods” include written materials such as newspapers, magazines...

77 FR 44168 - Spiny Lobster Fishery of the Gulf of Mexico and South Atlantic; Amendment 11

Science.gov (United States)

2012-07-27

... Trap Gear Closed Area 37. Point North Lat. West Long. A 25[deg]07'51.156'' 80[deg]17'27.910'' B 25[deg...'40.998'' A 25[deg]07'51.156'' 80[deg]17'27.910'' (xxxviii) Lobster Trap Gear Closed Area 38. Point...) Lobster Trap Gear Closed Area 51. Point North Lat. West Long. A 25[deg]16'33.006'' 80[deg]13'30.001'' B 25...

Identification of coeliac disease triggering glutenin peptides in adults.

Science.gov (United States)

Donnelly, Suzanne C; Šuligoj, Tanja; Ellis, H Julia; Ciclitira, Paul J

2016-07-01

Coeliac disease affects approximately 1% of Northern American and European populations. It is caused by an inappropriate immune response to dietary gluten. Gluten comprises of two major protein fractions: gliadins and glutenins. Glutenins have recently been found to be toxic to coeliac individuals. Proliferation assays suggest in some but not all paediatric coeliac individuals there may be immunological stimulation with high molecular weight (HMW) glutenins. Less evidence pertains to low molecular weight (LMW) glutenins. The aim is to assess adaptive, T-cell driven, and innate immune response in adult coeliac individuals towards HMW glutenin peptide, glut04, and LMW glutenin peptide, glt156. Coeliac patients were recruited attending endoscopy for routine monitoring. Adaptive immune response towards glut04 and glt156 was measured by proliferation assays and measurement of interferon-γ secretion in 28 T-cell lines. The innate immune response was assessed by measurement of enterocyte cell height (ECH) in coeliac small intestinal biopsies following overnight incubation in organ culture chambers in a further nine individuals. There were 3/28 and 2/28 positive proliferation results using gluten-sensitive T-cells with glut04 and glt156, respectively. All coeliac biopsies tested in organ culture chambers demonstrated clear reduction in ECH with peptic-tryptic digest of whole industrial gluten, glut04 and glt156 when compared to negative control ovalbumin (p < 0.005). Three individuals had both T-cell and organ culture study data. Their proliferation assays showed no stimulation of the T-cells. This study demonstrates glutenin epitopes glut04 and glt156, while minor T-cell epitopes, are important in their ability to trigger the innate immune response.

LASER MEDICINE: Effect of laser radiation absorption in water and blood on the optimal wavelength for endovenous obliteration of varicose veins

Science.gov (United States)

Zhilin, K. M.; Minaev, V. P.; Sokolov, Aleksandr L.

2009-08-01

This work examines laser radiation absorption in water and blood at the wavelengths that are used in endovenous laser treatment (EVLT): 0.81-1.06, 1.32, 1.47, 1.5 and 1.56 μm. It is shown that the best EVLT conditions are ensured by 1.56-μm radiation. Analysis of published data suggests that even higher EVLT efficacy may be achieved at wavelengths of 1.68 and 1.7 μm.

HIT Solar Cells with N-Type Low-Cost Metallurgical Si

Directory of Open Access Journals (Sweden)

Xing Yang

2018-01-01

Full Text Available A conversion efficiency of 20.23% of heterojunction with intrinsic thin layer (HIT solar cell on 156 mm × 156 mm metallurgical Si wafer has been obtained. Applying AFORS-HET software simulation, HIT solar cell with metallurgical Si was investigated with regard to impurity concentration, compensation level, and their impacts on cell performance. It is known that a small amount of impurity in metallurgical Si materials is not harmful to solar cell properties.

Isotope shift studies in gadolinium spectra

International Nuclear Information System (INIS)

Ahmad, S.A.; Saksena, G.D.; Venugopalan, A.

1976-01-01

Isotope shift studies have been carried out in the gadolinium spectrum using a recording Fabry-Perot spectrometer and gadolinium samples enriched in 156 Gd and 160 Gd isotopes. Isotope shifts Δsigma(156-160) have been recorded in 134 lines in the region 3930-4140 A. Some of these lines involve the recently identified even configuration 4f 8 5d6s of Gd I and the newly classified transition 4f 8 6s-4f 8 6p of Gd II. From the isotope shift measurements of lines involving the 4f 8 6s-4f 8 6p transition in Gd II, the isotope shift, ΔT(156-160)=87 mK, has been obtained for the 4f 8 6s configuration. Electronic configurations have been suggested for a number of energy levels and configuration mixing has been pointed out in certain cases. (Auth.)

37 CFR 1.56 - Duty to disclose information material to patentability.

Science.gov (United States)

2010-07-01

... application, and (1) It establishes, by itself or in combination with other information, a prima facie case of... patentability. A prima facie case of unpatentability is established when the information compels a conclusion... inventor, with the assignee or with anyone to whom there is an obligation to assign the application. (d...

East African Journal of Sciences (2016) Volume 10 (2) 151-156 ...

African Journals Online (AJOL)

user

2Department of Sport Science, Haramaya University, P. O. Box, 138, Haramaya, Ethiopia. 3College of ... An informal design (i.e. before and after without control) was applied. Twenty ... Physical education programs are designed and intended to promote .... Graduate Committee, School of Graduate Studies and then by ...

Egwuatu et al., Afr. J. Infect. Dis. (2016) 10(2): 156

African Journals Online (AJOL)

PROF ADEWUNMI

of Medicine and Dentistry, College of Medical Sciences, University of Calabar, Calabar, .... Sulfamethoxazole prophylaxis on antimicrobial resistance using Escherichia coli as an indicator. ..... with TMP-SMX being the most common treatment prescription and .... Socioeconomic and Behavioural Factors Leading to Acquired.

40 CFR 156.78 - Precautionary statements for physical or chemical hazards.

Science.gov (United States)

2010-07-01

... Hazards” warning statement. The graphic symbol must be no smaller than twice the size of the first... (CONTINUED) PESTICIDE PROGRAMS LABELING REQUIREMENTS FOR PESTICIDES AND DEVICES Human Hazard and...) A total release fogger is defined as a pesticide product in a pressurized container designed to...

Sidhana, Vol. 9, Part 2, September 1986, pp. 139-156. (C

Indian Academy of Sciences (India)

Pattern recognition, image processing and computer vision in fifth ... integration technology unless these become very relevant in the discussions ... 1980), a Japanese national project known as Pattern Information Processing Systems.

Microanalysis of tool steel and glass with laser-induced breakdown spectroscopy

Science.gov (United States)

Loebe, Klaus; Uhl, Arnold; Lucht, Hartmut

2003-10-01

A laser microscope system for the microanalytical characterization of complex materials is described. The universal measuring principle of laser-induced breakdown spectroscopy (LIBS) in combination with echelle optics permits a fast simultaneous multielement analysis with a possible spatial resolution below 10 pm. The developed system features completely UV-transparent optics for the laser-microscope coupling and the emission beam path and enables parallel signal detection within the wavelength range of 200-800 nm with a spectral resolution of a few picometers. Investigations of glass defects and tool steels were performed. The characterization of a glass defect in a tumbler by a micro-LIBS line scan, with use of a 266-nm diode-pumped Nd:YAG laser for excitation, is possible by simple comparison of plasma spectra of the defect and the surrounding area. Variations in the main elemental composition as well as impurities by trace elements are detected at the same time. Through measurement of the calibration samples with the known concentration of the corresponding element, a correlation between the intensity of spectral lines and the element concentration was also achieved. The change of elemental composition at the transient stellite solder of tool steels has been determined by an area scan. The two-dimensional pictures show abrupt changes of the element distribution along the solder edge and allow fundamental researches of dynamic modifications (e.g., diffusion) in steel.

Overall strategy of Creys Malville power station dismantling

International Nuclear Information System (INIS)

Alphonse, P.

2002-01-01

The power station was stopped by a government decision following the elections in 1997. This shutdown was then made official by a letter dated April 1998 and the decree of December 1998. This was a non-technical shutdown and as such had not been envisaged; there has been no early warning. Current dismantling strategy: The studies leading to shutdown and then dismantling were engaged in 1998 based on a scenario with a status corresponding to IAEA level 2 until 2046. In 2001, EDF management made the decision to dismantle all the first generation power stations and Creys Malville between now and 2025. It should be noted that the presence of strongly irradiated stellite in the Creys Malville reactor would still require remote systems for working in the reactor block after 2046. The sequence of operations dictated by the dismantling strategy is as follows: eliminate the risks as soon as possible and in particular the risk related to the sodium, 3300 tonnes of which is kept in liquid form in the reactor vessel; dismantle the most active parts which are too radioactive to be sent to the existing or planned storage centres. This may lead to on-site storage to allow decay to occur before sending to a storage centre; planning of the work interventions in order to limit the costs

Wear of rolling element bearings in sodium

International Nuclear Information System (INIS)

Campbell, C.S.

1976-01-01

Rolling element bearings and related mechanisms are attractive for service in liquid sodium but it is not clear what minimum wear rate can be anticipated. For axially loaded angular contact bearings rotation is incompatible with pure rolling on both races and wear arises from the resulting ball spin. The initial pressure distributions and sizes of the contact ellipses can be calculated but will change with bearing wear. However, the most effective distribution for producing wear would be for the full loads to be borne on the tips of the contact areas, whose maximum length is given by examination of the race wear tracks. A calculation on such a basis should set a lower limit for the wear coefficient. Both the torque and instantaneous wear rate of a bearing will be similar functions of the integral over the contact areas of the product of contact pressure and radius from the ball spin axis. A better estimate of wear coefficient should be obtained by relating the average torque, the average wear, the initial torque and the initial wear where the conditions are known. Analysis of tests in sodium at 400 0 C of high speed steel and Stellite bearings by these methods indicates specific wear rates of the order of 10 -15 m 3 /N-m, not unduly out of line with the range of values found in conventional sliding tests

Effects of the addition of casein phosphopeptide-amorphous calcium phosphate (CPP-ACP) on mechanical properties of luting and lining glass ionomer cement

Science.gov (United States)

Heravi, Farzin; Bagheri, Hossein; Rangrazi, Abdolrasoul; Mojtaba Zebarjad, Seyed

2016-07-01

Recently, the addition of casein phosphopeptide-amorphous calcium phosphate (CPP-ACP) into glass ionomer cements (GICs) has attracted interest due to its remineralization of teeth and its antibacterial effects. However, it should be investigated to ensure that the incorporation of CPP-ACP does not have significant adverse effects on its mechanical properties. The purpose of this study was to evaluate the effects of the addition of CPP-ACP on the mechanical properties of luting and lining GIC. The first step was to synthesize the CPP-ACP. Then the CPP-ACP at concentrations of 1%, 1.56% and 2% of CPP-ACP was added into a luting and lining GIC. GIC without CPP-ACP was used as a control group. The results revealed that the incorporation of CPP-ACP up to 1.56%(w/w) increased the flexural strength (29%), diametral tensile strength (36%) and microhardness (18%), followed by a reduction in these mechanical properties at 2%(w/w) CPP-ACP. The wear rate was significantly decreased (23%) in 1.56%(w/w) concentration of CPP-ACP and it was increased in 2%(w/w). Accordingly, the addition of 1.56%(w/w) CPP-ACP into luting and lining GIC had no adverse effect on the mechanical properties of luting and lining GIC and could be used in clinical practice.

A multimodal approach to emotion recognition ability in autism spectrum disorders

OpenAIRE

Jones, C.; Pickles, A.; Falcaro, M.; Marsden, A.; Happé, F.; Scott, S.; Sauter, D.; Tregay, J.; Phillips, R.; Baird, G.; Simonoff, E.; Charman, T.

2011-01-01

Background:  Autism spectrum disorders (ASD) are characterised by social and communication difficulties in day-to-day life, including problems in recognising emotions. However, experimental investigations of emotion recognition ability in ASD have been equivocal, hampered by small sample sizes, narrow IQ range and over-focus on the visual modality. Methods:  We tested 99 adolescents (mean age 15;6 years, mean IQ 85) with an ASD and 57 adolescents without an ASD (mean age 15;6 years, mean IQ 8...

Industrial PVD metallization for high efficiency crystalline silicon solar cells

OpenAIRE

Nekarda, J.; Reinwand, D.; Grohe, A.; Hartmann, P.; Preu, R.; Trassl, R.; Wieder, S.

2009-01-01

In this paper we present first results concerning different thermal evaporation processes for thin aluminum layers, which are carried out on a pilot system with a throughput of up to 540 wafers/h (156x156 mm2). To qualify the processes the deposited aluminum layers were evaluated with respect to homogeneity and conductivity. Additionally the effect of the different processes on the passivation quality of a thermally grown 100 nm thick SiO 2 was analyzed by means of lifetime measurements, indi...

ORF Alignment: NC_003272 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 156 ... Query: 29 ... MKGGDPHIRALMRTISASEANGNRPYSLLYGGQQVTDLSKHPEICVTIVTGPNTGDCSTA 88 ... ... MKGGDPHIRALMRTISASEANGNRPYSLLYGGQQVTDLSKHPEICVTIVTGPNTGDCSTA Sbjct: 1 ... MKGGDPHIRALMRTISASEANGNRP

Environmental exposure to human carcinogens in teenagers and the association with DNA damage

DEFF Research Database (Denmark)

Franken, Carmen; Koppen, Gudrun; Lambrechts, Nathalie

2017-01-01

) metabolites. In blood, arsenic, polychlorinated biphenyl (PCB) congeners 118 and 156, hexachlorobenzene (HCB), dichlorodiphenyltrichloroethane (DDT) and perfluorooctanoic acid (PFOA) were analyzed. Levels of methylmercury (MeHg) were measured in hair. Multiple linear regression models were used to establish...... between blood arsenic, hair MeHg, PCB 156 and HCB, and urinary 8-OHdG. The latter exposure biomarkers were also associated with higher fish intake. Urinary nickel and t,t-muconic acid were inversely associated with the alkaline comet assay. Conclusion This cross-sectional study found associations between...

ORF Alignment: NC_000911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Length = 156 ... Query: 72 ... MEGGDPYLRALMRTISASEANTPQPYNVIYGGQHVQDLSEHPNRCVKIFMGPNR...GNCSTA 131 ... MEGGDPYLRALMRTISASEANTPQPYNVIYGGQHVQDLSEHPNRCVKIFMGPNRGNCSTA Sbjct: 1 ... MEGGDPYLRALMRTISASEAN

Development of fabric using chemically-treated sisal fibres

CSIR Research Space (South Africa)

Zwane, PE

2006-06-01

Full Text Available .875 total 1094.000 159 Resilience between groups 28.369 3 9.456 1.812 .147 within groups 814.125 156 5.219 total 842.494 159 Surf. cont. between groups 12.325 3 4.108 1.270 .287 within groups 504.650 156 3... will be discussed as seen in Table 6. The control fabric was highly rated as being harder, rougher, harsher and more open rather than soft, smooth, slippery and compact compared to all the other fabric types. For flexibility, extensibility, resiliency...

ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available VGI 60 ... Query: 156 VGGFNKDRTPFLKYVDLLGVTYHASTMATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK 215 ... VGGFNKDRTPFLKYVDLLGVTYHASTM...ATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK Sbjct: 121 VGGFNKDRTPFLKYVDLLGVTYHASTMATGFGSHLAIPLLRNLIPEDKDYVKVDEQQVSK 180 ...

A novel copper(II) coordination at His186 in full-length murine prion protein

Energy Technology Data Exchange (ETDEWEB)

Watanabe, Yasuko [Laboratory of Radiation Biology, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan); Hiraoka, Wakako [Laboratory of Biophysics, School of Science and Technology, Meiji University, Kawasaki 214-8571 (Japan); Igarashi, Manabu; Ito, Kimihito [Department of Global Epidemiology, Hokkaido University Research Center for Zoonosis Control, Sapporo 001-0020 (Japan); Shimoyama, Yuhei [Soft-Matter Physics Laboratory, Graduate School of Emergent Science, Muroran Institute of Technology, Muroran 050-8585 (Japan); Horiuchi, Motohiro [Laboratory of Prion Diseases, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan); Yamamori, Tohru; Yasui, Hironobu; Kuwabara, Mikinori [Laboratory of Radiation Biology, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan); Inagaki, Fuyuhiko [Laboratory of Structural Biology, Graduate School of Pharmaceutical Sciences, Hokkaido University, Sapporo 060-0812 (Japan); Inanami, Osamu, E-mail: inanami@vetmed.hokudai.ac.jp [Laboratory of Radiation Biology, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan)

2010-04-09

To explore Cu(II) ion coordination by His{sup 186} in the C-terminal domain of full-length prion protein (moPrP), we utilized the magnetic dipolar interaction between a paramagnetic metal, Cu(II) ion, and a spin probe introduced in the neighborhood of the postulated binding site by the spin labeling technique (SDSL technique). Six moPrP mutants, moPrP(D143C), moPrP(Y148C), moPrP(E151C), moPrP(Y156C), moPrP(T189C), and moPrP(Y156C,H186A), were reacted with a methane thiosulfonate spin probe and a nitroxide residue (R1) was created in the binding site of each one. Line broadening of the ESR spectra was induced in the presence of Cu(II) ions in moPrP(Y148R1), moPrP(Y151R1), moPrP(Y156R1), and moPrP(T189R1) but not moPrP(D143R1). This line broadening indicated the presence of electron-electron dipolar interaction between Cu(II) and the nitroxide spin probe, suggesting that each interspin distance was within 20 A. The interspin distance ranges between Cu(II) and the spin probes of moPrP(Y148R1), moPrP(Y151R1), moPrP(Y156R1), and moPrP(T189R1) were estimated to be 12.1 A, 18.1 A, 10.7 A, and 8.4 A, respectively. In moPrP(Y156R1,H186A), line broadening between Cu(II) and the spin probe was not observed. These results suggest that a novel Cu(II) binding site is involved in His186 in the Helix2 region of the C-terminal domain of moPrP{sup C}.

A novel copper(II) coordination at His186 in full-length murine prion protein

International Nuclear Information System (INIS)

Watanabe, Yasuko; Hiraoka, Wakako; Igarashi, Manabu; Ito, Kimihito; Shimoyama, Yuhei; Horiuchi, Motohiro; Yamamori, Tohru; Yasui, Hironobu; Kuwabara, Mikinori; Inagaki, Fuyuhiko; Inanami, Osamu

2010-01-01

To explore Cu(II) ion coordination by His 186 in the C-terminal domain of full-length prion protein (moPrP), we utilized the magnetic dipolar interaction between a paramagnetic metal, Cu(II) ion, and a spin probe introduced in the neighborhood of the postulated binding site by the spin labeling technique (SDSL technique). Six moPrP mutants, moPrP(D143C), moPrP(Y148C), moPrP(E151C), moPrP(Y156C), moPrP(T189C), and moPrP(Y156C,H186A), were reacted with a methane thiosulfonate spin probe and a nitroxide residue (R1) was created in the binding site of each one. Line broadening of the ESR spectra was induced in the presence of Cu(II) ions in moPrP(Y148R1), moPrP(Y151R1), moPrP(Y156R1), and moPrP(T189R1) but not moPrP(D143R1). This line broadening indicated the presence of electron-electron dipolar interaction between Cu(II) and the nitroxide spin probe, suggesting that each interspin distance was within 20 A. The interspin distance ranges between Cu(II) and the spin probes of moPrP(Y148R1), moPrP(Y151R1), moPrP(Y156R1), and moPrP(T189R1) were estimated to be 12.1 A, 18.1 A, 10.7 A, and 8.4 A, respectively. In moPrP(Y156R1,H186A), line broadening between Cu(II) and the spin probe was not observed. These results suggest that a novel Cu(II) binding site is involved in His186 in the Helix2 region of the C-terminal domain of moPrP C .

Short-term outcomes of small incision cataract surgery provided by a regional population in the Pacific.

Science.gov (United States)

Bhikoo, Riyaz; Vellara, Hans; Lolokabaira, Salome; Murray, Neil; Sikivou, Biu; McGhee, Charles

2017-11-01

This study aims to describe patient demographics, visual and surgical outcomes of a cohort undergoing small incision cataract surgery at a Pacific regional ophthalmic training facility. This is a prospective, longitudinal study conducted at the Pacific Eye Institute, Fiji. One hundred fifty-six patients underwent small incision cataract surgery. Preoperatively, a complete ophthalmic examination, including pachymetry and macular optical coherence tomography performed by two independent investigators. Temporal small incision cataract surgery with intraocular lens insertion was performed by ophthalmologists, and trainee ophthalmologists. Follow-up occurred at day one, four weeks and 3 months. Patient characteristics, visual outcomes including surgically induced astigmatism and complications. Ninety-one per cent (142/156) attended 3-month follow-up with median age 63 years (range 19-82), 52% female (81/156) and 58% (90/156) Fijian ethnicity. In 37% (57/156), the contralateral eye was pseudophakic. Mean preoperative best spectacle-corrected visual acuity was logMAR 1.44 (6/165). At 3 months, 74% (105/142) achieved ≥6/18 unaided vision (94% [133/142] best spectacle-corrected visual acuity). Mean postoperative spherical equivalent was -0.78 (SD 0.95) D and mean surgically induced astigmatism 1.04 (0.57) D. Complications included posterior capsular rupture with vitreous loss (4% [6/156]), optical coherence tomography confirmed macular oedema (8% [12/152] at 4 weeks), significant posterior capsular opacity (23% [31/136]) and >5% increase in preoperative pachymetry (1% [1/142]) at 3 months. Reduction in preoperative best spectacle-corrected visual acuity occurred in 2% (3/142). No cases of endophthalmitis. Small incision cataract surgery provided to a regional population is effective with 94% achieving the World Health Organisation's definition of 'Good Vision' (≥6/18). Refinements in biometric and surgical techniques may allow a greater proportion of patients to

Even a monkey can understand fan activism: Political speech, artistic expression, and a public for the Japanese dôjin community

Directory of Open Access Journals (Sweden)

Alex Leavitt

2012-06-01

Full Text Available We examine the creation of dôjinshi works critiquing the passage of the metropolitan Tokyo ordinance Bill 156 in December 2010 as a case of fan-driven political activism. Bill 156 aims to limit artistic freedom and is specifically targeted at anime, manga, and other works of visual pop culture. Fans who participate in dôjin production perform both a love for this media and an active form of citizenship that is historically fannish but transformative beyond the mere appropriation and remix of media texts. We argue that dôjin fans and works constitute a recursive public, wherein participants actively create discourse around artistic and ideological issues while engaging in added layers of discourse regarding the maintenance of their existence as a public. We examine fan discourse and dôjin works engaging Bill 156 as an object for political activism, as anime and manga otaku perform their citizenship in the wider society of Japan for their local public and for a global audience of like-minded fans.

156 THE GULF WAR AS A FALL OUT OF THE CHANGING GLOBAL ...

African Journals Online (AJOL)

US-led UN forces bombarded Iraq out of Kuwait in 1991 left much to be ... testified that “the Gulf War resulted from a long range Anglo-American policy to control ... the Eastern bloc and the attendant end of the Cold War, it is the position of this ..... Nicaragua, Grenada and Panama nor was USSR given any in Afghanistan.

5 CFR 1201.156 - Time for processing appeals involving allegations of discrimination.

Science.gov (United States)

2010-01-01

... in appeal. When an appellant alleges prohibited discrimination in the appeal, the judge will decide... appeal, but has raised the issue later in the proceeding, the judge will decide both the issue of... remanded to agency. When the judge remands an issue of discrimination to the agency, adjudication will be...

Boating Safety, 15-6. Military Curriculum Materials for Vocational and Technical Education.

Science.gov (United States)

Ohio State Univ., Columbus. National Center for Research in Vocational Education.

This coursebook and training manual for a secondary/postsecondary level course on boating safety comprises one of a number of military-developed curriculum packages selected for adaptation to vocational instruction and curriculum development in a civilian setting. The purpose stated for the individualized, self-paced course is to establish policy…

78 FR 44806 - Amendments to Regulation D, Form D and Rule 156

Science.gov (United States)

2013-07-24

... FURTHER INFORMATION CONTACT: Charles Kwon, Special Counsel or Ted Yu, Senior Special Counsel, Office of... Efficiency, Competition and Capital Formation X. Small Business Regulatory Enforcement Fairness Act XI...

Wheat related allergy – A retrospective single-centre study of 156 patient

DEFF Research Database (Denmark)

Junker Christensen, Morten

2014-01-01

Background Allergy to wheat can manifest in different forms: sensitization to ingested wheat via the gastrointestinal tract can cause traditional food allergy or in combination with exercise, Wheat-Dependent Exercise-Induced Anaphylaxis (WDEIA). Sensitization to inhaled wheat flour may lead to oc...

Operation REDWING Commander Task Group 7.3, Operation Plan Number 1-56.

Science.gov (United States)

1956-01-24

Radio Circuit Description SI. Tab B - Radio Frequency Plan 7:: Tab C - Aircraft Radio Frequency List Tab D - Radio Circuit Diagram Appendix 2 - Radio...Frequency Plan C Aircraft Radio Frequency List D Radio Circuit Diagrams 2 - Radio Call Signs and Code ’Words N. ROHI5BE2 E LCDR, U. S. Navy Flag...appendix. TABS: A Radio Circuit Description B Radio Frequency Plan C Aircraft Radio Frequency List D Radio Circuit Diagrams Joint Task Force SEVEN Task

Inhibitory activity of Syzygium aromaticum and Cymbopogon citratus (DC.) Stapf. essential oils against Listeria monocytogenes inoculated in bovine ground meat.

Science.gov (United States)

de Oliveira, Thales Leandro Coutinho; das Graças Cardoso, Maria; de Araújo Soares, Rodrigo; Ramos, Eduardo Mendes; Piccoli, Roberta Hilsdorf; Tebaldi, Victor Maximiliano Reis

2013-01-01

This research evaluated the antimicrobial effect of the clove (Syzygium aromaticum) and lemongrass (Cymbopogon citratus (DC.) Stapf.) essential oils (EOs) against Listeria monocytogenes ATCC 19117 growth added to bovine ground meat stored under refrigeration (5 ± 2 °C) for three days. The EOs, extracted by hydrodistillation and analyzed by gas chromatography-mass spectrometry (GC-MS), were tested in vitro using an agar well diffusion methodology for determination of Minimum Inhibitory Concentration (MIC). The MIC concentrations for both essential oils on culture tested of L. monocytogenes were 1.56%. The EOs concentrations applied in contaminated ground beef were 1.56, 3.125 and 6.25% (w/v) based on MIC levels and possible activity reductions by food constituents. The bacteria populations were significantly reduced (p ≤ 0.05) after one day of storage in ground meat samples treated with clove and lemongrass EOs at concentrations of 1.56%. There were no significant counts of L. monocytogenes in samples at the other concentrations of the two oils applied after the second day of storage. The sensory acceptability evaluation of the bovine ground meat samples treated with EOs showed that the addition at concentrations higher than 1.56% promote undesirable alterations of taste, odor and characteristic color. The application of EOs at low concentrations in food products can be used in combination with other preservation methods, such as refrigeration, to control pathogens and spoilage bacteria during shelf-life; which goes according to current market trends, where consumers are requesting natural products.

Inhibitory activity of Syzygium aromaticum and Cymbopogon citratus (DC. Stapf. essential oils against Listeria monocytogenes inoculated in bovine ground meat

Directory of Open Access Journals (Sweden)

Thales Leandro Coutinho de Oliveira

2013-01-01

Full Text Available This research evaluated the antimicrobial effect of the clove (Syzygium aromaticum and lemongrass (Cymbopogon citratus (DC. Stapf. essential oils (EOs against Listeria monocytogenes ATCC 19117 growth added to bovine ground meat stored under refrigeration (5 ± 2 °C for three days. The EOs, extracted by hydrodistillation and analyzed by gas chromatography-mass spectrometry (GC-MS, were tested in vitro using an agar well diffusion methodology for determination of Minimum Inhibitory Concentration (MIC. The MIC concentrations for both essential oils on culture tested of L. monocytogenes were 1.56%. The EOs concentrations applied in contaminated ground beef were 1.56, 3.125 and 6.25% (w/v based on MIC levels and possible activity reductions by food constituents. The bacteria populations were significantly reduced (p < 0.05 after one day of storage in ground meat samples treated with clove and lemongrass EOs at concentrations of 1.56%. There were no significant counts of L. monocytogenes in samples at the other concentrations of the two oils applied after the second day of storage. The sensory acceptability evaluation of the bovine ground meat samples treated with EOs showed that the addition at concentrations higher than 1.56% promote undesirable alterations of taste, odor and characteristic color. The application of EOs at low concentrations in food products can be used in combination with other preservation methods, such as refrigeration, to control pathogens and spoilage bacteria during shelf-life; which goes according to current market trends, where consumers are requesting natural products.

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available KLQDVTPFIDFGPRIGDIPDALLARIMACRPLVSLNRQEAEIAAERFAL 215 ... PCGELLVEWLEKLQDVTPFIDFGPRIGDIPDALLARIMACRPL...VSLNRQEAEIAAERFAL Sbjct: 138 PCGELLVEWLEKLQDVTPFIDFGPRIGDIPDALLARIMACRPLVSLNRQEAE...NRMAKEDLI Sbjct: 18 ... LPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNALPLGQGVWAEIIRNRMAKEDLI 77 ... Query: 156 PCGELLVEWLE

Radiation buildup and control in BWR recirculation piping

International Nuclear Information System (INIS)

Meyer, W.; Wood, R.M.; Rao, T.V.; Vook, R.W.

1987-01-01

Boiling water nuclear reactors (BWRs) employ stainless steel (Types 304 or 316 NG) pipes in which high-purity water at temperatures of ∼ 275 0 C are circulated. Various components of the system, such as valves and bearings, often contain hard facing metal alloys such as Stellite-6. These components, along with the stainless steel tubing and feedwater, serve as sources of 59 Co. This cobalt, along with other soluble and insoluble impurities, is carried along with the circulating water to the reactor core where it is converted to radioactive 60 Co. After reentering the circulating water, the 60 Co can be incorporated into a complex corrosion layer in the form of CoCr 2 O 4 and/or CoFe 2 O 4 . The presence of even small amounts of 60 Co on the walls of BWR cooling systems is the dominant contributor to inplant radiation levels. Thus BWR owners and their agents are expending significant time and resources in efforts to reduce both the rate and amount of 60 Co buildup. The object of this research is twofold: (a) to form a thin diffusion barrier against the outward migration of cobalt from a cobalt-containing surface and (b) to prevent the growth of a 60 Co-containing corrosion film. The latter goal was the more important since most of the radioactive cobalt will originate from sources other than the stainless steel piping itself

Erosion resistance comparison of alternative surface treatments

Science.gov (United States)

Česánek, Z.; Schubert, J.; Houdková, Š.

2017-05-01

Erosion is a process characterized by the particle separation and the damage of component functional surfaces. Thermal spraying technology HP/HVOF (High Pressure / High Velocity Oxygen Fuel) is commonly used for protection of component surfaces against erosive wear. Alloy as well as cermet based coatings meet the requirements for high erosion resistance. Wear resistance is in many cases the determining property of required component functioning. The application suitability of coating materials is particularly influenced by different hardness. This paper therefore presents an erosion resistance comparison of alloy and cermet based coatings. The coatings were applied on steel substrates and were subjected to the erosive test using the device for evaluation of material erosion resistance working on the principle of centrifugal erodent flow. Abrasive sand Al2O3 with grain size 212-250 μm was selected as an erosive material. For this purpose, the specimens were prepared by thermal spraying technology HP/HVOF using commercially available powders Stellite 6, NiCrBSi, Cr3C2-25%NiCr, Cr3C2-25%CoNiCrAlY, Hastelloy C-276 and experimental coating TiMoCN-29% Ni. Erosion resistance of evaluated coatings was compared with erosive resistance of 1.4923 high alloyed steel without nitridation and in nitrided state and further with surface treatment using technology PVD. According to the evaluation, the resulting erosive resistance depends not only on the selected erodent and surface protection, but also on the erodent impact angle.

Black silicon with black bus-bar strings

DEFF Research Database (Denmark)

Davidsen, Rasmus Schmidt; Tang, Peter Torben; Mizushima, Io

2016-01-01

We present the combination of black silicon texturing and blackened bus-bar strings as a potential method for obtaining all-black solar panels, while using conventional, front-contacted solar cells. Black silicon was realized by mask-less reactive ion etching resulting in total, average reflectance...... below 0.5% across a 156x156 mm2 silicon wafer. Black bus-bars were realized by oxidized copper resulting in reflectance below 3% in the entire visible wavelength range. The combination of these two technologies may result in aesthetic, all-black panels based on conventional, front-contacted solar cells...

Unexpected structure in the E2 quasicontinuum spectrum of 154Dy

International Nuclear Information System (INIS)

Holzmann, R.; Khoo, T.L.; Ma, W.C.

1988-01-01

The evolution of the γ quasicontinuum spectrum with neutron number has been investigated in the sequence of dysprosium isotopes /sup 152,154,156/Dy. The three nuclei display a pronounced collective E2 component. In 154 Dy this component shows an unexpected splitting into two distinct parts, signifying a structural change along the γ cascade. The E2 and statistical components can be reproduced in simple γ cascade calculations; in 152 Dy and 156 Dy only rotational bands were included, whereas in 154 Dy additional vibration-like transitions were required to reproduce the two E2 peaks. 11 refs., 2 figs

ORF Alignment: NC_006832 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available n] ... Length = 225 ... Query: 36 ... KVLDKGFVRLVDYMGSDESVVQAARISYGRGTKSVSQDAALINYLMRHSHTTPFEM...CEIK 95 ... KVLDKGFVRLVDYMGSDESVVQAARISYGRGTKSVSQDAALINYLMRHSHTTPFEMCEIK Sbjct: 1 ... KVL...DKGFVRLVDYMGSDESVVQAARISYGRGTKSVSQDAALINYLMRHSHTTPFEMCEIK 60 ... Query: 156 EDAQYVTDLLKRDSDMVYETYNKFLIKGVSREISR

ORF Alignment: NC_006831 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available n] ... Length = 225 ... Query: 36 ... KVLDKGFVRLVDYMGSDESVVQAARISYGRGTKSVSQDAALINYLMRHSHTTPFEM...CEIK 95 ... KVLDKGFVRLVDYMGSDESVVQAARISYGRGTKSVSQDAALINYLMRHSHTTPFEMCEIK Sbjct: 1 ... KVL...DKGFVRLVDYMGSDESVVQAARISYGRGTKSVSQDAALINYLMRHSHTTPFEMCEIK 60 ... Query: 156 EDAQYVTDLLKRDSDMVYETYNKFLIKGVSREISR

ORF Alignment: NC_004917 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available paticus ATCC 51449] ... Length = 156 ... Query: 4 ... VSVIMGSKSDWNVMSECIEVLKKFDVAYEVIISSAHRSPERTKSYIKDAQSR...GAQVFIXX 63 ... VSVIMGSKSDWNVMSECIEVLKKFDVAYEVIISSAHRSPERTKSYIKDAQSRGAQVFI... ... Sbjct: 1 ... VSVIMGSKSDWNVMSECIEVLKKFDVAYEVIISSAHRSPERTKSYIKDAQSRGAQVFIGA 60 ... Query: 124 AYLAMQILSLKNDELAGK

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Arabidopsis thaliana] ... Length = 156 ... Query: 148 IKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAK...SASKFVKNISHGGGL 207 ... IKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKF...VKNISHGGGL Sbjct: 1 ... IKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKFVKNISHGGGL 60 ... Query: 268 CMDGFSLVKT

Cost-Effectiveness of Mass Dog Vaccination Campaigns against Rabies in Flores Island, Indonesia.

Science.gov (United States)

Wera, E; Mourits, M C M; Siko, M M; Hogeveen, H

2017-12-01

A dynamic deterministic simulation model was developed to determine the cost-effectiveness of different mass dog vaccination strategies against rabies in a dog population representative of a typical village on Flores Island. Cost-effectiveness was measured as public cost per averted dog-rabies case. Simulations started with the introduction of one infectious dog into a susceptible dog population of 399 dogs and subsequently ran for a period of 10 years. The base scenario represented a situation without any control intervention. Evaluated vaccination strategies were as follows: annual vaccination campaigns with short-acting vaccine (immunity duration of 52 weeks) (AV_52), annual campaigns with long-acting vaccine (immunity duration of 156 weeks) (AV_156), biannual campaigns with short-acting vaccine (BV_52) and once-in-2-years campaigns with long-acting vaccine (O2V_156). The effectiveness of the vaccination strategies was simulated for vaccination coverages of 50% and 70%. Cumulative results were reported for the 10-year simulation period. The base scenario resulted in three epidemic waves, with a total of 1274 dog-rabies cases. The public cost of applying AV_52 at a coverage of 50% was US$5342 for a village. This strategy was unfavourable compared to other strategies, as it was costly and ineffective in controlling the epidemic. The costs of AV_52 at a coverage of 70% and AV_156 at a coverage of 70% were, respectively, US$3646 and US$3716, equivalent to US$3.00 and US$3.17 per averted dog-rabies case. Increasing the coverage of AV_156 from 50% to 70% reduced the number of cases by 7% and reduced the cost by US$1452, resulting in a cost-effectiveness ratio of US$1.81 per averted dog-rabies case. This simulation model provides an effective tool to explore the public cost-effectiveness of mass dog vaccination strategies in Flores Island. Insights obtained from the simulation results are useful for animal health authorities to support decision-making in rabies

The Utility of Routine Ultrasound in the Diagnosis and Management of Adolescents with Abnormal Uterine Bleeding.

Science.gov (United States)

Pecchioli, Yael; Oyewumi, Lamide; Allen, Lisa M; Kives, Sari

2017-04-01

Despite the fact that most cases of abnormal uterine bleeding (AUB) in adolescence are due to an immature hypothalamic-pituitary-ovarian (HPO) axis, the current approach to investigating adolescents who present with AUB often includes pelvic ultrasound to exclude rare structural causes. The aim of this study was to determine whether an ultrasound ordered for the investigation of AUB in adolescents detects any significant anatomic pathology or alters diagnosis and management. A retrospective chart review of 230 patients younger than 18 years of age who presented with AUB to the gynecology clinic at the Hospital for Sick Children in Toronto, Canada between January 2010 and December 2012 was completed. Findings on pelvic ultrasound and any further imaging as well as management choices for these patients were examined. Of all patients, 67.8% (156/230) had ultrasound done as part of their AUB workup. The most common diagnosis for the patients who received ultrasound examinations and the patients who did not was AUB due to an immature HPO axis. Of the patients who received an ultrasound examination, 72.4% (113/156) had normal findings; incidental findings were identified in 17.9% (28/156) and polycystic ovary syndrome morphology in 6.4% (10/156). Structural causes of AUB were found in only 2 (1.3%) of the adolescents imaged. No patient had a change in her AUB management plan because of ultrasound findings. Our results strongly suggest that pelvic ultrasound examination is not required in the initial investigation of AUB in the adolescent population because it did not alter treatment in any of our patients. Crown Copyright © 2016. Published by Elsevier Inc. All rights reserved.

Nuclear isomerism in fission fragments produced by the spontaneous fission of {sup 252}Cf; Isomerisme nucleaire dans les fragments de fission produits dans la fission spontanee du {sup 252}Cf

Energy Technology Data Exchange (ETDEWEB)

Gautherin, C

1997-09-01

This thesis is devoted to the study of the nuclear structure of neutron-rich nuclei, via the search of isomeric nuclear states. Neutron-rich nuclei were produced in the spontaneous fission of {sup 252}Cf. The experimental study of isomeric states in these nuclei was performed with the {gamma}-array EUROGAM II, coupled to an additional and original fission fragment detector composed by photovoltaic cells, SAPhIR. The photovoltaic cells are well adapted to detect low energy heavy ions and have good energy and time resolutions to obtain a good fission fragment detection. This experiment led to the discovery of new isomeric states in {sup 135}Xe, {sup 104}Mo, {sup 146,147,148}Ce and {sup 152,154,156}Nd, with lifetimes between 60 ns and 2 {mu}s. Level schemes of these nuclei have been completed. An interpretation of the isomeric states in the nuclei {sup 154,156}Nd and {sup 156,158}Sm was performed by Hartree-Fock-Bogolyubov calculations using the DIS Gogny force with two quasi-particles excitations. The confrontation with the experimental results led to an interpretation of these isomeric states as K-isomers. (author)

LASER APPLICATIONS AND OTHER TOPICS IN QUANTUM ELECTRONICS: Change in the optical properties of hyaline cartilage heated by the near-IR laser radiation

Science.gov (United States)

Bagratashvili, Viktor N.; Bagratashvili, N. V.; Gapontsev, V. P.; Makhmutova, G. Sh; Minaev, V. P.; Omel'chenko, A. I.; Samartsev, I. E.; Sviridov, A. P.; Sobol', E. N.; Tsypina, S. I.

2001-06-01

The in vitro dynamics of the change in optical properties of hyaline cartilage heated by fibre lasers at wavelengths 0.97 and 1.56 μm is studied. The laser-induced bleaching (at 1.56 μm) and darkening (at 0.97 μm) of the cartilage, caused by the heating and transport of water as well as by a change in the cartilage matrix, were observed and studied. These effects should be taken into account while estimating the depth of heating of the tissue. The investigated dynamics of light scattering in the cartilage allows one to choose the optimum radiation dose for laser plastic surgery of cartilage tissues.

ORF Alignment: NC_004668 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s ... faecalis V583] ... Length = 156 ... Query: 151 NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKS...SLRMAAPSSMRLSVLG 210 ... NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKSSLRMA...APSSMRLSVLG Sbjct: 1 ... NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKSSLRMAAPSSMRLSVLG 60 ... Query: 271 VLPEEEQIF

ORF Alignment: NC_004193 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s ... iheyensis HTE831] ... Length = 156 ... Query: 98 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYH...SFSFAHWFSFNLNYIVGNA 157 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYHSFSFA...HWFSFNLNYIVGNA Sbjct: 1 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYHSFSFAHWFSFNLNYIVGNA 60 ... Query: 218 YADFVI

[Growth and metabolite production of the marine cyanobacterium Synechococcus sp. (Chroococcales) in function to irradiance].

Science.gov (United States)

Rosales-Loaiza, Néstor; Guevara, Miguel; Lodeiros, César; Morales, Ever

2008-06-01

Changes in salinity, temperature and irradiance during wet and dry seasons have induced metabolic versatility in cyanobacteria from saline environments. Cyanobacteria from these environments have biotechnological potential for the production of metabolites with pharmaceutical and industrial interest. We studied the growth, dry mass and metabolite production of the cyanobacterium Synechococcus sp. MOF-03 in function of irradiance (78, 156 and 234 micromol q m(-2) s(-1)). All batch cultures were maintained by triplicate in constant aeration, 12:12 h photoperiod, 30 +/- 2 degrees C and 35% per hundred. Maximum values of protein, carbohydrates and lipids, of 530.19 +/- 11.16, 408.94 +/- 4.27 and 56.20 +/- 1.17 microg ml(-1), respectively, were achieved at 78 micromol q m(-2) s(-1). Pigments, analyzed by HPLC, showed maximum values at 78 micromol q m(-2) s(-1) for chlorophyll a with 7.72 +/- 0.16 microg ml(-1), and at 234 micromol q m(-2) s(-1) for beta-carotene and zeaxanthin with 0.70 +/- 0.01 and 0.67 +/- 0.05 microg ml(-1). Chlorophyll a:beta-carotene ratio decreased from 17.15 to 6.91 at 78 and 234 micromol q m(-2) s(-'1); whereas beta-carotene:zeaxanthin ratio showed no changes between 78 and 156 micromol q m(-2) s(-1), around 1.21, and decreased at 234 micromol q m(-2) s(-1), to 1.04. Also, this cyanobacterium produced the greatest cell density and dry mass at 156 micromol q m(-2) s(-1), with 406.13 +/- 21.74 x l0(6) cell ml(-1) and 1.49 +/- 0.11 mg ml(-1), respectively. Exopolysaccharide production was stable between 156 y 234 micromol q m(-2) s(-1), around 110 microg ml(-1). This Synechococcus strain shows a great potential for the production of enriched biomass with high commercial value metabolites.

Genomic Organization, Phylogenetic Comparison and Differential Expression of the SBP-Box Family Genes in Grape

Science.gov (United States)

Hou, Hongmin; Li, Jun; Gao, Min; Singer, Stacy D.; Wang, Hao; Mao, Linyong; Fei, Zhangjun; Wang, Xiping

2013-01-01

Background The SBP-box gene family is specific to plants and encodes a class of zinc finger-containing transcription factors with a broad range of functions. Although SBP-box genes have been identified in numerous plants including green algae, moss, silver birch, snapdragon, Arabidopsis, rice and maize, there is little information concerning SBP-box genes, or the corresponding miR156/157, function in grapevine. Methodology/Principal Findings Eighteen SBP-box gene family members were identified in Vitis vinifera, twelve of which bore sequences that were complementary to miRNA156/157. Phylogenetic reconstruction demonstrated that plant SBP-domain proteins could be classified into seven subgroups, with the V. vinifera SBP-domain proteins being more closely related to SBP-domain proteins from dicotyledonous angiosperms than those from monocotyledonous angiosperms. In addition, synteny analysis between grape and Arabidopsis demonstrated that homologs of several grape SBP genes were found in corresponding syntenic blocks of Arabidopsis. Expression analysis of the grape SBP-box genes in various organs and at different stages of fruit development in V. quinquangularis ‘Shang-24’ revealed distinct spatiotemporal patterns. While the majority of the grape SBP-box genes lacking a miR156/157 target site were expressed ubiquitously and constitutively, most genes bearing a miR156/157 target site exhibited distinct expression patterns, possibly due to the inhibitory role of the microRNA. Furthermore, microarray data mining and quantitative real-time RT-PCR analysis identified several grape SBP-box genes that are potentially involved in the defense against biotic and abiotic stresses. Conclusion The results presented here provide a further understanding of SBP-box gene function in plants, and yields additional insights into the mechanism of stress management in grape, which may have important implications for the future success of this crop. PMID:23527172

Responses of sensitive and tolerant bush beans (Phaseolus vulgaris L.) to ozone in open-top chambers are influenced by phenotypic differences, morphological characteristics, and the chamber environment

Energy Technology Data Exchange (ETDEWEB)

Elagoez, Vahram [Plant Biology Graduate Program, University of Massachusetts, Amherst, MA 01003 (United States)]. E-mail: velagoz@nsm.umass.edu; Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)

2005-08-15

Responses of bush bean (Phaseolus vulgaris L.) lines 'S156' (O{sub 3}-sensitive) and 'R123' (O{sub 3}-tolerant), and cultivars 'BBL 290' (O{sub 3}-sensitive) and 'BBL 274' (O{sub 3}-tolerant) to ambient ozone (O{sub 3}) were investigated during the 2001 and 2002 growing seasons. Seedlings were grown in pots inside open-top chambers (OTCs), with charcoal filtered (CF) and non-filtered (NF) ambient air, and in non-chambered ambient air (AA) plots. Growth parameters from individual plants were evaluated after harvests at the end of vegetative (V{sub 4}) and reproductive (R{sub 10}) growth phases. Results at V{sub 4} indicated that CF did not provide additional benefits over NF in 'S156' in 2001 and 2002. In contrast, exposure to CF significantly impaired the growth of 'R123'. At the end of R{sub 10}, 'S156' produced more pods, most of which remained immature, and contained fewer seeds or were more frequently aborted, whereas pods produced in 'R123' reached pod maturation and senescence more consistently. Despite increased seed weights inside the OTCs, as observed in 'S156', differences between the two lines were insignificant when grown outside OTCs. Results from the 'BBL 290'/'BBL 274' pair, especially at V{sub 4} phase, remained inconclusive. Plant morphological characteristics, variabilities in environmental conditions, and 'chamber effects' inside OTCs were influential in determining plant response to ambient O{sub 3}. - Phenotypic differences, morphological characteristics, and 'chamber effects' inside OTCs are equally influential in determining the responses of beans to O{sub 3}.

Lack of Association Between Toxoplasma gondii Infection and Diabetes Mellitus: A Matched Case-Control Study in a Mexican Population.

Science.gov (United States)

Alvarado-Esquivel, Cosme; Loera-Moncivais, Nayely; Hernandez-Tinoco, Jesus; Sanchez-Anguiano, Luis Francisco; Hernandez-Madrid, Guillermina; Rabago-Sanchez, Elizabeth; Centeno-Tinoco, Maria Magdalena; Sandoval-Carrillo, Ada A; Salas-Pacheco, Jose M; Campos-Moreno, Oscar Vladimir; Antuna-Salcido, Elizabeth Irasema

2017-06-01

Very little is known about the association between infection with Toxoplasma gondii ( T. gondii ) and diabetes mellitus. We perform an age- and gender-matched case-control study to determine the association of T. gondii infection and diabetes mellitus. Cases included 156 patients with diabetes mellitus and 156 controls without diabetes mellitus who attended in two public clinics in Durango City, Mexico. Sera of cases and controls were tested for the presence of anti- Toxoplasma IgG and IgM antibodies using commercially available enzyme-linked fluorescence assays (ELFA). Anti- T. gondii IgG antibodies were found in 10 (6.4%) of the 156 cases and in five (3.2%) of the 156 controls (odds ratio (OR): 2.06; 95% confidence interval (CI): 0.69 - 6.19; P = 0.18). The frequency of high (> 150 IU/mL) anti- T. gondii IgG levels in seropositive cases (1/10: 10.0%) was comparable to the one (1/5: 20%) in seropositive controls (OR: 0.44; 95% CI: 0.02 - 9.03; P = 1.00). None of the 10 cases and five controls with seropositivity to anti- T. gondii IgG antibodies were positive for anti- T. gondii IgM antibodies. Stratification by gender showed similar frequencies of T. gondii infection in female cases (7/107: 6.5%) and female controls (4/107: 3.7%) (OR: 1.80; 95% CI: 0.51 - 6.34; P = 0.53), and in male cases (3/49: 6.1%) and male controls (1/49: 2.0%) (OR: 3.13; 95% CI: 0.31 - 31.19; P = 0.61). We conclude that there is not serological evidence of an association between T. gondii infection and diabetes mellitus in the studied subjects in Durango City, Mexico. Further studies to elucidate the role of T. gondii in diabetes should be conducted.

Study of the isomer nuclei produced in the spontaneous fission of {sup 252}Cf; Etude des noyaux isomeriques produits dans la fission spontanee de {sup 252}Cf

Energy Technology Data Exchange (ETDEWEB)

Gautherin, C.; Houry, M.; Korten, W.; Le Coz, Y.; Lucas, R.; Thiesen, Ch. [Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee, CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France); Badimon, C.; Barreau, G.; Doan, T.P.; Pedemay, G. [Centre d`Etudes Nucleaires, Bordeaux-1 Univ., 33 Gradignan (France); Belier, G.; Girod, M.; Meot, M.V. [CEA Centre d`Etudes de Bruyeres-le-Chatel, 91 (France); Astier, G.; Meot, V.; Peru, S. [CEA Centre d`Etudes de Bruyeres-le-Chatel, 91 (France); Astier, A.; Ducroux, L.; Meyer, M.; Redon, N. [Inst.de Physique Nucleaire, Lyon-1 Univ., 69 - Villeurbanne (France)

1997-06-01

Isomeric states have been studied in fission fragments produced by spontaneous fission of {sup 252}Cf. 34 isomeric nuclei have been identified by using coincidences between {gamma}-rays detected in EUROGAM II and fission fragments detected in photovoltaic cells. Lifetimes from 20 ns up to 2 {mu}s have been measured. Microscopic interpretation of the isomeric levels discovered has been tried by means of the Hartree-Fock-Bogolyubov procedure using Gogny force. It was found that the {sup 152,154,156}Nd nuclei have prolate deformation in their ground state; the rotational band built on this ground state is well reproduced by the calculation. For these nuclei the 2 quasi-particle excited states energies are above 1 MeV in agreement with the experiment. The computation confirms the similitude of the {sup 156}Nd and {sup 158}Sm isomeric states associated to neutron 2 quasi-particles of J{sup {pi}} K{sup {pi}} = 5{sup -} ({nu} 5/2 (642) x {nu} 5/2 (523)) while such similitude does not occur for the isotone nuclei {sup 154}Nd and {sup 156}Sm. The computation predicts a proton 2 quasi-particle excited states of J{sup {pi}} = 5{sup -}, near the isomeric level measured in {sup 156}Sm but not for that of {sup 154}Nd. Concerning the {sup 152}Nd the calculated level density is very near that of the states measured in the 1.6 to 2.3 MeV interval. However, the lack of precise information on spins and parities of the measured levels does make not possible a confrontation with the calculations. An up-graded equipment implying 32 photovoltaic cells instead of 2 cells is to be developed and installed by the EUROGAM 3 refs.

Neutron scattering from 12C between 15.6 and 17.3 MeV

International Nuclear Information System (INIS)

Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L.

1993-01-01

The differential cross section σ(θ) for neutron elastic scattering from 12 C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The σ(θ) data, together with published analysing power A y (θ) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present 12 C(n,n) 12 C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in 11 C via an iterative-moment approach or a dispersive optical-model analysis. (author)

Kigen et al., Afr J Tradit Complement Altern Med. (2016) 13(3):156 ...

African Journals Online (AJOL)

3Department of Surgery, Moi Teaching and Referral Hospital, P.O. Box 3, ... It is endowed with a beautiful topography that mainly consists of the scenic Nandi Hills. ..... One plant, Solanum aculeastrum was used as talisman, to offer children ..... interviewed had learnt the art from a close relative by word of mouth, mostly ...

Instructional Staff Salary and Benefits Spending: 1991-2011. Data Point. NCES 2016-156

Science.gov (United States)

Malkus, Nat; Hoyer, Kathleen Mulvaney

2016-01-01

This report uses expenditure data from the Common Core of Data (CCD) "National Public Education Financial Survey (NPEFS)" for fiscal years 1991 to 2011 and instructional staff data from the CCD "State Nonfiscal Survey of Public Elementary/Secondary Education" for school years 1990-91 to 2010-11. The CCD annually collects fiscal…

NODC Standard Format Drifting Buoy (F156) Data (1975-1994) (NODC Accession 0014200)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This data type contains time series ocean circulation data determined by tracking the movement of drifting buoys, drogues or other instrumented devices. Movement is...

Quadrupole decay strength of the M1 scissors mode of {sup 156}Gd

Energy Technology Data Exchange (ETDEWEB)

Beck, T.; Beller, J.; Gayer, U.; Mertes, L.; Pai, H.; Pietralla, N.; Ries, P.; Romig, C.; Werner, V.; Zweidinger, M. [IKP, TU Darmstadt (Germany); Derya, V. [IKP, Universitaet zu Koeln (Germany); Isaak, J.; Loeher, B.; Savran, D. [EMMI, GSI, Darmstadt (Germany); FIAS, Frankfurt (Germany); Scheck, M. [IKP, TU Darmstadt (Germany); School of Engineering, UWS, Paisley (United Kingdom); SUPA, Glasgow (United Kingdom); Tornow, W.; Weller, H.R. [Duke University, Durham (United States)

2015-07-01

The isovector low-lying J{sup π}{sub K}=1{sup +}{sub 1} scissors mode of deformed nuclei has been studied extensively in (e,e{sup '}) and (γ,γ{sup '}) experiments over the last 30 years with the main focus on strong M1 transitions to the ground state band. In the framework of the semiclassical two-rotor-model it has its origin in quadrupole deformation. A considerable E2 matrix element between the rotational band of the scissors mode and the ground band is predicted which has not been addressed experimentally. A photon-scattering experiment with linearly-polarized quasi monoenergetic vector (γ)-rays has been performed at the High Intensity vector (γ)-ray Source (HIvector (γ)S) at Duke University, Durham, NC, exploiting the γ{sup 3} setup. We have measured an E2/M1-multipole mixing ratio for the 1{sup +}{sub sc}→2{sup +}{sub 1} transition for the first time. The Alaga rule is applicable and delivers a first estimate of the transition strength B(E2:2{sup +}{sub sc}→0{sup +}{sub 1}). A candidate for a 2{sup +}{sub sc}→2{sup +}{sub 1} transition is discussed.

26 CFR 156.6161-1 - Extension of time for paying tax or deficiency.

Science.gov (United States)

2010-04-01

... shown on the notice and demand. In exceptional cases, a further extension for a period not in excess of... deficiency is due to negligence, to intentional disregard of rules and regulations, or to fraud with intent...

Alejandro González Iñárritu. The Revenant. Eua, 2015. 156 min

Directory of Open Access Journals (Sweden)

Stefanie Cavalcanti de Lima Silva

2017-05-01

Full Text Available http://dx.doi.org/10.5007/2175-7968.2017v37n2p349 As adaptações de obras literárias para o cinema são práticas corriqueiras e bastantes rentáveis, algumas alcançam bastante sucesso recebendo prêmios e grandes bilheterias, como foi o caso de The Revenant, obra de Michael Punke baseada em fatos reais da vida do explorador Hugo Glass na época do comércio de pele de animais e conflitos entre os brancos e os índios. A adaptação de The Revenant rendeu vários prêmios ao filme e um grande reconhecimento ao diretor mexicano Alejandro Iñarritu. Nessa resenha procuramos mostrar o que há de mais semelhantes entre as duas formas como a história foi contada, exaltando a trabalho da direção do filme em produzir cenários e personagens do século XIX americano.

ORF Alignment: NC_003279 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available RTIHTVGVILEKSYEDGKTTYTLHDPEDTAKIF 95 ... LPVTLASLSTKLEDTDDDSYQIGEYSFRTIHTVGVILEKSYEDGKTTYTLHDPEDTAKIF... Sbjct: 1 ... LPVTLASLSTKLEDTDDDSYQIGEYSFRTIHTVGVILEKSYEDGKTTYTLHDPEDTAKIF 60 ... Query: 156 ETQASYLFFKK 166 ... ETQASYLFFKK Sbjct: 121 ETQASYLFFKK 131 ...habditis elegans] ... Length = 131 ... Query: 36 ... LPVTLASLSTKLEDTDDDSYQIGEYSF

The Investigation for Antifungal Effect of Medicinal Plants, Combination Infusion of Piper Bettle Leaves, Punica Granatum Fructus Cortec, Curcuma Domestica Rhizome

Directory of Open Access Journals (Sweden)

Berna Elya

2002-12-01

Full Text Available The tested demartophyta used Candida albicans. This research using dilution method to determine of minimum inhibitory concentration (MIC and difusion method to determine zone inhibition around of disc. The results of determination of MIC showed that combination infusion Piper bettle leaves with Punica granatum Fructus Cortex against C. albicans respectively, 31,2 mg/ml : 7,8 mg/ml; 15,6 mg/ml : 15,6 mg/ml and 7,8 mg/ml : 31,2 mg/ml. The determination for zone inhibition from 3 concentration of infusion of Piper bettle leaves with 3 concentration of Punica granatum Fructus Cortex with 9 combination against C. albicans showed that combination of two infusion is the larger than the single infusion.

Identical and shifted identical bands

International Nuclear Information System (INIS)

Dodder, R.S; Jones, E.F.; Hamilton, J.H.

1997-01-01

Spontaneous fission of 252 Cm was studied with 72 large Compton suppressed Ge detectors in Gamma sphere. New isotopes 160 Sm and 162 Gd were identified. Through X-ray-γ and γ-γ-γ) coincidence measurements, level energies were established to spins 14 + to 20 + in 152 , 154 156 60 Nd 92 94 96 , 156 , 158 , 160 62 Sm 94 , 96 , 98 , and 160 , 162 64 Gd 96 , 98 . These nuclei exhibit a remarkable variety of identical bands and bands where the energies and moments of inertia are shifted by the same constant amount for every spin state from 2 + to 12 + for various combinations of nuclei differing by 2n, 4n, 2p, 4p, and α

Effect of L-Tryptophan and L-Leucine on Gut Hormone Secretion, Appetite Feelings and Gastric Emptying Rates in Lean and Non-Diabetic Obese Participants

DEFF Research Database (Denmark)

Meyer-Gerspach, Anne Christin; Häfliger, Simon; Meili, Julian

2016-01-01

in relation to peptide release. In contrast, the role of proteins or amino acids is less clear. Our aim was to compare the effects of the amino acids L-tryptophan (L-trp) and L-leucine (L-leu) separately on gastric emptying and gut peptide secretion. PARTICIPANTS/METHODS: The study was conducted...... as a randomized (balanced), double-blind, parallel-group trial. A total of 10 lean and 10 non-diabetic obese participants were included. Participants received intragastric loads of L-trp (0.52 g and 1.56 g) and L-leu (1.56 g), dissolved in 300 mL tap water; 75 g glucose and 300 mL tap water served as control...

Development surface modification technologies - A development of new nuclear materials by thin film deposition methods

Energy Technology Data Exchange (ETDEWEB)

Lee, Won Jong; Lee, Min Goo; Kim, Hyun Ho; Kim, Yong Il; Kwang, Hee Soo [Korea Advanced Institute of Scienec and Technology, Taejon (Korea, Republic of)

1995-08-01

Pitting corrosion of TiN-coted Inconel 600 in hightemperature chloride solution was studied. To improve the pitting resistance of Inconel 600 by depositing TiN thin film, TiN must have the thickness greater than a critical value at which the characteristics of the film itself appear. E{sub np}s of the TiN-coated sample were higher than those of the bare Inconel 600 at all the solution temperature implying that the TiN film improved the pitting resistance. The heavy defects on the surface of the substrate which were incompletely covered by TiN film served as the active sites for the pit nucleation. Fine polishing reduced those defects and improved the pitting resistance of the TiN-coated Inconel 600. The pit densities of the TiN-coated samples were much lower than those of the bare Inconel 600 at low chloride concentrations. However, at high chloride concentrations the TiN film failed to improve the pitting resistance of the Inconel. The TiN film deposited by ion-plating on Stellite was studied. The X-ray analysis shows that the deposited films were only in .delta.-TiN phase and the texture was changed from (111) to (200) with the increase of N{sub 2}/Ar ratio. The impurities in TiN films were carbon and oxygen. The amounts of these impurities were decreased greatly when the substrate bias, -200 V, was applied compared to no bias. 40 refs., 4 tabs., 20 figs. (author)

Corrosion behaviour and surface analysis of a Co-Cr and two Ni-Cr dental alloys before and after simulated porcelain firing.

Science.gov (United States)

Qiu, Jing; Yu, Wei-Qiang; Zhang, Fu-Qiang; Smales, Roger J; Zhang, Yi-Lin; Lu, Chun-Hui

2011-02-01

This study evaluated the corrosion behaviour and surface properties of a commercial cobalt-chromium (Co-Cr) alloy and two nickel-chromium (Ni-Cr) alloys [beryllium (Be)-free and Be-containing] before and after a simulated porcelain-firing process. Before porcelain firing, the microstructure, surface composition and hardness, electrochemical corrosion properties, and metal-ion release of as-cast alloy specimens were examined. After firing, similar alloy specimens were examined for the same properties. In both as-cast and fired conditions, the Co-Cr alloy (Wirobond C) showed significantly more resistance to corrosion than the two Ni-Cr alloys. After firing, the corrosion rate of the Be-free Ni-Cr alloy (Stellite N9) increased significantly, which corresponded to a reduction in the levels of Cr, molybdenum (Mo), and Ni in the surface oxides and to a reduction in the thickness of the surface oxide film. The corrosion properties of the Co-Cr alloy and the Be-containing Ni-Cr alloy (ChangPing) were not significantly affected by the firing process. Porcelain firing also changed the microstructure and microhardness values of the alloys, and there were increases in the release of Co and Ni ions, especially for Ni from the Be-free Ni-Cr alloy. Thus, the corrosion rate of the Be-free Ni-Cr alloy increased significantly after porcelain firing, whereas the firing process had little effect on the corrosion susceptibility of the Co-Cr alloy and the Be-containing Ni-Cr alloy. © 2011 Eur J Oral Sci.

Identification by random forest method of HLA class I amino acid substitutions associated with lower survival at day 100 in unrelated donor hematopoietic cell transplantation.

Science.gov (United States)

Marino, S R; Lin, S; Maiers, M; Haagenson, M; Spellman, S; Klein, J P; Binkowski, T A; Lee, S J; van Besien, K

2012-02-01

The identification of important amino acid substitutions associated with low survival in hematopoietic cell transplantation (HCT) is hampered by the large number of observed substitutions compared with the small number of patients available for analysis. Random forest analysis is designed to address these limitations. We studied 2107 HCT recipients with good or intermediate risk hematological malignancies to identify HLA class I amino acid substitutions associated with reduced survival at day 100 post transplant. Random forest analysis and traditional univariate and multivariate analyses were used. Random forest analysis identified amino acid substitutions in 33 positions that were associated with reduced 100 day survival, including HLA-A 9, 43, 62, 63, 76, 77, 95, 97, 114, 116, 152, 156, 166 and 167; HLA-B 97, 109, 116 and 156; and HLA-C 6, 9, 11, 14, 21, 66, 77, 80, 95, 97, 99, 116, 156, 163 and 173. In all 13 had been previously reported by other investigators using classical biostatistical approaches. Using the same data set, traditional multivariate logistic regression identified only five amino acid substitutions associated with lower day 100 survival. Random forest analysis is a novel statistical methodology for analysis of HLA mismatching and outcome studies, capable of identifying important amino acid substitutions missed by other methods.

SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility

Directory of Open Access Journals (Sweden)

Shuping Xing

2013-06-01

Full Text Available The non-miR156 targeted SBP-box gene SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 8 (SPL8, plays an important role in Arabidopsis anther development, where its loss-of-function results in a semi-sterile phenotype. Fully male-sterile plants are obtained when a spl8 loss-of-function mutation is introduced into a 35S:MIR156 genetic background, thereby revealing functional redundancy between SPL8 and miR156-targeted SBP-box genes. Here, we show that BIM1, a gene encoding a bHLH protein involved in brassinosteroid signaling and embryonic patterning, functions redundantly with SPL8 in its requirement for male fertility. Although bim1 single mutants displayed a mild fertility problem due to shortened filaments in some flowers, mutation of BIM1 significantly enhanced the semi-sterile phenotype of the spl8 mutant. Expression of both SPL8 and BIM1 was detected in overlapping expression domains during early anther developmental stages. Our data suggest that in regulating anther development, SPL8 and BIM1 function cooperatively in a common complex or in synergistic pathways. Phylogenetic analysis supports the idea of an evolutionary conserved function for both genes in angiosperm anther development.

Microvascular decompression in treating cranial nerve diseases%微血管减压术治疗颅神经疾病疗效分析

Institute of Scientific and Technical Information of China (English)

张志强; 黄涛; 罗小川; 谢才军; 谢绍盈; 沈有碧; 隋立森; 韩富

2008-01-01

Objective To study the efficacy of microvascular decompression in treating cranial nerve diseases. Methods 156 patients were treated with microvaseular decompression,of whom 119 were with trigeminal neuralgia,34 with hemifacial spasm and three with glossopharyngeal neuralgia.Rusults The overall effective rate was 96.8%(151/156) and the corresponding effective rate for the above three conditions were 94.2%,97.1% and 66.7%. Conlusions Mierovaseular decompression iS an effective treatment for cranial nerve diseases.%目的 探讨微血管减压术治疗三叉神经痛、面肌痉挛、舌咽神经痛的疗效. 方法 微血管减压手术治疗颅神经疾病156例(三叉神经痛119例,面肌痉挛34例,舌咽神经痛3例). 结果 总有效151例,有效率96.8%,其中三又神经痛、面肌痉挛和舌咽神经痛患者手术有效率分别为94.2%、97.1%和66.7%. 结论 微血管减压术治疗颅神经疾病疗效确切.

Epidemiology of pertussis in Casablanca (Morocco): contribution of conventional and molecular diagnosis tools.

Science.gov (United States)

Katfy, Khalid; Guiso, Nicole; Diawara, Idrissa; Zerouali, Khalid; Slaoui, Bouchra; Jouhadi, Zineb; Zineddine, Abdelhadi; Belabbes, Houria; Elmdaghri, Naima

2017-05-16

Pertussis, a vaccine preventable disease, is still responsible of significant morbidity and mortality around the world, mostly in newborns. The aim of the present study was (1) to introduce pertussis surveillance in the major pediatric hospital of Casablanca (2) to analyze the prevalence of pertussis among children under 14 years of age and their entourage in Casablanca, Morocco. This is a prospective and non-case controlled study, including children suspected of Pertussis admitted at the Abderrahim Harouchi Pediatric Hospital in Casablanca, from January 2013 to June 2015. Nasopharyngeal samples were obtained for Bordetella spp. culture and Real time PCR detection (RT-PCR) with specific primers of Bordetella spp., B. pertussis, B. parapertussis and B. holmesii. The detection of Bordetella spp. was also performed in some household contacts of the children suspected of pertussis. During the 2.5-years period, a total of 282 samples were collected from hospitalized children (156) and in some of their contacts (126). Among 156 samples from the children (from whom 57% were under 2 month of age), Bordetella DNA was detected in 61% (96/156) by RT-PCR. Among these positive samples, 91.7% (88/96) corresponded to B. pertussis DNA. Furthermore, in 39.5% (38/96) of the Bordetella positive samples, B. holmesii DNA was also detected. B. parapertussis DNA was detected in only one sample (1/156). Out of the 156 samples collected from the hospitalized children, only 48 were tested by culture, and 4 B. pertussis were isolated (8.3%). Among the 126 samples from the contacts of the children, mostly mothers (115 cases), Bordetella DNA was detected in 47% (59/126), 90% (53/59) being B. pertussis DNA. Moreover, B. holmesii DNA was also detected in 18.6% (11/59) of the Bordetella positive samples, and coexistence of B. pertussis and B. holmesii DNA in 36.5% (35/96). Two B. pertussis were isolated by culture performed on 43 samples of the contacts of the children (4.6%). This study

Coagulation Factor Tests: MedlinePlus Lab Test Information

Science.gov (United States)

... K. Brunner & Suddarth's Handbook of Laboratory and Diagnostic Tests. 2nd Ed, Kindle. Philadelphia: Wolters Kluwer Health, Lippincott Williams & Wilkins; c2014. Coagulation Factor Assay; 156–7 p. ...

A Comparison of Models of Economic Democracy: Towards the World of Shared Sovereignty

Czech Academy of Sciences Publication Activity Database

Hrubec, Marek

2016-01-01

Roč. 15, 1/2 (2016), s. 145-156 ISSN 1569-1500 Institutional support: RVO:67985955 Keywords : economic democracy * market * planning * ownership * shared sovereignty Subject RIV: AA - Philosophy ; Religion

The perceptions of teaching staff from Nigerian independent schools ...

African Journals Online (AJOL)

schools of a South African professional development workshop. Trudie Steyn .... and learning; change management; improving a school through action re- search ..... development. International Journal of Lifelong Learning, 25:139-156.

Evaluation of staphylococcus aureus growth in unirradiated and irradiated cured meats using the Gompertz equation

International Nuclear Information System (INIS)

Szczawinski, J.; Szczawinska, M.

1993-01-01

1. Sodium nitrite, in concentration of 156 mg/kg, exerted little (from practical point of view) inhibitory effect on S. aureus in cured meat. Its addition caused lag time extension, increase of exponential growth rate, decrease of generation time and maximum population density of staphylococci in samples of cured meat stored at 20 C. 2. Growth curves of Staphylococcus aureus in unirradiated and irradiated (50 kGy) meats cured without sodium nitrite were similar. 3. Irradiation of meat cured with 156 mg/kg sodium nitrite with increasing doses of ionizing radiation (0, 10, 30, 50 kGy) progressively decreased growth rates and lag time and increased generation time and maximum population densities of Staphylococcus aureus in samples inoculated after radiation treatment and incubated at 20 C. (orig.)

Isotope shifts and electronic configurations of some of the energy levels of the neutral gadolinium atom

International Nuclear Information System (INIS)

Ahmad, S.A.; Venugopalan, A.; Saksena, G.D.

1982-01-01

Isotope shift ΔT (156-160) have been evaluated for 52 odd and 90 even energy levels of the neutral gadolinium atom from the measurements carried out on 166 lines of the first spectrum in the region 4535 to 4975 A on a photoelectric recording Fabry-Perot Spectrometer and enriched samples of 156 Gd and 160 Gd. Earlier studies provide data for just two lines in this region. Assignment of electronic configurations to some of the energy levels have been either confirmed or revised; some unassigned levels have been assigned probable configurations. The present study provides, for the first time, isotope shift of the two levels of 4f 7 6s 2 7s configuration of Gd I. (author)

Nuclear gamma ray lines from supernovae

International Nuclear Information System (INIS)

Jardim, J.O.D.

1980-01-01

From theoretical considerations of the behaviour of gamma ray line fluxes occurring after a supernova explosion, the 1.156 and 0.847 MeV lines are seen to be the most likely to be observed. The 1.156 MeV line has been previously observed by other investigators. Observations of the 0.847 MeV line, and 1.332, 1.173 and 0.059 MeV lines using a Ge(Li) telescope aboard a stratospheric balloon which was flown in Brazil in 1977 are reported. The observation using a NaI(Tl) detector of a line in the energy interval 1.5 - 1.6 MeV, which may be due to 0 18 (p,p') 0 18 sup (*) reaction is also reported. (Author) [pt

Deset let zákona o veřejných výzkumných institucích

Czech Academy of Sciences Publication Activity Database

Bárta, Jan

2017-01-01

Roč. 156, č. 10 (2017), s. 915-927 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : semi-budgeted organization * public research institutions Subject RIV: AG - Legal Sciences OBOR OECD: Law

Gene : CBRC-EEUR-01-0576 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1e-156 87% ref|XP_548629.2| PREDICTED: similar to Olfactory receptor 4Q3 (Olfactory receptor OR14-3) [Canis ...familiaris] 1e-162 88% MEETSQESLVSLALVKKENDSKVVDFVLLGLSSSWELQLFLFLLFLLFYLTIVLGNLLIVVTVRADAHLLQSPMYYFLGHLSFID

Annual Report

Czech Academy of Sciences Publication Activity Database

Nedoma, Jiří (ed.)

2008-01-01

Roč. 2007, č. 48 (2008), s. 1-56 ISSN 1210-9649 Institutional research plan: CEZ:AV0Z60170517 Keywords : reservoir limnology * water microbiology * hydrochemistry Subject RIV: DA - Hydrology ; Limnology

Phototoxic potential of silymarin and its bioactive components

Czech Academy of Sciences Publication Activity Database

Svobodová-Rajnochová, A.; Zálešák, B.; Biedermann, David; Ulrichová, J.; Vostálová, J.

2016-01-01

Roč. 156, MAR 2016 (2016), s. 61-68 ISSN 1011-1344 Institutional support: RVO:61388971 Keywords : Flavonolignans * Phototoxicity * 313 NRU Subject RIV: CE - Biochemistry Impact factor: 2.673, year: 2016

Panská sněmovna jako možné východisko pro debatu o budoucnosti Senátu?

Czech Academy of Sciences Publication Activity Database

Malíř, Jan

2017-01-01

Roč. 156, č. 12 (2017), s. 1124-1152 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : bicameralism * The 1867 December Constitution * Herrenhaus Subject RIV: AG - Legal Sciences OBOR OECD: Law

Eesti Suusapäevad Jay Peak´is / Peeter Teedla ; fotod: Peeter Teedla

Index Scriptorium Estoniae

Teedla, Peeter

2006-01-01

märtsikuu esimesel nädalalõpul idaranniku eestlaste suusapäevad, osavõtjaid 156, paljud perekondade ja väikeste lastega, organiseerijaks Kristin Raamot. Peeti murdmaasuusatamise - ja slaalomivõistlused

78 FR 57843 - First Responder Network Authority Board Meeting

Science.gov (United States)

2013-09-20

... and Job Creation Act of 2012 (Act), Public Law 112-96, 126 Stat. 156 (2012), created the First.... Individuals requiring accommodations, such as sign language interpretation or other ancillary aids, are asked...

76 FR 72699 - KC Hydro LLC of New Hampshire; Notice of Preliminary Permit Application Accepted for Filing and...

Science.gov (United States)

2011-11-25

.... The proposed project would consist of: (1) The existing 156-foot- long, 19-foot-high Milton stone.... Although the Commission strongly encourages electronic filing, documents may also be paper-filed. To paper...

40 CFR 471.34 - Pretreatment standards for existing sources (PSES).

Science.gov (United States)

2010-07-01

... 156 69.2 (q) Annealing and solution heat treatment contact cooling water—Subpart C—PSES. There shall be no allowance for the discharge of wastewater pollutants. (r) Wet air pollution control scrubber...

Tvarožná (okr. Brno-venkov). "Za školou", Tvarožná X. Bohunicien. Sídliště. Záchranný výzkum

Czech Academy of Sciences Publication Activity Database

Škrdla, Petr; Tostevin, G.; Monnier, G.

2016-01-01

Roč. 57, č. 1 (2016), s. 156-157 ISSN 1211-7250 Grant - others:NSF(US) BCS-1354095 Institutional support: RVO:68081758 Keywords : Moravia * Bohunician * archaeology Subject RIV: AC - Archeology, Anthropology, Ethnology

Engineering Tocopherol Selectivity in α-TTP: A Combined In Vitro/In Silico Study

Science.gov (United States)

Helbling, Rachel E.; Aeschimann, Walter; Simona, Fabio; Stocker, Achim; Cascella, Michele

2012-01-01

We present a combined in vitro/in silico study to determine the molecular origin of the selectivity of -tocopherol transfer protein (-TTP) towards -tocopherol. Molecular dynamics simulations combined to free energy perturbation calculations predict a binding free energy for -tocopherol to -TTP 8.262.13 kcal mol lower than that of -tocopherol. Our calculations show that -tocopherol binds to -TTP in a significantly distorted geometry as compared to that of the natural ligand. Variations in the hydration of the binding pocket and in the protein structure are found as well. We propose a mutation, A156L, which significantly modifies the selectivity properties of -TTP towards the two tocopherols. In particular, our simulations predict that A156L binds preferentially to -tocopherol, with striking structural similarities to the wild-type--tocopherol complex. The affinity properties are confirmed by differential scanning fluorimetry as well as in vitro competitive binding assays. Our data indicate that residue A156 is at a critical position for determination of the selectivity of -TTP. The engineering of TTP mutants with modulating binding properties can have potential impact at industrial level for easier purification of single tocopherols from vitamin E mixtures coming from natural oils or synthetic processes. Moreover, the identification of a -tocopherol selective TTP offers the possibility to challenge the hypotheses for the evolutionary development of a mechanism for -tocopherol selection in omnivorous animals. PMID:23152872

Chemical Composition and Antibacterial Activity of the Essential Oil of Vitex agnus-castus L. (Lamiaceae).

Science.gov (United States)

Gonçalves, Regiane; Ayres, Vanessa F S; Carvalho, Carlos E; Souza, Maria G M; Guimarães, Anderson C; Corrêa, Geone M; Martins, Carlos H G; Takeara, Renata; Silva, Eliane O; Crotti, Antônio E M

2017-01-01

Abnormal multiplication of oral bacteria causes dental caries and dental plaque. These diseases continue to be major public health concerns worldwide, mainly in developing countries. In this study, the chemical composition and antimicrobial activity of the essential oil of Vitex agnus-castus leaves (VAC‒EO) collected in the North of Brazil against a representative panel of cariogenic bacteria were investigated. The antimicrobial activity of VAC-EO was evaluated in terms of its minimum inhibitory concentration (MIC) values by using the broth microdilution method in 96-well microplates. The chemical constituents of VAC-EO were identified by gas chromatography (GC‒FID) and gas chromatography‒mass spectrometry (GC‒MS). VAC‒EO displayed some activity against all the investigated oral pathogens; MIC values ranged from 15.6 to 200 μg/mL. VAC-EO had promising activity against Streptococcus mutans (MIC= 15.6 μg/mL), Lactobacillus casei (MIC= 15.6 μg/mL), and Streptococcus mitis (MIC= 31.2 μg/mL). The compounds 1,8-cineole (23.8%), (E)-β-farnesene (14.6%), (E)-caryophyllene (12.5%), sabinene (11.4%), and α-terpinyl acetate (7.7%) were the major chemical constituents of VAC‒EO. VAC-EO displays antimicrobial activity against cariogenic bacteria. The efficacy of VAC-EO against S. mutans is noteworthy and should be further investigated.

Chemical Composition and Antibacterial Activity of the Essential Oil of Vitex agnus-castus L. (Lamiaceae

Directory of Open Access Journals (Sweden)

REGIANE GONÇALVES

Full Text Available ABSTRACT Abnormal multiplication of oral bacteria causes dental caries and dental plaque. These diseases continue to be major public health concerns worldwide, mainly in developing countries. In this study, the chemical composition and antimicrobial activity of the essential oil of Vitex agnus-castus leaves (VAC‒EO collected in the North of Brazil against a representative panel of cariogenic bacteria were investigated. The antimicrobial activity of VAC-EO was evaluated in terms of its minimum inhibitory concentration (MIC values by using the broth microdilution method in 96-well microplates. The chemical constituents of VAC-EO were identified by gas chromatography (GC‒FID and gas chromatography‒mass spectrometry (GC‒MS. VAC‒EO displayed some activity against all the investigated oral pathogens; MIC values ranged from 15.6 to 200 μg/mL. VAC-EO had promising activity against Streptococcus mutans (MIC= 15.6 μg/mL, Lactobacillus casei (MIC= 15.6 μg/mL, and Streptococcus mitis (MIC= 31.2 μg/mL. The compounds 1,8-cineole (23.8%, (E-β-farnesene (14.6%, (E-caryophyllene (12.5%, sabinene (11.4%, and α-terpinyl acetate (7.7% were the major chemical constituents of VAC‒EO. VAC-EO displays antimicrobial activity against cariogenic bacteria. The efficacy of VAC-EO against S. mutans is noteworthy and should be further investigated.

Pleiotropic effects of hemagglutinin amino acid substitutions of H5 influenza escape mutants

International Nuclear Information System (INIS)

Rudneva, Irina A.; Timofeeva, Tatiana A.; Ignatieva, Anna V.; Shilov, Aleksandr A.; Krylov, Petr S.; Ilyushina, Natalia A.; Kaverin, Nikolai V.

2013-01-01

In the present study we assessed pleiotropic characteristics of the antibody-selected mutations. We examined pH optimum of fusion, temperatures of HA heat inactivation, and in vitro and in vivo replication kinetics of the previously obtained influenza H5 escape mutants. Our results showed that HA1 N142K mutation significantly lowered the pH of fusion optimum. Mutations of the escape mutants located in the HA lateral loop significantly affected H5 HA thermostability (P<0.05). HA changes at positions 131, 144, 145, and 156 and substitutions at positions 131, 142, 145, and 156 affected the replicative ability of H5 escape mutants in vitro and in vivo, respectively. Overall, a co-variation between antigenic specificity and different HA phenotypic properties has been demonstrated. We believe that the monitoring of pleiotropic effects of the HA mutations found in H5 escape mutants is essential for accurate prediction of mutants with pandemic potential. - Highlights: • HA1 N142K mutation significantly lowered the pH of fusion optimum. • Mutations located in the HA lateral loop significantly affected H5 HA thermostability. • HA changes at positions 131, 142, 144, 145, and 156 affected the replicative ability of H5 mutants. • Acquisition of glycosylation site could lead to the emergence of multiple pleiotropic effects

A Review on Catalytic Membranes Production and Applications

Directory of Open Access Journals (Sweden)

Heba Abdallah

2017-05-01

Full Text Available The development of the chemical industry regarding reducing the production cost and obtaining a high-quality product with low environmental impact became the essential requirements of the world in these days. The catalytic membrane is considered as one of the new alternative solutions of catalysts problems in the industries, where the reaction and separation can be amalgamated in one unit. The catalytic membrane has numerous advantages such as breaking the thermodynamic equilibrium limitation, increasing conversion rate, reducing the recycle and separation costs. But the limitation or most disadvantages of catalytic membranes related to the high capital costs for fabrication or the fact that manufacturing process is still under development. This review article summarizes the most recent advances and research activities related to preparation, characterization, and applications of catalytic membranes. In this article, various types of catalytic membranes are displayed with different applications and explained the positive impacts of using catalytic membranes in various reactions. Copyright © 2017 BCREC Group. All rights reserved. Received: 1st April 2016; Revised: 14th February 2017; Accepted: 22nd February 2017 How to Cite: Abdallah, H. (2017. A Review on Catalytic Membranes Production and Applications. Bulletin of Chemical Reaction Engineering & Catalysis, 12 (2: 136-156 (doi:10.9767/bcrec.12.2.462.136-156 Permalink/DOI: http://dx.doi.org/10.9767/bcrec.12.2.462.136-156

Pleiotropic effects of hemagglutinin amino acid substitutions of H5 influenza escape mutants

Energy Technology Data Exchange (ETDEWEB)

Rudneva, Irina A.; Timofeeva, Tatiana A.; Ignatieva, Anna V.; Shilov, Aleksandr A.; Krylov, Petr S. [D.I. Ivanovsky Institute of Virology, 123098 Moscow (Russian Federation); Ilyushina, Natalia A., E-mail: Natalia.Ilyushina@fda.hhs.gov [FDA CDER, 29 Lincoln Drive, Bethesda, MD 20892 (United States); Kaverin, Nikolai V., E-mail: nik.kaverin@gmail.com [D.I. Ivanovsky Institute of Virology, 123098 Moscow (Russian Federation)

2013-12-15

In the present study we assessed pleiotropic characteristics of the antibody-selected mutations. We examined pH optimum of fusion, temperatures of HA heat inactivation, and in vitro and in vivo replication kinetics of the previously obtained influenza H5 escape mutants. Our results showed that HA1 N142K mutation significantly lowered the pH of fusion optimum. Mutations of the escape mutants located in the HA lateral loop significantly affected H5 HA thermostability (P<0.05). HA changes at positions 131, 144, 145, and 156 and substitutions at positions 131, 142, 145, and 156 affected the replicative ability of H5 escape mutants in vitro and in vivo, respectively. Overall, a co-variation between antigenic specificity and different HA phenotypic properties has been demonstrated. We believe that the monitoring of pleiotropic effects of the HA mutations found in H5 escape mutants is essential for accurate prediction of mutants with pandemic potential. - Highlights: • HA1 N142K mutation significantly lowered the pH of fusion optimum. • Mutations located in the HA lateral loop significantly affected H5 HA thermostability. • HA changes at positions 131, 142, 144, 145, and 156 affected the replicative ability of H5 mutants. • Acquisition of glycosylation site could lead to the emergence of multiple pleiotropic effects.

Problems sleeping during pregnancy

Science.gov (United States)

... T, Dement WC, eds. Principles and Practice of Sleep Medicine . 6th ed. Philadelphia, PA: Elsevier; 2017:chap 156. Ibrahim S, Foldvary-Shaefer N. Sleep disorders in pregnancy: implications, evaluation, and treatment. Neurologic ...

76 FR 19468 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

Science.gov (United States)

2011-04-07

... Services and Kelly Services. 75,274 Abbott Laboratories, Abbott Park, IL....... February 14, 2010... Moines, IA........ January 28, 2010. Inc., D/B/A UPS; Des Moines Billing Site. 75,156 Abbott Point of...

77 FR 26358 - Petition for Waiver of Compliance

Science.gov (United States)

2012-05-03

... Aberdeen Subdivision (between Raleigh and Hamlet, NC) from Southern Junction (Milepost (MP) South 156.8) to Marston (MP South 241.6), and on the Wilmington Subdivision (between Hamlet and Wilmington, NC) from NE...

Acquired changes in stomatal characteristics in response to ozone during plant growth and leaf development of bush beans (Phaseolus vulgaris L.) indicate phenotypic plasticity

International Nuclear Information System (INIS)

Elagoez, Vahram; Han, Susan S.; Manning, William J.

2006-01-01

Bush bean (Phaseolus vulgaris L.) lines 'S156' (O 3 -sensitive)/'R123' (O 3 -tolerant) and cultivars 'BBL 290' (O 3 -sensitive)/'BBL 274' (O 3 -tolerant) were used to study the effects of O 3 on stomatal conductance (g s ), density, and aperture size on leaf and pod surfaces with the objective of establishing links between the degree of plant sensitivity to O 3 and plasticity of stomatal properties in response to O 3 . Studies in open-top chambers (OTCs) and in continuously stirred tank reactors (CSTRs) established a clear relationship between plant developmental stages, degrees of O 3 sensitivity and g s : while 'S156' had higher g s rates than 'R123' earlier in development, similar differences between 'BBL 290' and 'BBL 274' were observed at later stages. G s rates on the abaxial leaf surfaces of 'S156' and 'BBL 290', accompanied by low leaf temperatures, were significantly higher than their O 3 -tolerant counterparts. Exposure to O 3 in CSTRs had greater and more consistent impacts on both stomatal densities and aperture sizes of O 3 -sensitive cultivars. Stomatal densities were highest on the abaxial leaf surfaces of 'S156' and 'BBL 290' at higher O 3 concentrations (60 ppb), but the largest aperture sizes were recorded on the adaxial leaf surfaces at moderate O 3 concentrations (30 ppb). Exposure to O 3 eliminated aperture size differences on the adaxial leaf surfaces between sensitive and tolerant cultivars. Regardless of sensitivity to O 3 and treatment regimes, the smallest aperture sizes and highest stomatal densities were found on the abaxial leaf surface. Our studies showed that O 3 has the potential to affect stomatal plasticity and confirmed the presence of different control mechanisms for stomatal development on each leaf surface. This appeared to be more evident in O 3 -sensitive cultivars. - O 3 has the potential to affect stomatal development and the presence of different control mechanisms on each leaf surface is confirmed

Onset of efficacy and tolerability following the initiation dosing of long-acting paliperidone palmitate: post-hoc analyses of a randomized, double-blind clinical trial

Directory of Open Access Journals (Sweden)

Fu Dong-Jing

2011-05-01

Full Text Available Abstract Background Paliperidone palmitate is a long-acting injectable atypical antipsychotic for the acute and maintenance treatment of adults with schizophrenia. The recommended initiation dosing regimen is 234 mg on Day 1 and 156 mg on Day 8 via intramuscular (deltoid injection; followed by 39 to 234 mg once-monthly thereafter (deltoid or gluteal. These post-hoc analyses addressed two commonly encountered clinical issues regarding the initiation dosing: the time to onset of efficacy and the associated tolerability. Methods In a 13-week double-blind trial, 652 subjects with schizophrenia were randomized to paliperidone palmitate 39, 156, or 234 mg (corresponding to 25, 100, or 150 mg equivalents of paliperidone, respectively or placebo (NCT#00590577. Subjects randomized to paliperidone palmitate received 234 mg on Day 1, followed by their randomized fixed dose on Day 8, and monthly thereafter, with no oral antipsychotic supplementation. The onset of efficacy was defined as the first timepoint where the paliperidone palmitate group showed significant improvement in the Positive and Negative Syndrome Scale (PANSS score compared to placebo (Analysis of Covariance [ANCOVA] models and Last Observation Carried Forward [LOCF] methodology without adjusting for multiplicity using data from the Days 4, 8, 22, and 36 assessments. Adverse event (AE rates and relative risks (RR with 95% confidence intervals (CI versus placebo were determined. Results Paliperidone palmitate 234 mg on Day 1 was associated with greater improvement than placebo on Least Squares (LS mean PANSS total score at Day 8 (p = 0.037. After the Day 8 injection of 156 mg, there was continued PANSS improvement at Day 22 (p ≤ 0.007 vs. placebo and Day 36 (p Conclusions Significantly greater symptom improvement was observed by Day 8 with paliperidone palmitate (234 mg on Day 1 compared to placebo; this effect was maintained after the 156 mg Day 8 injection, with a trend towards a dose

1276-IJBCS-Article-Gbonjubola Oluseson A

African Journals Online (AJOL)

hp

The Minimum Inhibitory Concentration (MIC) of the preservatives against the test bacteria ranged between 0.156 ... foods to prevent growth of bacteria, yeast or other microorganisms ... Benzoic acid would uncouple substrate transport and ...

78 FR 45072 - Radiolocation Operations in the 78-81 GHz Bands; Request by the Trex Enterprises Corporation for...

Science.gov (United States)

2013-07-26

... antennas, cable television equipment, GPS equipment, pagers, cellular phones, mobile communications... Job Creation Act of 2012, Pub. L. 112-96, 126 Stat. 156. 0 4. Section 90.103(b) is amended by adding a...

40 CFR 471.35 - Pretreatment standards for new sources (PSNS).

Science.gov (United States)

2010-07-01

... metal powder atomized Chromium 0.970 0.393 Nickel 1.44 0.970 Fluoride 156 69.2 (q) Annealing and... of process wastewater pollutant. (r) Wet Air Pollution Control Scrubber Blowdown. Subpart C—PSNS...

Comparison of Protein Fractions in Seminal Plasma from Multiple Sperm Collections in Sterlet (Acipenser ruthenus)

Czech Academy of Sciences Publication Activity Database

Shaliutina, A.; Hulák, M.; Li, P.; Šulc, Miroslav; Dzyuba, B.; Linhart, O.

2013-01-01

Roč. 48, č. 1 (2013), s. 156-159 ISSN 0936-6768 Institutional support: RVO:61388971 Keywords : TROUT ONCORHYNCHUS - MYKISS * SEMEN CHARACTERISTICS * SPERMATOZOA Subject RIV: EE - Microbiology, Virology Impact factor: 1.177, year: 2013

Secondhand Smoke

Science.gov (United States)

... Exposure is High in Multiunit Housing Smokeless Products Electronic Cigarettes Youth Tobacco Prevention Tobacco Products Tobacco Ingredient ... smoke from burning tobacco products, such as cigarettes, cigars, or pipes. 1,5,6 Secondhand smoke also ...

76 FR 12984 - Privacy Act of 1974; Notice of a Computer Matching Program Between HUD and the United States...

Science.gov (United States)

2011-03-09

... Center, U.S. Department of Veteran Affairs, Bishop Henry Whipple Federal Building, Room 156E, 1 Federal... recipient for VA's data. Notice Procedures: HUD and VA will notify individuals at the time of application...

Household and context determinants of child labor in 156 districts of 11 developing countries

NARCIS (Netherlands)

Webbink, E.; Smits, J.P.J.M.; Jong, E. de

2008-01-01

We study household and context determinants of child labor for 150,000 children in 11 developing countries, with child labor rates ranging from 2 to over 20 percent. Multilevel analysis showed socio-economic factors to be still major determinants of child labor, with less child labor in households

SU-F-J-156: The Feasibility of MR-Only IMRT Planning for Prostate Anatomy

Energy Technology Data Exchange (ETDEWEB)

Vaitheeswaran, R; Sivaramakrishnan, KR; Kumar, Prashant; Gattamaneni, Raja; Kumar, Girish [Philips India Limited, Bangalore, Karnataka (India)

2016-06-15

Purpose: For prostate anatomy, previous investigations have shown that simulated CT (sCT) generated from MR images can be used for accurate dose computation. In this study, we demonstrate the feasibility of MR-only IMRT planning for prostate case. Methods: Regular CT (rCT) and MR images of the same patient were acquired for prostate anatomy. Regions-of-interest (ROIs) i.e. target and risk structures are delineated on the rCT. A simulated CT (sCT) is generated from the MR image using the method described by Schadewaldt N et al. Their work establishes the clinical acceptability of dose calculation results on the sCT when compared to rCT. rCT and sCT are rigidly registered to ensure proper alignment between the two images. rCT and sCT are overlaid on each other and slice-wise visual inspection confirms excellent agreement between the two images. ROIs on the rCT are copied over to sCT. Philips AutoPlanning solution is used for generating treatment plans. The same treatment technique protocol (plan parameters and clinical goals) is used to generate AutoPlan-rCT and AutoPlan-sCT respectively for rCT and and sCT. DVH comparison on ROIs and slice-wise evaluation of dose is performed between AutoPlan-rCT and AutoPlan-sCT. Delivery parameters i.e. beam and corresponding segments from the AutoPlan-sCT are copied over to rCT and dose is computed to get AutoPlan-sCT-on-rCT. Results: Plan evaluation is done based on Dose Volume Histogram (DVH) of ROIs and manual slice-wise inspection of dose distribution. Both AutoPlan-rCT and AutoPlan-sCT provide a clinically acceptable plan. Also, AutoPlan-sCT-on-rCT shows excellent agreement with AutoPlan-sCT. Conclusion: The study demonstrates that it is feasible to do IMRT planning on the simulated CT image obtained from MR image for prostate anatomy. The research is supported by Philips India Ltd.

FCJ-156 Hacking the Social: Internet Memes, Identity Antagonism, and the Logic of Lulz.

Directory of Open Access Journals (Sweden)

Ryan M. Milner

2013-12-01

Full Text Available 4chan and reddit are participatory media collectives undergirded by a “logic of lulz” that favours distanced irony and critique. It often works at the expense of core identity categories like race and gender. However, the logic need not be entirely counterproductive to public discourse. Provided that diverse identities find voice instead of exclusion, these sites may facilitate vibrant, agonistic discussion instead of disenfranchising antagonism. In order to assess this potential for productive agonism, I undertook a critical discourse analysis of these collectives. Emphasising the image memes they produce, I evaluated discourses on race and gender. Both race and gender representations were dominated by familiar stereotypes and partial representations. However, while dissenting perspectives on race were repressed or excluded, dissenting perspectives on gender were vocalised and contested. The ‘logic of lulz’ facilitated both dominance and counter, each articulated with heavy reliance on irony and critique. This logic ambiguously balanced agonism and antagonism, but contestation provided sharper engagement than repression.

78 FR 29613 - Modification and Revocation of Air Traffic Service Routes; Jackson, MS

Science.gov (United States)

2013-05-21

... structure as required to preserve the safe and efficient flow of air traffic. Environmental Review The FAA... Guthrie 156[deg] and Millsap, TX, 274[deg] radials; Millsap; Glen Rose, TX; Cedar Creek, TX; Quitman, TX...

Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from Hakuho Maru from 1992-11-29 to 1992-12-26 (NODC Accession 9500072)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Conductivity, Temperature and Depth (CTD) datasets were obtained from the tropical Pacific (equator, 156E) at 3 or 6 hours intervals over period spanning from...

Spirituality - the Story of a concept in the psychology of religion

Czech Academy of Sciences Publication Activity Database

Říčan, Pavel

2004-01-01

Roč. 26, - (2004), s. 135-156 ISSN 0084-6724 R&D Projects: GA AV ČR IAA7025301 Institutional research plan: CEZ:AV0Z7025918 Keywords : Spirituality * religiousness * psychology Subject RIV: AN - Psychology

Peptidases of pinworms Syphacia muris and Passalurus ambiguus

Czech Academy of Sciences Publication Activity Database

Vadlejch, J.; Lytvynets, Andrej; Jankovská, I.; Langrová, I.

2010-01-01

Roč. 126, č. 2 (2010), s. 156-160 ISSN 0014-4894 Institutional research plan: CEZ:AV0Z50110509 Keywords : Peptidases * Pinworms * laboratory animals Subject RIV: EG - Zoology Impact factor: 1.869, year: 2010

Excess Molar Volumes and Excess Molar Enthalpies in Binary Systems N-alkyl-triethylammonium bis(trifluoromethylsulfonyl)imide + Methanol

Czech Academy of Sciences Publication Activity Database

Machanová, Karolina; Troncoso, J.; Jacquemin, J.; Bendová, Magdalena

2014-01-01

Roč. 363, FEB 15 (2014), s. 156-166 ISSN 0378-3812 Institutional support: RVO:67985858 Keywords : ionic liquids * excess properties * binary mixtures Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.200, year: 2014

40 CFR 471.32 - Effluent limitations representing the degree of effluent reduction attainable by the application...

Science.gov (United States)

2010-07-01

... powder atomized Chromium 0.970 0.393 Nickel 1.44 .970 Fluoride 156 69.2 (q) Annealing and solution heat... pollutants. (r) Wet air pollution control scrubber blowdown. Subpart C—BAT Pollutant or pollutant property...

The efficiency of micro-Raman spectroscopy in the analysis of complicated mixtures in modern paints: Munch's and Kupka's paintings under study

Czech Academy of Sciences Publication Activity Database

Košařová, V.; Hradil, David; Hradilová, J.; Čermáková, Zdeňka; Němec, I.; Schreiner, M.

2016-01-01

Roč. 156, MAR (2016), s. 36-46 ISSN 1386-1425 Institutional support: RVO:61388980 Keywords : Micro-Raman spectroscopy * Portable Raman spectrometry * Modern paints Subject RIV: CA - Inorganic Chemistry Impact factor: 2.536, year: 2016

James A. FitzPatrick Nuclear Power Plant. Annual report of operations: January-December 1976

International Nuclear Information System (INIS)

1977-01-01

Net electrical energy generated was 4,156,298 MWH with the generator on line 6,289.1 hrs. Information is presented concerning operating experience, specification changes, maintenance, licensee event reports, fuel performance and data tabulations

Verification of novel magnetic nanoparticles as a contrast media for MRI-CT/SPECT imaging

Czech Academy of Sciences Publication Activity Database

Kostiv, Uliana; Laudová, B.; Lobaz, Volodymyr; Kučka, Jan; Franová, P.; Hrubý, Martin; Horák, Daniel; Šefc, L.

2017-01-01

Roč. 13, č. 1 (2017), s. 156 ISSN 1336-7242. [Zjazd chemikov /69./. 11.09.2017-15.09.2017, Horný Smokovec] Institutional support: RVO:61389013 Keywords : magnetic nanoparticles * diagnostics Subject RIV: CD - Macromolecular Chemistry

Electrochemically self-assembled mesoporous dye-modified zinc oxide thin films

Czech Academy of Sciences Publication Activity Database

Rathouský, Jiří; Loewenstein, T.; Nonomura, K.; Yoshida, T.; Wark, M.; Schlettwein, D.

2005-01-01

Roč. 156, - (2005), s. 315-320 ISSN 0167-2991 Institutional research plan: CEZ:AV0Z40400503 Keywords : adsorption * physical chemistry * film preparation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.307, year: 2005

Pollutant dispersal and stability in a severely polluted floodplain: A case study in the Litavka River, Czech Republic

Czech Academy of Sciences Publication Activity Database

Nováková, Tereza; Kotková, Kristýna; Elznicová, J.; Strnad, L.; Engel, Z.; Matys Grygar, Tomáš

2015-01-01

Roč. 156, SEP (2015), s. 131-144 ISSN 0375-6742 Institutional support: RVO:61388980 Keywords : Anthropogenic alluvium * Fluvial sediments * Heavy metals * Secondary pollution from mining Subject RIV: DD - Geochemistry Impact factor: 2.147, year: 2015

Antibacterial, antifungal and insecticidal activities of some selected ...

African Journals Online (AJOL)

USER

2010-08-02

Aug 2, 2010 ... crude extract with MICs 16, 5.0, 25 and 0.156 μg/ml, respectively. Among the ... Key words: Polygonum persicaria, Rumex hastatus, Rumex dentatus, Rumex nepalensis, Polygonum plebejum, ..... Glossary of Indian Medicinal.

Biophysical approach to low back pain: a pilot report

Czech Academy of Sciences Publication Activity Database

Foletti, A.; Pokorný, Jiří

2015-01-01

Roč. 34, č. 2 (2015), s. 156-159 ISSN 1536-8378 Institutional support: RVO:67985882 Keywords : Bioelectromagnetic medicine * Biophysical therapy * Coherence domains Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.208, year: 2015

75 FR 68738 - Proposed Flood Elevation Determinations

Science.gov (United States)

2010-11-09

... +156 +155 upstream of Taylors Store Road (Secondary Road 1004). Polecat Branch At the confluence with...). Just upstream of U.S. +151 +152 Route 64. Swift Creek Approximately 1.8 miles +90 +88 City of Rocky...

"Růžová zahrádka". Rukopisné modlitební knížky 18. a 19. století. Sbírka Jana Poše. Arcidiecézní muzeum v Olomouci 19. února-3. května 2009.

Czech Academy of Sciences Publication Activity Database

Holubová, Markéta

26 /68/, č. 2 (2009), s. 156-157 ISSN 1211-8117 Institutional research plan: CEZ:AV0Z90580513 Keywords : prayer book * Jan Poš * collection * 18. and 19. century Subject RIV: AC - Archeology, Anthropology, Ethnology

Analysis of PTA hardfacing with CoCrWC and CoCrMoSi alloys

Directory of Open Access Journals (Sweden)

Adriano Scheid

2013-12-01

Full Text Available CoCrWC alloys are widely used to protect components that operate under wear and high temperature environments. Enhanced performance has been achieved with the CoCrMoSi alloys but processing this alloy system is still a challenge due to the presence of the brittle Laves phase, particularly when welding is involved. This work evaluated Plasma Transferred Arc coatings processed with the Co-based alloy CoMoCrSi - Tribaloy T400, reinforced with Laves phase, comparing its weldability to the CoCrWC - Stellite 6, reinforced with carbides. Coatings were also analyzed regarding the response to temperature exposure at 600°C for 7 days and subsequent effect on microstructure and sliding abrasive wear. Coatings characterization was carried out by light and scanning electron microscopy, X-ray diffraction and Vickers hardness. CoCrWC coatings exhibited a Cobalt solid solution dendritic microstructure and a thin interdendritic region with eutectic carbides, while CoCrMoSi deposits exhibit a large lamellar eutectic region of Laves phase and Cobalt solid solution and a small fraction of primary Laves phase. Although phase stability was observed by X-ray diffraction, coarsening of the microstructure occurred for both alloys. CoCrMoSi showed thicker lamellar Laves phase and CoCrWC coarser eutectic carbides. Coatings stability assessed by wear tests revealed that although the wear rate of the as-deposited CoCrMoSi alloy was lower than that of CoCrWC alloy its increase after temperature exposure was more significant, 22% against 15%. Results were discussed regarding the protection of industrial components in particular, bearings in 55AlZn hot dip galvanizing components.

Control rod upper pin and roller removal and replacement

International Nuclear Information System (INIS)

Giordano, B.

1995-01-01

There has been increasing utility interest in removing cobalt sources as a means to minimize dose rates and shipping costs associated with operations, maintenance, shipping and radioactive waste disposal. This activation product accounts for approximately 80% of the dose rates at a plant. Estimates suggest that older (original equipment) control rod blades (CRBs) using stellite rollers and Haynes Alloy 25 pins can contribute as much as 43% of the cobalt in the plant. Since CRBs are the most concentrated source of cobalt in the reactor vessel, pin and roller (P ampersand R) replacement will provide significant reductions in cobalt-60 levels. The reductions will be measurable within 2 years, and should plateau within 5 to 6 years. This paper described a new, simple, cost effective, field proven in-situ method to replace these high source term contributing components and return the CRB to the reactor core for continued service. The paper also briefly describes a methodology that has been developed to estimate the labor and material costs along with a man-rem dollar savings for removal of the upper P ampersand Rs from in-service CRBs purchased prior to 1982. This method permits comparison to the cost of early replacement of CRBs. The result of this study is an EXCEL spreadsheet cost/benefit analysis that can be made plant specific by incorporation of plant data. The Analysis shows that the removal of P ampersand Rs can be beneficial for a Co-60 contribution as low as 5-10%. Recent interest by non-utility radioactive material users in obtaining the removed P ampersand Rs may further increase the benefit and reduce the cost associated with in-situ removal

213 Re-Positioning Nigeria's Radio Broadcast as a Catalyst for ...

African Journals Online (AJOL)

USER

challenge by the Nigeria radio broadcast that needs not waste time to counter the ... revolution in technology has brought radio even closer to Africans than ever before ..... information and better education make people want to change''. (156).

NCBI nr-aa BLAST: CBRC-OSAT-05-0034 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OSAT-05-0034 gb|AAM20520.1| serine/threonine protein kinase isolog [Arabidopsi...s thaliana] gb|AAO30076.1| serine/threonine protein kinase isolog [Arabidopsis thaliana] AAM20520.1 1e-156 49% ...

47 CFR 80.329 - Safety signals and messages.

Science.gov (United States)

2010-10-01

.... It must be sent before the call. (c) In radiotelephony, the safety signal consists of the word... signal and call must be sent on one of the international distress frequencies (2182 kHz or 156.8 MHz...

A review of the distribution of Yellowhammer (Emberiza citrinella) dialects in Europe reveals the lack of a clear macrogeographic pattern

Czech Academy of Sciences Publication Activity Database

Petrusková, T.; Diblíková, L.; Pipek, P.; Frauendorf, E.; Procházka, Petr; Petrusek, A.

2015-01-01

Roč. 156, č. 1 (2015), s. 263-273 ISSN 0021-8375 Institutional support: RVO:68081766 Keywords : Emberiza citrinella * Song variation * Dialect nomenclature * Online sources * Macrogeographic patterns Subject RIV: EG - Zoology Impact factor: 1.419, year: 2015

Honosné udidlo ze Stavenic, okr. Šumperk

Czech Academy of Sciences Publication Activity Database

Profantová, Naďa

2012-01-01

Roč. 64, č. 1 (2012), s. 153-156 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Early Middle Ages * Northern Moravia * equestrian bit * equestrian gear * Hungarians Subject RIV: AC - Archeology, Anthropology, Ethnology

Jan Vetter. Příspěvek k tématu zahraničních učeneckých kontaktů Jednoty bratrské na počátku 17. století

Czech Academy of Sciences Publication Activity Database

Just, Jiří

2014-01-01

Roč. 44, 91/92 (2014), s. 156-204 ISSN 0323-2220 R&D Projects: GA ČR GA13-08740S Institutional support: RVO:67985955 Keywords : Bohemian Brethren * religious education * correspondence networks Subject RIV: AB - History

„Nová“ historická tornáda a tromby v českých zemích

Czech Academy of Sciences Publication Activity Database

Lacinová, M.; Munzar, Jan

2007-01-01

Roč. 60, č. 5 (2007), s. 153-156 ISSN 0026-1173 Institutional research plan: CEZ:AV0Z30860518 Keywords : tornado * funnel cloud/spout * dangerous phenomenon * history of Czech Lands Subject RIV: DG - Athmosphere Sciences, Meteorology

Tumour necrosis factor-alpha increases extravasation of virus particles into tumour tissue by activating the Rho A/Rho kinase pathway

Czech Academy of Sciences Publication Activity Database

Seki, T.; Carroll, F.; Illingworth, S.; Green, N.; Cawood, R.; Bachtarzi, H.; Šubr, Vladimír; Fisher, K. D.; Seymour, L. W.

2011-01-01

Roč. 156, č. 3 (2011), s. 381-389 ISSN 0168-3659 Institutional research plan: CEZ:AV0Z40500505 Keywords : drug delivery * adenovirus * vascular permeability Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.732, year: 2011

Too much diarrhoea, too many infections, and too few neutrophils

African Journals Online (AJOL)

He had oral candidiasis, generalised lymphadenopathy, and ... function was normal (thyroid-stimulating hormone 1.56 mIU/L, T4 ... finding in ill paediatric patients and can be conveniently subdivided into that due to decreased production or.

On the efficiency of the first price auction

Czech Academy of Sciences Publication Activity Database

Hernando-Veciana, Á.; Michelucci, Fabio

2017-01-01

Roč. 156, July (2017), s. 159-161 ISSN 0165-1765 Institutional support: Progres-Q24 Keywords : efficiency * first price auction * english auction Subject RIV: AH - Economics OBOR OECD: Economic Theory Impact factor: 0.558, year: 2016

STR data for the AmpFlSTR Profiler loci from the three main ethnic population groups (Malay, Chinese and Indian) in Malaysia.

Science.gov (United States)

Lim, K B; Jeevan, N H; Jaya, P; Othman, M I; Lee, Y H

2001-06-01

Allele frequencies for the nine STRs genetic loci included in the AmpFlSTR Profiler kit were obtained from samples of unrelated individuals comprising 139-156 Malays, 149-153 Chinese and 132-135 Indians, residing in Malaysia.

The microbiology of Lascaux Cave

Czech Academy of Sciences Publication Activity Database

Bastian, F.; Jurado, V.; Nováková, Alena; Alabouvette, C.; Saiz-Jimenez, C.

2010-01-01

Roč. 156, č. 3 (2010), s. 644-652 ISSN 1350-0872 Institutional research plan: CEZ:AV0Z60660521 Keywords : Lascaux Cave * microbiology * Paleolithic paintings Subject RIV: EH - Ecology, Behaviour Impact factor: 2.957, year: 2010

Why Are Drugs So Hard to Quit?

Medline Plus

Full Text Available ... has been rented. This feature is not available right now. Please try again later. Published on Feb ... Dr. Jones Discusses Program Success with Opioid Dependent Women - Duration: 1:56. National Institute on Drug Abuse ( ...

Phylogeography and Pleistocene refugia of the Little Owl Athene noctua inferred from mtDNA sequence data

Czech Academy of Sciences Publication Activity Database

Pellegrino, I.; Negri, A.; Cucco, M.; Mucci, N.; Pavia, M.; Šálek, Martin; Boano, G.; Randi, E.

2014-01-01

Roč. 156, č. 3 (2014), s. 639-657 ISSN 0019-1019 Institutional support: RVO:68081766 Keywords : central western Europe * control region * cytochrome c oxidase * postglacial expansion Subject RIV: EG - Zoology Impact factor: 1.921, year: 2014

Estimation of best parents parents and superior cross combinations for yield and fiber quality related traits in upland cotton (gossypium hirsutum L.)

International Nuclear Information System (INIS)

Shaukat, S.; Khan, T.M.; Ijaz, S.

2013-01-01

Combining ability was studied for identification of potential cultivars and hybrids in upland cotton (Gossypium hirsutum L.) in a 6x6 set of diallel crosses among six genotypes of cotton, i.e., VH-232, CRS-2007, SB-149, GR-156, FH-207, and MARVI carried out on fiber length, fiber fineness, fiber elongation, fiber strength, ginning out tern (GOT) and seed cotton yield. Analysis of variance revealed highly significant (p < 0.01) differences among the genotypes for all traits. Combining ability studies showed that the mean squares, due to general combining ability (GCA), specific combining ability (SCA) and reciprocal effects were highly significant in F1 generation. Genetic components, due to GCA and SCA, revealed that traits, such as, fiber length, strength and fineness, showed high proportion of additive type of gene action in F1 generation because of greater GCA variances were greater than SCA variance. GR-156 was the best combiner for lint percentage and fiber length. FH-207 was the best combiner for fiber fineness. FH-207, MARVI and SB-149 were the best general combiners for fiber character and were suggested to be used in future breeding programme to improve fiber quality traits. CRS-2007 x GR-156, CRS-2007 x MARVI, SB-149 x MARVI and VH-232 x SB-149 had higher specific combining ability and reciprocal effects and they can be used for future breeding programme to improve fiber quality. (author)

The role of fetal adrenal hormones in the switch from fetal to adult globin synthesis in the sheep.

Science.gov (United States)

Wintour, E M; Smith, M B; Bell, R J; McDougall, J G; Cauchi, M N

1985-01-01

The switch from gamma (fetal) to beta (adult) globin production was studied by the analysis of globin synthesis in chronically cannulated ovine fetuses and newborn lambs. The gamma/alpha globin synthesis ratio decreased from 0.98 +/- 0.11 (S.D.) (n = 4 samples) at 100-120 days of gestation to 0.15 +/- 0.07 (n = 4) in lambs of 150-156 days post-conception, and the beta/alpha synthesis ratio increased from 0.04 +/- 0.06 (n = 4) to 1.13 +/- 0.21 (n = 4) over the same period. In bilaterally adrenalectomized fetuses, which survived in utero until 151-156 days, the gamma/alpha and beta/alpha synthesis ratios were 0.64 +/- 0.14 (n = 3) and 0.25 +/- 0.07 (n = 3) respectively in the 150- to 156-day period. Bilateral adrenalectomy did not affect the time of onset of beta globin synthesis, but significantly decreased the rate. In one bilaterally adrenalectomized fetus the infusion of increasing concentrations of cortisol restored the rate of beta globin synthesis to normal. Treatment of three intact fetuses with 100 micrograms cortisol/h for 3 weeks, from 100 to 121 days, did not affect the timing or rate of switch from gamma to beta globin synthesis. Thus fetal adrenal secretions, probably cortisol, affected the rate of change of gamma to beta globin synthesis but other factors must have been involved in the initiation of the switch.

Global gene expression profiling related to temperature-sensitive growth abnormalities in interspecific crosses between tetraploid wheat and Aegilops tauschii.

Directory of Open Access Journals (Sweden)

Ryusuke Matsuda

Full Text Available Triploid wheat hybrids between tetraploid wheat and Aegilops tauschii sometimes show abnormal growth phenotypes, and the growth abnormalities inhibit generation of wheat synthetic hexaploids. In type II necrosis, one of the growth abnormalities, necrotic cell death accompanied by marked growth repression occurs only under low temperature conditions. At normal temperature, the type II necrosis lines show grass-clump dwarfism with no necrotic symptoms, excess tillers, severe dwarfism and delayed flowering. Here, we report comparative expression analyses to elucidate the molecular mechanisms of the temperature-dependent phenotypic plasticity in the triploid wheat hybrids. We compared gene and small RNA expression profiles in crown tissues to characterize the temperature-dependent phenotypic plasticity. No up-regulation of defense-related genes was observed under the normal temperature, and down-regulation of wheat APETALA1-like MADS-box genes, considered to act as flowering promoters, was found in the grass-clump dwarf lines. Some microRNAs, including miR156, were up-regulated, whereas the levels of transcripts of the miR156 target genes SPLs, known to inhibit tiller and branch number, were reduced in crown tissues of the grass-clump dwarf lines at the normal temperature. Unusual expression of the miR156/SPLs module could explain the grass-clump dwarf phenotype. Dramatic alteration of gene expression profiles, including miRNA levels, in crown tissues is associated with the temperature-dependent phenotypic plasticity in type II necrosis/grass-clump dwarf wheat hybrids.

Complete genome sequences of blueberry red ringspot virus (Caulimoviridae) isolates from the Czech Republic and Slovenia

Czech Academy of Sciences Publication Activity Database

Petrzik, Karel; Přibylová, Jaroslava; Mavrič-Pleško, I.; Špak, Josef

2011-01-01

Roč. 156, č. 10 (2011), s. 1901-1903 ISSN 0304-8608 Institutional research plan: CEZ:AV0Z50510513 Keywords : Complete genome * blueberry virus * highbush blueberry Subject RIV: EE - Microbiology, Virology Impact factor: 2.111, year: 2011

Hyaluronan polymeric micelles for topical drug delivery

Czech Academy of Sciences Publication Activity Database

Šmejkalová, D.; Muthný, T.; Nešporová, K.; Hermannová, M.; Achbergerová, E.; Huerta-Angelesa, G.; Marek Svoboda, M.; Čepa, M.; Machalová, V.; Luptáková, Dominika; Velebný, V.

2017-01-01

Roč. 156, JAN 20 (2017), s. 86-96 ISSN 0144-8617 Institutional support: RVO:61388971 Keywords : Skin penetration * Polymeric micelle * Hyaluronan Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.811, year: 2016

Comparative Discourse Analysis of the Security-Privacy Dilemma: Salience of Security Issues in Printed Media

Czech Academy of Sciences Publication Activity Database

Guasti, Petra; Mansfeldová, Zdenka

2015-01-01

Roč. 30, č. 10 (2015), s. 127-156 ISSN 0254-0223 EU Projects: European Commission(XE) 285223 - SECONOMICS Institutional support: RVO:68378025 Keywords : security * media * stuxnet Subject RIV: AO - Sociology, Demography Impact factor: 0.444, year: 2015

Hole-hole correlation effects on magnetic properties of Mn.sub.x./sub.III.sub.1-x./sub.V diluted magnetic semiconductors

Czech Academy of Sciences Publication Activity Database

Jungwirth, Tomáš; Byounghak, L.; MacDonald, A. H.

2001-01-01

Roč. 10, - (2001), s. 153-156 ISSN 1386-9477 Institutional research plan: CEZ:AV0Z1010914 Keywords : diluted magnetic semiconductors * ferromagnetism * electronic correlation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.009, year: 2001

Novel chemoselective hydrogenation of aromatic nitro compounds over ferric hydroxide supported nanocluster gold in the presence of CO and H2O.

Science.gov (United States)

Liu, Lequan; Qiao, Botao; Chen, Zhengjian; Zhang, Juan; Deng, Youquan

2009-02-14

Chemoselective hydrogenation of aromatic nitro compounds were first efficiently achieved over Au/Fe(OH)(x) at 100-120 degrees C for 1.5-6 h (depending on different substrates) in the presence of CO and H(2)O.

Monetary and Fiscal Policy Interactions in the Euro Area

Science.gov (United States)

2004-03-01

Balassa - Samuelson -Effekt, Nr. 3/2002, erschienen in: Stefan Reitz (Hg.): Theoretische und wirtschaftspolitische Aspekte der internatio- nalen Integration...156, 2000, S. 646-660. Friihere Diskussionsbeitriige zur Finanzwissenschaft Josten, Stefan, Crime, Inequality, and Economic Growth. A Classical Argument

Fucosylated glycans in the periventricular structures and the cerebrospinal fluid of the fetal rat forebrain. An autoradiographic and lectin binding histiotopic study

Czech Academy of Sciences Publication Activity Database

Mareš, Vladislav; Brückner, G.

2001-01-01

Roč. 19, č. 3 (2001), s. 297-303 ISSN 0736-5748 Institutional research plan: CEZ:AV0Z5011922 Keywords : fetal rat brain * fucosylated glycans * cerebrospinal fluid Subject RIV: FH - Neurology Impact factor: 2.156, year: 2001

THE CHRISTIAN CHURCH AND THE QUEST FOR CULTURAL ...

African Journals Online (AJOL)

Ike Odimegwu

religion and value system, and of course, the whole apparatus of. Western culture had ... on through learning and teaching from generation to generation” (p. 156). ..... social solidarity, belief in retribution and reward after death etc. These basic ...

Rudolf Bultmann en Stoïsynse etiek

African Journals Online (AJOL)

15 Jun 2015 ... Hierdie voorlesing ter ere van Rudolf Bultmann se geboorte 130 jaar gelede, op 20 Augustus 1884 ...... 156–203, De Gruyter, Berlin. ... Knowledge' conference, University of Groningen, the Netherlands, 01–14th May. 2014.

Evropské mezinárodní právo soukromé a zamyšlení nad výročím Římských smluv

Czech Academy of Sciences Publication Activity Database

Pauknerová, Monika

2017-01-01

Roč. 156, č. 3 (2017), s. 179-191 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : European private international law * Czech private international law * international unification of private law Subject RIV: AG - Legal Sciences OBOR OECD: Law

Reasoning with Inductive Argument Test: A Study of Validity and Reliability

Directory of Open Access Journals (Sweden)

Mehmet Emrah Karadere

2013-12-01

Conclusion: The preliminary data obtained from the study of reliability and validity of the scale shows that ‘Reasoning with Inductive Argument Test’ supports reliability and validity in Turkish population. [JCBPR 2013; 2(3.000: 156-161

Effects of low-level prenatal γ-ray irradiation on postnatal growth and behavior in mice

International Nuclear Information System (INIS)

Wang Bing; Zhou Xiangyan

1994-01-01

Pregnant adult C57BL/6J mice were randomly allotted to six experimental groups. Doses of 0, 0.106, 0.156, 0.312, 0.518 or 0.656 Gy from 60 Co γ-rays were delivered respectively on the 12.5th day of gestation by single radiation except for group 1 (used as control). Pups were observed for the growth (body weight, BW), the age of acquisition of three reflexes (surface righting, SR, negative geotaxis, NG and grasp reflex, GR), the appearance of three physiologic markers (eye opening, EO, pinna detachment, PD and incisor eruption, IE) and the sensuous functions (visual placing, VP and mother-taxis, MT). And by using these parameters 0.156 to 0.312 Gy irradiation may represent a threshold range for exposure on the 12.5th day of gestation to a single γ-radiation

Black silicon solar cells with black bus-bar strings

DEFF Research Database (Denmark)

Davidsen, Rasmus Schmidt; Tang, Peter Torben; Mizushima, Io

2016-01-01

We present the combination of black silicon texturing and blackened bus-bar strings as a potential method for obtaining all-black solar panels, while using conventional, front-contacted solar cells. Black silicon was realized by maskless reactive ion etching resulting in total, average reflectance...... below 0.5% across a 156x156 mm2 silicon wafer. Four different methods to obtain blackened bus-bar strings were compared with respect to reflectance, and two of these methods (i.e., oxidized copper and etched solder) were used to fabricate functional allblack solar 9-cell panels. The black bus-bars (e.......g., by oxidized copper) have a reflectance below 3% in the entire visible wavelength range. The combination of black silicon cells and blackened bus-bars results in aesthetic, all-black panels based on conventional, front-contacted solar cells without compromising efficiency....

Phenology and floral visitors of Erythrina crista-galli L. (Leguminosae: Faboideae in Santa Maria, Rio Grande do Sul, Brazil

Directory of Open Access Journals (Sweden)

Ana Beatriz Barros de Morais

2008-06-01

Full Text Available Erythrina crista-galli is a characteristic species of the Pampa biome also used as an ornament in urban arborization. Erythrina crista-galli flourishes more intensively from November to Decem¬ber. Anthesis starts around 7:00 am to 11:00 am, and flowers last five days. A total of 1,275 floral visits were registered over 57h of observations. Apidae bees (Trigona spinipes and Apis mellifera were the most frequent visitors (88.23%, followed by Muscidae flies (5.50%, Formicidae ants (2.35%, Vespidae wasps (1.56%, and Chrysomelidae beetles (1.56%. Trochilidae hummingbirds (Chlorostilbon aureoventris (0.79% also visited the flowers. Trigona spinipes was observed at throughout the daytime and behaved as a probable pollinator, along with A. mellifera and C. aureoventris. E. crista-galli is autocompatible, producing fruits and seeds after manual pollination and under natural conditions.

Novel Synthesis of 1,6,7,9-Tetrasubstituted 8-Oxo-1-azaspiro[4.4 ...

African Journals Online (AJOL)

ings concerning a method of producing highly functionalized ... alkenes 3 for the preparation of functionalized cyclopentanones. 4 as shown in Scheme 1.5,6 ... The 1H NMR spectrum obtained for this novel azaspirocycle is shown in Fig. 2,.

Inner structure of intact chloroplasts observed by a low temperature laser scanning microscope

Czech Academy of Sciences Publication Activity Database

Vácha, František; Vácha, M.; Bumba, L.; Hashizume, K.; Tani, T.

2000-01-01

Roč. 38, - (2000), s. 493-496 ISSN 0300-3604 R&D Projects: GA MŠk ME 156; GA MŠk VS96085 Keywords : chloroplasts * physiology * scanning microscopy Subject RIV: EE - Microbiology, Virology Impact factor: 0.482, year: 2000

DECEMBER JMBR 13 - 2 correction.cdr

African Journals Online (AJOL)

Fine Print

Sixty six subjects (9.4%) of the study population had myopia, 35 (5%) had hypermetropia, 156 (22.3%) ... people around the world are visually impaired from uncorrected. 7 ... Hypermetropia (long-sightedness) is when parallel rays of light are ...

Lipid peroxide, glutathione and glutathione-dependent enzyme (GST)

African Journals Online (AJOL)

Jane

2011-08-01

Aug 1, 2011 ... shipbuilding, transport, oil refinery spill, industrial and urban effluents ... toxic effects in marine organisms, especially on zooplankton. ... calculated by using an extinction coefficient of 1.56 × 105 M-1 cm1 and expressed as ...

Self-Calibrating High Resolution Tunable Filter for Remote Gas Sensing Applications, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — We propose to develop a compact, robust, optically-based sensor for local and remote sensing of oxygen (O2) at 1.26 µm, carbon dioxide (CO2) at 1.56 µm and other...

Obhajoba umírněné optimalizace: O struktuře principů jako interpersonálních důvodů

Czech Academy of Sciences Publication Activity Database

Pavlakos, George

2017-01-01

Roč. 156, č. 10 (2017), s. 870-883 ISSN 0231-6625 R&D Projects: GA ČR GA15-23955S Institutional support: RVO:68378122 Keywords : proportionality * optimalization * normative reasons Subject RIV: AG - Legal Sciences OBOR OECD: Law

75 FR 77008 - Notice of Information Collection

Science.gov (United States)

2010-12-10

... efforts to extend the use of information technology to more Government processes via the Internet... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [NOTICE (10-156)] Notice of Information Collection AGENCY: National Aeronautics and Space Administration (NASA). ACTION: Notice of information collection...

NCBI nr-aa BLAST: CBRC-MEUG-01-2581 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MEUG-01-2581 ref|NP_001138703.1| G protein-coupled receptor 81 [Canis lupus fa...miliaris] gb|ACJ03849.1| G-protein coupled receptor 81 [Canis lupus familiaris] NP_001138703.1 1e-156 78% ...

Information and communication technologies in a multi-sector endogenous growth model

Czech Academy of Sciences Publication Activity Database

Vourvachaki, Evangelia

-, č. 386 (2009), s. 1-56 ISSN 1211-3298 Institutional research plan: CEZ:MSM0021620846 Keywords : multi-sector economy * endogenous growth * information and communication technologies Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp386.pdf

Leisure-time physical activity and some psychological parameters ...

African Journals Online (AJOL)

... physical work capacity for the demands of daily living and job performance. ... physical activity and psychological well-being of executive employees; and to ... A cross-sectional study design was carried out on a group of 156 (mean age; ...

Doklad aktivity nizkoteplotních Ca-Na-Cl solanek ve feldspatizovaných granitech živcového ložiska Krásno (masiv Krudum)

Czech Academy of Sciences Publication Activity Database

Dolníček, Z.; René, Miloš

2012-01-01

Roč. 19, 1/2 (2012), s. 153-156 ISSN 1212-6209 R&D Projects: GA ČR GA205/09/0540 Institutional research plan: CEZ:AV0Z30460519 Keywords : granite * alteration * fluorite Subject RIV: DB - Geology ; Mineralogy

Crecimiento y producción de metabolitos de la cianobacteria marina Synechococcus sp. (Chroococcales en función de la irradiancia

Directory of Open Access Journals (Sweden)

Néstor Rosales-Loaiza

2008-06-01

Full Text Available Las cianobacterias de ambientes salinos presentan una versatilidad metabólica inducida por los cambios de salinidad, temperatura e irradiancia, durante los períodos de sequía y lluvias. Por ello es importante la búsqueda en estos ambientes de cianobacterias con potencial biotecnológico para la producción de metabolitos de interés farmacéutico e industrial. Se reporta el crecimiento, masa seca y producción de metabolitos de la cianobacteria Synechococcus sp. MOF-03 en función de la irradiancia (78, 156 y 234 µmol q m-2 s-1. Los cultivos discontinuos por triplicado, fueron mantenidos con aireación constante, fotoperiodo 12:12 h, 30 ±2ºC y a 35‰. Los máximos valores de proteínas, carbohidratos y lípidos de 530.19 ±11.16, 408.94 ±4.27 y 56.20 ±1.17 µg ml-1 respectivamente, fueron obtenidos a 78 µmol q m-2 s-1. Los pigmentos, analizados por HPLC, mostraron los máximos a 78 µmol q m-2 s-1 para clorofila a con 7.72 ±0.16 µg ml-1; y a 234 µmol q m-2 s-1 para ß-caroteno y zeaxantina con 0.70 ±0.01 and 0.67 ±0.05 µg ml-1. La relación clorofila a:ß-caroteno disminuyó de 17.15 hasta 6.91 a 78 y 234 µmol q m-2 s-1; mientras que la relación ß-caroteno:zeaxantina se mantuvo sin cambios entre 78 y 156 µmol q m-2 s-1, con cerca de 1.21 y disminuyó a 234 µmol q m-2 s-1 a 1.04. La cianobacteria produjo la mayor densidad celular y masa seca a 156 µmol q m-2 s-1, con 406.13 ±21.74 x106 cel ml-1 y 1.49 ±0.11 mg ml-1 respectivamente. La producción de exopolisacáridos se mantuvo alrededor de 110 µg ml-1 entre 156 y 234 µmol q m-2 s-1. Así, esta cepa de Synechococcus muestra un gran potencial para la producción de biomasa enriquecida con metabolitos de alto valor comercial.Growth and metabolite production of the marine cyanobacterium Synechococcus sp. (Chroococcales in function to irradiance. Changes in salinity, temperature and irradiance during wet and dry seasons have induced metabolic versatility in cyanobacteria

Seniorita v odměňování - čas pro změnu

Czech Academy of Sciences Publication Activity Database

Štefko, Martin

2017-01-01

Roč. 156, č. 10 (2017), s. 858-869 ISSN 0231-6625 R&D Projects: GA ČR(CZ) GA17-26629S Institutional support: RVO:68378122 Keywords : public wage * age discrimination * seniority Subject RIV: AG - Legal Sciences OBOR OECD: Law

A GEANT4 Monte-Carlo simulation code for precision beta spectroscopy

Czech Academy of Sciences Publication Activity Database

Wauters, F.; Kraev, I.; Zákoucký, Dalibor; Beck, M.; Golovko, V. V.; Kozlov, V. Yu.; Phalet, T.; Tandecki, M.; Traykov, E.; Van Gorp, S.; Severijns, N.

2009-01-01

Roč. 609, 2-3 (2009), s. 156-164 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10480505 Keywords : beta decay * nuclei * electrons Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.317, year: 2009

Occupational risk factors for HIV infection among traditional birth ...

African Journals Online (AJOL)

all of the time when caring for women and babies during labour and delivery. Totals of 156. (42.3%) and 88 ... not efforts to resuscitate the stressed infants. The following ... for the opted test was performed with the University Teaching Hospital.

Standard methods for sampling freshwater fishes: Opportunities for international collaboration

Czech Academy of Sciences Publication Activity Database

Bonar, S. A.; Mercado-Silva, N.; Hubert, W.A.; Beard, T. D.; Dave, G.; Kubečka, Jan; Graeb, B.D.S.; Lester, N.P.; Porath, M.; Winfield, I. J.

2017-01-01

Roč. 42, č. 3 (2017), s. 150-156 ISSN 0363-2415 Institutional support: RVO:60077344 Keywords : European lakes * size structure * conservation * UK Subject RIV: EH - Ecology, Behaviour OBOR OECD: Marine biology, freshwater biology, limnology Impact factor: 3.000, year: 2016

Work together on work or…? An examination of employers’ intention to cooperate with local governments by providing unemployed people with a job

NARCIS (Netherlands)

Oldenhuis, Hilbrand; Polstra, Louis

Waarom willen werkgevers samenwerken met sociale diensten ten behoeve van de arbeidsre-integratie van bijstandsgerechten? Het antwoord heeft implicaties voor het werkgeverscontacten van sociale diensten. Met digitale enquête hebben we gegevens verkregen van 197 kleine, 156 middelgrote en 61 grote

38 CFR 49.46 - Procurement records.

Science.gov (United States)

2010-07-01

..., HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Procurement Standards § 49.46... of competition when competitive bids or offers are not obtained, and (c) Basis for award cost or price. (Authority: Pub. L. 104-156; 110 Stat. 1396) ...

ORF Alignment: NC_003284 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL

Retroaktivita jako diskursivní pojem?

Czech Academy of Sciences Publication Activity Database

Šejvl, Michal

2017-01-01

Roč. 156, č. 1 (2017), s. 37-62 ISSN 0231-6625 R&D Projects: GA ČR GAP408/12/2579 Institutional support: RVO:68378122 Keywords : retroactivity * retrospectivity * legal fiction * legal principle Subject RIV: AG - Legal Sciences OBOR OECD: Law

78 FR 24780 - 60-Day Notice of Proposed Information Collection: Nonimmigrant Treaty Trader/Investor Application

Science.gov (United States)

2013-04-26

...: Nonimmigrant Treaty Trader/Investor Application ACTION: Notice of request for public comment. SUMMARY: The... Information Collection: Nonimmigrant Treaty Trader/Investor Application. OMB Control Number: OMB-1405-0101... Number: DS-156E. Respondents: Nonimmigrant Treaty Trader/Investors. Estimated Number of Respondents: 17...

wild and domesticated mushroom consumption in nigeria abstract

African Journals Online (AJOL)

USER

of awareness, consumption history, wild or ... 15.6% were students and 11.1% business ... 1.1. N/A. 5. 5.6. NA = Not applicable mushrooms for over 10 years; whereas 13.3% ... Consumption history of wild and cultivated mushrooms in Nigeria.

ORF Alignment: NC_002663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

Zákazy niqábu v Egyptě aneb když světský soud interpretuje islámské právo

Czech Academy of Sciences Publication Activity Database

Bezoušková, Lenka

2017-01-01

Roč. 156, č. 6 (2017), s. 523-537 ISSN 0231-6625 R&D Projects: GA ČR GA13-30299S Institutional support: RVO:68378122 Keywords : niqab * Constitutional Court * Egypt * Islamic law Subject RIV: AG - Legal Sciences OBOR OECD: Law

78 FR 66936 - Issuance of Final Guidance Publication

Science.gov (United States)

2013-11-07

... NIOSH-156] Issuance of Final Guidance Publication AGENCY: National Institute for Occupational Safety and... Services (HHS). ACTION: Notice of issuance of final guidance publication. SUMMARY: The National Institute...), announces the availability of the following publication: ``Current Intelligence Bulletin 66--Derivation of...

Temporal behavior of deep-seated gravitational slope deformations: A review

Czech Academy of Sciences Publication Activity Database

Pánek, T.; Klimeš, Jan

2016-01-01

Roč. 156, MAY (2016), s. 14-38 ISSN 0012-8252 Institutional support: RVO:67985891 Keywords : deep-seated gravitational slope deformations * catastrophic slope failures * deformation rates * dating * monitoring Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 7.051, year: 2016

Frequency modulation reveals the phasing of orbital eccentricity during Cretaceous Oceanic Anoxic Event II and the Eocene hyperthermals

Czech Academy of Sciences Publication Activity Database

Laurin, Jiří; Meyers, S. R.; Galeotti, S.; Lanci, L.

2016-01-01

Roč. 442, 15 May (2016), s. 143-156 ISSN 0012-821X R&D Projects: GA MŠk LH12041 Institutional support: RVO:67985530 Keywords : orbital eccentricity * cyclostratigraphy * Cenomanian Subject RIV: DB - Geology ; Mineralogy Impact factor: 4.409, year: 2016

Odpovědnost poskytovatelů hostingových služeb se zřetelem k povaze a druhu přenášeného obsahu

Czech Academy of Sciences Publication Activity Database

Matejka, Ján; Krausová, Alžběta

2017-01-01

Roč. 156, č. 9 (2017), s. 751-769 ISSN 0231-6625 R&D Projects: GA ČR(CZ) GA16-26910S Institutional support: RVO:68378122 Keywords : liability * constructive knowledge * actual knowledge Subject RIV: AG - Legal Sciences OBOR OECD: Law

Produção de beterraba fertilizada com jitirana em diferentes doses e tempos de incorporação ao solo Production of sugar beet fertilized with scarlet starglory at different doses and times of incorporation to soil

Directory of Open Access Journals (Sweden)

Maiele L. da Silva

2011-08-01

Full Text Available Este trabalho foi conduzido no período de julho a novembro de 2009, na Fazenda Experimental Rafael Fernandes, da Universidade Federal Rural do Semi-Árido UFERSA, Brasil, objetivando-se avaliar a produção da beterraba (Beta vulgaris L. fertilizada com jitirana (Merremia aegyptia L. sob diferentes doses e tempos de sua incorporação ao solo. O delineamento experimental adotado foi em blocos completamente casualizados e os tratamentos arranjados em esquema fatorial 4 x 4 + 1 com 3 repetições, com 72 plantas por parcela, sendo o primeiro fator constituído pelas doses de jitirana (5,4; 8,8; 12,2 e 15,6 t ha-1 em base seca, o segundo pelos tempos de sua incorporação ao solo (0, 10, 20 e 30 dias após a semeadura - DAS e o tratamento adicional com adubação de 80 t ha-1 de esterco bovino. A cultivar de beterraba plantada foi a Early Wonder. A melhor performance produtiva da beterraba foi obtida na dose de 15,6 t ha-1 de jitirana incorporada ao solo, no tempo 0 dia. Os indicadores econômicos na dose de 15,6 t ha-1 no tempo de 0 dia foram superiores aos obtidos com o uso de 80 t ha-1 de esterco bovino. O cultivo da beterraba é viável agroeconomicamente com o uso da jitirana como adubo verde.This study was conducted from July to November 2009, at Universidade Federal Rural do Semi-Árido (UFERSA, Mossoró, RN, Brazil, to assess the production of sugar beet (Beta vulgaris L. fertilized with scarlet starglory (Merremia aegyptia L. at different doses and times of soil incorporation. The experimental design was a randomized complete block with treatments arranged in a 4 x 4 + 1 factorial, with three replicates and 72 plants per plot, where the first factor consisted of the doses of scarlet starglory (5.4, 8.8, 12.2 and 15. 6 t ha-1 on dry basis, the second one by the times of soil incorporation (0, 10, 20, and 30 days after sowing - DAS, and additional treatment with 80 t ha-1 of cattle manure. The sugar beet cultivar grown was Early Wonder. The

Time-Motion and Biological Responses in Simulated Mixed Martial Arts Sparring Matches.

Science.gov (United States)

Coswig, Victor S; Ramos, Solange de P; Del Vecchio, Fabrício B

2016-08-01

Coswig, VS, Ramos, SdP, and Del Vecchio, FB. Time-motion and biological responses in simulated mixed martial arts sparring matches. J Strength Cond Res 30(8): 2156-2163, 2016-Simulated matches are a relevant component of training for mixed martial arts (MMA) athletes. This study aimed to characterize time-motion responses and investigate physiological stress and neuromuscular changes related to MMA sparring matches. Thirteen athletes with an average age of 25 ± 5 years, body mass of 81.3 ± 9.5 kg, height of 176.2 ± 5.5 cm, and time of practice in MMA of 39 ± 25 months participated in the study. The fighters executed three 5-minute rounds with 1-minute intervals. Blood and salivary samples were collected and physical tests and psychometric questionnaires administered at 3 time points: before (PRE), immediately after (POST), and 48 hours after the combat (48 h). Statistical analysis applied analysis of variance for repeated measurements. In biochemical analysis, significant changes (p ≤ 0.05) were identified between PRE and POST (glucose: 80.3 ± 12.7 to 156.5 ± 19.1 mg·ml; lactate: 4 ± 1.7 to 15.6 ± 4.8 mmol·dl), POST and 48 hours (glucose: 156.5 ± 19.1 to 87.6 ± 15.5 mg·ml; lactate: 15.6 ± 4.8 to 2.9 ± 3.5 mmol·dl; urea: 44.1 ± 8.9 to 36.3 ± 7.8 mg·ml), and PRE and 48 hours (creatine kinase [CK]: 255.8 ± 137.4 to 395.9 ± 188.7 U/L). In addition, time-motion analyses showed a total high:low intensity of 1:2 and an effort:pause ratio of 1:3. In conclusion, simulated MMA sparring matches feature moderate to high intensity and a low degree of musculoskeletal damage, which can be seen by absence of physical performance and decrease in CK. Results of the study indicate that sparring training could be introduced into competitive microcycles to improve technical and tactical aspects of MMA matches, due to the high motor specificity and low muscle damage.

Acquired changes in stomatal characteristics in response to ozone during plant growth and leaf development of bush beans (Phaseolus vulgaris L.) indicate phenotypic plasticity

Energy Technology Data Exchange (ETDEWEB)

Elagoez, Vahram [Plant Biology Graduate Program, University of Massachusetts, Amherst, MA 01003 (United States)]. E-mail: velagoz@nsm.umass.edu; Han, Susan S. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States); Manning, William J. [Department of Plant, Soil and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)

2006-04-15

Bush bean (Phaseolus vulgaris L.) lines 'S156' (O{sub 3}-sensitive)/'R123' (O{sub 3}-tolerant) and cultivars 'BBL 290' (O{sub 3}-sensitive)/'BBL 274' (O{sub 3}-tolerant) were used to study the effects of O{sub 3} on stomatal conductance (g {sub s}), density, and aperture size on leaf and pod surfaces with the objective of establishing links between the degree of plant sensitivity to O{sub 3} and plasticity of stomatal properties in response to O{sub 3}. Studies in open-top chambers (OTCs) and in continuously stirred tank reactors (CSTRs) established a clear relationship between plant developmental stages, degrees of O{sub 3} sensitivity and g {sub s}: while 'S156' had higher g {sub s} rates than 'R123' earlier in development, similar differences between 'BBL 290' and 'BBL 274' were observed at later stages. G {sub s} rates on the abaxial leaf surfaces of 'S156' and 'BBL 290', accompanied by low leaf temperatures, were significantly higher than their O{sub 3}-tolerant counterparts. Exposure to O{sub 3} in CSTRs had greater and more consistent impacts on both stomatal densities and aperture sizes of O{sub 3}-sensitive cultivars. Stomatal densities were highest on the abaxial leaf surfaces of 'S156' and 'BBL 290' at higher O{sub 3} concentrations (60 ppb), but the largest aperture sizes were recorded on the adaxial leaf surfaces at moderate O{sub 3} concentrations (30 ppb). Exposure to O{sub 3} eliminated aperture size differences on the adaxial leaf surfaces between sensitive and tolerant cultivars. Regardless of sensitivity to O{sub 3} and treatment regimes, the smallest aperture sizes and highest stomatal densities were found on the abaxial leaf surface. Our studies showed that O{sub 3} has the potential to affect stomatal plasticity and confirmed the presence of different control mechanisms for stomatal development on each leaf surface. This

In-Silico detection of chokepoints enzymes in four plasmodium species

African Journals Online (AJOL)

Of the over 156 species of Plasmodium that infect vertebrates, only four infect man: Plasmodium falciparum, Plasmodium vivax, Plasmodium ovale and Plasmodium malariae. Other species infect other animals including birds, reptiles and rodents. The rodent malaria parasites are Plasmodium berghei, Plasmodium yoelii, ...

Enige ervaringen met de Beck Depression Inventory (BDI)

NARCIS (Netherlands)

Bouman, TK; Luteijn, F; Albersnagel, FA; van der Ploeg, FAE

1985-01-01

Reviews the research outside the Netherlands concerning the reliability and validity of the Beck Depression Inventory (BDI) and conducted an evaluation of the BDI based on responses from 106 heterogeneous psychiatric patients and 156 undergraduates. Results indicate that the BDI is a reliable

Meediahiiglane või meediasegadus? / Stanley Reed

Index Scriptorium Estoniae

Reed, Stanley

2008-01-01

Thomas H. Glocer kavatseb tulevikku muuta 157aastase uudisteagentuuri ja finantsandmegigandi Reutersi ning ajalehekirjastajana alustanud 78aastase äriteabeimpeeriumi Thomson abil. Glocer müüs Reutersi 15,6 miljardi dollari eest Thomsonile ning asus ise Thomson Reutersi juhi kohale. Vt. samas: Teabehiid

Land Evaluation of an Agricultural Landscape in Dingyadi District ...

African Journals Online (AJOL)

Nigerian Journal of Basic and Applied Science (June, 2013), 21(2): 148-156 ... In land fertility capability classification (FCC) soil units TLL 1, TUP 2 and. TUP3 were classified as LSg, Lde and Sde ..... Systems (EOLSS). Vomocil, J.A (1965) ...

Do pathological fractures influence survival and local recurrence rate in bony sarcomas?

NARCIS (Netherlands)

Bramer, J. A. M.; Abudu, A. A.; Grimer, R. J.; Carter, S. R.; Tillman, R. M.

2007-01-01

The influence of pathological fracture on surgical management, local recurrence and survival was established in patients with high grade, localised, extremity osteosarcoma (n=484), chondrosarcoma (n=130) and Ewing's sarcoma (n=156). Limb salvage was possible in 79% of patients with a fracture

Determination of the complete nucleotide sequence of a lupine potyvirus isolate from the Czech Republic reveals that it belongs to a new member of the genus Potyvirus

Czech Academy of Sciences Publication Activity Database

Sarkisova, Tatiana; Petrzik, Karel

2011-01-01

Roč. 156, č. 1 (2011), s. 167-169 ISSN 0304-8608 R&D Projects: GA MZe QH71145 Institutional research plan: CEZ:AV0Z50510513 Keywords : plants * virus * motif Subject RIV: EE - Microbiology, Virology Impact factor: 2.111, year: 2011

Semiconductor processing apparatus with compact free radical source

NARCIS (Netherlands)

Kovalgin, Alexeij Y.; Aarnink, Antonius A.I.

2013-01-01

A semiconductor processing apparatus (1), comprising: a substrate processing chamber (158), defining a substrate support location (156) at which a generally planar semiconductor substrate (300) is supportable; and at least one free radical source (200), including: a precursor gas source (250); an

Development of (2-bromo-1,1,2,2-tetrafluoroethyl)(phenyl)sulfane as tetrafluoroethyl-radical and tetrafluoroethylene-diradical synthons for additions to alkenes

Czech Academy of Sciences Publication Activity Database

Chernykh, Yana; Beier, Petr

2013-01-01

Roč. 156, December (2013), s. 307-313 ISSN 0022-1139 R&D Projects: GA ČR GAP207/11/0421 Institutional support: RVO:61388963 Keywords : radical addition * sulfide * tetrafluoroethyl * tetrafluoroethylene Subject RIV: CC - Organic Chemistry Impact factor: 1.952, year: 2013

75 FR 7526 - Withdrawal of Regulatory Guide

Science.gov (United States)

2010-02-19

...'s Electronic Reading Room at http://www.nrc.gov/reading-rm/doc-collections . Regulatory guides are... NUCLEAR REGULATORY COMMISSION [NRC-2010-0052] Withdrawal of Regulatory Guide AGENCY: Nuclear Regulatory Commission. ACTION: Withdrawal of Regulatory Guide 1.56, ``Maintenance of Water Purity in Boiling...

Free Boolean algebras over unions of two well orderings

Czech Academy of Sciences Publication Activity Database

Bonnet, R.; Faouzi, L.; Kubiś, Wieslaw

2009-01-01

Roč. 156, č. 7 (2009), s. 1177-1185 ISSN 0166-8641 Institutional research plan: CEZ:AV0Z10190503 Keywords : Well quasi orderings * Poset algebras * Superatomic Boolean algebras * Compact distributive lattices Subject RIV: BA - General Mathematics Impact factor: 0.441, year: 2009

Diet-microbe co-metabolic interactions in wild primates reveal clues on human evolution

Czech Academy of Sciences Publication Activity Database

Gomez, A. M.; Rothman, J. M.; Petrželková, Klára Judita; Yeoman, C. J.; Vlčková, K.; Umana, J. D.; Carr, M.; Modrý, D.; Tod, A.; Nelson, K.; Stumpf, R. M.; Wilson, B. A.; White, B. A.; Leigh, S. R.

2015-01-01

Roč. 156, č. 60 (2015), s. 149 ISSN 0002-9483. [Annual Meeting of the American Association of Physical Anthropologists /84./. 25.03.2015-28.03.2015, St Louis] Institutional support: RVO:68081766 Keywords : wild primates * human evolution Subject RIV: EE - Microbiology, Virology

Purification and characterization of the enantioselective nitrile hydratase from Rhodococcus equi A4

Czech Academy of Sciences Publication Activity Database

Přepechalová, Irena; Martínková, Ludmila; Stolz, A.; Ovesná, M.; Bezouška, Karel; Kopecký, Jan; Křen, Vladimír

2001-01-01

Roč. 55, - (2001), s. 150-156 ISSN 0175-7598 R&D Projects: GA AV ČR IAA4020802 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EE - Microbiology, Virology Impact factor: 1.754, year: 2001

78 FR 77719 - NASA Advisory Council; Science Committee; Planetary Science Subcommittee; Meeting

Science.gov (United States)

2013-12-24

... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice 13-156] NASA Advisory Council; Science...-463, as amended, the National Aeronautics and Space Administration (NASA) announces a meeting of the Planetary Science Subcommittee of the NASA Advisory Council (NAC). This Subcommittee reports to the Science...

Specific determinants of intrinsic work motivation, burnout and turnover intentions: A study among nurses

NARCIS (Netherlands)

Janssen, P.P.M.; Jonge, J. de; Bakker, A.B.

1999-01-01

This study of 156 Dutch general hospital nurses tested a theoretically derived model of specific relationships between work stressors and stress reactions. The model proposes four central domains of the work situation, namely work content, working conditions, social and labour relations, and

Photocatalysis with chromium-doped TiO2: Bulk and surface doping

KAUST Repository

Ould-Chikh, Samy; Proux, Olivier; Afanasiev, Pavel V.; Khrouz, Lhoussain; Hedhili, Mohamed N.; Anjum, Dalaver H.; Harb, Moussab; Geantet, Christophe; Basset, Jean-Marie; Puzenat, Eric

2014-01-01

The photocatalytic properties of TiO2 modified by chromium are usually found to depend strongly on the preparation method. To clarify this problem, two series of chromium-doped titania with a chromium content of up to 1.56 wt % have been prepared

Surface hydrophobicity and roughness influences the morphology and biochemistry of streptomycetes during attached growth and differentiation

Czech Academy of Sciences Publication Activity Database

Petráčková, Denisa; Buriánková, Karolína; Tesařová, E.; Bobková, Šárka; Bezoušková, Silvia; Benada, Oldřich; Kofroňová, Olga; Janeček, Jiří; Halada, Petr; Weiser, Jaroslav

2013-01-01

Roč. 342, č. 2 (2013), s. 147-156 ISSN 0378-1097 R&D Projects: GA AV ČR IAA500200913 Institutional support: RVO:61388971 Keywords : streptomycetes * attached growth * glass beads Subject RIV: EE - Microbiology, Virology Impact factor: 2.046, year: 2013