WorldWideScience

Sample records for starr-edwards bjork-shiley c-c

  1. Strut fracture in a Bjork-Shiley aortic valve prosthesis.

    Science.gov (United States)

    Lifschultz, B D; Donoghue, E R

    1985-10-01

    Strut fracture can be a life-threatening adverse effect of mechanical prosthetic heart valves. This complication has occurred in the DeBakey, the Beall, the Cooley-Cutter and, most recently, the Bjork-Shiley valves. We report the case of a 35-year-old man who died suddenly 16 months after a 60 degree Bjork-Shiley Convexo-Concave heart valve prosthesis was inserted in the aortic position. At autopsy, the two welded attachments of the valve's outlet strut had fractured. The valve's tilting disc was found in his abdominal aorta.

  2. Bjork-Shiley convexoconcave valves: Susceptibility artifacts at brain MR imaging and mechanical valve fractures

    NARCIS (Netherlands)

    van Gorp, Maarten J.; van der Graaf, Yolanda; de Mol, Bas A. J. M.; Bakker, Chris J. G.; Witkamp, Theo D.; Ramos, Lino M. P.; Mali, Willem P. T. M.

    2004-01-01

    PURPOSE: To assess the relationship between heart valve history and susceptibility artifacts at magnetic resonance (MR) imaging of the brain in patients with Bjork-Shiley convexoconcave (BSCC) valves. MATERIALS AND METHODS: MR images of the brain were obtained in 58 patients with prosthetic heart

  3. Outlet strut fracture and leaflet escape of Bjork-Shiley convexo-concave valve.

    Science.gov (United States)

    Uchino, Gaku; Yoshida, Hideo; Sakoda, Naoya; Hattori, Shigeru; Kawabata, Takuya; Saiki, Munehiro; Fujita, Yasufumi; Yunoki, Keiji; Hisamochi, Kunikazu; Mine, Yoshinari

    2017-06-01

    Prosthetic valve fracture is a serious complication and may arise in patient post-valve replacement. We experienced an outlet strut fracture and leaflet escape of a Bjork-Shiley convexo-concave valve. We performed an emergency redo mitral valve replacement and successfully retrieved the fractured strut and escaped leaflet from superficial femoral artery and the abdominal aorta. The patient showed an uneventful postoperative recovery.

  4. Gamma Ray Sterilization of Starr-Edwards Heart Valve Prostheses

    Energy Technology Data Exchange (ETDEWEB)

    Gibbons, J. R. P.; Alladine, M. F. [London Chest Hospital, London (United Kingdom)

    1967-09-15

    Starr-Edwards valves have normally been sterilized by exposure to ethylene oxide or by autoclaving. Patients having a prosthetic valve replacement are known to have a higher incidence of endocarditis in comparison with patients in which no prosthesis has been used. Ethylene oxide will only sterilize the surface of the valve and autoclaving has caused distortion of the polytetrafluorethylene ring. Work has been done on the effect of gamma radiation on the components of these valve prostheses and is given in detail. The bacteriological efficiency, at a total absorbed dose of 2. 5 Mrad, has been established. Thirty valves treated by this method have now been inserted and twelve patients have been examined post-operatively for a period of one to two years. All valves are working normally and there has been no evidence of blood-borne infection or malfunction of the valve. (author)

  5. Structural valve deterioration in a starr-edwards mitral caged-disk valve prosthesis.

    Science.gov (United States)

    Aoyagi, Shigeaki; Tayama, Kei-Ichiro; Okazaki, Teiji; Shintani, Yusuke; Kono, Michitaka; Wada, Kumiko; Kosuga, Ken-Ichi; Mori, Ryusuke; Tanaka, Hiroyuki

    2013-01-01

    The durability of the Starr-Edwards (SE) mitral caged-disk valve, model 6520, is not clearly known, and structural valve deterioration in the SE disk valve is very rare. Replacement of the SE mitral disk valve was performed in 7 patients 23-40 years after implantation. Macroscopic examination of the removed disk valves showed no structural abnormalities in 3 patients, in whom the disk valves were removed at valves excised >36 years after implantation in 4 patients. Disk fracture, a longitudinal split in the disk along its circumference at the site of incorporation of the titanium ring, was detected in the valves removed 36 and 40 years after implantation, respectively, and many cracks were also observed on the outflow aspect of the disk removed 40 years after implantation. Disk fracture and localized disk wear were found in the SE mitral disk valves implanted >36 years previously. The present results suggest that SE mitral caged-disk valves implanted >20 years previously should be carefully followed up, and that those implanted >30 years previously should be electively replaced with modern prosthetic valves

  6. Why Y-c.c

    Czech Academy of Sciences Publication Activity Database

    Chodounský, David; Zapletal, Jindřich

    2015-01-01

    Roč. 166, č. 11 (2015), s. 1123-1149 ISSN 0168-0072 R&D Projects: GA ČR(CZ) GF15-34700L Institutional support: RVO:67985840 Keywords : c.c.c. partitions * proper forcing * forcing axiom Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2015 http://www.sciencedirect.com/science/article/pii/S0168007215000664

  7. Operational Aspects of C/C++ Concurrency

    OpenAIRE

    Podkopaev, Anton; Sergey, Ilya; Nanevski, Aleksandar

    2016-01-01

    In this work, we present a family of operational semantics that gradually approximates the realistic program behaviors in the C/C++11 memory model. Each semantics in our framework is built by elaborating and combining two simple ingredients: viewfronts and operation buffers. Viewfronts allow us to express the spatial aspect of thread interaction, i.e., which values a thread can read, while operation buffers enable manipulation with the temporal execution aspect, i.e., determining the order in...

  8. Re-operation for aortic and mitral prosthetic dysfunctions.

    Science.gov (United States)

    Kaul, T K; Sastry, M R; Mercer, J L; Meade, J B

    1985-01-01

    The overall incidence of re-operation and prosthetic valve endocarditis was low in the present series as mechanical prostheses were used predominantly. The prosthetic dysfunctions were less frequent following the primary implantation with Bjork Shiley prostheses, but high operative risk was associated with the clotted Bjork Shiley prostheses. We also had unusual experience of strut fracture and sticking of Bjork Shiley discs in the closed position in both aortic and mitral positions. The early deaths were nil since the use of cardioplegic protection. Intra-operative bleeding due to adhesions can be minimised by using synthetic or heterologous pericardium during the primary operation.

  9. Linear ketenimines. Variable structures of C,C-dicyanoketenimines and C,C-bis-sulfonylketenimines.

    Science.gov (United States)

    Finnerty, Justin; Mitschke, Ullrich; Wentrup, Curt

    2002-02-22

    C,C-dicyanoketenimines 10a-c were generated by flash vacuum thermolysis of ketene N,S-acetals 9a-c or by thermal or photochemical decomposition of alpha-azido-beta-cyanocinnamonitrile 11. In the latter reaction, 3,3-dicyano-2-phenyl-1-azirine 12 is also formed. IR spectroscopy of the keteniminines isolated in Ar matrixes or as neat films, NMR spectroscopy of 10c, and theoretical calculations (B3LYP/6-31G) demonstrate that these ketenimines have variable geometry, being essentially linear along the CCN-R framework in polar media (neat films and solution), but in the gas phase or Ar matrix they are bent, as is usual for ketenimines. Experiments and calculations agree that a single CN substituent as in 13 is not enough to enforce linearity, and sulfonyl groups are less effective that cyano groups in causing linearity. C,C-bis(methylsulfonyl)ketenimines 4-5 and a C-cyano-C-(methylsulfonyl)ketenimine 15 are not linear. The compound p-O2NC6H4N=C=C(COOMe)2 previously reported in the literature is probably somewhat linearized along the CCNR moiety. A computational survey (B3LYP/6-31G) of the inversion barrier at nitrogen indicates that electronegative C-substituents dramatically lower the barrier; this is also true of N-acyl substituents. Increasing polarity causes lower barriers. Although N-alkylbis(methylsulfonyl)ketenimines are not calculated to be linear, the barriers are so low that crystal lattice forces can induce planarity in N-methylbis(methylsulfonyl)ketenimine 3.

  10. Forging C-C Bonds Through Decarbonylation of Aryl Ketones.

    Science.gov (United States)

    Somerville, Rosie J; Martin, Ruben

    2017-06-06

    The ability of nickel to cleave strong σ-bonds is again in the spotlight after a recent report that demonstrates the feasibility of using nickel complexes to promote decarbonylation of diaryl ketones. This transformation involves the cleavage of two strong C-C(O) bonds and avoids the use of noble metals, hence reinforcing the potential of decarbonylation as a technique for forging C-C bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. HfC plasma coating of C/C composites

    International Nuclear Information System (INIS)

    Boncoeur, M.; Schnedecker, G.; Lulewicz, J.D.

    1992-01-01

    The surface properties of C/C composites such as hardness and corrosion or erosion resistance can be modified by a ceramic coating applied by plasma torch. The technique of plasma spraying in controlled temperature and atmosphere, that was developed and patented by the CEA, makes it possible to apply coatings to the majority of metals and ceramics without affecting the characteristics of the composite. An example of hard deposit of HfC on a C/C composite is described. The characteristics of the deposit and of the bonding with the C/C composite were studied before and after a heat treatment under vacuum for 2 hours at 1000 C. 2 refs

  12. Nanosized f.c.c. thallium inclusions in aluminium

    International Nuclear Information System (INIS)

    Johnson, E.; Johansen, A.; Thoft, N.B.; Andersen, H.H.; Sarholt-Kristensen, L.

    1993-01-01

    Ion implantation of pure aluminium with thallium induces the formation of nanosized crystalline inclusions of thallium with a f.c.c. structure. The size of the inclusions depends on the implantation conditions and subsequent annealing treatments and is typically in the range from 1 to 10 nm. The inclusions are aligned topotactically with the aluminium matrix with a cube-cube orientation relationship and they have a truncated octahedral shape bounded by {111} and {001} planes. The lattice parameter of the f.c.c. thallium inclusions is 0.484 ± 0.002 nm, which is slightly but significantly larger than in the high-pressure f.c.c. thallium phase known to be stable above 3.8 GPa. (Author)

  13. Efficient C/C++ programming smaller, faster, better

    CERN Document Server

    Heller, Steve

    1994-01-01

    Efficient C/C++ Programming describes a practical, real-world approach to efficient C/C++ programming. Topics covered range from how to save storage using a restricted character set and how to speed up access to records by employing hash coding and caching. A selective mailing list system is used to illustrate rapid access to and rearrangement of information selected by criteria specified at runtime.Comprised of eight chapters, this book begins by discussing factors to consider when deciding whether a program needs optimization. In the next chapter, a supermarket price lookup system is used to

  14. High temperature oxidation of carbide-carbon materials of NbC-C, NbC-TiC-C systems

    International Nuclear Information System (INIS)

    Afonin, Yu.D.; Shalaginov, V.N.; Beketov, A.R.

    1981-01-01

    The effect of titanium carbide additions on the oxidation of carbide - carbon composition NbC-TiC-C in oxygen under the pressure of 10 mm Hg and in the air at atmospheric pressure in the temperature range 800-1300 deg is studied. It is shown that the region of negative temperature coefficient during oxidation in the system NbC+C is determined by the processes of sintering and polymorphous transformation. The specific character of the oxide film, formed during oxidation of Nbsub(x)Tisub(y)C+C composites is connected with non-equilibrium nature of carbide grain in its composition. Carbon gasification takes place with the formation of carbon dioxide. Composite materials, containing titanium carbide in complex carbide up to 50-83 mol. %, are the most corrosion resisting ones [ru

  15. Get more control over your C/C++ service

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    Are you looking for a way to better diagnose or monitor your C/C++ programs? Find out more about CMX - a neat, lightweight library (<32Kb) which targets this need. It allows to expose information from inside a process through a simple API, enabling pre-failure detection in combination with your favourite monitoring system.

  16. A new f.c.c. phase in yttrium films

    International Nuclear Information System (INIS)

    Kaul, V.K.; Srivastava, O.N.

    1976-01-01

    A new polymorphic phase characterised by a face-centered cubic structure, with lattice parameter 5.83 +- 0.02A, has been identified in thin films of yttrium. Electron diffraction evidence and electrical resistivity measurements have been carried out in order to detect the new f.c.c. phase. (Auth.)

  17. Oxidative electrochemical aryl C-C coupling of spiropyrans

    NARCIS (Netherlands)

    Ivashenko, Oleksii; van Herpt, Jochem T.; Rudolf, Petra; Feringa, Ben L.; Browne, Wesley R.

    2013-01-01

    The isolation and definitive assignment of the species formed upon electrochemical oxidation of nitro-spiropyran (SP) is reported. The oxidative aryl C-C coupling at the indoline moiety of the SP radical cation to form covalent dimers of the ring-closed SP form is demonstrated. The coupling is

  18. On the Michael addition of water to C = C bonds

    NARCIS (Netherlands)

    Chen, B.

    2015-01-01

    ?-Hydroxy carbonyl compounds are an important class of compounds often found as a common structural motif in natural products. Although the molecules themselves look rather simple, their synthesis can be challenging. Water addition to conjugated C = C bonds opens up a straightforward route for the

  19. Deformation microstructure and orientation of F.C.C. crystals

    DEFF Research Database (Denmark)

    Liu, Q.; Hansen, N.

    1995-01-01

    The effect of crystallographic orientation on the microstructural evolution in f.c.c. metals with medium to high stacking fault energy is analyzed. This analysis is based on a literature review of the behaviour of single crystals and polycrystals supplemented with an experimental study of cold...

  20. Borane-catalyzed cracking of C-C bonds in coal; Boran-katalysierte C-C-Bindungungsspaltung in Steinkohle

    Energy Technology Data Exchange (ETDEWEB)

    Narangerel, J; Haenel, M W [Max-Planck-Institut fuer Kohlenforschung, Muelheim an der Ruhr (Germany)

    1998-09-01

    Coal, especially coking coal, was reacted with hydrogen at comparatively mild reaction conditions (150-280 degrees centigrade, 20 MPa hydrogen pressure) in the presence of catalysts consisting of borange reagents and certain transition metal halides to obtaine more than 80 percent of pyridine-soluble products. The influence of the degree of coalification, catalyst and temperature on the borane-catalyzed hydrogenolysis of C-C bonds in coal was investigated. (orig.) [Deutsch] Steinkohlen, insbesondere im Inkohlungsbereich der Fettkohlen (Kokskohlen), werden in Gegenwart von Katalysatoren aus Boran-Reagentien und bestimmten Uebergangsmetallhalogeniden mit Wasserstoff bei vergleichsweise milden Reaktionsbedingungen (250-280 C, 20 MPa Wasserstoffdruck) in zu ueber 80% pyridinloesliche Produkte umgewandelt. Der Einfluss von Inkohlungsgrad, Katalysator und Temperatur auf die Boran-katalysierte C-C-Bindungshydrogenolyse in Kohle wurde untersucht. (orig.)

  1. C.C.D. readout of a picosecond streak camera with an intensified C.C.D

    International Nuclear Information System (INIS)

    Lemonier, M.; Richard, J.C.; Cavailler, C.; Mens, A.; Raze, G.

    1984-08-01

    This paper deals with a digital streak camera readout device. The device consists in a low light level television camera made of a solid state C.C.D. array coupled to an image intensifier associated to a video-digitizer coupled to a micro-computer system. The streak camera images are picked-up as a video signal, digitized and stored. This system allows the fast recording and the automatic processing of the data provided by the streak tube

  2. Geometric factors in f.c.c. and b.c.c. metal-on-metal epitaxy

    International Nuclear Information System (INIS)

    Bruce, L.A.; Jaeger, H.

    1978-01-01

    Deposits of Ni, Au and Ag formed by condensing metal vapour in U.H.V. onto (001)W, held at a temperature Tsub(s) in the range 300K< Tsub(s)<1200 K, always form epitaxial layers. However, while Au and Ag form (001) epitaxial layers of f.c.c. single crystals, (001)d parallel to (001)s with, say, [110]d parallel to [010]s, Ni and Cu occur in two orthogonal domains, each characterized by an exclusive set of fault (or twin) planes. Within a fault plane, atoms are hexagonally close-packed and, within a domain, fault planes are normal to either [1-1-0]s or [1-10]s and a close-packed direction in the planes is normal to the substrate. The lateral stacking of the fault planes may range from random at low values of Tsub(s) to that of, say, (11-1-) planes in heavily faulted and/or twinned (110) epitaxed f.c.c. material, or of basal planes in (110) epitaxed h.c.p. material at high values of Tsub(s). The results are readily explained on the basis of a growth model developed for deposits of Ni and Cu on (001) Ag. (author)

  3. Influence of applied load on wear behavior of C/C-Cu composites under electric current

    Directory of Open Access Journals (Sweden)

    Jian Yin

    2017-04-01

    Full Text Available Using carbon fiber needled fabrics with Cu-mesh and graphite powder as the preform, Cu mesh modified carbon/carbon(C/C-Cu composites were prepared by chemical vapor deposition (CVD with C3H6 and impregnation-carbonization (I/C with furan resin. C/C composites, as a comparison, were also prepared. Their microstructures and wear morphologies were observed by optical microscopy (OM and scanning electron microscope (SEM, respectively. Wear behavior of C/C and C/C-Cu composites under different applied loads were investigated on a pin-on-disc wear tester. The results show that Cu meshes are well dispersed and pyrolytic carbon is in rough laminar structure. Both C/C and C/C-Cu composites had good wear properties. The current-carrying capacity of C/C-Cu composites increases and the arc discharge is hindered as the applied load increases from 40 N to 80 N. Both C/C and C/C-Cu composites had good wear properties. The mass wear rate of C/C-Cu composites under 80 N was only 4.2% of that under 60 N. In addition, C/C-Cu composites represent different wear behaviors because wear mechanisms of arc erosion, abrasive wear, adhesive wear, and oxidative wear are changing under different applied loads.

  4. Measurements of psi -> K-Lambda(Xi)over-bar(+) + c.c. and psi -> gamma K-Lambda(Xi)over-bar(+) + c.c.

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Duan, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. Y.; Gao, Y.; Gao, Z.; Garzia, I.; Geng, C.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Leng, C.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, Lei; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Weber, T.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, H. S.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.

    2015-01-01

    Using a sample of 1.06 x 10(8) psi(3686) events produced in e(+)e(-) collisions at root s = 3.686 GeV and collected with the BESIII detector at the BEPCII collider, we present studies of the decays psi(3686) -> K-Lambda(Xi) over bar (+) + c.c. and psi(3686) -> gamma K-Lambda(Xi) over bar (+) + c.c.

  5. Application of C/C composites to the combustion chamber of rocket engines. Part 1: Heating tests of C/C composites with high temperature combustion gases

    Science.gov (United States)

    Tadano, Makoto; Sato, Masahiro; Kuroda, Yukio; Kusaka, Kazuo; Ueda, Shuichi; Suemitsu, Takeshi; Hasegawa, Satoshi; Kude, Yukinori

    1995-04-01

    Carbon fiber reinforced carbon composite (C/C composite) has various superior properties, such as high specific strength, specific modulus, and fracture strength at high temperatures of more than 1800 K. Therefore, C/C composite is expected to be useful for many structural applications, such as combustion chambers of rocket engines and nose-cones of space-planes, but C/C composite lacks oxidation resistivity in high temperature environments. To meet the lifespan requirement for thermal barrier coatings, a ceramic coating has been employed in the hot-gas side wall. However, the main drawback to the use of C/C composite is the tendency for delamination to occur between the coating layer on the hot-gas side and the base materials on the cooling side during repeated thermal heating loads. To improve the thermal properties of the thermal barrier coating, five different types of 30-mm diameter C/C composite specimens constructed with functionally gradient materials (FGM's) and a modified matrix coating layer were fabricated. In this test, these specimens were exposed to the combustion gases of the rocket engine using nitrogen tetroxide (NTO) / monomethyl hydrazine (MMH) to evaluate the properties of thermal and erosive resistance on the thermal barrier coating after the heating test. It was observed that modified matrix and coating with FGM's are effective in improving the thermal properties of C/C composite.

  6. Search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c .

    Science.gov (United States)

    Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dorjkhaidav, O.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garzia, I.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, S.; Gu, Y. T.; Guo, A. Q.; Guo, L. B.; Guo, R. P.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Kiese, P.; Kliemt, R.; Kloss, B.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuhlmann, M.; Kupsc, A.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Leng, C.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, Jin; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, P. L.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Y. Y.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Morello, G.; Muchnoi, N. Yu.; Muramatsu, H.; Musiol, P.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, J. J.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rong, G.; Rosner, Ch.; Ruan, X. D.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B. T.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Wei, J. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, H.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. Q.; Zhang, X. Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhou, Y. X.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zotti, L.; Zou, B. S.; Zou, J. H.; Besiii Collaboration

    2017-12-01

    Using the data samples of (1310.6 ±7.2 )×106 J /ψ events and (448.1 ±2.9 )×106 ψ (3686 ) events collected with the BESIII detector, we search for the rare decays J /ψ →D0e+e-+c .c . and ψ (3686 )→D0e+e-+c .c . No significant signals are observed and the corresponding upper limits on the branching fractions at the 90% confidence level are determined to be B (J /ψ →D0e+e-+c .c .)<8.5 ×10-8 and B (ψ (3686 )→D0e+e-+c .c .)<1.4 ×10-7 , respectively. Our limit on B (J /ψ →D0e+e-+c .c .) is more stringent by 2 orders of magnitude than the previous results, and B (ψ (3686 )→D0e+e-+c .c .) is measured for the first time.

  7. JACoW SIP4C/C++ at CERN - Status and lessons learned

    CERN Document Server

    Jensen, Steen; Dworak, Andrzej; Gourber-Pace, Marine; Hoguin, Frederic; Lauener, Joel; Locci, Frank; Sigerud, Katarina; Sliwinski, Wojciech

    2018-01-01

    After 4 years of promoting the Software Improvement Process for C/C++ (SIP4C/C++) initiative at CERN, we describe the current status for tools and procedures along with how they have been integrated into our environment. Based on feedback from four project teams, we present reasons for and against their adoption. Finally, we show how SIP4C/C++ has improved development and delivery processes as well as the first-line support of delivered products.

  8. MECHANICAL HEART-VALVE PROSTHESES - SOUND LEVEL AND RELATED COMPLAINTS

    NARCIS (Netherlands)

    LAURENS, RRP; WIT, HP; EBELS, T

    In a randomised study, we investigated the sound production of mechanical heart valve prostheses and the complaints related to this sound. The CarboMedics, Bjork-Shiley monostrut and StJude Medical prostheses were compared. A-weighted levels of the pulse-like sound produced by the prosthesis were

  9. Fracture and embolization of a Björk-Shiley disc. Fatal failure of a prosthetic mitral valve.

    Science.gov (United States)

    Norenberg, D D; Evans, R W; Gundersen, A E; Abellera, R M

    1977-12-01

    A case of fracture of the disc occluder of a Bjork-Shiley mitral prosthesis with embolization of the disc fragments to distal aorta is presented. The possibility of valve dysfunction and the diagnostic value of echocardiography should be considered whenever acute heart failure occurs in a patient with an artificial valve.

  10. Thromboembolism and mechanical heart valves : A randomized study revisited

    NARCIS (Netherlands)

    Kuntze, CEE; Blackstone, EH; Ebels, T

    Background. This study was designed to revise and substantiate previous inferences, based on short-term follow-up, about differences in the incidence of anticoagulant-related events after heart valve replacement among patients who had been randomly assigned to receive either a Bjork-Shiley,

  11. A bonding study of c-C5H8 adsorption on Pt(111)

    International Nuclear Information System (INIS)

    Simonetti, S.; Jasen, P.; Gonzalez, E.; Juan, A.; Brizuela, G.

    2006-01-01

    The chemisorption of cyclopentane (c-C 5 H 8 ) on Pt(111) has been studied using a qualitative band-structure calculations in the framework of tight-binding implementation with the YAeHMOP package. We modeled the metal surface by a two-dimensional slab of finite thickness with an overlayer of c-C 5 H 8 , in a (3x3) di-σ geometry. The c-C 5 H 8 molecule is attached to the surface with its C?C atoms bonded mainly with two Pt atoms while the opposite CH 2 bends towards the surface. The Pt?Pt bonds in the underlying surface and the C?C bonds of c-C 5 H 8 are weakened upon the chemisorption. A noticeable Pt-H and Pt-C interactions has been observed. We found that of Pt 5d z 2 band plays an important role in the bonding between c-C 5 H 8 and the surface, as do the Pt 6s and 6p z bands. The HOMO-LUMO bands of c-C 5 H 8 are very dispersed, indicative of a strong interaction with the metal surface

  12. Effects of Hydrogen Ion Implantation on TiC-C Coating of Stainless Steel

    Institute of Scientific and Technical Information of China (English)

    ZHANG Rui-qian; LIU Yao-guang; HUANG Ning-kang

    2008-01-01

    Titanium carbide coatings are widely used as various wear-resistant material.The hydrogen erosion resistance of TiC-C films and the effect of hydrogen participation on TiC-C films were studied.Seventy-five percent TiC-C films are prepared on stainless steel surface by using ion mixing,where TiC-C films are deposited by rf magnetron sputtering followed by argon ion bombardment.The samples are then submitted to hydrogen ion implantation at 1.2×10-3 Pa.Characterization for the 75% TiC-C films was done with SIMS,XRD,AES,and XPS.Secondary ion mass spectroscopy (SIMS) was used to analyze hydrogen concentration variation with depth,X-Ray diffraction (XRD) was used to identify the phases,and Auger electron spectra (AES) as well as X-ray photoelectron spectra (XPS) were used to check the effects of hydrogen on shifts of chemical bonding states of C and Ti in the TiC-C films.It is found that TiC-C films on stainless steel surface can prevent hydrogen from entering stainless steel.

  13. Stress analysis of two-dimensional C/C composite components for HTGR's core restraint techanism

    International Nuclear Information System (INIS)

    Satoshi Hanawa; Taiju Shibata; Jyunya Sumita; Masahiro Ishihara; Tatsuo Iyoku; Kazuhiro Sawa

    2005-01-01

    Carbon fiber reinforced carbon matrix composite (C/C composite) is one of the most promising materials for HTGRs core components due to their high strength as well as high temperature resistibility. One of the most attractive applications of C/C composite is the core restraint mechanism. The core restraint mechanism is located around the reflector block and it works to tighten reactor core blocks so as to restrict un-supposition flow pass of coolant gas (bypass flow) in the core. The restriction of bypass flow reads to the high efficiency of coolant flow rate inside of the reactor core. For the future HTGRs and VHTR (Very High Temperature Reactor), it is important to develop the core restraint mechanism with C/C composite substitute for metallic materials as used for HTTR. For the application of C/C composite to core restraint mechanism, it is important to investigate the applicability of C/C composite in viewpoint of structural integrity. In the present study, supposing the application of 2D-C/C composite to core restraint mechanism, thermal stress behavior was analyzed by considering the thickness of the C/C composite and the gap between reflector block and core restraint. It was shown from the thermal stress analysis that the circumferential stress decreases with increasing the gap and that the restraint force increases with increasing the thickness. By optimizing the thickness of C/C composite and gap between reflector block and core restraint, the C/C composite is applicable to the core restraint mechanism. (authors)

  14. Development of high conductive C/C composite tiles for plasma facing armor

    International Nuclear Information System (INIS)

    Ioki, K.; Namiki, K.; Tsujimura, S.; Toyoda, M.; Seki, M.; Takatsu, H.

    1991-01-01

    C/C composites with high thermal conductivity were developed in unidirectional, two-dimensional and felt types, and were fabricated as full-scale armor tile. Their thermal conductivity in the direction perpendicular to the plasma-side surface is 250∝550 W/mdeg C, that is comparable to that of pyrolytic graphite. It was shown by heat load tests that the C/C composites have low surface erosion characteristics and high thermal shock resistance. Various kinds of C/C composites were successfully bonded to metal substrate, and their mechanical strength and thermal shock resistance were tested. (orig.)

  15. Rh-Catalyzed decarbonylative coupling with alkynes via C-C activation of isatins.

    Science.gov (United States)

    Zeng, Rong; Dong, Guangbin

    2015-02-04

    Herein we report a [5 + 2 - 1] transformation though catalytic decarbonylative coupling between isatins and alkynes, which provides a unique way to synthesize 2-quinolinone derivatives. A broad range of alkynes can be coupled efficiently with high regioselectivity. This reaction is proposed to go through C-C activation of isatins, followed by decarbonylation and alkyne insertion. Directing group (DG) plays a critical role in this transformation. Assisted by the DG, the C-C cleavage of isatins occurs at room temperature.

  16. Rh(III)-Catalyzed Synthesis of N-Unprotected Indoles from Imidamides and Diazo Ketoesters via C-H Activation and C-C/C-N Bond Cleavage.

    Science.gov (United States)

    Qi, Zisong; Yu, Songjie; Li, Xingwei

    2016-02-19

    The synthesis of N-unprotected indoles has been realized via Rh(III)-catalyzed C-H activation/annulation of imidamides with α-diazo β-ketoesters. The reaction occurs with the release of an amide coproduct, which originates from both the imidamide and the diazo as a result of C═N cleavage of the imidamide and C-C(acyl) cleavage of the diazo. A rhodacyclic intermediate has been isolated and a plausible mechanism has been proposed.

  17. Irradiation effects on C/C composite materials for high temperature nuclear applications

    International Nuclear Information System (INIS)

    Eto, M.; Ugachi, H.; Baba, S.I.; Ishiyama, S.; Ishihara, M.; Hayashi, K.

    2000-01-01

    Excellent characteristics such as high strength and high thermal shock resistance of C/C composite materials have led us to try to apply them to the high temperature components in nuclear facilities. Such components include the armour tile of the first wall and divertor of fusion reactor and the elements of control rod for the use in HTGR. One of the most important aspects to be clarified about C/C composites for nuclear applications is the effect of neutron irradiation on their properties. At the Japan Atomic Energy Research Institute (JAERI), research on the irradiation effects on various properties of C/C composite materials has been carried out using fission reactors (JRR-3, JMTR), accelerators (TANDEM, TIARA) and the Fusion Neutronics Source (FNS). Additionally, strength tests of some neutron-irradiated elements for the control rod were carried out to investigate the feasibility of C/C composites. The paper summarises the R and D activities on the irradiation effects on C/C composites. (authors)

  18. Elastic-constant systematics in f.c.c. metals, including lanthanides-actinides

    Energy Technology Data Exchange (ETDEWEB)

    Ledbetter, Hassel [Mechanical Engineering Department, University of Colorado, Boulder, Colorado 80309 (United States); Migliori, Albert [Los Alamos National Laboratory (E536), Los Alamos, New Mexico 87545 (United States)

    2008-01-15

    For f.c.c. metals, using Blackman's diagram of dimensionless elastic-constant ratios, we consider the systematics of physical properties and interatomic bonding. We focus especially on the lanthanides-actinides La, Ce, Yb, Th, U, Pu, those for which we know some monocrystal elastic constants. Their behavior differs from the other f.c.c. metals, and all except La show a negative Cauchy pressure, contrary to most f.c.c. metals, which show a positive Cauchy pressure. Among the lanthanides-actinides, {delta}-Pu stands apart, consistent with its many odd physical properties. Based on elastic-constant correlations, we suggest that {delta}-Pu possesses a strong s-electron interatomic-bonding component together with a covalent component. Elastically, {delta}-Pu shows properties similar to Yb. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  19. Nanowires of silicon carbide and 3D SiC/C nanocomposites with inverse opal structure

    International Nuclear Information System (INIS)

    Emelchenko, G.A.; Zhokhov, A.A.; Masalov, V.M.; Kudrenko, E.A.; Tereshenko, A.N.; Steinman, E.A.; Khodos, I.I.; Zinenko, V.I.; Agafonov, Yu.A.

    2011-01-01

    Synthesis, morphology, structural and optical characteristics of SiC NWs and SiC/C nanocomposites with an inverse opal lattice have been investigated. The samples were prepared by carbothermal reduction of silica (SiC NWs) and by thermo-chemical treatment of opal matrices (SiC/C) filled with carbon compounds which was followed by silicon dioxide dissolution. It was shown that the nucleation of SiC NWs occurs at the surface of carbon fibers felt. It was observed three preferred growth direction of the NWs: [111], [110] and [112]. HRTEM studies revealed the mechanism of the wires growth direction change. SiC/C- HRTEM revealed in the structure of the composites, except for silicon carbide, graphite and amorphous carbon, spherical carbon particles containing concentric graphite shells (onion-like particles).

  20. Characterization of C/C composites porosity for the fusion; Caracterisation de la porosite de composites C/C d'interet pour la fusion

    Energy Technology Data Exchange (ETDEWEB)

    Martin, C.; Ballet, A.C.; Pardanaud, C.; Roubin, P. [Universite de Provence, Centre St-Jerome, Laboratoire PIIM, 13 - Marseille (France); Beurroies, I.; Richou, M. [Universite de Provence, Centre St-Jerome, Laboratoire Madirel, 13 - Marseille (France); Brosset, C.; Pegourie, B. [Association EURATOM-CEA sur la Fusion Controlee, CE Cadarache, 13 - St-Paul-lez-Durance (France)

    2008-07-01

    In tokamaks, the composites C/C are used as components facing the plasma because of their excellent thermo-mechanical properties. In Tore Supra tokamak, analysis of particles of graphite erosion showed a big deuterium retention by the machine wall. This fuel retention will lead in ITER to a non acceptable level of tritium. As the diffusion in materials is bound to the porosity, the authors realized a study of two composites porosity: N11 and NB31. Different analysis methods have been performed and the temperature or grain size dependence studied. (A.L.B.)

  1. Efficient detection of dangling pointer error for C/C++ programs

    Science.gov (United States)

    Zhang, Wenzhe

    2017-08-01

    Dangling pointer error is pervasive in C/C++ programs and it is very hard to detect. This paper introduces an efficient detector to detect dangling pointer error in C/C++ programs. By selectively leave some memory accesses unmonitored, our method could reduce the memory monitoring overhead and thus achieves better performance over previous methods. Experiments show that our method could achieve an average speed up of 9% over previous compiler instrumentation based method and more than 50% over previous page protection based method.

  2. Experimental study on thermophysical properties of C/C composites at high temperature

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wei; YI Fa-jun; HAN Jie-cai; MENG Song-he

    2006-01-01

    The coefficient of thermal expansion, thermal diffusivity and specific heat of C/C composites from room temperature to ultra high temperature were experimentally investigated. Thermal conductivity and thermal stress resistance of the composites were therefore computed based on experimental results. The results show that the composite has a very low thermal expansion coefficient. Thermal diffusivity decreases exponentially with temperature increase. The specific heat increases linearly as the temperature rises, and the variation trend of thermal conductivity is similar to that of thermal diffusivity. The thermal stress coefficient of C/C composite has little change with temperature variation, and thermal stress resistance of the composite at high temperature is stable.

  3. High temperature oxidation behaviour of mullite coated C/C composites in air

    International Nuclear Information System (INIS)

    Fritze, H.; Borchardt, G.; Weber, S.; Scherrer, S.; Weiss, R.

    1997-01-01

    Based on thermogravimetric measurements on Si-SiC-mullite coated C/C material the temperature dependence of the overall rate constant is interpreted in the temperature range 400 C 1400 C), however, the oxidation behaviour of SiC limits long term application. In this temperature range, additional outer mullite coatings produced by pulsed laser deposition improve the oxidation behaviour. (orig.)

  4. Preparation of Biomorphic SiC/C Ceramics from Pine Wood via Supercritical Ethanol Infiltration

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Biomorphic (wood derived) carbide ceramics with an overall composition in the SiC/C was produced by supercritical ethanol infiltration of low viscosity tetraethylorthosilicate/supercritical ethanol into biologically derived carbon templates (CB-templates) and in situ hydrolysis into Si(OH)4-gel, the Si(OH)4-gel was calcined at 1400℃ to promote the polycondensation of Si(OH)4-gel into SiO2-phase and then carbonthermal reduction of the SiO2 with the biocarbon template into highly porous, biomorphic SiC/C ceramics. The phases and morphology conversion mechanism of resulting porous SiC/C ceramics have been investigated by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and Fourier transform infrared spectroscopy (FT-IR). Experimental results showed that the biomorphic cellular morphology of pinewood charcoal was remained in the porous SiC/C ceramic with high precision that consisted of β-SiC with minority of α-SiC and the remain free carbon existed in amorphous phase.

  5. Characterization of 2D-C/C composite for application of very high temperature reactor

    International Nuclear Information System (INIS)

    Shibata, Taiju; Sumita, Junya; Kunimoto, Eiji; Sawa, Kazuhiro; Makita, Taiyo; Takagi, Takashi; Kim, W.J.; Jung, C.H.; Park, J.Y.

    2010-01-01

    For in-core components of VHTR (Very High Temperature Reactor), carbon fiber reinforced carbon matrix composite (C/C composite) is one of the major candidate materials. In this study, fracture behaviors of two dimensional (2D-) C/C composites were examined by SENB specimens with four-point bending test. The surface of specimens was observed by a CCD camera during the bending test, and observed by a stereomicroscope before and after the bending test. The following results were obtained through mode-I fracture test. (1) Three types of the composites were evaluated by tentatively using the stress intensity factor equation for metallic materials. The equivalent stress intensity factor of 2D-C/C composite is in the range of 5.9 - 10.0MPa m 1/2 . It was expected that the fracture mechanism for the composite materials could be assessed by this test method. (2) The crack opening displacement-load behavior of C/C composite might depend not only on the propagation of crack but also on delaminating between layers. (author)

  6. Development of a Class for Multiple Precision Arithmetic in C/C++ Language

    OpenAIRE

    福田, 宏

    1998-01-01

    We have defined a floating-point variable of arbitrary length for a calculation of high precision and have developed a set of mathematical functions of it in C/C++ language. The variable and the functions are combined into a class in C++ language. In addition, the functions can be easily converted to those in FORTRAN language.

  7. MemPick : High-level data structure detection in C/C++ binaries

    NARCIS (Netherlands)

    Haller, Istvan; Slowinska, Asia; Bos, Herbert

    2013-01-01

    Many existing techniques for reversing data structures in C/C++ binaries are limited to low-level programming constructs, such as individual variables or structs. Unfortunately, without detailed information about a program's pointer structures, forensics and reverse engineering are exceedingly hard.

  8. Scalable data structure detection and classification for C/C++ binaries

    NARCIS (Netherlands)

    Haller, I.; Slowinska, J.M.; Bos, H.J.

    2015-01-01

    Many existing techniques for reversing data structures in C/C ++ binaries are limited to low-level programming constructs, such as individual variables or structs. Unfortunately, without detailed information about a program's pointer structures, forensics and reverse engineering are exceedingly

  9. Interfacial morphologies and growth modes of F.C.C. metallic crystals from liquid alloys

    International Nuclear Information System (INIS)

    Camel, Denis

    1980-01-01

    Equilibrium and growth morphologies of f.c.c. metallic crystals in contact with liquid alloys have been observed in-situ using transmission electron microscopy. These morphologies have been discussed in terms of atomic interfacial structure and growth mechanisms with the help of a statistical thermodynamic model which takes into account the effects of chemical interactions and interfacial adsorption. (author) [fr

  10. Development of C/C composite for the core component of the high temperature gas cooled reactor

    Energy Technology Data Exchange (ETDEWEB)

    Park, J. Y.; Kim, W. J.; Ryu, W. S.; Jang, J. H

    2005-01-15

    This report reviewed a state of the art on development of C/C composite for the core components for VHTR and described the followings items. The fabrication methods of C/C composites. Summary on the JAERI report (JAERI-Res 2002-026) on the process screening test for the selection of a proper C/C composite material. Review of the proceedings presented at the GEN-IV VHTR material PMB meeting. A status of the domestic commercial C/C composite. The published property data and the characteristics of the commercial C/C composite.

  11. Development of C/C composite for the core component of the high temperature gas cooled reactor

    International Nuclear Information System (INIS)

    Park, J. Y.; Kim, W. J.; Ryu, W. S.; Jang, J. H.

    2005-01-01

    This report reviewed a state of the art on development of C/C composite for the core components for VHTR and described the followings items. The fabrication methods of C/C composites. Summary on the JAERI report (JAERI-Res 2002-026) on the process screening test for the selection of a proper C/C composite material. Review of the proceedings presented at the GEN-IV VHTR material PMB meeting. A status of the domestic commercial C/C composite. The published property data and the characteristics of the commercial C/C composite

  12. Substrate-Mediated C-C and C-H Coupling after Dehalogenation.

    Science.gov (United States)

    Kong, Huihui; Yang, Sha; Gao, Hongying; Timmer, Alexander; Hill, Jonathan P; Díaz Arado, Oscar; Mönig, Harry; Huang, Xinyan; Tang, Qin; Ji, Qingmin; Liu, Wei; Fuchs, Harald

    2017-03-15

    Intermolecular C-C coupling after cleavage of C-X (mostly, X = Br or I) bonds has been extensively studied for facilitating the synthesis of polymeric nanostructures. However, the accidental appearance of C-H coupling at the terminal carbon atoms would limit the successive extension of covalent polymers. To our knowledge, the selective C-H coupling after dehalogenation has not so far been reported, which may illuminate another interesting field of chemical synthesis on surfaces besides in situ fabrication of polymers, i.e., synthesis of novel organic molecules. By combining STM imaging, XPS analysis, and DFT calculations, we have achieved predominant C-C coupling on Au(111) and more interestingly selective C-H coupling on Ag(111), which in turn leads to selective synthesis of polymeric chains or new organic molecules.

  13. Quick Way to Port Existing C/C++ Chemoinformatics Toolkits to the Web Using Emscripten.

    Science.gov (United States)

    Jiang, Chen; Jin, Xi

    2017-10-23

    Emscripten is a special open source compiler that compiles C and C++ code into JavaScript. By utilizing this compiler, some typical C/C++ chemoinformatics toolkits and libraries are quickly ported to to web. The compiled JavaScript files have sizes similar to native programs, and from a series of constructed benchmarks, the performance of the compiled JavaScript codes is also close to that of the native codes and is better than the handwritten JavaScript codes. Therefore, we believe that Emscripten is a feasible and practical tool for reusing existing C/C++ codes on the web, and many other chemoinformatics or molecular calculation software tools can also be easily ported by Emscripten.

  14. Photoinduced C-C Cross-Coupling of Aryl Chlorides and Inert Arenes

    Directory of Open Access Journals (Sweden)

    Lele Wang

    2016-01-01

    Full Text Available Here we report a facile, efficient, and catalyst-free method to realize C-C cross-coupling of aryl chlorides and inert arenes under UV light irradiation. The aryl radical upon homolytic cleavage of C-Cl bond initiated the nucleophilic substitution reaction with inert arenes to give biaryl products. This mild reaction mode can also be applied to other synthetic reactions, such as the construction of C-N bonds and trifluoromethylated compounds.

  15. The E.C.C. programme in the field of radioactive wastes

    International Nuclear Information System (INIS)

    Orlowski, S.

    1976-01-01

    After a description of the aims of the E.C.C. in the field of radioactive wastes, the contents and the structure of the programme developed for this purpose as well as its time schedule and financing, are presented. The state of work progress and the first results of the actions taken, whose application is marked by an active cooperation of numerous national experts are quoted [fr

  16. Boron-Based Catalysts for C-C Bond-Formation Reactions.

    Science.gov (United States)

    Rao, Bin; Kinjo, Rei

    2018-05-02

    Because the construction of the C-C bond is one of the most significant reactions in organic chemistry, the development of an efficient strategy has attracted much attention throughout the synthetic community. Among various protocols to form C-C bonds, organoboron compounds are not just limited to stoichiometric reagents, but have also made great achievements as catalysts because of the easy modification of the electronic and steric impacts on the boron center. This review presents recent developments of boron-based catalysts applied in the field of C-C bond-formation reactions, which are classified into four kinds on the basis of the type of boron catalyst: 1) highly Lewis acidic borane, B(C 6 F 5 ) 3 ; 2) organoboron acids, RB(OH) 2 , and their ester derivatives; 3) borenium ions, (R 2 BL)X; and 4) other miscellaneous kinds. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Determination of material properties for short fibre reinforced C/C-SiC

    Directory of Open Access Journals (Sweden)

    Hausherr J.-M.

    2015-01-01

    Full Text Available Determining the mechanical properties of short fibre reinforced CMC using standard sized coupons has always been a challenge due to a high statistical scattering of the measured values. Although the random orientation of short fibres results in a quasi-isotropic material behavior of 2D-structures with a sufficiently large volume, the small volume typical for test coupons usually results in a non-isotropic fibre orientation in the tested volume. This paper describes a method for manufacturing unidirectional oriented short fibre reinforced CMC materials and presents material properties of UD-C/C-SiC. After verifying the fibre orientation of the CMC using micro-computed tomography, coupons were extracted to determine the orthotropic material properties. These orthotropic material properties were then used to predict the properties of C/C-SiC with randomly distributed short fibres. To validate the method, micro-computed tomography is used to quantitatively determine the fibre orientation within coupons extracted from randomly distributed short fibre C/C-SiC. After mechanical three-point-bending tests, the measured stiffness and bending strength is compared with the predicted properties. Finally, the data are used to devise a method suited for reducing the inherent large spread of material properties associated with the measurement of CMC materials with randomly distributed short fibres.

  18. A new SiC/C bulk FGM for fusion reactor

    International Nuclear Information System (INIS)

    Changchun, G.; Anhua, W.; Wenbin, C.; Jiangtao, L.

    2001-01-01

    Graphite is widely used in present Tokamak facilities and a C/C composite has been selected as one of the candidate materials for the ITER. But C-based material has an excessive chemical sputtering yield at 600-1000 K and exhibits irradiation enhanced sublimation at >1200 K under plasma erosion condition, causing serious C-contamination of plasma. Low Z material SiC has several advantages for use in fusion reactor, such as excellent high temperature properties, corrosion resistance, low density, and especially its low activation irradiation. To reduce C contamination during plasma exposure, previously SiC coatings were chemically deposited on the surface of C-substrate, however, the thermal stresses arise on the interface between the coating layers and the substrate under high temperature. Heating/cooling cycle leading to cracks in SiC/C interface, small thickness of coating and long processing time are limiting factors for FGM made with CVD process. In this paper, a new SiC/C bulk FGM has been successfully fabricated with P/M hot pressing process. The chemical sputtering yield, gas desorption performance, thermal shock resistance and physical sputtering performance in Tokamak are outlined in this paper. (author)

  19. SiC/C composite sheets produced from polycarbosilane/resin/bonder mixtures. Polycarbosilane/jushi/bonder kongokei kara sakuseishita SiC/C fukugo sheet

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, K. (The National Defense Academy, Kanagawa (Japan)); Koga, J.; Iwata, T.; Yamanaka, S.; Ono, M. (Mitsubishi Materials Corp., Saitama (Japan))

    1992-02-01

    In a course of work to improve anti-oxidative property and strength of sheets of carbonic composite materials with resins, and further to produce those sheets in an industrial scale, it was tried to prepare two types of 0.4 {approximately} 0.6 m thickness SiC / C composite sheets by heat treatment of two green sheets polycarbosilane ( PCS ) / fran resin / binder type and PCS / (phenol-formaldehyde resin / binder type ) at temperature of 1200 {approximately} 1400{degree}C in an atmosphere of nitrogen. The sheets thus made were subjected to SEM observation, X-ray diffraction, measurement of density and electric resistance, and to tests on weight loss by heating and on bending. The texture of them were as tight as that of their resin carbon ( glassy carbon ). The structural feature is formation of amorphous SiO{sub 2} as a secondary product, This indicates that Si in PCS reacts with oxygen in resin during pyrolysis. The bending strength and anti-oxidative property depend on the SiC content from PCS and that the mixing effect of SiC on them are feasible when a mixing ratio of PCS / resin is higher than (2/1). 13 ref., 7 figs., 2 tabs.

  20. Enhancement of the oxidation resistance of carbon fibres in C/C composites via surface treatments

    Energy Technology Data Exchange (ETDEWEB)

    Labruquere, S.; Pailler, R.; Naslain, R. [Bordeaux Univ., Pessac (France). Lab. des Composites Thermostructuraux; Desbat, B. [Lab. de Spectroscopie Moleculaire et Cristalline, Univ. of Bordeaux, Talence (France)

    1997-12-31

    Carbon-carbon (C/C) composites are commonly used in rockets and braking systems. However, the carbon reacts with oxygen, burning away rapidly at temperatures as low as 450 C. This work deals with the protection of carbon fibres from oxidation between 600 and 1000 C. Two kinds of methods were investigated to protect carbon fibres: (i) surface treatment with aqueous solutions (e.g. of H3PO4) and (ii) chemical vapour deposition (CVD) of SiC coatings. Oxidation resistance of the as treated preforms was studied under dry air atmosphere. (orig.) 2 refs.

  1. An Erbium-Based Bifuctional Heterogeneous Catalyst: A Cooperative Route Towards C-C Bond Formation

    Directory of Open Access Journals (Sweden)

    Manuela Oliverio

    2014-07-01

    Full Text Available Heterogeneous bifuctional catalysts are multifunctional synthetic catalysts enabling efficient organic transformations by exploiting two opposite functionalities without mutual destruction. In this paper we report the first Er(III-based metallorganic heterogeneous catalyst, synthesized by post-calcination MW-assisted grafting and modification of the natural aminoacid L-cysteine. The natural acid–base distance between sites was maintained to assure the cooperation. The applicability of this new bifunctional heterogeneous catalyst to C-C bond formation and the supposed mechanisms of action are discussed as well.

  2. Microanalysis on the Hydrogen Ion Irradiated 50 wt pct TiC-C Films

    Institute of Scientific and Technical Information of China (English)

    Hui JIANG; Yaoguang LIU; Ningkang HUANG

    2007-01-01

    The 50 wt pct TiC-C films were prepared on stainless steel substrates by using a technique of ion beam mixing.These films were irradiated by hydrogen ion beam with a dose of 1×1018 ions/cm2 and an energy of 5 keV.Microanalysis of X-ray photoelectron spectroscopy (XPS) and secondary ion mass spectroscopy (SIMS) were used to analyze the films before and after hydrogen ion irradiation and to study the mechanism of hydrogen resistance.

  3. Quantum-mechanical approach to the state of hydrogen in b. c. c. metals

    Energy Technology Data Exchange (ETDEWEB)

    Fukai, Y; Sugimoto, H

    1980-01-01

    A first step towards consistent understanding of various properties of interstitial hydrogen in b.c.c. metals has been made by solving a Schroedinger equation for hydrogen atoms in the field of interaction with surrounding metal atoms. Properties investigated include the nature of self-trapped states, the relative stability of self-trapped configurations, the average stress field (P-tensor), the excitation energy to be determined by neutron spectroscopy, etc. Calculations were performed on hydrogen isotopes (H, D, T) in group-V metals (V, Nb, Ta), and good agreement was obtained with many different kinds of observations. Some predictions and tentative explanations are also presented.

  4. Quantum-mechanical approach to the state of hydrogen in B. C. C. metals

    Energy Technology Data Exchange (ETDEWEB)

    Fukai, Y; Sugimoto, H [Chuo Univ., Tokyo (Japan). Dept. of Physics

    1980-01-01

    A first step towards consistent understanding of various properties of interstitial hydrogen in B.C.C. metals has been made by solving a Schroedinger equation for hydrogen atoms in the field of interaction with surrounding metal atoms. Properties investigated include a nature of self-trapped states, a relative stability of self-trapped configurations, the average stress field (P-tensor), the excitation energy to be determined by neutron spectroscopy, etc. Calculations were performed on hydrogen isotopes (H, D, T) in group-V metals (V, Nb, Ta), and good agreement was obtained with many different kinds of observations. Some predictions and tentative explanations are also presented.

  5. Thermal shock resistances of a bonding material of C/C composite and copper

    International Nuclear Information System (INIS)

    Kurumada, Akira; Oku, Tatsuo; Kawamata, Kiyohiro; Motojima, Osamu; Noda, Nobuaki; McEnaney, B.

    1997-01-01

    The purpose of this study is to contribute to the development and the safety design of plasma facing components for fusion reactor devices. We evaluated the thermal shock resistance and the thermal shock fracture toughness of a bonding material which was jointed a carbon-fiber-reinforced carbon composite (C/C composite) to oxygen-free copper. We also examined the microstructures of the bonding layers using a scanning electron microscope before and after thermal shock tests. The bonding material did not fracture during thermal shock tests. However, thermal cracks and delamination cracks were observed in the bonding layers. (author)

  6. C-C bond formation in the intramolecular Diels-Alder reaction of triene amides.

    Science.gov (United States)

    Benallou, Abdelilah; El Alaoui El Abdallaoui, Habib; Garmes, Hocine

    2018-02-01

    The mechanism nature of the intramolecular Diels-Alder reaction has been performed; and thus, the changes of C-C bond forming/breaking along IRC are characterized in this study. Conceptual DFT analyses of the most favorable adduct fused/exo shows that the flux electronic will take place from diene to dienophile moiety. Moreover, ELF topological analysis based on the electron density predicts that C-C bond is formed by the coupling of two pseudoradical centers generated at the most significant atoms of the molecules. However, C2 vs C3, also C1 and C4 interaction comes mainly from the global electron density transfer which takes place along the reaction. Two- stage one-step is the proposed mechanism of this reaction, the first stage aims for the formation of C2-C3 σ bond while the second stage aims for C1-C4 σ bond formation. Interestingly, the observed asynchronicity of this IMDA reaction due principally to the asymmetric reorganization of electron density at the most attractive centers.

  7. A two-dimensional conjugated aromatic polymer via C-C coupling reaction

    Science.gov (United States)

    Liu, Wei; Luo, Xin; Bao, Yang; Liu, Yan Peng; Ning, Guo-Hong; Abdelwahab, Ibrahim; Li, Linjun; Nai, Chang Tai; Hu, Zhi Gang; Zhao, Dan; Liu, Bin; Quek, Su Ying; Loh, Kian Ping

    2017-06-01

    The fabrication of crystalline 2D conjugated polymers with well-defined repeating units and in-built porosity presents a significant challenge to synthetic chemists. Yet they present an appealing target because of their desirable physical and electronic properties. Here we report the preparation of a 2D conjugated aromatic polymer synthesized via C-C coupling reactions between tetrabromopolyaromatic monomers. Pre-arranged monomers in the bulk crystal undergo C-C coupling driven by endogenous solid-state polymerization to produce a crystalline polymer, which can be mechanically exfoliated into micrometre-sized lamellar sheets with a thickness of 1 nm. Isothermal gas-sorption measurements of the bulk material reveal a dominant pore size of ~0.6 nm, which indicates uniform open channels from the eclipsed stacking of the sheets. When employed as an organic anode in an ambient-temperature sodium cell, the material allows a fast charge/discharge of sodium ions, with impressive reversible capacity, rate capability and stability metrics.

  8. C-C Coupling on Single-Atom-Based Heterogeneous Catalyst.

    Science.gov (United States)

    Zhang, Xiaoyan; Sun, Zaicheng; Wang, Bin; Tang, Yu; Nguyen, Luan; Li, Yuting; Tao, Franklin Feng

    2018-01-24

    Compared to homogeneous catalysis, heterogeneous catalysis allows for ready separation of products from the catalyst and thus reuse of the catalyst. C-C coupling is typically performed on a molecular catalyst which is mixed with reactants in liquid phase during catalysis. This homogeneous mixing at a molecular level in the same phase makes separation of the molecular catalyst extremely challenging and costly. Here we demonstrated that a TiO 2 -based nanoparticle catalyst anchoring singly dispersed Pd atoms (Pd 1 /TiO 2 ) is selective and highly active for more than 10 Sonogashira C-C coupling reactions (R≡CH + R'X → R≡R'; X = Br, I; R' = aryl or vinyl). The coupling between iodobenzene and phenylacetylene on Pd 1 /TiO 2 exhibits a turnover rate of 51.0 diphenylacetylene molecules per anchored Pd atom per minute at 60 °C, with a low apparent activation barrier of 28.9 kJ/mol and no cost of catalyst separation. DFT calculations suggest that the single Pd atom bonded to surface lattice oxygen atoms of TiO 2 acts as a site to dissociatively chemisorb iodobenzene to generate an intermediate phenyl, which then couples with phenylacetylenyl bound to a surface oxygen atom. This coupling of phenyl adsorbed on Pd 1 and phenylacetylenyl bound to O ad of TiO 2 forms the product molecule, diphenylacetylene.

  9. Present situation of researches on polar ionosphere by C.C.I.R

    International Nuclear Information System (INIS)

    Ishikawa, Saburo

    1974-01-01

    Various subjects of studies made by the sixth research committee of C.C.I.R. (International Radio Consultative Committee) are reported. The C.C.I.R. has not any definite study programme and question concerning polar ionosphere, because it studies and delivers opinion on the techniques and operation of radio communication especially in developing countries. The subjects of study programme by the sixth research committee are as follows: estimation of the intensity and transmission loss of space wave electric field in a zone between 1.5 and 40 MHz, observation of the ionosphere of oblique entrance, scattering propagation of ionosphere, back scattering, fading of signal transmitted through ionosphere, transmission of space waves in the zone between 150 and 1,500 kHz, and effect of ionosphere on space communication. In addition, the following fourteen reports are cited: confirmation of prodromal phenomena of ionosphere disturbances, observation of the ionosphere of oblique entrance, remote propagation with supermode, basic information on forecast, back scattering, side scattering from the ground surface and ionosphere, Esub(s) propagation, scattering propagation, Esub(s) forecast, fading, effect of ionosphere on the transmission between the earth and space, radio noise produced in and above ionosphere, and propagation of standard broadcast wave. (Iwakiri, K.)

  10. Dynamic performance of a C/C composite finger seal in a tilting mode

    Directory of Open Access Journals (Sweden)

    Hailin ZHAO

    2017-08-01

    Full Text Available The complex operating state of aeroengines has an impact on the performance of finger seals. However, little work has been focused on the issue and the dynamic performance of finger seals is also rarely studied. Therefore, a distributed mass equivalent model considering working conditions is proposed in this paper for solving the existing problems. The effects of the fiber bundle density and the preparation direction of the fiber bundle of a C/C composite on the dynamic performance of a finger seal are investigated in rotor tilt based on the proposed model. The difference between the C/C composite finger seal performances under the rotor precession and nutation tilt cases is also investigated. The results show that the fiber bundle density and the preparation direction of the fiber bundle have an influence on the dynamic performance of the finger seal as rotor tilt is considered, and the dynamic performance of the finger seal is different in the two kinds of tilting modes. In addition, a novel method for design of finger seals is presented based on the contact pressure between finger boots and the rotor. Finger seals with good leakage rates and low wear can be acquired in this method.

  11. Quantification of C=C and C=O Surface Carbons in Detonation Nanodiamond by NMR

    Energy Technology Data Exchange (ETDEWEB)

    Cui, J -F; Fang, X -W; Schmidt-Rohr, K

    2014-05-08

    The ability of solid-state 13C NMR to detect and quantify small amounts of sp2-hybridized carbon on the surface of ~5 nm diameter nanodiamond particles is demonstrated. The C=C carbon fraction is only 1.1 ± 0.4% in pristine purified detonation nanodiamond, while a full single-layer graphitic or “bucky diamond” shell would contain ca. 25% of all C in a 5 nm diameter particle. Instead of large aromatic patches repeatedly proposed in the recent literature, sp3-hybridized CH and COH carbons cover most of the nanodiamond particle surface, accounting for ~5% each. C=O and COO groups also seen in X-ray absorption near-edge structure spectroscopy (XANES) but not detected in previous NMR studies make up ca. 1.5% of all C. They are removed by heat treatment at 800 °C, which increases the aromatic fraction. 13C{1H} NMR demonstrates that the various sp2-hybridized carbons are mostly not protonated, but cross-polarization shows that they are separated from 1H by only a few bond lengths, which proves that they are near the protonated surface. Together, the observed C–H, C–OH, C=O, and C=C groups account for 12–14% of all C, which matches the surface fraction expected for bulk-terminated 5 nm diameter diamond particles.

  12. Oxidative C-C bond cleavage of 1,2-diols by silver(II)

    International Nuclear Information System (INIS)

    Kumar, A.

    1981-01-01

    Oxidation of ethylene glycol and related compounds by Ag(II) has been investigated. Complexation of these substrates by Ag(II) precedes their oxidation. Oxidation occurs through electron transfer from an OH group to the Ag(II) within the complex resulting in the formation of alkoxyl-type radicals. The radicals thus formed undergo β-scission to give cleavage products. For ethylene glycol a complexation rate 1.3 x 10 6 M -1 s -1 and oxidation rate approx. 3 x 10 3 s -1 were observed. A general trend for the type of the substrates which would undergo C-C bond scission by Ag(II) is discussed

  13. The preparation of HfC/C ceramics via molecular design.

    Science.gov (United States)

    Inzenhofer, Kathrin; Schmalz, Thomas; Wrackmeyer, Bernd; Motz, Günter

    2011-05-07

    Polymer derived ceramics have received lots of attention throughout the last few decades. Unfortunately, only a few precursor systems have been developed, focusing on silicon based polymers and ceramics, respectively. Herein, the synthesis of novel hafnium containing organometallic polymers by two different approaches is reported. Dialkenyl substituted hafnocene monomers were synthesized and subsequently polymerized via a free radical mechanism. Salt metathesis reactions of hafnocene dichloride with bifunctional linkers led to the formation of polymeric materials. NMR spectroscopic methods--in solution as well as in the solid state--were used to characterize the organometallic polymers. Ceramics were finally obtained after cross-linking and thermal treatment under argon (T(max) = 1800 °C). SEM investigations, elemental analyses, Raman spectroscopy and XRD investigations identified the pyrolyzed products as partially crystalline HfC/C mixed phases.

  14. Nuclear spin relaxation due to hydrogen diffusion in b.c.c. metals

    International Nuclear Information System (INIS)

    Faux, D.A.; Hall, C.K.

    1989-01-01

    We present Monte Carlo simulation results for the proton-proton contribution to the T 1 -1 relaxation rate for hydrogen spins diffusing on the tetrahedral sites of a b.c.c. metal. It is assumed that each hydrogen blocks all sites to the zeroth (no multiple-occupancy), second or third neighbour and that longer-range interactions may be neglected. Comparisons are made to the BPP and Torrey models. It is found that both the BPP and Torrey models give reasonable values for the peak height but that their predictions for the peak position and the high- and low-temperature limit are in error, particularly for large blocking distances. (orig.)

  15. Electric measurements of PV heterojunction structures a-SiC/c-Si

    Science.gov (United States)

    Perný, Milan; Šály, Vladimír; Janíček, František; Mikolášek, Miroslav; Váry, Michal; Huran, Jozef

    2018-01-01

    Due to the particular advantages of amorphous silicon or its alloys with carbon in comparison to conventional crystalline materials makes such a material still interesting for study. The amorphous silicon carbide may be used in a number of micro-mechanical and micro-electronics applications and also for photovoltaic energy conversion devices. Boron doped thin layers of amorphous silicon carbide, presented in this paper, were prepared due to the optimization process for preparation of heterojunction solar cell structure. DC and AC measurement and subsequent evaluation were carried out in order to comprehensively assess the electrical transport processes in the prepared a-SiC/c-Si structures. We have investigated the influence of methane content in deposition gas mixture and different electrode configuration.

  16. Rhenium-Promoted C-C Bond-Cleavage Reactions of Internal Propargyl Alcohols.

    Science.gov (United States)

    Lee, Kui Fun; Bai, Wei; Sung, Herman H Y; Williams, Ian D; Lin, Zhenyang; Jia, Guochen

    2018-06-07

    The first examples of C-C bond cleavage reactions of internal propargyl alcohols to give vinylidene complexes are described. Treatment of [Re(dppm) 3 ]I with RC≡CC(OH)R'R'' (R=aryl, alkyl; C(OH)R'R''=C(OH)Ph 2, C(OH)Me 2 , C(OH)HPh, C(OH)H 2 ) produced the vinylidene complexes ReI(=C=CHR)(dppm) 2 with the elimination of C(O)R'R''. Computational studies support that the reactions proceed through a β-alkynyl elimination of alkoxide intermediates Re{OC(R')(R'')C≡CR}(dppm) 2 . © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. C,C'-bis(benzodiazaborolyl)dicarba-closo-dodecaboranes: synthesis, structures, photophysics and electrochemistry.

    Science.gov (United States)

    Weber, Lothar; Kahlert, Jan; Brockhinke, Regina; Böhling, Lena; Halama, Johannes; Brockhinke, Andreas; Stammler, Hans-Georg; Neumann, Beate; Nervi, Carlo; Harder, Rachel A; Fox, Mark A

    2013-08-14

    Six new C,C'-bis(benzodiazaborolyl)dicarba-closo-dodecaboranes, 1,A-R2-1,A-C2B10H10, where R represents the group 2-(1,3-Et2-1,3,2-N2BC6H4) or 2-(1,3-Ph2-1,3,2-N2BC6H4) and A is 2, 7 or 12, were synthesized from o-, m-, and p-dicarbadodecaboranes (carboranes) by lithiation and subsequent treatment with the respective 2-bromo-1,3,2-benzodiazaboroles. UV-visible and fluorescence spectra of all carboranes display low energy charge transfer emissions. While such emissions with Stokes shifts between 17,330 and 21,290 cm(-1) are typical for C,C'-bis(aryl)-ortho-carboranes, the observed low-energy emissions with Stokes shifts between 8320 and 15,170 cm(-1) for the meta- and para-isomers are unusual as high-energy emissions are typical for meta- and para-dicarbadodecaboranes. Fluorescence quantum yields (φF) for the novel 1,7- and 1,12-bis(benzodiazaborolyl)-carboranes depend on the substituents at the nitrogen atoms of the heterocycle. Thus, the para-carborane with N-ethyl substituents 1,12-(1',3'-Et2-1',3',2'-N2BC6H4)2-1,12-C2B10H10 has a φF value of 41% in cyclohexane solution and only of 9% in the solid state, whereas the analogous 1,12-(1',3'-Ph2-1',3',2'-N2BC6H4)2-1,12-C2B10H10 shows quantum yields of 3% in cyclohexane solution and 72% in the solid state. X-ray crystallographic, computational and cyclic voltammetry studies for these carboranes are also presented.

  18. Direct conversion of cellulose using carbon monoxide and water on a Pt-Mo2C/C catalyst

    KAUST Repository

    Li, Jing

    2014-01-01

    CO and H2O were employed as the hydrogen source for cellulose conversion to polyols. Pt-Mo2C/C tandem catalyst with the Pt-Mo 2C domain responsible for H2 and/or H production and the Pt-C domain for cellulose conversion was fabricated. Considerable polyols were obtained over this tandem Pt-Mo2C/C catalyst. This journal is © 2014 The Royal Society of Chemistry.

  19. C=C bond cleavage on neutral VO3(V2O5)n clusters.

    Science.gov (United States)

    Dong, Feng; Heinbuch, Scott; Xie, Yan; Bernstein, Elliot R; Rocca, Jorge J; Wang, Zhe-Chen; Ding, Xun-Lei; He, Sheng-Gui

    2009-01-28

    The reactions of neutral vanadium oxide clusters with alkenes (ethylene, propylene, 1-butene, and 1,3-butadiene) are investigated by experiments and density function theory (DFT) calculations. Single photon ionization through extreme ultraviolet radiation (EUV, 46.9 nm, 26.5 eV) is used to detect neutral cluster distributions and reaction products. In the experiments, we observe products (V(2)O(5))(n)VO(2)CH(2), (V(2)O(5))(n)VO(2)C(2)H(4), (V(2)O(5))(n)VO(2)C(3)H(4), and (V(2)O(5))(n)VO(2)C(3)H(6), for neural V(m)O(n) clusters in reactions with C(2)H(4), C(3)H(6), C(4)H(6), and C(4)H(8), respectively. The observation of these products indicates that the C=C bonds of alkenes can be broken on neutral oxygen rich vanadium oxide clusters with the general structure VO(3)(V(2)O(5))(n=0,1,2...). DFT calculations demonstrate that the reaction VO(3) + C(3)H(6) --> VO(2)C(2)H(4) + H(2)CO is thermodynamically favorable and overall barrierless at room temperature. They also provide a mechanistic explanation for the general reaction in which the C=C double bond of alkenes is broken on VO(3)(V(2)O(5))(n=0,1,2...) clusters. A catalytic cycle for alkene oxidation on vanadium oxide is suggested based on our experimental and theoretical investigations. The reactions of V(m)O(n) with C(6)H(6) and C(2)F(4) are also investigated by experiments. The products VO(2)(V(2)O(5))(n)C(6)H(4) are observed for dehydration reactions between V(m)O(n) clusters and C(6)H(6). No product is detected for V(m)O(n) clusters reacting with C(2)F(4). The mechanisms of the reactions between VO(3) and C(2)F(4)/C(6)H(6) are also investigated by calculations at the B3LYP/TZVP level.

  20. Migrating C/C++ Software to Mobile Platforms in the ADM Context

    Directory of Open Access Journals (Sweden)

    Liliana Martinez

    2017-03-01

    Full Text Available Software technology is constantly evolving and therefore the development of applications requires adapting software components and applications in order to be aligned to new paradigms such as Pervasive Computing, Cloud Computing and Internet of Things. In particular, many desktop software components need to be migrated to mobile technologies. This migration faces many challenges due to the proliferation of different mobile platforms. Developers usually make applications tailored for each type of device expending time and effort. As a result, new programming languages are emerging to integrate the native behaviors of the different platforms targeted in development projects. In this direction, the Haxe language allows writing mobile applications that target all major mobile platforms. Novel technical frameworks for information integration and tool interoperability such as Architecture-Driven Modernization (ADM proposed by the Object Management Group (OMG can help to manage a huge diversity of mobile technologies. The Architecture-Driven Modernization Task Force (ADMTF was formed to create specifications and promote industry consensus on the modernization of existing applications. In this work, we propose a migration process from C/C++ software to different mobile platforms that integrates ADM standards with Haxe. We exemplify the different steps of the process with a simple case study, the migration of “the Set of Mandelbrot” C++ application. The proposal was validated in Eclipse Modeling Framework considering that some of its tools and run-time environments are aligned with ADM standards.

  1. PENINGKATAN KINERJA PERSEDIAAN PRODUK DI PT. PROPAN RAYA I.C.C SURABAYA

    Directory of Open Access Journals (Sweden)

    Yuki Tejo Prakoso

    2013-06-01

    Full Text Available Inventory control is an internal process that is essential for the company's operations, especially in the field of industrial paints. Many types, colors and sizes of packaging paint often urged companies to hoard supplies. Nevertheless the possibility of failing to meet customer demand still occur, either due to exhaustion of stock, delivery delays, or for any other reason. Finished product inventory control in a way or innovative method must be developed to reduce excess inventory so as to minimize storage costs and to meet customer needs optimally. Use the ABC method and modifications VEN can be an alternative in inventory control application based on the classification of products and level of service companies. With a combination of ABC-VEN method, it will obtain 9 grade product inventory to the value of each service level that has been adjusted so that it can help determine the optimal inventory control policies for the company. From the research, suggested inventory control policy indicates that the inventory turnover rate suggested an average 3.14 times per year is the number of days supply of inventory was 76 days.This means that the inventory control policy suggested, PT. Propan Raya I.C.C can improve inventory performance by increasing the speed of inventory turnover amounted to 60.2% and increase the efficiency of the number of days supply of inventory by 37.7% of the current inventory.

  2. SiC/C components for nuclear applications from low cost precursor

    International Nuclear Information System (INIS)

    Narciso, J.; Calderon, N.R.

    2009-01-01

    The development of structural materials with the desired properties to produce the components facing the plasma in fusion reactors is one of the key problems in fusion technology. The structural materials used in the first wall and breeder blanket limits the operating temperature of the system, and higher operating temperatures means higher efficiency. Among the advanced material under consideration for those parts (first wall and breeder blanket) SiC based composites offers the greatest potential. However, considerable research is still required in order to solve engineering feasibility and manufacturing issues, as the improvement of the maximum working temperature and the capability of fabrication of components with homogeneous properties at reasonable cost. Last decade, there has been a strong effort in blanket design using SiC f /SiC composites which are rather expensive while excellent mechanical properties are not so mandatory as resistance to neutron irradiation for this application. In this work, an experimental procedure for manufacturing SiC/C composite materials with homogeneous properties from low cost precursors is described. The process consists in classical reactive infiltration of porous carbon preforms by liquid silicon to produce RBSC where the porous carbon preforms are tailor-made for the fabrication of SiC components without residual Si. The proper selection of the feedstock nature and the pyrolysis conditions determine the microstructure and sinterability of the carbon particles, respectively. These two features control the reactivity of the carbon substrate and porosity of the carbon preform for complete infiltration. The absence of silicon and the homogeneous microstructure of the SiC materials produced by this procedure make them suitable for structural applications at temperatures higher than 1200 deg. C. Furthermore, the technique allows near-net-shape capability and the carbon source is a low cost material. (author)

  3. Energy and Rate Determinations to Activate the C-C σ-BOND of Acetone by Gaseous NI^+

    Science.gov (United States)

    Castleberry, Vanessa A.; Dee, S. Jason; Villarroel, Otsmar J.; Laboren, Ivanna E.; Frey, Sarah E.; Bellert, Darrin J.

    2009-06-01

    A unique application of a custom fabricated photodissociation spectrometer permits the determination of thermodynamic properties (activation energies), reaction rates, and mechanistic details of bare metal cation mediated C-C σ-bond activation in the gas phase. Specifically, the products and rates resulting from the unimolecular decomposition of the Ni^+Acetone (Ni^+Ac) adduct are monitored after absorption of a known amount of energy. The three dissociative products which are observed in high yield are Ni^+, Ni^+CO, and CH3CO^+. The latter two fragment ions result from the activation of a C-C σ-bond. It was found that minimally 14 000 cm^{-1} of energy must be deposited into the adduct ion to induce C-C bond breakage. Preliminary results for the Ni^+ activation of the C-C σ-bond of acetone indicate that there are (at least) two low energy reaction coordinates leading to C-C bond breakage. The lower energy pathway emerges from the doublet ground state with an upper limit to the activation energy of 14 000 cm^{-1} and reaction rate ≈0.14 molecules/μs. The higher energy path is assumed to be along the quartet reaction coordinate with a minimum activation energy of 18 800 cm^{-1} (relative to the ground state) and a slightly slower reaction rate.

  4. Potential Hazards Relating to Pyrolysis of c-C4F8O, n-C4F10 and c-C4F8 in selected gaseous diffusion plant operations

    International Nuclear Information System (INIS)

    Trowbridge, L.D.

    2000-01-01

    As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes is under way. This report summarizes studies directed at estimating the chemical and thermal stability of three candidate coolants, c-C 4 F 8 O, n-C 4 F 10 and c-C 4 4F 8 , in a few specific environments to be found in gaseous diffusion plant operations

  5. Chemical vapor deposition of SiC on C-C composites as plasma facing materials for fusion application

    International Nuclear Information System (INIS)

    Kim, W. J.; Lee, M. Y.; Park, J. Y.; Hong, G. W.; Kim, J. I.; Choi, D. J.

    2000-01-01

    Because of the low activation and excellent mechanical properties at elevated temperatures, carbon-fiber reinforced carbon(C-C) composites have received much attention for plasma facing materials for fusion reactor and high-temperature structural applications such as aircrafts and space vehicles. These proposed applications have been frustrated by the lack of resistance to hydrogen erosion and oxidation on exposure to ambient oxidizing conditions at high temperature. Although Silicon Carbide (SiC) has shown excellent properties as an effective erosion-and oxidation-protection coating, many cracks are developed during fabrication and thermal cycles in use due to the Coefficients of Thermal Expansion(CTE) mismatch between SiC and C-C composite. In this study, we adopted a pyrolitic carbon as an interlayer between SiC and C-C substrate in order to minimize the CTE mismatch. The oxidation-protection performance of this composite was investigated as well

  6. Development of unidirectional C/C composite with high thermal conductivity and its application to plasma facing materials

    International Nuclear Information System (INIS)

    Ioki, Kimihiro; Onozuka, Masanori; Ikeda, Takeshi; Akiba, Masato.

    1994-01-01

    Unidirectional C/C composite named 'MFC-1' with high conductivity was developed, and full-scale armor tiles were fabricated. The thermal conductivity in the direction perpendicular to the plasma-side surface is more than 300-500 W/m·degC, which is higher than those of other C/C composites ever made, even superior to that of pyrolytic carbon. It was shown by high heat load tests done using an electron beam test facility that the unidirectional C/C composite was very resistant against both surface erosion as well as severe thermal shock. The 'MFC-1' was successfully brazed to copper substrate, and its high thermal shock resistance was observed in heat load tests (20 MW/m 2 , 3s, not cooled). A functionally gradient material has been also developed as compliant layer for the MFC-1 bonded to copper. (author)

  7. Development of unidirectional C/C composite with high thermal conductivity and its application to plasma facing materials

    Energy Technology Data Exchange (ETDEWEB)

    Ioki, Kimihiro (Mitsubishi Atomic Power Industries, Inc., Tokyo (Japan)); Onozuka, Masanori; Ikeda, Takeshi; Akiba, Masato

    1994-03-01

    Unidirectional C/C composite named 'MFC-1' with high conductivity was developed, and full-scale armor tiles were fabricated. The thermal conductivity in the direction perpendicular to the plasma-side surface is more than 300-500 W/m[center dot]degC, which is higher than those of other C/C composites ever made, even superior to that of pyrolytic carbon. It was shown by high heat load tests done using an electron beam test facility that the unidirectional C/C composite was very resistant against both surface erosion as well as severe thermal shock. The 'MFC-1' was successfully brazed to copper substrate, and its high thermal shock resistance was observed in heat load tests (20 MW/m[sup 2], 3s, not cooled). A functionally gradient material has been also developed as compliant layer for the MFC-1 bonded to copper. (author).

  8. Recent Advances in Ring-Opening Functionalization of Cycloalkanols by C-C σ-Bond Cleavage.

    Science.gov (United States)

    Wu, Xinxin; Zhu, Chen

    2018-06-01

    Cycloalkanols prove to be privileged precursors for the synthesis of distally substituted alkyl ketones and polycyclic aromatic hydrocarbons (PAHs) by virtue of cleavage of their cyclic C-C bonds. Direct functionalization of cyclobutanols to build up other chemical bonds (e. g., C-F, C-Cl, C-Br, C-N, C-S, C-Se, C-C, etc.) has been achieved by using the ring-opening strategy. Mechanistically, the C-C cleavage of cyclobutanols can be involved in two pathways: (a) transition-metal catalyzed β-carbon elimination; (b) radical-mediated 'radical clock'-type ring opening. The recent advances of our group for the ring-opening functionalization of tertiary cycloalkanols are described in this account. © 2018 The Chemical Society of Japan & Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Thermal cyclic oxidation behavior of the developed compositionally gradient graphite material of SiC/C in air environment

    International Nuclear Information System (INIS)

    Nakano, Junichi; Fujii, Kimio; Shindo, Masami

    1993-08-01

    For the developed compositionally gradient graphite material composed of surface SiC coating layer, middle SiC/C layer and graphite matrix, the thermal cyclic oxidation test was performed together with two kinds of the SiC coated graphite materials in air environment. It was made clear that the developed material exhibited high performance under severe thermal cyclic condition independent of the morphology of middle SiC/C layers and had the longer time or the more cycle margins from crack initiation to failure for surface SiC coating layer compared with the SiC coated graphite materials. (author)

  10. SEISMIC B E H AV I OUR OF R.C.C BUILDING WITH AND WITHOUT FLOATING COLUMNS

    OpenAIRE

    E. ANUSHA; E. V. RAGHVA RAO; N. CHENNA KESAVA

    2018-01-01

    The main purpose of the project is to study the seismic behaviour of R.C.C building with and without floating column,G+5 structures has been selected for carrying out the project work. The building models are generated using software STAAD.

  11. Numerical modelling of micro-machining of f.c.c. single crystal: Influence of strain gradients

    KAUST Repository

    Demiral, Murat; Roy, Anish; El Sayed, Tamer S.; Silberschmidt, Vadim V.

    2014-01-01

    of orthogonal micro-machining of f.c.c. single crystal copper was developed. The model was implemented in a commercial software ABAQUS/Explicit employing a user-defined subroutine VUMAT. Strain-gradient crystal-plasticity and conventional crystal

  12. Oxidative addition of the ethane C-C bond to Pd. An ab initio benchmark and DFT validation study

    NARCIS (Netherlands)

    De Jong, G.T.; Geerke, D.P.; Diefenbach, A.; Sola, M.; Bickelhaupt, F.M.

    2005-01-01

    We have computed a state-of-the-art benchmark potential energy surface (PES) for the archetypal oxidative addition of the ethane C-C bond to the palladium atom and have used this to evaluate the performance of 24 popular density functionals, covering LDA, GGA, meta-GGA, and hybrid density

  13. Bite angle effects of diphosphines in C-C and C-X bond forming cross coupling reactions

    NARCIS (Netherlands)

    Birkholz, M.N.; Freixa, Z.; van Leeuwen, P.W.N.M.

    2009-01-01

    Catalytic reactions of C-C and C-X bond formation are discussed in this critical review with particular emphasis on cross coupling reactions catalyzed by palladium and wide bite angle bidentate diphosphine ligands. Especially those studies have been collected that allow comparison of the ligand bite

  14. Highly Conductive, Mechanically Robust, and Electrochemically Inactive TiC/C Nanofiber Scaffold for High-Performance Silicon Anode Batteries

    KAUST Repository

    Yao, Yan; Huo, Kaifu; Hu, Liangbing; Liu, Nian; Cha, Judy J.; McDowell, Matthew T.; Chu, Paul K.; Cui, Yi

    2011-01-01

    Silicon has a high specific capacity of 4200 mAh/g as lithium-ion battery anodes, but its rapid capacity fading due to >300% volume expansion and pulverization presents a significant challenge for practical applications. Here we report a core-shell TiC/C/Si inactive/active nanocomposite for Si anodes demonstrating high specific capacity and excellent electrochemical cycling. The amorphous silicon layer serves as the active material to store Li+, while the inactive TiC/C nanofibers act as a conductive and mechanically robust scaffold for electron transport during the Li-Si alloying process. The core-shell TiC/C/Si nanocomposite anode shows ∼3000 mAh g-1 discharge capacity and 92% capacity retention after 100 charge/discharge cycles. The excellent cycling stability and high rate performance could be attributed to the tapering of the nanofibers and the open structure that allows facile Li ion transport and the high conductivity and mechanical stability of the TiC/C scaffold. © 2011 American Chemical Society.

  15. Highly Conductive, Mechanically Robust, and Electrochemically Inactive TiC/C Nanofiber Scaffold for High-Performance Silicon Anode Batteries

    KAUST Repository

    Yao, Yan

    2011-10-25

    Silicon has a high specific capacity of 4200 mAh/g as lithium-ion battery anodes, but its rapid capacity fading due to >300% volume expansion and pulverization presents a significant challenge for practical applications. Here we report a core-shell TiC/C/Si inactive/active nanocomposite for Si anodes demonstrating high specific capacity and excellent electrochemical cycling. The amorphous silicon layer serves as the active material to store Li+, while the inactive TiC/C nanofibers act as a conductive and mechanically robust scaffold for electron transport during the Li-Si alloying process. The core-shell TiC/C/Si nanocomposite anode shows ∼3000 mAh g-1 discharge capacity and 92% capacity retention after 100 charge/discharge cycles. The excellent cycling stability and high rate performance could be attributed to the tapering of the nanofibers and the open structure that allows facile Li ion transport and the high conductivity and mechanical stability of the TiC/C scaffold. © 2011 American Chemical Society.

  16. Gold-Catalyzed Formal C-C Bond Insertion Reaction of 2-Aryl-2-diazoesters with 1,3-Diketones.

    Science.gov (United States)

    Ren, Yuan-Yuan; Chen, Mo; Li, Ke; Zhu, Shou-Fei

    2018-06-29

    The transition-metal-catalyzed formal C-C bond insertion reaction of diazo compounds with monocarbonyl compounds is well established, but the related reaction of 1,3-diketones instead gives C-H bond insertion products. Herein, we report a protocol for a gold-catalyzed formal C-C bond insertion reaction of 2-aryl-2-diazoesters with 1,3-diketones, which provides efficient access to polycarbonyl compounds with an all-carbon quaternary center. The aryl ester moiety plays a crucial role in the unusual chemoselectivity, and the addition of a Brønsted acid to the reaction mixture improves the yield of the C-C bond insertion product. A reaction mechanism involving cyclopropanation of a gold carbenoid with an enolate and ring-opening of the resulting donor-acceptor-type cyclopropane intermediate is proposed. This mechanism differs from that of the traditional Lewis-acid-catalyzed C-C bond insertion reaction of diazo compounds with monocarbonyl compounds, which involves a rearrangement of a zwitterion intermediate as a key step. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Examination of C/C flat tile mock-ups with hypervapotron cooling after high heat flux testing

    International Nuclear Information System (INIS)

    Schedler, B.; Friedrich, T.; Traxler, H.; Eidenberger, E.; Scheu, C.; Clemens, H.; Pippan, R.; Escourbiac, F.

    2007-01-01

    Two C/C flat tile mock-ups with a hypervapotron cooling concept, have been successfully tested beyond ITER specification (3000 cycles at 15 MW/m 2 , 300 cycles at 20 MW/m 2 and 800-1000 cycles at 25 MW/m 2 ) in two electron beam testing facilities [F. Escourbiac, et al., Experimental simulation of cascade failure effect on tungsten and CFC flat tile armoured HHF components, Fusion Eng. Des., submitted for publication; F. Escourbiac, et al., A mature industrial solution for ITER divertor plasma facing components: hypervapotron cooling concept adapted to Tore Supra flat tile technology, Fusion Eng. Des. 75-79 (2005) 387-390]. Both mock-ups provide a SNECMA SEPCARB NS31 armour, which has been joined onto the CuCrZr heat sink by active metal casting (AMC) and electron beam welding (EBW). No tile detachment or sudden loss of single tiles has been observed; a cascade-like failure of flat tile armours was impossible to generate. At the maximum cyclic heat flux load of 25 MW/m 2 all tested tiles performed well except one, which revealed already a clear indication in the thermographic examination at the end of the manufacture. Visual examination and analysis of metallographic cuts of the remaining tiles demonstrated that the interface has not been altered. In addition, the shear strength of the C/C to copper joints measured after the high heat flux (HHF) test has been found to be still above the interlamellar shear strength of the used C/C material. The high resistance of the interface is explained by a modification of the C/C to copper joint interface due to silicon originating from the used C/C material

  18. Examination of C/C flat tile mock-ups with hypervapotron cooling after high heat flux testing

    Energy Technology Data Exchange (ETDEWEB)

    Schedler, B. [Technology Centre of PLANSEE SE, A-6600 Reutte (Austria)], E-mail: bertram.schedler@plansee.com; Friedrich, T.; Traxler, H. [Technology Centre of PLANSEE SE, A-6600 Reutte (Austria); Eidenberger, E.; Scheu, C.; Clemens, H. [Department of Physical Metallurgy and Materials Testing, University of Leoben, A-8700 Leoben (Austria); Pippan, R. [Austrian Academy of Sciences, Erich-Schmid-Institute of Material Science, A-8700 Leoben (Austria); Escourbiac, F. [Association EURATOM-CEA, DSM/DRFC, CEA Cadarache, F-13108 St. Paul Lez Durance (France)

    2007-04-15

    Two C/C flat tile mock-ups with a hypervapotron cooling concept, have been successfully tested beyond ITER specification (3000 cycles at 15 MW/m{sup 2}, 300 cycles at 20 MW/m{sup 2} and 800-1000 cycles at 25 MW/m{sup 2}) in two electron beam testing facilities [F. Escourbiac, et al., Experimental simulation of cascade failure effect on tungsten and CFC flat tile armoured HHF components, Fusion Eng. Des., submitted for publication; F. Escourbiac, et al., A mature industrial solution for ITER divertor plasma facing components: hypervapotron cooling concept adapted to Tore Supra flat tile technology, Fusion Eng. Des. 75-79 (2005) 387-390]. Both mock-ups provide a SNECMA SEPCARB NS31 armour, which has been joined onto the CuCrZr heat sink by active metal casting (AMC) and electron beam welding (EBW). No tile detachment or sudden loss of single tiles has been observed; a cascade-like failure of flat tile armours was impossible to generate. At the maximum cyclic heat flux load of 25 MW/m{sup 2} all tested tiles performed well except one, which revealed already a clear indication in the thermographic examination at the end of the manufacture. Visual examination and analysis of metallographic cuts of the remaining tiles demonstrated that the interface has not been altered. In addition, the shear strength of the C/C to copper joints measured after the high heat flux (HHF) test has been found to be still above the interlamellar shear strength of the used C/C material. The high resistance of the interface is explained by a modification of the C/C to copper joint interface due to silicon originating from the used C/C material.

  19. Wearing mechanisms of Al{sub 2} O{sub 3}-Si C-C for torpedo car; Mecanismos de desgate dos refratarios de Al{sub 2}O{sub 3}-SiC-C para carro-torpedo

    Energy Technology Data Exchange (ETDEWEB)

    Quintela, Marco Antonio; Correa Filho, Gerson [USIMINAS, Ipatinga, MG (Brazil). Centro de Pesquisa e Desenvolvimento; Correa Filho, Joao Rodrigues [USIMINAS, Ipatinga, MG (Brazil). Gerencia de Manutencao de Refratarios e Civil

    1995-12-31

    Recently, with the improvement in the hot metal pretreatment practice in the torpedo car at USIMINAS, refractory linings were subjected to severe working conditions resulting in a considerable change in the performance of Al{sub 2} O{sub 3}-Si C-C bricks. A Post Mortem study of the torpedo car linings was carried out using ceramographic analysis and scanning electron microscopy. It was found that the wear mechanisms of Al{sub 2} O{sub 3}-Si C-C bricks comprise mainly the development of dense and secondary phases around Al{sub 2} O{sub 3} particles, together with the formation of low refractoriness phases on the slag and refractory interface. (author) 5 figs.

  20. Evaluation report on the study on the application of 3D woven C/C composite materials; Sanjigenori C/C composite zairyo no kikai buhin eno oyo ni kansuru kenkyu hyoka hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    The paper described a study made during 1995 through 1998 on the application of 3D woven C/C composite materials to machine parts. The materials are large in rigidity, small in specific gravity, excellent in specific rigidity, and suitable for high speed rotation. They are excellent in heat resistance/dynamic reformation and expected as materials which can exceed limits of the existing steel for machine parts. However, to use them as machine parts, a possibility of high precision cutting is required. Therefore, a study was made on metal multi-layer membrane coating to C/C composites. Pitch-system high-elastic carbon fibers were made a 4-directional material by orienting horizontally in 3 directions at 120 degrees per plane and also orienting vertically. Various materials such as W, Mo and WC were coated by the laser assisted plasma hybrid spraying method. High adhesion coats with little pore were obtained. Multi-directionally woven C/C composites used to be poor in surface precision workability, but the problem was able to be solved by coating surfaces with metal layers and metal multi-layer membranes. The application is expanded not only to polygonal mirrors (for laser printing machine) and milling spindles, but largely to machine parts. 11 figs., 1 tab.

  1. Impedance spectroscopy of heterojunction solar cell a-SiC/c-Si with ITO antireflection film investigated at different temperatures

    International Nuclear Information System (INIS)

    Šály, V; Pern, M; Janíček, F; Mikolášek, M; Packa, J; Huran, J

    2017-01-01

    Progressive smart photovoltaic technologies including heterostructures a-SiC/c-Si with ITO antireflection film are one of the prospective replacements of conventional photovoltaic silicon technology. Our paper is focused on the investigation of heterostructures a-SiC/c-Si provided with a layer of ITO (indium oxide/tin oxide 90/10 wt.%) which acts as a passivating and antireflection coating. Prepared photovoltaic cell structure was investigated at various temperatures and the influence of temperature on its operation was searched. The investigation of the dynamic properties of heterojunction PV cells was carried out using impedance spectroscopy. The equivalent AC circuit which approximates the measured impedance data was proposed. Assessment of the influence of the temperature on the operation of prepared heterostructure was carried out by analysis of the temperature dependence of AC equivalent circuit elements. (paper)

  2. Impedance spectroscopy of heterojunction solar cell a-SiC/c-Si with ITO antireflection film investigated at different temperatures

    Science.gov (United States)

    Šály, V.; Perný, M.; Janíček, F.; Huran, J.; Mikolášek, M.; Packa, J.

    2017-04-01

    Progressive smart photovoltaic technologies including heterostructures a-SiC/c-Si with ITO antireflection film are one of the prospective replacements of conventional photovoltaic silicon technology. Our paper is focused on the investigation of heterostructures a-SiC/c-Si provided with a layer of ITO (indium oxide/tin oxide 90/10 wt.%) which acts as a passivating and antireflection coating. Prepared photovoltaic cell structure was investigated at various temperatures and the influence of temperature on its operation was searched. The investigation of the dynamic properties of heterojunction PV cells was carried out using impedance spectroscopy. The equivalent AC circuit which approximates the measured impedance data was proposed. Assessment of the influence of the temperature on the operation of prepared heterostructure was carried out by analysis of the temperature dependence of AC equivalent circuit elements.

  3. Impact of Intragranular Substructure Parameters on the Forming Limit Diagrams of Single-Phase B.C.C. Steels

    Directory of Open Access Journals (Sweden)

    Gérald Franz

    2013-11-01

    Full Text Available An advanced elastic-plastic self-consistent polycrystalline model, accounting for intragranular microstructure development and evolution, is coupled with a bifurcation-based localization criterion and applied to the numerical investigation of the impact of microstructural patterns on ductility of single-phase steels. The proposed multiscale model, taking into account essential microstructural aspects, such as initial and induced textures, dislocation densities, and softening mechanisms, allows us to emphasize the relationship between intragranular microstructure of B.C.C. steels and their ductility. A qualitative study in terms of forming limit diagrams for various dislocation networks, during monotonic loading tests, is conducted in order to analyze the impact of intragranular substructure parameters on the formability of single-phase B.C.C. steels.

  4. Photo-assisted cyanation of transition metal nitrates coupled with room temperature C-C bond cleavage of acetonitrile.

    Science.gov (United States)

    Zou, Shihui; Li, Renhong; Kobayashi, Hisayoshi; Liu, Juanjuan; Fan, Jie

    2013-03-07

    It is a challenge to use acetonitrile as a cyanating agent because of the difficulty in cleaving its C-CN bond. Herein, we report a mild photo-assisted route to conduct the cyanation of transition metal nitrates using acetonitrile as the cyanating agent coupled with room-temperature C-C bond cleavage. DFT calculations and experimental observations suggest a radical-involved reaction mechanism, which excludes toxicity from free cyanide ions.

  5. Spheroidization behavior of dendritic b.c.c. phase in Zr-based モ-phase composite

    Directory of Open Access Journals (Sweden)

    Sun Guoyuan

    2013-03-01

    Full Text Available The spheroidization behavior of the dendritic b.c.c. phase dispersed in a bulk metallic glass (BMG matrix was investigated through applying semi-solid isothermal processing and a subsequent rapid quenching procedure to a Zr-based モ-phase composite. The Zr-based composite with the composition of Zr56.2Ti13.8Nb5.0Cu6.9Ni5.6Be12.5 was prefabricated by a water-cooled copper mold-casting method and characterized by X-ray diffraction (XRD and scanning electron microscope (SEM. The results show that the composite consists of a glassy matrix and uniformly distributed fine dendrites of the モ-Zr solid solution with the body-centered-cubic (b.c.c. structure. Based on the differential scanning calorimeter (DSC examination results, and in view of the b.c.c. モ-Zr to h.c.p. メ-Zr phase transition temperature, a semi-solid holding temperature of 900 ìC was determined. After reheating the prefabricated composite to the semi-solid temperature, followed by an isothermal holding process at this temperature for 5 min, and then quenching the semi-solid mixture into iced-water; the two-phase microstructure composed of a BMG matrix and uniformly dispersed spherical b.c.c. モ-Zr particles with a high degree of sphericity was achieved. The present spheroidization transition is a thermodynamically autonomic behavior, and essentially a diffusion process controlled by kinetic factors; and the formation of the BMG matrix should be attributed to the rapid quenching of the semi-solid mixture as well as the large glass-forming ability of the remaining melt in the semi-solid mixture.

  6. Search for the weak decays J/psi -> D-s(()*()-) e(+)nu(e) + c.c.

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Chu, Y. P.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fu, C. D.; Gao, Q.; Gao, Y.; Garzia, I.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, T.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S; Han, Y. L.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Li, C. H.; Li, Cheng; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Moeini, H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Spruck, B.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.

    2014-01-01

    Using a sample of 2.25 x 10(8) J/psi events collected with the BESIII detector at the BEPCII collider, we search for the J/psi semileptonic weak decay J/psi -> D-s(-) e(+)nu(e) +c.c. with a much higher sensitivity than previous searches. We also perform the first search for J/psi -> D-s(*-) e(+)

  7. Effects of Preform Density on Structure and Property of C/C-SiC Composites Fabricated by Gaseous Silicon Infiltration

    Directory of Open Access Journals (Sweden)

    CAO Yu

    2016-07-01

    Full Text Available The 3-D needled C/C preforms with different densities deposited by chemical vapor infiltration (CVI method were used to fabricate C/C-SiC composites by gaseous silicon infiltration (GSI. The porosity and CVI C thickness of the preforms were studied, and the effects of preform density on the mechanical and thermal properties of C/C-SiC composites were analyzed. The results show that with the increase of preform density, the preform porosity decreases and the CVI C thickness increases from several hundred nanometers to several microns. For the C/C-SiC composites, as the preform density increases, the residual C content increases while the density and residual Si content decreases. The SiC content first keeps at a high level of about 40% (volume fraction, which then quickly reduces. Meanwhile, the mechanical properties increase to the highest values when the preform density is 1.085g/cm3, with the flexure strength up to 308.31MP and fracture toughness up to 11.36MPa·m1/2, which then decrease as the preform density further increases. The thermal conductivity and CTE of the composites, however, decrease with the increase of preform density. It is found that when the preform porosity is too high, sufficient infiltration channels lead to more residual Si, and thinner CVI C thickness results in the severe corrosion of the reinforcing fibers by Si and lower mechanical properties. When the preform porosity is relatively low, the contents of Si and SiC quickly reduce since the infiltration channels are rapidly blocked, resulting in the formation of large closed pores and not high mechanical properties.

  8. The effect of hydrogen on the superconducting and structural properties of b.c.c. Nb-Ru alloys

    International Nuclear Information System (INIS)

    Robbins, C.G.; Ishikawa, M.; Treyvaud, A.; Muller, J.

    1975-01-01

    The superconducting transition temperature (Tsub(c)) has been measured before and after the introduction of hydrogen into Nbsub((1-x))Rusub(x) (0.20<=x<=0.33). In all cases, the presence of appreciable amounts of this interstitial component led to a sharp increase in the Tsub(c). All the evidence suggests that conversion of the host metal lattice to f.c.c. is necessary for the appearance of the elevated Tsub(c). (author)

  9. Suggestion for search of ethylene oxide (c-C2H4O) in a cosmic object

    Science.gov (United States)

    Sharma, M. K.; Sharma, M.; Chandra, S.

    2018-05-01

    Ethylene oxide (c-C2H4O) and its isomer acetaldehyde (CH3CHO) are important organic molecules because of their potential role in the formation of amino acids. The c-C2H4O molecule is a b-type asymmetric top molecule and owing to half-spin of each of the four hydrogen atoms, it has two distinct ortho (nuclear spin one) and para (nuclear spin zero and two) species. It has been detected in the Sgr B2N. Using the rotational and centrifugal distortion constants along with the electric dipole moment, we have calculated energies of 100 rotational levels of each of the ortho and para species of c-C2H4O molecule and the Einstein A-coefficients for radiative transitions between the levels. The values of Einstein A-coefficients along with the scaled values for the collisional rate coefficients are used for solving a set of statistical equilibrium equations coupled with the equations of radiative transfer. Brightness-temperatures of five rotational transitions of each of the ortho and para species of c-C2H4O molecule are investigated. Out of these ten transitions, three transitions are found to show the anomalous absorption and rest seven are found to show the emission feature. We have also investigated seven transitions observed unblended in the Sgr B2(N). We have found that the transitions 3_{3 0} - 3_{2 1} (23.134 GHz), 2_{2 0} - 2_{1 1} (15.603 GHz), 3_{3 1} - 3_{2 2} (39.680 GHz) and 1_{1 1} - 0_{0 0} (39.582 GHz) may play important role for the identification of ethylene oxide in a cosmic object.

  10. The use of ultrasmall iron(0) nanoparticles as catalysts for the selective hydrogenation of unsaturated C-C bonds.

    Science.gov (United States)

    Kelsen, Vinciane; Wendt, Bianca; Werkmeister, Svenja; Junge, Kathrin; Beller, Matthias; Chaudret, Bruno

    2013-04-28

    The performance of well-defined ultrasmall iron(0) nanoparticles (NPs) as catalysts for the selective hydrogenation of unsaturated C-C and C=X bonds is reported. Monodisperse iron nanoparticles of about 2 nm size are synthesized by the decomposition of {Fe(N[Si(CH3)3]2)2}2 under dihydrogen. They are found to be active for the hydrogenation of various alkenes and alkynes under mild conditions and weakly active for C=O bond hydrogenation.

  11. Enhancement of C/C-LAS joint using aligned carbon nanotubes prepared by injection chemical vapor deposition

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Feng-Ling; Fu, Qian-Gang, E-mail: fuqiangang@nwpu.edu.cn; Feng, Lei; Shen, Qing-Liang

    2016-01-05

    Carbon nanotubes (CNTs) enhanced carbon/carbon-lithium aluminum silicate (C/C-LAS) joint was prepared by a three-step technique of pack cementation, injection chemical vapor deposition (ICVD) and hot-pressing. A layer of aligned CNTs was grown on the surface of SiC coated C/C composites by ICVD method, and the joint was obtained by hot-pressing with magnesium aluminum silicate (MAS) as the interlayer. SEM observation reveals that the introduced CNTs result in the formation of a dense and crack-free CNT/MAS nanocomposite interface between SiC and MAS. Compared with the joints without CNTs, the average shear strength of the joints reinforced by CNTs was improved by 48% accompanied by an obvious change in failure mode from brittle fracture without CNTs to plastic fracture with CNTs. The pulling-out and bridging of CNTs on the fracture surfaces had a positive effect on the strength enhancement of the C/C-LAS joint.

  12. SnTe-TiC-C composites as high-performance anodes for Li-ion batteries

    Science.gov (United States)

    Son, Seung Yeon; Hur, Jaehyun; Kim, Kwang Ho; Son, Hyung Bin; Lee, Seung Geol; Kim, Il Tae

    2017-10-01

    Intermetallic SnTe composites dispersed in a conductive TiC/C hybrid matrix are synthesized by high-energy ball milling (HEBM). The electrochemical performances of the composites as potential anodes for Li-ion batteries are evaluated. The structural and morphological characteristics of the SnTe-TiC-C composites with various TiC contents are investigated by X-ray diffraction (XRD) and high-resolution transmission electron microscopy, which reveal that SnTe and TiC are uniformly dispersed in a carbon matrix. The electrochemical performance is significantly improved by introducing TiC to the SnTe-C composite; higher TiC contents result in better performances. Among the prepared composites, the SnTe-TiC (30%)-C and SnTe-TiC (40%)-C electrodes exhibit the best electrochemical performance, showing the reversible capacities of, respectively, 652 mAh cm-3 and 588 mAh cm-3 after 400 cycles and high rate capabilities with the capacity retentions of 75.4% for SnTe-TiC (30%)-C and 82.2% for SnTe-TiC (40%)-C at 10 A g-1. Furthermore, the Li storage reaction mechanisms of Te or Sn in the SnTe-TiC-C electrodes are confirmed by ex situ XRD.

  13. Ternary electrocatalysts for oxidizing ethanol to carbon dioxide: making ir capable of splitting C-C bond.

    Science.gov (United States)

    Li, Meng; Cullen, David A; Sasaki, Kotaro; Marinkovic, Nebojsa S; More, Karren; Adzic, Radoslav R

    2013-01-09

    Splitting the C-C bond is the main obstacle to electrooxidation of ethanol (EOR) to CO(2). We recently demonstrated that the ternary PtRhSnO(2) electrocatalyst can accomplish that reaction at room temperature with Rh having a unique capability to split the C-C bond. In this article, we report the finding that Ir can be induced to split the C-C bond as a component of the ternary catalyst. We characterized and compared the properties of several carbon-supported nanoparticle (NP) electrocatalysts comprising a SnO(2) NP core decorated with multimetallic nanoislands (MM' = PtIr, PtRh, IrRh, PtIrRh) prepared using a seeded growth approach. An array of characterization techniques were employed to establish the composition and architecture of the synthesized MM'/SnO(2) NPs, while electrochemical and in situ infrared reflection absorption spectroscopy studies elucidated trends in activity and the nature of the reaction intermediates and products. Both EOR reactivity and selectivity toward CO(2) formation of several of these MM'/SnO(2)/C electrocatalysts are significantly higher compared to conventional Pt/C and Pt/SnO(2)/C catalysts. We demonstrate that the PtIr/SnO(2)/C catalyst with high Ir content shows outstanding catalytic properties with the most negative EOR onset potential and reasonably good selectivity toward ethanol complete oxidation to CO(2).

  14. LABORATORY GAS-PHASE DETECTION OF THE CYCLOPROPENYL CATION (c-C{sub 3}H{sub 3} {sup +})

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Dongfeng; Doney, Kirstin D.; Linnartz, Harold, E-mail: zhao@strw.leidenuniv.nl [Sackler Laboratory for Astrophysics, Leiden Observatory, University of Leiden, PO Box 9513, NL 2300 RA Leiden (Netherlands)

    2014-08-20

    The cyclopropenyl cation (c-C{sub 3}H{sub 3} {sup +}) is the smallest aromatic hydrocarbon molecule and considered to be a pivotal intermediate in ion-molecule reactions in space. An astronomical identification has been prohibited so far, because of a lack of gas-phase data. Here we report the first high resolution infrared laboratory gas-phase spectrum of the ν {sub 4} (C-H asymmetric stretching) fundamental band of c-C{sub 3}H{sub 3} {sup +}. The c-C{sub 3}H{sub 3} {sup +} cations are generated in supersonically expanding planar plasma by discharging a propyne/helium gas pulse, yielding a rotational temperature of ∼35 K. The absorption spectrum is recorded in the 3.19 μm region using sensitive continuous-wave cavity ring-down spectroscopy. The analysis of about 130 ro-vibrational transitions results in precise spectroscopic parameters. These constants allow for an accurate comparison with high-level theoretical predictions, and provide the relevant information needed to search for this astrochemically relevant carbo-cation in space.

  15. SiC-C Composite as A Highly Stable and Easily Regenerable Photothermal Material for Practical Water Evaporation

    KAUST Repository

    Shi, Le

    2018-05-26

    Solar-driven water distillation by photothermal materials is emerging as a promising way of renewable energy-driven clean water production. In designing photothermal materials, light absorption, photo-to-thermal conversion efficiency, and ability to localize thermal energy at the water-air interface are three important considerations. However, one additional consideration, regenerability, has so far slipped out of the photothermal material designs at status quo. This work reveals that there is a fouling layer formed during photothermal evaporation of real seawater (Red Sea water) and domestic wastewater, which once formed, would be difficult to remove. Herein, we synthesize a SiC-C composite monolith as an effective photothermal material where carbon acts as photothermal component and SiC serves as a heat conductor and strong structural support. The high mechanical strength of the monolithic composite makes it able to withstand repeatedly high strength physical cleaning by brush scrubbing and sonication and the anti-carbon-loss mechanism generates zero carbon loss during the physical cleaning. In the case of the domestic wastewater evaporation, the bio- and organic foulants on the SiC-C composite monolith can be totally removed by annealing at 1000 oC in N2 atmosphere. We believe that the SiC-C composite monoliths are promising photothermal materials in practical solar-driven water evaporation applications thanks to their highly stable and easily regenerable properties and therefore more research efforts are warranted to further improve their performances.

  16. Reductive Elimination Leading to C-C Bond Formation in Gold(III) Complexes: A Mechanistic and Computational Study.

    Science.gov (United States)

    Rocchigiani, Luca; Fernandez-Cestau, Julio; Budzelaar, Peter H M; Bochmann, Manfred

    2018-06-21

    The factors affecting the rates of reductive C-C cross-coupling reactions in gold(III) aryls were studied by using complexes that allow easy access to a series of electronically modified aryl ligands, as well as to gold methyl and vinyl complexes, by using the pincer compounds [(C^N^C)AuR] (R=C 6 F 5 , CH=CMe 2 , Me and p-C 6 H 4 X, where X=OMe, F, H, tBu, Cl, CF 3 , or NO 2 ) as starting materials (C^N^C=2,6-(4'-tBuC 6 H 3 ) 2 pyridine dianion). Protodeauration followed by addition of one equivalent SMe 2 leads to the quantitative generation of the thioether complexes [(C^N-CH)AuR(SMe 2 )] + . Upon addition of a second SMe 2 pyridine is displaced, which triggers the reductive aryl-R elimination. The rates for these cross-couplings increase in the sequence k(vinyl)>k(aryl)≫k(C 6 F 5 )>k(Me). Vinyl-aryl coupling is particularly fast, 1.15×10 -3  L mol -1  s -1 at 221 K, whereas both C 6 F 5 and Me couplings encountered higher barriers for the C-C bond forming step. The use of P(p-tol) 3 in place of SMe 2 greatly accelerates the C-C couplings. Computational modelling shows that in the C^N-bonded compounds displacement of N by a donor L is required before the aryl ligands can adopt a conformation suitable for C-C bond formation, so that elimination takes place from a four-coordinate intermediate. The C-C bond formation is the rate-limiting step. In the non-chelating case, reductive C(sp 2 )-C(sp 2 ) elimination from three-coordinate ions [(Ar 1 )(Ar 2 )AuL] + is almost barrier-free, particularly if L=phosphine. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Metal-organic cooperative catalysis in C-H and C-C bond activation and its concurrent recovery.

    Science.gov (United States)

    Park, Young Jun; Park, Jung-Woo; Jun, Chul-Ho

    2008-02-01

    The development of an efficient catalytic activation (cleavage) system for C-H and C-C bonds is an important challenge in organic synthesis, because these bonds comprise a variety of organic molecules such as natural products, petroleum oils, and polymers on the earth. Among many elegant approaches utilizing transition metals to activate C-H and C-C bonds facilely, chelation-assisted protocols based on the coordinating ability of an organic moiety have attracted great attention, though they have often suffered from the need for an intact coordinating group in a substrate. In this Account, we describe our entire efforts to activate C-H or C-C bonds adjacent to carbonyl groups by employing a new concept of metal-organic cooperative catalysis (MOCC), which enables the temporal installation of a 2-aminopyridyl group into common aldehydes or ketones in a catalytic way. Consequently, a series of new catalytic reactions such as alcohol hydroacylation, oxo-ester synthesis, C-C triple bond cleavage, hydrative dimerization of alkynes, and skeletal rearrangements of cyclic ketones was realized through MOCC. In particular, in the quest for an optimized MOCC system composed of a Wilkinson's catalyst (Ph 3P) 3RhCl and an organic catalyst (2-amino-3-picoline), surprising efficiency enhancements could be achieved when benzoic acid and aniline were introduced as promoters for the aldimine formation process. Furthermore, a notable accomplishment of C-C bond activation has been made using 2-amino-3-picoline as a temporary chelating auxiliary in the reactions of unstrained ketones with various terminal olefins and Wilkinson's catalyst. In the case of seven-membered cyclic ketones, an interesting ring contraction to five- or six-membered ones takes place through skeletal rearrangements initiated by the C-C bond activation of MOCC. On the other hand, the fundamental advances of these catalytic systems into recyclable processes could be achieved by immobilizing both metal and organic

  18. Thermal fatigue behavior of C/C composites modified by SiC-MoSi2-CrSi2 coating

    International Nuclear Information System (INIS)

    Chu Yanhui; Fu Qiangang; Li Hejun; Li Kezhi

    2011-01-01

    Highlights: → The low-density C/C composites were modified by SiC-MoSi 2 -CrSi 2 multiphase coating by pack cementation. → The thermal fatigue behavior of the modified C/C composites was studied after undergoing thermal cycling for 20 times under the different environments. → The decrease of the flexural strength of the modified C/C composites during thermal cycle in air was primarily attributed to the partial oxidation of the modified C/C samples. - Abstract: Carbon/carbon (C/C) composites were modified by SiC-MoSi 2 -CrSi 2 multiphase coating by pack cementation, and their thermal fatigue behavior under thermal cycling in Ar and air environments was investigated. The modified C/C composites were characterized by scanning electron microscopy and X-ray diffraction. Results of tests show that, after 20-time thermal cycles between 1773 K and room temperature in Ar environment, the flexural strength of modified C/C samples decreased lightly and the percentage of remaining strength was 94.92%. While, after thermal cycling between 1773 K and room temperature in air for 20 times, the weight loss of modified C/C samples was 5.1%, and the flexural strength of the modified C/C samples reduced obviously and the percentage of remaining strength was only 75.22%. The fracture mode of modified C/C samples changed from a brittle behavior to a pseudo-plastic one as the service environment transformed from Ar to air. The decrease of the flexural strength during thermal cycle in air was primarily attributed to the partial oxidation of modified C/C samples.

  19. Production of strange resonances in C+C and Pb+Pb collisions at 158 AGeV

    CERN Document Server

    Friese, V

    2002-01-01

    The experiment NA49 at the CERN-SPS measures $\\phi$ , $K*(892)_0$ and $\\Lambda$ (1520) through their hadronic decay channels. For the $\\phi$ meson we present the evolution of transverse spectra and total yields from p+p over C+C to Pb+Pb at various centralities. The $K*(892)_0$ yield is given for different centralities in Pb+Pb. The yield of $\\Lambda$ (1520) in central Pb+Pb is compared to that obtained in p+p and p+Pb collisions at the same beam energy. (4 refs).

  20. Cu-catalyzed esterification reaction via aerobic oxygenation and C-C bond cleavage: an approach to α-ketoesters.

    Science.gov (United States)

    Zhang, Chun; Feng, Peng; Jiao, Ning

    2013-10-09

    The Cu-catalyzed novel aerobic oxidative esterification reaction of 1,3-diones for the synthesis of α-ketoesters has been developed. This method combines C-C σ-bond cleavage, dioxygen activation and oxidative C-H bond functionalization, as well as provides a practical, neutral, and mild synthetic approach to α-ketoesters which are important units in many biologically active compounds and useful precursors in a variety of functional group transformations. A plausible radical process is proposed on the basis of mechanistic studies.

  1. Aryl Insertion vs Aryl-Aryl Coupling in C,C-Chelated Organoborates: The "Missing Link" of Tetraarylborate Photochemistry.

    Science.gov (United States)

    Radtke, Julian; Mellerup, Soren K; Bolte, Michael; Lerner, Hans-Wolfram; Wang, Suning; Wagner, Matthias

    2018-06-14

    The photoreactivity of 9-borafluorene-based, C,C-chelated organoborates was investigated. Unlike the related tetraarylborates, the charge-transfer transitions imparted by the biphenyl chelate lead to selective insertion of one aryl substituent into the endocyclic B-C bond of the 9-borafluorene moiety, resulting in the formation of boratanorcaradienes. This photoreaction likely proceeds according to a Zimmerman rearrangement, which is analogous to one of the initially proposed mechanisms for tetraarylborates and provides additional insight into these long-debated photochemical reactions.

  2. Fibulin-1C, C1 esterase inhibitor and glucose regulated protein 75 interact with the CREC proteins, calumenin and reticulocalbin

    DEFF Research Database (Denmark)

    Hansen, Gry Aune Westergaard; Ludvigsen, Maja; Jacobsen, Christian

    2015-01-01

    Affinity purification, immunoprecipitation, gel electrophoresis and mass spectrometry were used to identify fibulin-1C, C1 esterase inhibitor and glucose regulated protein 75, grp75, as binding partners of the CREC proteins, calumenin and reticulocalbin. Surface plasmon resonance was used to verify...... the interaction of all three proteins with each of the CREC proteins. Fibulin-1C interacts with calumenin and reticulocalbin with an estimated dissociation constant around 50-60 nM. The interaction, at least for reticulocalbin, was not dependent upon the presence of Ca2+. C1 esterase inhibitor interacted...

  3. Numerical modelling of micro-machining of f.c.c. single crystal: Influence of strain gradients

    KAUST Repository

    Demiral, Murat

    2014-11-01

    A micro-machining process becomes increasingly important with the continuous miniaturization of components used in various fields from military to civilian applications. To characterise underlying micromechanics, a 3D finite-element model of orthogonal micro-machining of f.c.c. single crystal copper was developed. The model was implemented in a commercial software ABAQUS/Explicit employing a user-defined subroutine VUMAT. Strain-gradient crystal-plasticity and conventional crystal-plasticity theories were used to demonstrate the influence of pre-existing and evolved strain gradients on the cutting process for different combinations of crystal orientations and cutting directions. Crown Copyright © 2014.

  4. Method 446.0: In Vitro Determination of Chlorophylls a, b, c + c and Pheopigments in 1 2Marine And Freshwater Algae by Visible Spectrophotometry

    Science.gov (United States)

    This method provides a procedure for determination of chlorophylls a (chl a), b (chl b), c + c 1 2 (chl c + c ) and pheopigments of chlorophyll a (pheo a) 1 2 found in marine and freshwater phytoplankton. Chlorophyllide a is determined as chl a. Visible wavelength spectrophotomet...

  5. A Discrete Event Simulation Model for Evaluating the Performances of an M/G/C/C State Dependent Queuing System

    Science.gov (United States)

    Khalid, Ruzelan; M. Nawawi, Mohd Kamal; Kawsar, Luthful A.; Ghani, Noraida A.; Kamil, Anton A.; Mustafa, Adli

    2013-01-01

    M/G/C/C state dependent queuing networks consider service rates as a function of the number of residing entities (e.g., pedestrians, vehicles, and products). However, modeling such dynamic rates is not supported in modern Discrete Simulation System (DES) software. We designed an approach to cater this limitation and used it to construct the M/G/C/C state-dependent queuing model in Arena software. Using the model, we have evaluated and analyzed the impacts of various arrival rates to the throughput, the blocking probability, the expected service time and the expected number of entities in a complex network topology. Results indicated that there is a range of arrival rates for each network where the simulation results fluctuate drastically across replications and this causes the simulation results and analytical results exhibit discrepancies. Detail results that show how tally the simulation results and the analytical results in both abstract and graphical forms and some scientific justifications for these have been documented and discussed. PMID:23560037

  6. MIL-100-Fe derived N-doped Fe/Fe3C@C electrocatalysts for efficient oxygen reduction reaction

    Science.gov (United States)

    Guo, Dakai; Han, Sancan; Wang, Jiacheng; Zhu, Yufang

    2018-03-01

    N-doped porous Fe/Fe3C@C electrocatalysts were prepared by the pyrolysis of the hexamethylenetetramine (HMT)-incorporated MIL-100-Fe at different temperatures (700-1000 °C) under N2 atmosphere. Rotary evaporation of MIL-100-Fe and HMT solution could make more N-enriched HMT molecules enter into the pores of MIL-100-Fe, thus improving nitrogen contents of the final pyrolyzed samples. All pyrolyzed samples show porous textures with middle specific surface areas. The X-ray photoelectron spectroscopy (XPS) results demonstrate the successful introduction of N atoms into carbon framework. Sample Fe-N2-800 prepared by annealing the precursors with the HMT/MIL-100-Fe weight ratio of 2 at 800 °C exhibits the best electrocatalytic activity towards the oxygen reduction reaction (ORR) in terms of onset potential and current density because of high graphitic N and pyridinic N content. The enwrapped Fe/Fe3C nanoparticles and Fe-Nx active sites in these samples could also boost the ORR activity synergistically. Moreover, sample Fe-N2-800 demonstrates a dominant four electron reduction process, as well as excellent long-term operation stability and methanol crossover resistance. Thus, the N-doped Fe/Fe3C@C composites derived from the HMT-incorporated MIL-100-Fe are promising electrocatalysts to replace Pt/C for ORR in practical applications.

  7. The methylenetetrahydrofolate reductase c.c.677 C>T and c.c.1298 A>C polymorphisms in reproductive failures: Experience from an RSA and RIF study on a Polish population.

    Science.gov (United States)

    Nowak, Izabela; Bylińska, Aleksandra; Wilczyńska, Karolina; Wiśniewski, Andrzej; Malinowski, Andrzej; Wilczyński, Jacek R; Radwan, Paweł; Radwan, Michał; Barcz, Ewa; Płoski, Rafał; Motak-Pochrzęst, Hanna; Banasik, Małgorzata; Sobczyński, Maciej; Kuśnierczyk, Piotr

    2017-01-01

    Almost 1600 individuals from the Polish population were recruited to this study. Among them 319 were fertile couples, 289 were recurrent spontaneous abortion (RSA) couples, and 131 were in the group of recurrent implantation failure (RIF) following in vitro fertilization. The aim of this study was to evaluate the MTHFR c.c.677 C>T and c.c.1298 A>C polymorphisms' association with RSA and RIF. We used PCR-RFLP with HinfI (677 C>T) and MboII (1298 A>C) digestion. We observed a protective effect of the female AC genotype (OR = 0.64, p = 0.01) and the C allele (AC+CC genotypes; OR = 0.65, p = 0.009) against RSA. Moreover, 1298 AA/677 CT women were more frequent in RSA (31.14%) and RIF (25.20%) groups in comparison to fertile women (22.88%), although this difference was significant only in the case of RSA (p = 0.022, OR = 1.52). Male combined genotype analysis revealed no association with reproductive failure of their partners. Nevertheless, the female/male combination AA/AC of the 1298 polymorphism was more frequent in RSA couples (p = 0.049, OR = 1.49). However, the significant results became insignificant after Bonferroni correction. In addition, analysis of haplotypes showed significantly higher frequency of the C/C haplotype (1298 C/677 C) in the female control group than in the female RSA group (p = 0.03, OR = 0.77). Moreover, the association between elevated homocysteine (Hcy) level in plasma of RSA and RIF women and MTHFR polymorphisms was investigated but did not reveal significant differences. In conclusion, for clinical practice, it is better to check the homocysteine level in plasma and, if the Hcy level is increased, to recommend patients to take folic acid supplements rather than undergo screening of MTHFR for 1298 A>C and 677 C>T polymorphisms.

  8. Symmetry breaking and spectral considerations of the surprisingly floppy c-C3H radical and the related dipole-bound excited state of c-C3H-

    Science.gov (United States)

    Bassett, Matthew K.; Fortenberry, Ryan C.

    2017-06-01

    The C3H radical is believed to be prevalent throughout the interstellar medium and may be involved in the formation of polycyclic aromatic hydrocarbons. C3H exists as both a linear and a cyclic isomer. The C2 v cyclopropenylidenyl radical isomer was detected in the dark molecular cloud TMC-1, and the linear propenylidenyl radical isomer has been observed in various dark molecular clouds. Even though the c-C3H radical has been classified rotationally, the vibrational frequencies of this seemingly important interstellar molecule have never been directly observed. Established, highly accurate quartic force field methodologies are employed here to compute useful geometrical data, spectroscopic constants, and vibrational frequencies. The computed rotational constants are consistent with the experimental results. Consequently, the three a1 (ν1, ν2, and ν3) and one b1 (ν6) anharmonic vibrational frequencies at 3117.7 cm-1, 1564.3 cm-1, 1198.5 cm-1, and 826.7 cm-1, respectively, are reliable predictions for these, as of yet unseen, observables. Unfortunately, the two b2 fundamentals (ν4 and ν5) cannot be treated adequately in the current approach due to a flat and possible double-well potential described in detail herein. The dipole-bound excited state of the anion suffers from the same issues and may not even be bound. However, the trusted fundamental vibrational frequencies described for the neutral radical should not be affected by this deformity and are the first robustly produced for c-C3H. The insights gained here will also be applicable to other structures containing three-membered bare and exposed carbon rings that are surprisingly floppy in nature.

  9. Reactive carbon-chain molecules: synthesis of 1-diazo-2,4-pentadiyne and spectroscopic characterization of triplet pentadiynylidene (H-C[triple bond]C-:C-C[triple bond]C-H).

    Science.gov (United States)

    Bowling, Nathan P; Halter, Robert J; Hodges, Jonathan A; Seburg, Randal A; Thomas, Phillip S; Simmons, Christopher S; Stanton, John F; McMahon, Robert J

    2006-03-15

    1-Diazo-2,4-pentadiyne (6a), along with both monodeuterio isotopomers 6b and 6c, has been synthesized via a route that proceeds through diacetylene, 2,4-pentadiynal, and 2,4-pentadiynal tosylhydrazone. Photolysis of diazo compounds 6a-c (lambda > 444 nm; Ar or N2, 10 K) generates triplet carbenes HC5H (1) and HC5D (1-d), which have been characterized by IR, EPR, and UV/vis spectroscopy. Although many resonance structures contribute to the resonance hybrid for this highly unsaturated carbon-chain molecule, experiment and theory reveal that the structure is best depicted in terms of the dominant resonance contributor of penta-1,4-diyn-3-ylidene (diethynylcarbene, H-C[triple bond]C-:C-C[triple bond]C-H). Theory predicts an axially symmetric (D(infinity h)) structure and a triplet electronic ground state for 1 (CCSD(T)/ANO). Experimental IR frequencies and isotope shifts are in good agreement with computed values. The triplet EPR spectrum of 1 (absolute value(D/hc) = 0.6157 cm(-1), absolute value(E/hc) = 0.0006 cm(-1)) is consistent with an axially symmetric structure, and the Curie law behavior confirms that the triplet state is the ground state. The electronic absorption spectrum of 1 exhibits a weak transition near 400 nm with extensive vibronic coupling. Chemical trapping of triplet HC5H (1) in an O2-doped matrix affords the carbonyl oxide 16 derived exclusively from attack at the central carbon.

  10. Direct approaches to nitriles via highly efficient nitrogenation strategy through C-H or C-C bond cleavage.

    Science.gov (United States)

    Wang, Teng; Jiao, Ning

    2014-04-15

    Because of the importance of nitrogen-containing compounds in chemistry and biology, organic chemists have long focused on the development of novel methodologies for their synthesis. For example, nitrogen-containing compounds show up within functional materials, as top-selling drugs, and as bioactive molecules. To synthesize these compounds in a green and sustainable way, researchers have focused on the direct functionalization of hydrocarbons via C-H or C-C bond cleavage. Although researchers have made significant progress in the direct functionalization of simple hydrocarbons, direct C-N bond formation via C-H or C-C bond cleavage remains challenging, in part because of the unstable character of some N-nucleophiles under oxidative conditions. The nitriles are versatile building blocks and precursors in organic synthesis. Recently, chemists have achieved the direct C-H cyanation with toxic cyanide salts in the presence of stoichiometric metal oxidants. In this Account, we describe recent progress made by our group in nitrile synthesis. C-H or C-C bond cleavage is a key process in our strategy, and azides or DMF serve as the nitrogen source. In these reactions, we successfully realized direct nitrile synthesis using a variety of hydrocarbon groups as nitrile precursors, including methyl, alkenyl, and alkynyl groups. We could carry out C(sp(3))-H functionalization on benzylic, allylic, and propargylic C-H bonds to produce diverse valuable synthetic nitriles. Mild oxidation of C═C double-bonds and C≡C triple-bonds also produced nitriles. The incorporation of nitrogen within the carbon skeleton typically involved the participation of azide reagents. Although some mechanistic details remain unclear, studies of these nitrogenation reactions implicate the involvement of a cation or radical intermediate, and an oxidative rearrangement of azide intermediate produced the nitrile. We also explored environmentally friendly oxidants, such as molecular oxygen, to make our

  11. Chemoselective Radical Dehalogenation and C-C Bond Formation on Aryl Halide Substrates Using Organic Photoredox Catalysts.

    Science.gov (United States)

    Poelma, Saemi O; Burnett, G Leslie; Discekici, Emre H; Mattson, Kaila M; Treat, Nicolas J; Luo, Yingdong; Hudson, Zachary M; Shankel, Shelby L; Clark, Paul G; Kramer, John W; Hawker, Craig J; Read de Alaniz, Javier

    2016-08-19

    Despite the number of methods available for dehalogenation and carbon-carbon bond formation using aryl halides, strategies that provide chemoselectivity for systems bearing multiple carbon-halogen bonds are still needed. Herein, we report the ability to tune the reduction potential of metal-free phenothiazine-based photoredox catalysts and demonstrate the application of these catalysts for chemoselective carbon-halogen bond activation to achieve C-C cross-coupling reactions as well as reductive dehalogenations. This procedure works both for conjugated polyhalides as well as unconjugated substrates. We further illustrate the usefulness of this protocol by intramolecular cyclization of a pyrrole substrate, an advanced building block for a family of natural products known to exhibit biological activity.

  12. libstable: Fast, Parallel, and High-Precision Computation of α-Stable Distributions in R, C/C++, and MATLAB

    Directory of Open Access Journals (Sweden)

    Javier Royuela-del-Val

    2017-06-01

    Full Text Available α-stable distributions are a family of well-known probability distributions. However, the lack of closed analytical expressions hinders their application. Currently, several tools have been developed to numerically evaluate their density and distribution functions or to estimate their parameters, but available solutions either do not reach sufficient precision on their evaluations or are excessively slow for practical purposes. Moreover, they do not take full advantage of the parallel processing capabilities of current multi-core machines. Other solutions work only on a subset of the α-stable parameter space. In this paper we present an R package and a C/C++ library with a MATLAB front-end that permit parallelized, fast and high precision evaluation of density, distribution and quantile functions, as well as random variable generation and parameter estimation of α-stable distributions in their whole parameter space. The described library can be easily integrated into third party developments.

  13. When ab ≠ c - c': published errors in the reports of single-mediator models.

    Science.gov (United States)

    Petrocelli, John V; Clarkson, Joshua J; Whitmire, Melanie B; Moon, Paul E

    2013-06-01

    Accurate reports of mediation analyses are critical to the assessment of inferences related to causality, since these inferences are consequential for both the evaluation of previous research (e.g., meta-analyses) and the progression of future research. However, upon reexamination, approximately 15% of published articles in psychology contain at least one incorrect statistical conclusion (Bakker & Wicherts, Behavior research methods, 43, 666-678 2011), disparities that beget the question of inaccuracy in mediation reports. To quantify this question of inaccuracy, articles reporting standard use of single-mediator models in three high-impact journals in personality and social psychology during 2011 were examined. More than 24% of the 156 models coded failed an equivalence test (i.e., ab = c - c'), suggesting that one or more regression coefficients in mediation analyses are frequently misreported. The authors cite common sources of errors, provide recommendations for enhanced accuracy in reports of single-mediator models, and discuss implications for alternative methods.

  14. Synthesis of SiC decorated carbonaceous nanorods and its hierarchical composites Si@SiC@C for high-performance lithium ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chundong [School of Optical and Electronic Information, Huazhong University of Science and Technology, Wuhan 430074 (China); Center of Super-Diamond and Advanced Films (COSDAF), Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China); Li, Yi, E-mail: liyi@suda.edu.cn [College of Chemistry, Chemical Engineering and Materials Science, Soochow University, Suzhou (China); Center of Super-Diamond and Advanced Films (COSDAF), Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China); Ostrikov, Kostya [School of Chemistry, Physics and Mechanical Engineering, Queensland University of Technology, Brisbane, Queensland 4000 (Australia); Plasma Nanoscience, Industrial Innovation Program, CSIRO Manufacturing Flagship, Lindfield, New South Wales 2070 (Australia); Yang, Yonggang [College of Chemistry, Chemical Engineering and Materials Science, Soochow University, Suzhou (China); Zhang, Wenjun, E-mail: apwjzh@cityu.edu.hk [Center of Super-Diamond and Advanced Films (COSDAF), Department of Physics and Materials Science, City University of Hong Kong, Hong Kong SAR (China)

    2015-10-15

    SiC- based nanomaterials possess superior electric, thermal and mechanical properties. However, due to the tricky synthesis process, which needs to be carried out under high temperature with multi-step reaction procedures, the further application is dramatically limited. Herein, a simple as well as a controllable approach is proposed for synthesis of SiC- based nanostructures under low temperature. Phenyl-bridged polysilsesquioxane was chosen as the starting material to react with magnesium at 650 °C, following which SiC@C nanocomposites were finally obtained, and it maintains the original bent rod-like architecture of polysilsesquioxanes. The possible formation process for the nanocomposites can proposed as well. The electrochemical behaviour of nanocomposites was accessed, verifying that the synthesized SiC@C nanocomposites deliver good electrochemical performance. Moreover, SiC@C also shows to be a promising scaffold in supporting Si thin film electrode in achieving stable cycling performance in lithium ion batteries. - Highlights: • SiC@C bent nanorods were synthesized with a magnesium reaction approach. • Carbon nanorod spines studded with ultrafine β-SiC nanocrystallines was realized. • The synthesized SiC@C keeps the original rod-like structure of polysilsesquioxanes. • The possible formation process for the nanocomposites was analysed and proposed. • Si@SiC@C nanocomposites reveal good electrochemical performance in LIBs.

  15. c-C5H5 on a Ni(1 1 1) surface: Theoretical study of the adsorption, electronic structure and bonding

    International Nuclear Information System (INIS)

    German, E.; Simonetti, S.; Pronsato, E.; Juan, A.; Brizuela, G.

    2008-01-01

    In the present work the ASED-MO method is applied to study the adsorption of cyclopentadienyl anion on a Ni(1 1 1) surface. The adsorption with the centre of the aromatic ring placed above the hollow position has been identified to be energetically the most favourable. The aromatic ring remains almost flat, the H atoms are tilted 17 deg. away from the metal surface. We modelled the metal surface by a two-dimensional slab of finite thickness, with an overlayer of c-C 5 H 5 - , one c-C 5 H 5 - per nine surface Ni atoms. The c-C 5 H 5 - molecule is attached to the surface with its five C atoms bonding mainly with three Ni atoms. The Ni-Ni bond in the underlying surface and the C-C bonds of c-C 5 H 5 - are weakened upon adsorption. We found that the band of Ni 5d z 2 orbitals plays an important role in the bonding between c-C 5 H 5 - and the surface, as do the Ni 6s and 6p z bands

  16. Fibulin-1C, C1 Esterase Inhibitor and Glucose Regulated Protein 75 Interact with the CREC Proteins, Calumenin and Reticulocalbin.

    Directory of Open Access Journals (Sweden)

    Gry Aune Westergaard Hansen

    Full Text Available Affinity purification, immunoprecipitation, gel electrophoresis and mass spectrometry were used to identify fibulin-1C, C1 esterase inhibitor and glucose regulated protein 75, grp75, as binding partners of the CREC proteins, calumenin and reticulocalbin. Surface plasmon resonance was used to verify the interaction of all three proteins with each of the CREC proteins. Fibulin-1C interacts with calumenin and reticulocalbin with an estimated dissociation constant around 50-60 nM. The interaction, at least for reticulocalbin, was not dependent upon the presence of Ca2+. C1 esterase inhibitor interacted with both proteins with an estimated dissociation constant at 1 μM for reticulocalbin and 150 nM for calumenin. The interaction, at least for calumenin, was dependent upon the presence of Ca2+ with strong interaction at 3.5 mM while no detectable interaction could be found at 0.1 mM. Grp75 binds with an affinity of approximately 3-7 nM with reticulocalbin as well as with calumenin. These interactions suggest functional participation of the CREC proteins in chaperone activity, cell proliferation and transformation, cellular aging, haemostasis and thrombosis as well as modulation of the complement system in fighting bacterial infection.

  17. C-C motif ligand 5 promotes migration of prostate cancer cells in the prostate cancer bone metastasis microenvironment.

    Science.gov (United States)

    Urata, Satoko; Izumi, Kouji; Hiratsuka, Kaoru; Maolake, Aerken; Natsagdorj, Ariunbold; Shigehara, Kazuyoshi; Iwamoto, Hiroaki; Kadomoto, Suguru; Makino, Tomoyuki; Naito, Renato; Kadono, Yoshifumi; Lin, Wen-Jye; Wufuer, Guzailinuer; Narimoto, Kazutaka; Mizokami, Atsushi

    2018-03-01

    Chemokines and their receptors have key roles in cancer progression. The present study investigated chemokine activity in the prostate cancer bone metastasis microenvironment. Growth and migration of human prostate cancer cells were assayed in cocultures with bone stromal cells. The migration of LNCaP cells significantly increased when co-cultured with bone stromal cells isolated from prostate cancer bone metastases. Cytokine array analysis of conditioned medium from bone stromal cell cultures identified CCL5 as a concentration-dependent promoter of LNCaP cell migration. The migration of LNCaP cells was suppressed when C-C motif ligand 5 (CCL5) neutralizing antibody was added to cocultures with bone stromal cells. Knockdown of androgen receptor with small interfering RNA increased the migration of LNCaP cells compared with control cells, and CCL5 did not promote the migration of androgen receptor knockdown LNCaP. Elevated CCL5 secretion in bone stromal cells from metastatic lesions induced prostate cancer cell migration by a mechanism consistent with CCL5 activity upstream of androgen receptor signaling. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  18. Coupling Mo2C@C core-shell nanocrystals on 3D graphene hybrid aerogel for high-performance lithium ion battery

    Science.gov (United States)

    Xin, Hailin; Hai, Yang; Li, Dongzhi; Qiu, Zhaozheng; Lin, Yemao; Yang, Bo; Fan, Haosen; Zhu, Caizhen

    2018-05-01

    Hybrid aerogel by dispersing Mo2C@C core-shell nanocrystals into three-dimensional (3D) graphene (Mo2C@C-GA) has been successfully prepared through two-step methods. Firstly, carbon-coated MoO2 nanocrystals uniformly anchor on 3D graphene aerogel (MoO2@C-GA) via hydrothermal reaction. Then the MoO2@C-GA precursor is transformed into Mo2C@C-GA after the following carbonization process. Furthermore, the freeze-drying step plays an important role in the resulting pore size distribution of the porous networks. Moreover, graphene aerogels exhibit extremely low densities and superior electrical properties. When evaluated as anode material for lithium ion battery, Mo2C@C-GA delivers excellent rate capability and stable cycle performance when compared with C-GA and Mo2C nanoparticles. Mo2C@C-GA exhibits the initial discharge capacity of 1461.4 mA h g-1 at the current density of 0.1 A g-1, and retains a reversible capacity of 1089.8 mA h g-1 after 100 cycles at a current density of 0.1 A g-1. Even at high current density of 5 A g-1, a discharge capacity of 623.5 mA h g-1 can be still achieved. The excellent performance of Mo2C@C-GA could be attributed to the synergistic effect of Mo2C@C nanocrystals and the 3D graphene conductive network.

  19. The influence of FLiNaK salt impregnation on the mechanical properties of a 2D woven C/C composite

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Dongsheng, E-mail: zhangdongsheng@sinap.ac.cn; Xia, Huihao; Yang, Xinmei, E-mail: yangxinmei@sinap.ac.cn; Feng, Shanglei; Song, Jinliang; Zhou, Xingtai

    2017-03-15

    Impregnating of molten LiF-NaF-KF salt (LiF-NaF-KF: 46.5–11.5-42 mol%, FLiNaK) into a 2D woven C/C composite was performed at 650 °C under different pressure. The weight gain and mechanical properties change of the 2D woven C/C composite after FLiNaK salt impregnation were measured. The FLiNaK salt distribution into the 2D woven C/C composite was observed by X-ray computed tomography (X-ray CT) and scanning electron microscopy. The results showed that the weight gain of the 2D woven C/C composite increased with increasing impregnating pressure. In X-ray CT images, FLiNaK salt was distributed into the open pores and fissures among fiber bundles and neighboring plies. The interlaminar shear strength, compressive strength, and flexural strength of the 2D woven C/C composite increased with the increase of weight gain. The influence of FLiNaK salt impregnation on the mechanical properties was attributed to the coupling effect of re-densification of FLiNaK salt impregnation and residual stress formed in 2D woven C/C composite. - Highlights: • FLiNaK salt was distributed into the open pores and fissures among fiber bundles. • The mechanical properties of the 2D woven C/C composite increased with the increase of weight gain. • The influence of FLiNaK was attributed to the re-densification of FLiNaK salt and residual stress.

  20. Rhodium-Catalyzed C-C Bond Formation via Heteroatom-Directed C-H Bond Activation

    Energy Technology Data Exchange (ETDEWEB)

    Colby, Denise; Bergman, Robert; Ellman, Jonathan

    2010-05-13

    Once considered the 'holy grail' of organometallic chemistry, synthetically useful reactions employing C-H bond activation have increasingly been developed and applied to natural product and drug synthesis over the past decade. The ubiquity and relative low cost of hydrocarbons makes C-H bond functionalization an attractive alternative to classical C-C bond forming reactions such as cross-coupling, which require organohalides and organometallic reagents. In addition to providing an atom economical alternative to standard cross - coupling strategies, C-H bond functionalization also reduces the production of toxic by-products, thereby contributing to the growing field of reactions with decreased environmental impact. In the area of C-C bond forming reactions that proceed via a C-H activation mechanism, rhodium catalysts stand out for their functional group tolerance and wide range of synthetic utility. Over the course of the last decade, many Rh-catalyzed methods for heteroatom-directed C-H bond functionalization have been reported and will be the focus of this review. Material appearing in the literature prior to 2001 has been reviewed previously and will only be introduced as background when necessary. The synthesis of complex molecules from relatively simple precursors has long been a goal for many organic chemists. The ability to selectively functionalize a molecule with minimal pre-activation can streamline syntheses and expand the opportunities to explore the utility of complex molecules in areas ranging from the pharmaceutical industry to materials science. Indeed, the issue of selectivity is paramount in the development of all C-H bond functionalization methods. Several groups have developed elegant approaches towards achieving selectivity in molecules that possess many sterically and electronically similar C-H bonds. Many of these approaches are discussed in detail in the accompanying articles in this special issue of Chemical Reviews. One approach

  1. Chemokine (C-C motif ligand 20, a potential biomarker for Graves' disease, is regulated by osteopontin.

    Directory of Open Access Journals (Sweden)

    Xiaoli Li

    Full Text Available CONTEXT: Graves' disease (GD is a common autoimmune disease involving the thyroid gland. The altered balance of pro- and anti-inflammatory cytokines plays an important role in the pathogenesis of GD. Chemokine (C-C motif ligand 20 (CCL20 is important for interleukin-17 (IL-17 signal activation and a potent chemoattractant for Th17 cells. Meanwhile, Osteopontin (OPN, a broadly expressed pleiotropic cytokine, has been implicated in GD through inducing Th1-involved response to enhance the production of proinflammatory cytokines and chemokines, but little is known about the role of OPN in regulating CCL20 and IL-17 signaling. OBJECTIVE: This study sought to explore the possibility of CCL20 level as a biomarker for GD, as well as investigate the role of OPN in regulating CCL20 production. METHODS: Fifty untreated GD patients, fifteen euthyroid GD patients, twelve TRAb-negative GD patients and thirty-five healthy control donors were recruited. OPN, CCL20 and other clinical GD diagnosis parameters were measured. CD4+T cells were isolated from peripheral blood mononuclear cells (PBMCs using antibody-coated magnetic beads. Enzyme-linked immune-sorbent assay and quantitative polymerase chain reaction were used to determine CCL20 expression level. RESULTS: We found that the plasma CCL20 level was enhanced in GD patients and decreased in euthyroid and TRAb-negative GD patients. In addition, CCL20 level correlated with GD clinical diagnostic parameters and plasma OPN level. Moreover, we demonstrated that recombinant OPN and plasma from untreated GD patients increased the expression of CCL20 in CD4+T cells, which could be blocked by OPN antibody. Furthermore, we found that the effect of OPN on CCL20 expression was mediated by β3 integrin receptor, IL-17, NF-κB and MAPK pathways. CONCLUSIONS: These results demonstrated that CCL20 might serve as a biomarker for GD and suggested the possible role of OPN in induction of CCL20 expression.

  2. High Levels of Chemokine C-C Motif Ligand 20 in Human Milk and Its Production by Oral Keratinocytes.

    Science.gov (United States)

    Lourenço, Alan G; Komesu, Marilena C; Duarte, Geraldo; Del Ciampo, Luiz A; Mussi-Pinhata, Marisa M; Yamamoto, Aparecida Y

    2017-03-01

    Chemokine C-C motif ligand 20 (CCL20) is implicated in the formation and function of mucosal lymphoid tissues. Although CCL20 is secreted by many normal human tissues, no studies have evaluated the presence of CCL20 in human milk or its production by oral keratinocytes stimulated by human milk. To evaluate the presence of CCL20 in breast milk and verify CCL20 secretion in vitro by oral keratinocytes stimulated with human and bovine milk, as well as its possible association with breast milk lactoferrin levels. The levels of CCL20 and lactoferrin were measured by enzyme-linked immunosorbent assay in human milk at three different stages of maturation from 74 healthy breastfeeding mothers. In vitro, oral keratinocytes were stimulated with human and bovine milk, and CCL20 was measured in their supernatant. High concentrations of CCL20 were detected in the human breast milk samples obtained during the first week (1,777.07 pg/mL) and second week postpartum (1,523.44 pg/mL), with a significantly low concentration in samples at 3-6 weeks postpartum (238.42 pg/mL; p stimulated higher CCL20 secretion by oral keratinocytes compared with bovine milk (p stimulation had no association with breast milk lactoferrin concentration. CCl20 is present at high levels in human milk, predominantly in the first and second week postpartum, but at significantly lower levels at 3-6 weeks postpartum. Human milk is capable of stimulating CCL20 secretion by oral keratinocytes, and this induction had no association with breast milk lactoferrin concentration.

  3. Liderazgo de una empresa familiar que influye en el clima laboral de los trabajadores de la empresa SEDEMI S.C.C

    OpenAIRE

    Rodríguez Valenzuela, Darwin Fausto

    2015-01-01

    El presente trabajo detalla el estudio del liderazgo y su influencia en el clima organizacional de los trabajadores de la empresa familiar Sedemi S.C.C., con la fin de proponer opciones de mejora, que coadyuven al directorio de la empresa, para fomentar un ambiente laboral agradable y motivador para sus empleados, y de esta manera incrementar su desempeño laboral. La investigación se realizó en la empresa SEDEMI S.C.C. La población objetivo está conformada por los empleados administrativos y ...

  4. Processing and characterization of laser sintered hybrid B4C/cBN reinforced Ti-based metal matrix composite

    Science.gov (United States)

    Gupta, Ankit; Hussain, Manowar; Misra, Saurav; Das, Alok Kumar; Mandal, Amitava

    2018-06-01

    The purpose of this study is to make a boron carbide (B4C) and cubic boron nitride (cBN) reinforced Ti6Al4V metal matrix composites (MMC's) by direct metal laser sintering (DMLS) technique using the continuous wave (CW) SPI fiber laser and to check the feasibility of the formation of three dimensional objects by this process. For this study, the process parameters like laser power density (3.528-5.172 W/cm2 (×104), scanning speed (3500-4500 mm/min), composition of the reinforced materials B4C (5-25% by volume) and cBN (3% by volume) were taken as input variables and hatching gap (0.2 mm), spot diameter (0.4 mm), layer thickness (0.4 mm) were taken as constant. It was analyzed that surface characteristic, density and the mechanical properties of sintered samples were greatly influenced by varying the input process parameters. Field emission scanning electron microscopy (FESEM), Energy dispersive X-ray spectroscopy (EDX) and X-Ray diffraction (XRD) were performed for microstructural analysis, elemental analysis, and recognition of intermetallic compounds respectively. Mechanical properties like micro-hardness & wear rate were examined by Vickers micro-hardness tester & pin on disc arrangement respectively. From hardness tests, it was observed that hardness property of the sintered specimens was increased as compared to the parent material. The XRD results show that there is a good affinity between Ti6Al4V-B4C-cBN to produce various intermetallic compounds which themselves enhance the mechanical properties of the samples. From FESEM analysis, we can conclude that there is a uniform distribution of reinforcements in the titanium alloy matrix. Furthermore, the coefficient of friction (COF) was characterized by the irregular pattern and it tends to decrease with an increase in the volume % of reinforcement. The results obtained in this work may be useful in preparing the MMC's with improved mechanical properties and overall characteristics.

  5. Mechanical performance of Hi-Nicalon/CVI-SiC composites with multilayer SiC/C interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Halverson, H.G.; Carter, R.H.; Curtin, W.A. [Virginia Polytechnic Inst. and State Univ., Blacksburg, VA (United States). Dept. of Engineering Science and Mechanics

    1997-12-01

    The mechanical properties and interfacial characteristics of new SiC/SiC ceramic composites, composed of Hi-Nicalon fibers in a CVI-SiC matrix and having a variety of multilayer SiC/C coatings between the fibers and the matrix, are studied in detail to elucidate the roles of the coatings and fibers. Axial tension tests and unload/reload hysteresis loop measurements are performed to determine mechanical performance. All materials exhibit the strong and tough behavior characteristic of good ceramic composites, with all multilayer variants performing quite similarly. SEM microscopy demonstrates that matrix cracks penetrate through the multilayers and debond at the fiber/inner-coating interface. Analysis of the hysteretic behavior leads to values for interfacial sliding resistance {tau} {approx} 11 ksi and interfacial toughness {Gamma}{sub i} {approx} 2 J/m{sup 2} that are nearly independent of multilayer structure, and are similar to values obtained for standard pyrolitic carbon interfaces. These results all indicate debonding at the fiber surface for all coating structures, which provides a common roughness, {tau}, and {Gamma}{sub i}. Analysis of fiber fracture mirrors provides an estimate of the in-situ strength of the fibers and demonstrates the high strength retention of the Hi-Nicalon fibers. The in-situ fiber strengths are combined with the measured pullout lengths to obtain an independent determination of {tau} = 8.5 ksi that agrees well with the value found from the hysteretic behavior. Predictions of composite strength using the derived fiber strengths agree well with the measured value although the predicted failure strain is too large. This study demonstrates that Hi-Nicalon fiber/CVI-SiC composites perform well for a wide range of multilayer interface structures and that the interfaces present relatively high values of {tau} and {Gamma}{sub i}, both of which are beneficial to strength and toughness. The small carbon layer thicknesses in these multilayer

  6. Catalytic diastereoselective tandem conjugate addition-elimination reaction of Morita-Baylis-Hillman C adducts by C-C bond cleavage

    KAUST Repository

    Yang, Wenguo; Tan, Davin; Lee, Richmond; Li, Lixin; Pan, Yuanhang; Huang, Kuo-Wei; Tan, Choonhong; Jiang, Zhiyong

    2012-01-01

    Through the cleavage of the C-C bond, the first catalytic tandem conjugate addition-elimination reaction of Morita-Baylis-Hillman C adducts has been presented. Various S N2′-like C-, S-, and P-allylic compounds could be obtained with exclusive E

  7. Study of the unimolecular decompositions of the (C3H6)+2 and (c-C3H6)+2 complexes

    International Nuclear Information System (INIS)

    Tzeng, W.; Ono, Y.; Linn, S.H.; Ng, C.Y.

    1985-01-01

    The major product channels identified in the unimolecular decompositions ofC 3 H + 6 xC 3 H 6 and c-C 3 H + 6 xc-C 3 H 6 in the total energy [neutral (C 3 H 6 ) 2 or (c-C 3 H 6 ) 2 heat of formation plus excitation energy] range of approx.230--450 kcal/mol are C 3 H + 7 +C 3 H 5 , C 4 H + 7 +C 2 H 5 , C 4 H + 8 +C 2 H 4 , and C 5 H + 9 +CH 3 . The measured appearance energy for C 4 H + 7 (9.54 +- 0.04 eV) from (C 3 H 6 ) 2 is equal to the thermochemical threshold for the formation of C 4 H + 7 +C 2 H 5 from (C 3 H 6 ) 2 , indicating that the exit potential energy barrier for the ion--molecule reaction C 3 H + 6 +C 3 H 6 →C 4 H + 7 +C 2 H 5 is negligible. There is evidence that the formations of C 4 H + 7 +C 2 H 4 +H from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 also proceed with high probabilities when they are energetically allowed. The variations of the relative abundances for C 4 H + 7 ,C 4 H + 8 , and C 5 H + 9 from (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 as a function of ionizing photon energy are in qualitative agreement, suggesting that (C 3 H 6 ) + 2 and (c-C 3 H 6 ) + 2 rearrange to similar C 6 H + 12 isomers prior to fragmentation. The fact that C 6 H + 11 is found to be a primary ion from the unimolecular decomposition of (c-C 3 H 6 ) + 2 but not (C 3 H 6 ) + 2 supports the conclusion that the distribution of C 6 H + 12 collision complexes involved in the C 3 H + 6 +C 3 H 6 reactions is different from that in the cyclopropane ion--molecule reactions

  8. Catalyst-Dependent Chemoselective Formal Insertion of Diazo Compounds into C-C or C-H Bonds of 1,3-Dicarbonyl Compounds.

    Science.gov (United States)

    Liu, Zhaohong; Sivaguru, Paramasivam; Zanoni, Giuseppe; Anderson, Edward A; Bi, Xihe

    2018-05-08

    A catalyst-dependent chemoselective one-carbon insertion of diazo compounds into the C-C or C-H bonds of 1,3-dicarbonyl species is reported. In the presence of silver(I) triflate, diazo insertion into the C(=O)-C bond of the 1,3-dicarbonyl substrate leads to a 1,4-dicarbonyl product containing an all-carbon α-quaternary center. This reaction constitutes the first example of an insertion of diazo-derived carbenoids into acyclic C-C bonds. When instead scandium(III) triflate was applied as the catalyst, the reaction pathway switched to formal C-H insertion, affording 2-alkylated 1,3-dicarbonyl products. Different reaction pathways are proposed to account for this powerful catalyst-dependent chemoselectivity. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Measurement of low-mass e+e- pair production in 1 and 2 A GeV C-C collision with HADES

    International Nuclear Information System (INIS)

    Sudol, M.; Boyard, J.L.; Hennino, T.; Moriniere, E.; Ramstein, B.; Roy-Stephan, M.; Agakishiev, G.; Destefanis, M.; Gilardi, C.; Kirschner, D.; Kuehn, W.; Lange, J.S.; Metag, V.; Novotny, R.; Pechenov, V.; Pechenova, O.; Perez Cavalcanti, T.; Spataro, S.; Spruck, B.; Agodi, C.; Bellia, G.; Coniglione, R.; Finocchiaro, P.; Maiolino, C.; Piattelli, P.; Sapienza, P.; Balanda, A.; Dybczak, A.; Kozuch, A.; Otwinowski, J.; Przygoda, W.; Salabura, P.; Trebacz, R.; Wisniowski, M.; Wojcik, T.; Belver, D.; Cabanelas, P.; Duran, I.; Garzon, J.A.; Lamas-Valverde, J.; Marin, J.; Belyaev, A.; Chernenko, S.; Fateev, O.; Ierusalimov, A.; Zanevsky, Y.; Bielcik, J.; Braun-Munzinger, P.; Galatyuk, T.; Gonzalez-Diaz, D.; Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Muench, M.; Palka, M.; Pietraszko, J.; Rustamov, A.; Schroeder, C.; Schwab, E.; Simon, R.; Traxler, M.; Yurevich, S.; Zumbruch, P.; Blanco, A.; Ferreira-Marques, R.; Fonte, P.; Lopes, L.; Mangiarotti, A.; Bortolotti, A.; Iori, I.; Michalska, B.; Christ, T.; Eberl, T.; Fabbietti, L.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R.; Maier, L.; Sailer, B.; Schmah, A.; Weber, M.; Diaz, J.; Gil, A.; Dohrmann, F.; Grosse, E.; Kaempfer, B.; Kanaki, K.; Kotte, R.; Naumann, L.; Wuestenfeld, J.; Zhou, P.; Froehlich, I.; Heilmann, M.; Lorenz, M.; Markert, J.; Michel, J.; Muentz, C.; Pachmayer, Y.C.; Stroebele, H.; Sturm, C.; Tarantola, A.; Teilab, K.; Golubeva, M.; Guber, F.; Ivashkin, A.; Karavicheva, T.; Kurepin, A.; Lapidus, K.; Reshetin, A.; Sadovsky, A.; Krasa, A.; Krizek, F.; Kugler, A.; Pospisil, V.; Sobolev, Yu.G.; Tlusty, P.; Wagner, V.; Mousa, J.; Parpottas, Y.; Tsertos, H.; Stroth, J.

    2009-01-01

    HADES is a secondary generation experiment operated at GSI Darmstadt with the main goal to study dielectron production in proton, pion and heavy ion induced reactions. The first part of the HADES mission is to reinvestigate the puzzling pair excess measured by the DLS collaboration in C+C and Ca+Ca collisions at 1 A GeV. For this purpose dedicated measurements with the C+C system at 1 and 2 A GeV were performed. The pair excess above a cocktail of free hadronic decays has been extracted and compared to the one measured by DLS. Furthermore, the excess is confronted with predictions of various model calculations. (orig.)

  10. Measurement of low-mass e{sup +}e{sup -} pair production in 1 and 2 A GeV C-C collision with HADES

    Energy Technology Data Exchange (ETDEWEB)

    Sudol, M.; Boyard, J.L.; Hennino, T.; Moriniere, E.; Ramstein, B.; Roy-Stephan, M. [CNRS/IN2P3 - Univ. Paris Sud, Inst. de Physique Nucleaire (UMR 8608), Orsay Cedex (France); Agakishiev, G.; Destefanis, M.; Gilardi, C.; Kirschner, D.; Kuehn, W.; Lange, J.S.; Metag, V.; Novotny, R.; Pechenov, V.; Pechenova, O.; Perez Cavalcanti, T.; Spataro, S.; Spruck, B. [Justus Liebig Universitaet Giessen, II. Physikalisches Institut, Giessen (Germany); Agodi, C.; Bellia, G.; Coniglione, R.; Finocchiaro, P.; Maiolino, C.; Piattelli, P.; Sapienza, P. [Istituto Nazionale di Fisica Nucleare-Laboratori Nazionali del Sud, Catania (Italy); Balanda, A.; Dybczak, A.; Kozuch, A.; Otwinowski, J.; Przygoda, W.; Salabura, P.; Trebacz, R.; Wisniowski, M.; Wojcik, T. [Jagiellonian Univ. of Cracow, Smoluchowski Inst. of Physics, Krakow (Poland); Belver, D.; Cabanelas, P.; Duran, I.; Garzon, J.A.; Lamas-Valverde, J.; Marin, J. [Univ. of Santiago de Compostela, Santiago de Compostela (Spain); Belyaev, A.; Chernenko, S.; Fateev, O.; Ierusalimov, A.; Zanevsky, Y. [Joint Inst. of Nuclear Research, Dubna (Russian Federation); Bielcik, J.; Braun-Munzinger, P.; Galatyuk, T.; Gonzalez-Diaz, D.; Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Muench, M.; Palka, M.; Pietraszko, J.; Rustamov, A.; Schroeder, C.; Schwab, E.; Simon, R.; Traxler, M.; Yurevich, S.; Zumbruch, P. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Blanco, A.; Ferreira-Marques, R.; Fonte, P.; Lopes, L.; Mangiarotti, A. [LIP-Lab. de Instrumentacao e Fisica Experimental de Particulas, Coimbra (Portugal); Bortolotti, A.; Iori, I.; Michalska, B. [Sezione di Milano, Istituto Nazionale di Fisica Nucleare, Milano (Italy); Christ, T.; Eberl, T.; Fabbietti, L.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R.; Maier, L.; Sailer, B.; Schmah, A.; Weber, M. [Technische Univ. Muenchen, Munich (Germany); Diaz, J.; Gil, A. [Univ. de Valencia-CSIC, Valencia (Spain)] [and others

    2009-07-15

    HADES is a secondary generation experiment operated at GSI Darmstadt with the main goal to study dielectron production in proton, pion and heavy ion induced reactions. The first part of the HADES mission is to reinvestigate the puzzling pair excess measured by the DLS collaboration in C+C and Ca+Ca collisions at 1 A GeV. For this purpose dedicated measurements with the C+C system at 1 and 2 A GeV were performed. The pair excess above a cocktail of free hadronic decays has been extracted and compared to the one measured by DLS. Furthermore, the excess is confronted with predictions of various model calculations. (orig.)

  11. Catalytic constructive deoxygenation of lignin-derived phenols: new C-C bond formation processes from imidazole-sulfonates and ether cleavage reactions.

    Science.gov (United States)

    Leckie, Stuart M; Harkness, Gavin J; Clarke, Matthew L

    2014-10-09

    As part of a programme aimed at exploiting lignin as a chemical feedstock for less oxygenated fine chemicals, several catalytic C-C bond forming reactions utilising guaiacol imidazole sulfonate are demonstrated. These include the cross-coupling of a Grignard, a non-toxic cyanide source, a benzoxazole, and nitromethane. A modified Meyers reaction is used to accomplish a second constructive deoxygenation on a benzoxazole functionalised anisole.

  12. Application of INAA for chemical quality control analysis of C-C composite and high purity graphite by determining trace elemental concentrations

    International Nuclear Information System (INIS)

    Shinde, Amol D.; Reddy, A.V.R.; Acharya, R.; Venugopalan, Ramani

    2015-01-01

    Carbon based materials like graphite and C-C composites are used for various scientific and technological applications. Owing to its low neutron capture cross section and good moderating properties, graphite is used as a moderator or reflector in nuclear reactors. For high temperature reactors like CHTR, graphite and C-C composites are proposed as structural materials. Studies are in progress to use C-C composites as prospective candidate instead of graphite due to their excellent mechanical and thermal properties. The advantage of carbon-carbon composite is that the microstructure and the properties can be tailor made. Impurities like rare earth elements and neutron poisons which have high neutron absorption cross section and elements whose activation products of have longer half-lives like 60 Co (5.27 y), 65 Zn (244.3 d) and 59 Fe (44.5 d) are not desired in structural materials. For chemical quality control (CQC) it is necessary to evaluate accurately the impurity concentrations using a suitable non-destructive analytical technique. In the present work, two carbon/carbon composite samples and two high purity graphite samples were analyzed by Instrumental Neutron Activation Analysis (INAA) using high-flux reactor neutrons. Samples, sealed in Al foil, were irradiated in tray-rod position of Dhruva reactor, BARC at a neutron flux of ∼ 5 x 10 13 cm -2 s -1 . Radioactive assay was carried out using high resolution gamma ray spectrometry using 40% HPGe detector

  13. `Joint Research and Development of Industrial Technology,` an international research collaboration for fiscal 1997. Utilization of 3D-woven C/C composite materials to machine components; 1997 nendo kokusai kenkyu kyoryoku jigyo `sangyo kiban gijutsu kyodo kenkyu kaihatsu`. Sanjigen ori C/C composite zairyo no kikai buhin eno oyo ni kansuru kenkyu seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    A polygonal mirror in a printer and the main shaft of a high-speed milling machine are used as models for the development of technology for applying C/C (carbon/carbon) composite materials to machine components that are required to turn at high speeds. Various C/C composites are tested for flexural strength and thermal expansion for the designing and manufacturing of C/C composites for the polygonal mirror and main shaft. The first coating on the C/C composite is deposited by laser/plasma hybrid spraying, and is a Mo coating. A spraying robot is experimentally built for homogeneous coating. In the case of polygonal mirror, an Al coating is deposited further by the gas-deposition method. The polygonal mirror proves excellent in both dimension and reflectance, and attains the target speed of 45,000rpm. In the case of milling machine main shaft, however, it is not strong enough to withstand 40,000rpm although it is a success from a viewpoint of coating technology and manufacturing technology. 15 refs., 33 figs., 13 tabs.

  14. Single-Molecule Titration in a Protein Nanoreactor Reveals the Protonation/Deprotonation Mechanism of a C:C Mismatch in DNA.

    Science.gov (United States)

    Ren, Hang; Cheyne, Cameron G; Fleming, Aaron M; Burrows, Cynthia J; White, Henry S

    2018-04-18

    Measurement of single-molecule reactions can elucidate microscopic mechanisms that are often hidden from ensemble analysis. Herein, we report the acid-base titration of a single DNA duplex confined within the wild-type α-hemolysin (α-HL) nanopore for up to 3 h, while monitoring the ionic current through the nanopore. Modulation between two states in the current-time trace for duplexes containing the C:C mismatch in proximity to the latch constriction of α-HL is attributed to the base flipping of the C:C mismatch. As the pH is lowered, the rate for the C:C mismatch to flip from the intra-helical state to the extra-helical state ( k intra-extra ) decreases, while the rate for base flipping from the extra-helical state to the intra-helical state ( k extra-intra ) remains unchanged. Both k intra-extra and k extra-intra are on the order of 1 × 10 -2 s -1 to 1 × 10 -1 s -1 and remain stable over the time scale of the measurement (several hours). Analysis of the pH-dependent kinetics of base flipping using a hidden Markov kinetic model demonstrates that protonation/deprotonation occurs while the base pair is in the intra-helical state. We also demonstrate that the rate of protonation is limited by transport of H + into the α-HL nanopore. Single-molecule kinetic isotope experiments exhibit a large kinetic isotope effect (KIE) for k intra-extra ( k H / k D ≈ 5) but a limited KIE for k extra-intra ( k H / k D ≈ 1.3), supporting our model. Our experiments correspond to the longest single-molecule measurements performed using a nanopore, and demonstrate its application in interrogating mechanisms of single-molecule reactions in confined geometries.

  15. Robust electrodes based on coaxial TiC/C-MnO2 core/shell nanofiber arrays with excellent cycling stability for high-performance supercapacitors.

    Science.gov (United States)

    Zhang, Xuming; Peng, Xiang; Li, Wan; Li, Limin; Gao, Biao; Wu, Guosong; Huo, Kaifu; Chu, Paul K

    2015-04-17

    A coaxial electrode structure composed of manganese oxide-decorated TiC/C core/shell nanofiber arrays is produced hydrothermally in a KMnO4 solution. The pristine TiC/C core/shell structure prepared on the Ti alloy substrate provides the self-sacrificing carbon shell and highly conductive TiC core, thus greatly simplifying the fabrication process without requiring an additional reduction source and conductive additive. The as-prepared electrode exhibits a high specific capacitance of 645 F g(-1) at a discharging current density of 1 A g(-1) attributable to the highly conductive TiC/C and amorphous MnO2 shell with fast ion diffusion. In the charging/discharging cycling test, the as-prepared electrode shows high stability and 99% capacity retention after 5000 cycles. Although the thermal treatment conducted on the as-prepared electrode decreases the initial capacitance, the electrode undergoes capacitance recovery through structural transformation from the crystalline cluster to layered birnessite type MnO2 nanosheets as a result of dissolution and further electrodeposition in the cycling. 96.5% of the initial capacitance is retained after 1000 cycles at high charging/discharging current density of 25 A g(-1). This study demonstrates a novel scaffold to construct MnO2 based SCs with high specific capacitance as well as excellent mechanical and cycling stability boding well for future design of high-performance MnO2-based SCs. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Identification of 5-hydroxy-tryptamine (bufotenine) in takini (Brosimumacutifolium Huber subsp. acutifolium C.C. Berg, Moraceae), a shamanic potion used in the Guiana Plateau.

    Science.gov (United States)

    Moretti, Christian; Gaillard, Yvan; Grenand, Pierre; Bévalot, Fabien; Prévosto, Jean-Michel

    2006-06-30

    This paper is the first thorough analysis of takini, a hallucinogen used by the shamans of several peoples in Suriname, French Guiana, and the region east of the Para in Brazil. The drug is contained in the latex of the Brosimum acutifolium tree, and until now, its psychotropic properties appeared inconsistent with the more general medicinal uses of the tree in the surrounding region. Our chemical and botanical studies reveal that the active ingredient of takini is bufotenine; and that this compound is only contained in the subspecies Brosimum acutifolium Huber subsp. acutifolium C.C. Berg that is found in the same area of the eastern Guianas.

  17. Catalytic diastereoselective tandem conjugate addition-elimination reaction of Morita-Baylis-Hillman C adducts by C-C bond cleavage

    KAUST Repository

    Yang, Wenguo

    2012-02-08

    Through the cleavage of the C-C bond, the first catalytic tandem conjugate addition-elimination reaction of Morita-Baylis-Hillman C adducts has been presented. Various S N2′-like C-, S-, and P-allylic compounds could be obtained with exclusive E configuration in good to excellent yields. The Michael product could also be easily prepared by tuning the β-C-substituent group of the α-methylene ester under the same reaction conditions. Calculated relative energies of various transition states by DFT methods strongly support the observed chemoselectivity and diastereoselectivity. © 2012 Wiley-VCH Verlag GmbH&Co. KGaA, Weinheim.

  18. Self assembly of dialkoxo bridged dinuclear Fe(III) complex of pyridoxal Schiff base with C-C bond formation - structure, spectral and magnetic properties

    Czech Academy of Sciences Publication Activity Database

    Murašková, V.; Szabó, N.; Pižl, M.; Hoskovcová, I.; Dušek, Michal; Huber, Š.; Sedmidubský, D.

    2017-01-01

    Roč. 461, May (2017), s. 111-119 ISSN 0020-1693 R&D Projects: GA ČR(CZ) GA15-12653S; GA MŠk LO1603 EU Projects: European Commission(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : iron(III) dinuclear complex * dialkoxo bridged pyridoxal Schiff base * C-C bond * crystal structure * magnetic properties Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 2.002, year: 2016

  19. Mechanistic Insights on C-O and C-C Bond Activation and Hydrogen Insertion during Acetic Acid Hydrogenation Catalyzed by Ruthenium Clusters in Aqueous Medium

    Energy Technology Data Exchange (ETDEWEB)

    Shangguan, Junnan; Olarte, Mariefel V.; Chin, Ya-Huei [Cathy

    2016-06-07

    Catalytic pathways for acetic acid (CH3COOH) and hydrogen (H2) reactions on dispersed Ru clusters in the aqueous medium and the associated kinetic requirements for C-O and C-C bond cleavages and hydrogen insertion are established from rate and isotopic assessments. CH3COOH reacts with H2 in steps that either retain its carbon backbone and lead to ethanol, ethyl acetate, and ethane (47-95 %, 1-23 %, and 2-17 % carbon selectivities, respectively) or break its C-C bond and form methane (1-43 % carbon selectivities) at moderate temperatures (413-523 K) and H2 pressures (10-60 bar, 298 K). Initial CH3COOH activation is the kinetically relevant step, during which CH3C(O)-OH bond cleaves on a metal site pair at Ru cluster surfaces nearly saturated with adsorbed hydroxyl (OH*) and acetate (CH3COO*) intermediates, forming an adsorbed acetyl (CH3CO*) and hydroxyl (OH*) species. Acetic acid turnover rates increase proportionally with both H2 (10-60 bar) and CH3COOH concentrations at low CH3COOH concentrations (<0.83 M), but decrease from first to zero order as the CH3COOH concentration and the CH3COO* coverages increase and the vacant Ru sites concomitantly decrease. Beyond the initial CH3C(O)-OH bond activation, sequential H-insertions on the surface acetyl species (CH3CO*) lead to C2 products and their derivative (ethanol, ethane, and ethyl acetate) and the competitive C-C bond cleavage of CH3CO* causes the eventual methane formation. The instantaneous carbon selectivities towards C2 species (ethanol, ethane, and ethyl acetate) increase linearly with the concentration of proton-type Hδ+ (derived from carboxylic acid dissociation) and chemisorbed H*. The selectivities towards C2 products decrease with increasing temperature, because of higher observed barriers for C-C bond cleavage than H-insertion. This study offers an interpretation of mechanism and energetics and provides kinetic evidence of carboxylic acid assisted proton-type hydrogen (Hδ+) shuffling during H

  20. Diseño de un sistema administrativo contable aplicable a la empresa Centro Artesanal Niño Jesús S.C.C.

    OpenAIRE

    Posso García, Carlos Patricio

    2006-01-01

    El Sistema Administrativo Contable es el pilar de toda organización para poder desarrollar adecuadamente sus actividades, estableciendo responsabilidades a los encargados de las todas las áreas, medidas de seguridad y control. Diseñar un modelo de un SISTEMA ADMINISTRATIVO-CONTABLE para la empresa CENTRO ARTESANAL NIÑO JESÚS S.C.C. permitirá contar con una oportuna, completa y exacta información de los resultados financieros de la Empresa en su conjunto; así como mejorar los procesos ad...

  1. Laboratory simulation of laser propagation through plasma sheaths containing ablation particles of ZrB2-SiC-C during hypersonic flight.

    Science.gov (United States)

    Zang, Qing; Bai, Xiangxing; Ma, Ping; Huang, Jie; Ma, Jing; Yu, Siyuan; Shi, Hongyan; Sun, Xiudong; Liu, Yang; Lu, Yueguang

    2017-02-15

    The optical communication method has potential for solving the blackout problem, which is a big challenge faced in the development of aerospace. Two laser transmission systems were set up to explore the influence of the plasma and the ablation particles on the propagation of the laser. The experimental results indicate that the laser can transmit through the plasma with little attenuation. When there are ablation particles of ZrB2-SiC-C added in the plasma, the intensity of the laser has fluctuations. The work introduced in this Letter can be regarded as basic research of the propagation characters of the laser through plasma sheaths.

  2. Search for the rare decay of ψ (3686 )→Λc+p ¯ e+e-+c .c . at BESIII

    Science.gov (United States)

    Ablikim, M.; Achasov, M. N.; Ahmed, S.; Albrecht, M.; Alekseev, M.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Bai, Y.; Bakina, O.; Baldini Ferroli, R.; Ban, Y.; Begzsuren, K.; Bennett, D. W.; Bennett, J. V.; Berger, N.; Bertani, M.; Bettoni, D.; Bianchi, F.; Boger, E.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chai, J.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, J. C.; Chen, M. L.; Chen, P. L.; Chen, S. J.; Chen, X. R.; Chen, Y. B.; Chu, X. K.; Cibinetto, G.; Cossio, F.; Dai, H. L.; Dai, J. P.; Dbeyssi, A.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; de Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Dou, Z. L.; Du, S. X.; Duan, P. F.; Fang, J.; Fang, S. S.; Fang, Y.; Farinelli, R.; Fava, L.; Fegan, S.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fritsch, M.; Fu, C. D.; Gao, Q.; Gao, X. L.; Gao, Y.; Gao, Y. G.; Gao, Z.; Garillon, B.; Garzia, I.; Gilman, A.; Goetzen, K.; Gong, L.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guo, A. Q.; Guo, R. P.; Guo, Y. P.; Guskov, A.; Haddadi, Z.; Han, S.; Hao, X. Q.; Harris, F. A.; He, K. L.; He, X. Q.; Heinsius, F. H.; Held, T.; Heng, Y. K.; Holtmann, T.; Hou, Z. L.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. S.; Huang, J. S.; Huang, X. T.; Huang, X. Z.; Huang, Z. L.; Hussain, T.; Ikegami Andersson, W.; Irshad, M.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, X. S.; Jiang, X. Y.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Jin, Y.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Khan, T.; Khoukaz, A.; Kiese, P.; Kliemt, R.; Koch, L.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuemmel, M.; Kuessner, M.; Kupsc, A.; Kurth, M.; Kühn, W.; Lange, J. S.; Lara, M.; Larin, P.; Lavezzi, L.; Leithoff, H.; Li, C.; Li, Cheng; Li, D. M.; Li, F.; Li, F. Y.; Li, G.; Li, H. B.; Li, H. J.; Li, J. C.; Li, J. W.; Li, Jin; Li, K. J.; Li, Kang; Li, Ke; Li, Lei; Li, P. L.; Li, P. R.; Li, Q. Y.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Liao, L. Z.; Libby, J.; Lin, C. X.; Lin, D. X.; Liu, B.; Liu, B. J.; Liu, C. X.; Liu, D.; Liu, D. Y.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. L.; Liu, H. M.; Liu, Huanhuan; Liu, Huihui; Liu, J. B.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, Ke; Liu, L. D.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqing; Long, Y. F.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, X. L.; Lusso, S.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, M. M.; Ma, Q. M.; Ma, T.; Ma, X. N.; Ma, X. Y.; Ma, Y. M.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mangoni, A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Meng, Z. X.; Messchendorp, J. G.; Mezzadri, G.; Min, J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Morales Morales, C.; Muchnoi, N. Yu.; Muramatsu, H.; Mustafa, A.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Pan, Y.; Papenbrock, M.; Patteri, P.; Pelizaeus, M.; Pellegrino, J.; Peng, H. P.; Peng, Z. Y.; Peters, K.; Pettersson, J.; Ping, J. L.; Ping, R. G.; Pitka, A.; Poling, R.; Prasad, V.; Qi, H. R.; Qi, M.; Qi, T. Y.; Qian, S.; Qiao, C. F.; Qin, N.; Qin, X. S.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Richter, M.; Ripka, M.; Rolo, M.; Rong, G.; Rosner, Ch.; Sarantsev, A.; Savrié, M.; Schnier, C.; Schoenning, K.; Shan, W.; Shan, X. Y.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shi, X.; Song, J. J.; Song, W. M.; Song, X. Y.; Sosio, S.; Sowa, C.; Spataro, S.; Sun, G. X.; Sun, J. F.; Sun, L.; Sun, S. S.; Sun, X. H.; Sun, Y. J.; Sun, Y. K.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tan, Y. T.; Tang, C. J.; Tang, G. Y.; Tang, X.; Tapan, I.; Tiemens, M.; Tsednee, B.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, Dan; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, Meng; Wang, P.; Wang, P. L.; Wang, W. P.; Wang, X. F.; Wang, Y.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. Y.; Wang, Zongyuan; Weber, T.; Wei, D. H.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, L. J.; Wu, Z.; Xia, L.; Xia, Y.; Xiao, D.; Xiao, Y. J.; Xiao, Z. J.; Xie, Y. G.; Xie, Y. H.; Xiong, X. A.; Xiu, Q. L.; Xu, G. F.; Xu, J. J.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, F.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. J.; Yang, H. X.; Yang, L.; Yang, Y. H.; Yang, Y. X.; Yang, Yifan; Ye, M.; Ye, M. H.; Yin, J. H.; You, Z. Y.; Yu, B. X.; Yu, C. X.; Yu, J. S.; Yuan, C. Z.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zeng, Y.; Zeng, Z.; Zhang, B. X.; Zhang, B. Y.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, T. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Y. T.; Zhang, Yang; Zhang, Yao; Zhang, Yu; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Q.; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, A. N.; Zhu, J.; Zhu, J.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, S. H.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.; Besiii Collaboration

    2018-05-01

    Based on a data sample of (448.1 ±2.9 )×106ψ (3686 ) decays collected with the BESIII experiment, a search for the flavor changing neutral current transition ψ (3686 )→Λc+p ¯ e+e-+c .c . is performed for the first time. No signal candidates are observed and the upper limit on the branching fraction of ψ (3686 )→Λc+p ¯e+e- is determined to be 1.7 ×10-6 at the 90% confidence level. The result is consistent with expectations from the standard model, and no evidence for new physics is found.

  3. 14C/C measurements support Andreev's internode method to determine lichen growth rates in Cladina stygia (Fr.) Ahti

    Energy Technology Data Exchange (ETDEWEB)

    Holt, E; Bench, G

    2007-12-05

    Growth rates and the ability to date an organism can greatly contribute to understanding its population biology and community dynamics. 1n 1954, Andreev proposed a method to date Cladina, a fruticose lichen, using total thallus length and number of internodes. No research, however, has demonstrated the reliability of this technique or compared its estimates to those derived by other means. In this study, we demonstrate the utility of {sup 14}C/C ratios to determine lichen age and growth rate in Cladina stygia (Fr.) Ahti collected from northwestern Alaska, USA. The average growth rate using {sup 14}C/C ratios was 6.5 mm {center_dot} yr{sup -1}, which was not significantly different from growth rates derived by Andreev's internode method (average = 6.2 mm {center_dot} yr{sup -1}); thus, suggesting the reliability of Andreev's simple field method for dating lichens. In addition, we found lichen growth rates appeared to differ with geographic location, yet did not seem related to ambient temperature and total precipitation.

  4. Gas-phase reactivity of lanthanide cations with fluorocarbons: C-F versus C-H and C-C bond activation

    International Nuclear Information System (INIS)

    Cornehl, H.H.; Hornung, G.; Schwarz, H.

    1996-01-01

    The gas-phase reactivity of the fluorinated hydrocarbons CF 4 , CHF 3 , CH 3 F, C 2 F 6 , 1,1-C 2 H 4 F 2 , and C 6 F 6 with the lanthanide cations Ce + , Pr + , Sm + , Ho + , Tm + , and Yb + and the reactivity of C 6 H 5 F with all lanthanide cations Ln + (Ln = La-Lu, with the exception of Pm + ) have been examined by Fourier-transform ion cyclotron resonance mass spectrometry. The perfluorinated compounds tetrafluoromethane and hexafluoroethane as well as trifluoromethane do not react with any lanthanide cation. Selective activation of the strong C-F bonds in fluoromethane, 1,1-difluoroethane, hexafluorobenzene, and fluorobenzene appears as a general reaction scheme along the 4f row. Experimental evidence is given for a 'harpoon'-like mechanism for the F atom abstraction process which operates via an initial electron transfer from the lanthanide cation to the fluorinated substrate in the encounter complex Ln + RF. The most reactive lanthanides La + , Ce + , Gd + , and Tb + and also the formal closed-shell species Lu + exhibit additional C-H and C-C bond activation pathways in the reaction with fluorobenzene, namely dehydrohalogenation as well as loss of a neutral acetylene molecule. In the case of Tm + and Yb + the formation of neutral LnF 3 is observed in a multistep process via C-C coupling and charge transfer. 17 refs., 2 figs., 2 tabs

  5. Nucleation and evolution of strain-induced martensitic (b.c.c.) embryos and substructure in stainless steel: a transmission electron microscope study

    International Nuclear Information System (INIS)

    Staudhammer, K.P.; Hecker, S.S.; Murr, L.E.

    1983-01-01

    The deformation of type 304 stainless steel produces a preponderance of strain-induced /chi/ (b.c.c.) martensite, which nucleates as stable embryos at micro-shear band or twin-fault intersections as proposed by Olson and Cohen. The two intersecting micro-shear bands must have a specific defect (fault-displacement) structure, and for stable martensite embryos to form requires a minimal micro-shear band thickness ranging from 50-70 A. The critical nature of nucleation is influenced by the local temperature and strain. The structure, geometry, and morphology of strain-induced martensite embryos is essentially invariant regardless of the strain rate, strain state or temperature. Larger volume fractions of martensite evolve at large strains (greater than or equal to 20%) as a result of embryo coalescence to produce a blocky-type morphology. Martensite embryos and coalesced volume elements of /chi/ are frequently characterized by an irregular non-homogeneous distribution of smaller b.c.c. regimes which result from the irregular satisfaction of the necessary and specific fault-displacement requirements within a larger intersection volume

  6. A review of the irradiation evolution of dispersed oxide nanoparticles in the b.c.c. Fe-Cr system: Current understanding and future directions

    Energy Technology Data Exchange (ETDEWEB)

    Wharry, Janelle P., E-mail: jwharry@purdue.edu [Purdue University, 400 Central Drive, West Lafayette, IN 47907 (United States); Swenson, Matthew J.; Yano, Kayla H. [Boise State University, 1910 University Drive, Boise, ID 83725 (United States)

    2017-04-01

    Thus far, a number of studies have investigated the irradiation evolution of oxide nanoparticles in b.c.c. Fe-Cr based oxide dispersion strengthened (ODS) alloys. But given the inconsistent experimental conditions, results have been widely variable and inconclusive. Crystal structure and chemistry changes differ from experiment to experiment, and the total nanoparticle volume fraction has been observed to both increase and decrease. Furthermore, there has not yet been a comprehensive review of the archival literature. In this paper, we summarize the existing studies on nanoparticle irradiation evolution. We note significant observations with respect to oxide nanoparticle crystallinity, composition, size, and number density. We discuss four possible contributing mechanisms for nanoparticle evolution: ballistic dissolution, Ostwald ripening, irradiation-enhanced diffusion, and homogeneous nucleation. Finally, we propose future directions to achieve a more comprehensive understanding of irradiation effects on oxide nanoparticles in ODS alloys.

  7. Synthesis of palladium nanoparticles with leaf extract of Chrysophyllum cainito (Star apple) and their applications as efficient catalyst for C-C coupling and reduction reactions

    Science.gov (United States)

    Majumdar, Rakhi; Tantayanon, Supawan; Bag, Braja Gopal

    2017-10-01

    A simple green chemical method for the one-step synthesis of palladium nanoparticles (PdNPs) has been described by reducing palladium (II) chloride with the leaf extract of Chrysophyllum cainito in aqueous medium. The synthesis of the palladium nanoparticles completed within 2-3 h at room temperature, whereas on heat treatment (70-80 °C), the synthesis of colloidal PdNPs completed almost instantly. The stabilized PdNPs have been characterized in detail by spectroscopic, electron microscopic and light scattering measurements. The synthesized PdNPs have been utilized as a green catalyst for C-C coupling reactions under aerobic and phosphine-free conditions in aqueous medium. In addition, the synthesized PdNPs have also been utilized as a catalyst for a very efficient sodium borohydride reduction of 3- and 4-nitrophenols. The synthesized PdNPs can retain their catalytic activity for several months.

  8. Ted L. Shrader, D.C., F.I.C.C.: a gentle force for improvement in chiropractic. 1998 Lee-Homewood Chiropractic Heritage Award recipient.

    Science.gov (United States)

    Green, B N; Johnson, C D; Keating, J C

    1998-06-01

    Long before technology assessment and continuous quality improvement were in vogue in chiropractic, Ted L. Shrader, D.C., F.I.C.C., was working toward these goals in the profession. Convinced that chiropractic must change from within for the benefit of society, Dr. Shrader has made a career-long commitment to evaluating chiropractic procedures and establishing consensus statements regarding chiropractic principle. Determined in mind, moral by nature, and unobtrusive in manner, Dr. Shrader has been decidedly effective in his endeavors. He has encouraged in chiropractic a mind for critical thinking. The fruits of his labor can be seen today in chiropractic publication, among chiropractic scholars, within the American Chiropractic Association Council on Technique, in conference proceedings, and in our institutions.

  9. Los aspectos ideológicos-pedagógicos del proyecto del «Instituto Secundario C. C. Vigil» (1970-1977

    Directory of Open Access Journals (Sweden)

    María Luz Prados

    2017-01-01

    Full Text Available En el presente artículo se analizan los aspectos ideológico-pedagógicos del proyecto político-pedagógico del Instituto Secundario C. C. Vigil. Tal proyecto formó parte del complejo institucional de lo que fuera la Biblioteca Constancio C. Vigil (1959-1977, emblemática entidad de la ciudad de Rosario que llevó adelante un proyecto cultural, social, pedagógico y mutual en uno de sus barrios populares: el barrio Tablada. Esta entidad fue víctima del terrorismo de Estado y, específicamente, de la política educativa procesista (Kaufmann, 2006 desplegada durante la última dictadura cívico-militar (1976-1983 sufriendo una intervención militar en el año 1977 que puso fin a toda su labor.

  10. Study of {lambda} hyperon production in C+C collisions at 2 AGeV beam energy with the HADES spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kanaki, K.

    2007-03-15

    The HADES spectrometer is a high resolution detector installed at the SIS/GSI, Darmstadt. It was primarily designed for studying dielectron decay channels of vector mesons. However, its high accuracy capabilities make it an attractive tool for investigating other rare probes at these beam energies, like strange baryons. Development and investigation of Multiwire Drift Chambers for high spatial resolution have been provided. One of the early experimental runs of HADES was analyzed and the {lambda} hyperon signal was successfully reconstructed for the first time in C+C collisions at 2 AGeV beam kinetic energy. The total {lambda} production cross section is contrasted with expectations from simulations and compared with measurements of the {lambda} yield in heavier systems at the same energy. In addition, the result is considered in the context of strangeness balance and the relative strangeness content of the reaction products is determined. (orig.)

  11. Study of Λ hyperon production in C+C collisions at 2 AGeV beam energy with the HADES spectrometer

    International Nuclear Information System (INIS)

    Kanaki, K.

    2007-03-01

    The HADES spectrometer is a high resolution detector installed at the SIS/GSI, Darmstadt. It was primarily designed for studying dielectron decay channels of vector mesons. However, its high accuracy capabilities make it an attractive tool for investigating other rare probes at these beam energies, like strange baryons. Development and investigation of Multiwire Drift Chambers for high spatial resolution have been provided. One of the early experimental runs of HADES was analyzed and the Λ hyperon signal was successfully reconstructed for the first time in C+C collisions at 2 AGeV beam kinetic energy. The total Λ production cross section is contrasted with expectations from simulations and compared with measurements of the Λ yield in heavier systems at the same energy. In addition, the result is considered in the context of strangeness balance and the relative strangeness content of the reaction products is determined. (orig.)

  12. Formation of C-C and C-O bonds and oxygen removal in reactions of alkanediols, alkanols, and alkanals on copper catalysts.

    Science.gov (United States)

    Sad, María E; Neurock, Matthew; Iglesia, Enrique

    2011-12-21

    This study reports evidence for catalytic deoxygenation of alkanols, alkanals, and alkanediols on dispersed Cu clusters with minimal use of external H(2) and with the concurrent formation of new C-C and C-O bonds. These catalysts selectively remove O-atoms from these oxygenates as CO or CO(2) through decarbonylation or decarboxylation routes, respectively, that use C-atoms present within reactants or as H(2)O using H(2) added or formed in situ from CO/H(2)O mixtures via water-gas shift. Cu catalysts fully convert 1,3-propanediol to equilibrated propanol-propanal intermediates that subsequently form larger oxygenates via aldol-type condensation and esterification routes without detectable involvement of the oxide supports. Propanal-propanol-H(2) equilibration is mediated by their chemisorption and interconversion at surfaces via C-H and O-H activation and propoxide intermediates. The kinetic effects of H(2), propanal, and propanol pressures on turnover rates, taken together with measured selectivities and the established chemical events for base-catalyzed condensation and esterification reactions, indicate that both reactions involve kinetically relevant bimolecular steps in which propoxide species, acting as the base, abstract the α-hydrogen in adsorbed propanal (condensation) or attack the electrophilic C-atom at its carbonyl group (esterification). These weakly held basic alkoxides render Cu surfaces able to mediate C-C and C-O formation reactions typically catalyzed by basic sites inherent in the catalyst, instead of provided by coadsorbed organic moieties. Turnover rates for condensation and esterification reactions decrease with increasing Cu dispersion, because low-coordination corner and edge atoms prevalent on small clusters stabilize adsorbed intermediates and increase the activation barriers for the bimolecular kinetically relevant steps required for both reactions. © 2011 American Chemical Society

  13. New Concept of the Biosynthesis of 4-Alkyl-L-proline Precursors of Lincomycin, Hormaomycin and Pyrrolobenzodiazepines: Could a γ-Glutamyltransferase Cleave the C-C Bond?

    Directory of Open Access Journals (Sweden)

    Petra eJiraskova

    2016-03-01

    Full Text Available Structurally different and functionally diverse natural compounds – antitumour agents pyrrolo[1,4]benzodiazepines, bacterial hormone hormaomycin and lincosamide antibiotic lincomycin – share a common building unit, 4-alkyl-L-proline derivative (APD. APDs arise from L-tyrosine through a special biosynthetic pathway. Its generally accepted scheme, however, did not comply with current state of knowledge. Based on gene inactivation experiments and in vitro functional tests with recombinant enzymes, we designed a new APD biosynthetic scheme for the model of lincomycin biosynthesis. In the new scheme at least one characteristic in each of five final biosynthetic steps has been changed: the order of reactions, assignment of enzymes and/or reaction mechanisms. First, we demonstrate that LmbW methylates a different substrate than previously assumed. Second, we propose a unique reaction mechanism for the next step, in which a putative γ-glutamyltransferase LmbA indirectly cleaves off the oxalyl residue by transient attachment of glutamate to LmbW product. This unprecedented mechanism would represent the first example of the C-C bond cleavage catalyzed by a γ-glutamyltransferase, i.e., an enzyme that appears unsuitable for such activity. Finally, the inactivation experiments show that LmbX is an isomerase indicating that it transforms its substrate into a compound suitable for reduction by LmbY, thereby facilitating its subsequent complete conversion to APD 4-propyl-L-proline. Elucidation of the APD biosynthesis has long time resisted mainly due to the apparent absence of relevant C-C bond cleaving enzymatic activity. Our proposal aims to unblock this situation not only for lincomycin biosynthesis, but generally for all above mentioned groups of bioactive natural products with biotechnological potential.

  14. The diabetogenic VPS13C/C2CD4A/C2CD4B rs7172432 variant impairs glucose-stimulated insulin response in 5,722 non-diabetic Danish individuals

    DEFF Research Database (Denmark)

    Grarup, N; Overvad, M; Sparsø, T

    2011-01-01

    A genome-wide association study in the Japanese population reported two genome-wide significant loci associated with type 2 diabetes of which the VPS13C/C2CD4A/C2CD4B locus was replicated in Europeans. We looked for potential associations between the diabetogenic VPS13C/C2CD4A/C2CD4B rs7172432 va...

  15. Measurement of low-mass e{sup +}e{sup -} pair production in 2 AGeV C-C collisions with HADES

    Energy Technology Data Exchange (ETDEWEB)

    Sudol, Malgorzata

    2007-07-01

    The search for a modification of hadron properties inside nuclear matter at normal and/or high temperature and density is one of the most interesting issues of modern nuclear physics. Dilepton experiments, give insight into the properties of strong interaction and the nature of hadron mass generation. One of these research tools is the HADES spectrometer. HADES is a high acceptance dilepton spectrometer installed at the heavy-ion synchrotron (SIS) at GSI, Darmstadt. The main physics motivation of HADES is the measurement of e{sup +}e{sup -} pairs in the invariant-mass range up to 1 GeV/c{sup 2} in pion- and proton-induced reactions, as well as in heavy-ion collisions. The goal is to investigate the properties of the vector mesons {rho}, {omega} and of other hadrons reconstructed from e{sup +}e{sup -} decay pairs. Dileptons are penetrating probes allowing to study the in-medium properties of hadrons. However, the measurement of such dilepton pairs is difficult because of a very large background from other processes in which leptons are created. This thesis presents the analysis of the data provided by the first physics run with the HADES spectrometer. For the first time e{sup +}e{sup -} pairs produced in C+C collisions at an incident energy of 2 GeV per nucleon have been collected with sufficient statistics. This experiment is of particular importance since it allows to address the puzzling pair excess measured by the former DLS experiment at a beam energy 1.04 AGeV. The thesis consists of five chapters. The first chapter presents the physics case which is addressed in the work. In the second chapter the HADES spectrometer is introduced with the characteristic of specific detectors which are part of the spectrometer. Chapter three focusses on the issue of charged-particle identification. The fourth chapter discusses the reconstruction of the di-electron spectra in C+C collisions. In this part of the thesis a comparison with theoretical models is included as well

  16. Andrographolide attenuates LPS-stimulated up-regulation of C-C and C-X-C motif chemokines in rodent cortex and primary astrocytes.

    Science.gov (United States)

    Wong, Siew Ying; Tan, Michelle G K; Banks, William A; Wong, W S Fred; Wong, Peter T-H; Lai, Mitchell K P

    2016-02-09

    Andrographolide is the major bioactive compound isolated from Andrographis paniculata, a native South Asian herb used medicinally for its anti-inflammatory properties. In this study, we aimed to assess andrographolide's potential utility as an anti-neuroinflammatory therapeutic. The effects of andrographolide on lipopolysaccharide (LPS)-induced chemokine up-regulation both in mouse cortex and in cultured primary astrocytes were measured, including cytokine profiling, gene expression, and, in cultured astrocytes, activation of putative signaling regulators. Orally administered andrographolide significantly attenuated mouse cortical chemokine levels from the C-C and C-X-C subfamilies. Similarly, andrographolide abrogated a range of LPS-induced chemokines as well as tumor necrosis factor (TNF)-α in astrocytes. In astrocytes, the inhibitory actions of andrographolide on chemokine and TNF-α up-regulation appeared to be mediated by nuclear factor-κB (NF-κB) or c-Jun N-terminal kinase (JNK) activation. These results suggest that andrographolide may be useful as a therapeutic for neuroinflammatory diseases, especially those characterized by chemokine dysregulation.

  17. Tribological Characteristics of C/C-SiC-Cu Composite and Al/SiC Composite Materials under Various Contact Conditions

    International Nuclear Information System (INIS)

    Kim, Byung-Kook; Shin, Dong-Gap; Kim, Chang-Lae; Kim, Dae-Eun; Goo, Byeong-Choon

    2017-01-01

    The surface temperature of disc brakes varies during braking, which can affect the friction and wear behavior of braking systems. In order to develop an efficient braking system, the friction and wear behaviors of brake materials need to be clearly understood. In this work, the friction and wear behavior of the C/C-SiC-Cu composite and the Al/SiC composite, which are used in disc braking systems, were investigated. Both the surface temperature and contact pressure were studied. A pin-on-reciprocating tribotester was used for this purpose, in order to control temperature and load. Results showed that the friction varied significantly with temperature and sliding distance. It was found that a transfer layer of compacted wear debris formed on the wear track of the two materials. These layers caused the surface roughness of the wear track to increase. The outcome of this work is expected to serve as a basis for the development of braking systems under various operating conditions.

  18. Tribological Characteristics of C/C-SiC-Cu Composite and Al/SiC Composite Materials under Various Contact Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Byung-Kook; Shin, Dong-Gap; Kim, Chang-Lae; Kim, Dae-Eun [Yonsei Univ., Seoul (Korea, Republic of); Goo, Byeong-Choon [Korea Railroad Research Institute, Uiwang (Korea, Republic of)

    2017-01-15

    The surface temperature of disc brakes varies during braking, which can affect the friction and wear behavior of braking systems. In order to develop an efficient braking system, the friction and wear behaviors of brake materials need to be clearly understood. In this work, the friction and wear behavior of the C/C-SiC-Cu composite and the Al/SiC composite, which are used in disc braking systems, were investigated. Both the surface temperature and contact pressure were studied. A pin-on-reciprocating tribotester was used for this purpose, in order to control temperature and load. Results showed that the friction varied significantly with temperature and sliding distance. It was found that a transfer layer of compacted wear debris formed on the wear track of the two materials. These layers caused the surface roughness of the wear track to increase. The outcome of this work is expected to serve as a basis for the development of braking systems under various operating conditions.

  19. Deletion of the B-B' and C-C' regions of inverted terminal repeats reduces rAAV productivity but increases transgene expression.

    Science.gov (United States)

    Zhou, Qingzhang; Tian, Wenhong; Liu, Chunguo; Lian, Zhonghui; Dong, Xiaoyan; Wu, Xiaobing

    2017-07-14

    Inverted terminal repeats (ITRs) of the adeno-associated virus (AAV) are essential for rescue, replication, packaging, and integration of the viral genome. While ITR mutations have been identified in previous reports, we designed a new truncated ITR lacking the B-B' and C-C' regions named as ITRΔBC and investigated its effects on viral genome replication, packaging, and expression of recombinant AAV (rAAV). The packaging ability was compared between ITRΔBC rAAV and wild-type (wt) ITR rAAV. Our results showed the productivity of ITRΔBC rAAV was reduced 4-fold, which is consistent with the 8-fold decrease in the replication of viral genomic DNA of ITRΔBC rAAV compared with wt ITR rAAV. Surprisingly, transgene expression was significantly higher for ITRΔBC rAAV. A preliminary exploration of the underlying mechanisms was carried out by inhibiting and degrading the ataxia telangiectasia mutated (ATM) protein and the Mre11 complex (MRN), respectively, since the rAAV expression was inhibited by the ATM and/or MRN through cis interaction or binding with wt ITRs. We demonstrated that the inhibitory effects were weakened on ITRΔBC rAAV expression. This study suggests deletion in ITR can affect the transgene expression of AAV, which provides a new way to improve the AAV expression through ITRs modification.

  20. Raman spectroscopic determination of the length, strength, compressibility, Debye temperature, elasticity, and force constant of the C-C bond in graphene.

    Science.gov (United States)

    Yang, X X; Li, J W; Zhou, Z F; Wang, Y; Yang, L W; Zheng, W T; Sun, Chang Q

    2012-01-21

    From the perspective of bond relaxation and bond vibration, we have formulated the Raman phonon relaxation of graphene, under the stimuli of the number-of-layers, the uni-axial strain, the pressure, and the temperature, in terms of the response of the length and strength of the representative bond of the entire specimen to the applied stimuli. Theoretical unification of the measurements clarifies that: (i) the opposite trends of the Raman shifts, which are due to the number-of-layers reduction, of the G-peak shift and arises from the vibration of a pair of atoms, while the D- and the 2D-peak shifts involve the z-neighbor of a specific atom; (ii) the tensile strain-induced phonon softening and phonon-band splitting arise from the asymmetric response of the C(3v) bond geometry to the C(2v) uni-axial bond elongation; (iii) the thermal softening of the phonons originates from bond expansion and weakening; and (iv) the pressure stiffening of the phonons results from bond compression and work hardening. Reproduction of the measurements has led to quantitative information about the referential frequencies from which the Raman frequencies shift as well as the length, energy, force constant, Debye temperature, compressibility and elastic modulus of the C-C bond in graphene, which is of instrumental importance in the understanding of the unusual behavior of graphene.

  1. Potential Hazards Relating to Pyrolysis of c-C{sub 4}F{sub 8} in Selected Gaseous Diffusion Plant Operations

    Energy Technology Data Exchange (ETDEWEB)

    Trowbridge, L.D.

    1999-03-01

    As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes in under way. One issue concerning a primary candidate, c-C4F8, is the possibility that it might produce the highly toxic perfluoroisobutylene (PFIB) in high temperature environments. This study was commissioned to determine the likelihood and severity of decomposition under two specific high temperature thermal environments, namely the use of a flame test for the presence of coolant vapors and welding in the presence of coolant vapors. The purpose of the study was to develop and evaluate available data to provide information that will allow the technical and industrial hygiene staff at the GDPs to perform appropriate safety evaluations and to determine the need for field testing or experimental work. The scope of this study included a literature search and an evaluation of the information developed therefrom. Part of that evaluation consists of chemical kinetics modeling of coolant decomposition in the two operational environments. The general conclusions are that PFIB formation is unlikely in either situation but that it cannot be ruled out completely under extreme conditions. The presence of oxygen, moisture, and combustion products will tend to lead to formation of oxidation products (COF2, CO, CO2, and HF) rather than PFIB.

  2. Targeting chemokine (C-C motif) ligand 2 (CCL2) as an example of translation of cancer molecular biology to the clinic.

    Science.gov (United States)

    Zhang, Jian; Patel, Lalit; Pienta, Kenneth J

    2010-01-01

    Chemokines are a family of small and secreted proteins that play pleiotropic roles in inflammation-related pathological diseases, including cancer. Among the identified 50 human chemokines, chemokine (C-C motif) ligand 2 (CCL2) is of particular importance in cancer development since it serves as one of the key mediators of interactions between tumor and host cells. CCL2 is produced by cancer cells and multiple different host cells within the tumor microenvironment. CCL2 mediates tumorigenesis in many different cancer types. For example, CCL2 has been reported to promote prostate cancer cell proliferation, migration, invasion, and survival, via binding to its functional receptor CCR2. Furthermore, CCL2 induces the recruitment of macrophages and induces angiogenesis and matrix remodeling. Targeting CCL2 has been demonstrated as an effective therapeutic approach in preclinical prostate cancer models, and currently, neutralizing monoclonal antibody against CCL2 has entered into clinical trials in prostate cancer. In this chapter, targeting CCL2 in prostate cancer will be used as an example to show translation of laboratory findings from cancer molecular biology to the clinic. Copyright © 2010 Elsevier Inc. All rights reserved.

  3. A new species of Centris (Centris (Fabricius from northeastern Brazil, with taxonomic notes on C. (C. pulchra Moure, Oliveira & Viana (Hymenoptera, Apidae

    Directory of Open Access Journals (Sweden)

    Thiago Mahlmann

    2012-12-01

    Full Text Available We describe a new species of the bee genus Centris, C. (C. byrsonimae Mahlmann & Oliveira sp. n., whose name has appeared as a nomen nudum in the literature since 1985. Further, a new species group of Centris s.str. is proposed, the pulchra group, based on morphological characters, which comprises the species C. pulchra Moure, Oliveira & Viana, 2003 and C. byrsonimae sp. n.. Based on information from specimen labels studied and data from the literature, a list of plant species visited by the pulchra group is presented. The male genitalia and hidden metasomal sterna 7 and 8 of C. pulchra are described for the first time. Typographic errors pertaining to the paratype labels reported in the original description of C. pulchra are corrected. One female paratype of C. pulchra is designated herein as a paratype of C. byrsonimae sp. n. An updated list of species of Centris s.str. from northeastern Brazil is provided including references about geographic distributions as well as an identification key to the pulchra species group.

  4. 4-alkyl-L-(Dehydro)proline biosynthesis in actinobacteria involves N-terminal nucleophile-hydrolase activity of γ-glutamyltranspeptidase homolog for C-C bond cleavage

    Science.gov (United States)

    Zhong, Guannan; Zhao, Qunfei; Zhang, Qinglin; Liu, Wen

    2017-07-01

    γ-Glutamyltranspeptidases (γ-GTs), ubiquitous in glutathione metabolism for γ-glutamyl transfer/hydrolysis, are N-terminal nucleophile (Ntn)-hydrolase fold proteins that share an autoproteolytic process for self-activation. γ-GT homologues are widely present in Gram-positive actinobacteria where their Ntn-hydrolase activities, however, are not involved in glutathione metabolism. Herein, we demonstrate that the formation of 4-Alkyl-L-(dehydro)proline (ALDP) residues, the non-proteinogenic α-amino acids that serve as vital components of many bioactive metabolites found in actinobacteria, involves unprecedented Ntn-hydrolase activity of γ-GT homologue for C-C bond cleavage. The related enzymes share a key Thr residue, which acts as an internal nucleophile for protein hydrolysis and then as a newly released N-terminal nucleophile for carboxylate side-chain processing likely through the generation of an oxalyl-Thr enzyme intermediate. These findings provide mechanistic insights into the biosynthesis of various ALDP residues/associated natural products, highlight the versatile functions of Ntn-hydrolase fold proteins, and particularly generate interest in thus far less-appreciated γ-GT homologues in actinobacteria.

  5. International key comparison of neutron fluence measurements in mono-energetic neutron fields: C.C.R.I.(3)-K10

    Energy Technology Data Exchange (ETDEWEB)

    Chen, J.; Wang, Z.; Rong, C. [China Institute of Atomic Energy (CIAE), Beijing, People' s Republic of China (China); Lovestam, G.; Plompen, A.; Puglisi, N. [EC-JRC-Institute for Reference Materials and Measurements (IRMM), Geel (Belgium); Gilliam, D.M.; Eisenhauer, C.M.; Nico, J.S.; Dewey, M.S. [National Institute of Standards and Technology (NIST), Gaithersburg (United States); Kudo, K.; Uritani, A.; Harano, H.; Takeda, N. [National Metrology Institute of Japan (NMIJ), Tsukuba (Japan); Thomas, D.J.; Roberts, N.J.; Bennett, A.; Kolkowski, P. [National Physical Laboratory (NPL), Teddington (United Kingdom); Moisseev, N.N.; Kharitonov, I.A. [Mendeleyev Institute for Metrology (VNIIM), St Petersburg (Russian Federation); Guldbakke, S.; Klein, H.; Nolte, R.; Schlegel, D. [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany)

    2007-12-15

    C.C.R.I. Section III (neutron measurements) conducted a unique key comparison of neutron fluence measurements in mono-energetic neutron fields. In contrast to former comparisons, here the fluence measurements were performed with the participants' instruments in the same neutron fields at the P.T.B. accelerator facility. Seven laboratories- the C.I.A.E. (China), I.R.M.M. (E.C.), N.M.I.J. (Japan), N.I.S.T. (USA), N.P.L. (UK), P.T.B. (Germany) and the V.N.I.I.M. (Russia)-employed their primary standard reference methods or transfer instruments carefully calibrated against their primary standards, to determine the fluence of 0.144 MeV, 1.2 MeV, 5.0 MeV and 14.8 MeV neutrons and reported calibration coefficients for a selected neutron monitor and each neutron energy with a detailed uncertainty budget for the measurements. The key comparison reference values (K.C.R.V.) were finally evaluated as the weighted mean values of the neutron fluence at 1 m distance from the target in vacuum per neutron monitor count. The uncertainties of each K.C.R.V. amounted to about 1%. The degree of equivalence (D.o.E.), defined as the deviation of the result reported by the laboratories for each energy from the corresponding K.C.R.V., and the associated expanded uncertainty are also reported. The deviations between the results of two laboratories each with the corresponding expanded uncertainties complete the documentation of the degrees of equivalence. (authors)

  6. Increased C-C chemokine receptor 2 gene expression in monocytes of severe obstructive sleep apnea patients and under intermittent hypoxia.

    Science.gov (United States)

    Chuang, Li-Pang; Chen, Ning-Hung; Lin, Shih-Wei; Chang, Ying-Ling; Liao, Hsiang-Ruei; Lin, Yu-Sheng; Chao, I-Ju; Lin, Yuling; Pang, Jong-Hwei S

    2014-01-01

    Obstructive sleep apnea (OSA) is known to be a risk factor of coronary artery disease. The chemotaxis and adhesion of monocytes to the endothelium in the early atherosclerosis is important. This study aimed to investigate the effect of intermittent hypoxia, the hallmark of OSA, on the chemotaxis and adhesion of monocytes. Peripheral blood was sampled from 54 adults enrolled for suspected OSA. RNA was prepared from the isolated monocytes for the analysis of C-C chemokine receptor 2 (CCR2). The effect of intermittent hypoxia on the regulation and function of CCR2 was investigated on THP-1 monocytic cells and monocytes. The mRNA and protein expression levels were investigated by RT/real-time PCR and western blot analysis, respectively. Transwell filter migration assay and cell adhesion assay were performed to study the chemotaxis and adhesion of monocytes. Monocytic CCR2 gene expression was found to be increased in severe OSA patients and higher levels were detected after sleep. Intermittent hypoxia increased the CCR2 expression in THP-1 monocytic cells even in the presence of TNF-α and CRP. Intermittent hypoxia also promoted the MCP-1-mediated chemotaxis and adhesion of monocytes to endothelial cells. Furthermore, inhibitor for p42/44 MAPK or p38 MAPK suppressed the activation of monocytic CCR2 expression by intermittent hypoxia. This is the first study to demonstrate the increase of CCR2 gene expression in monocytes of severe OSA patients. Monocytic CCR2 gene expression can be induced under intermittent hypoxia which contributes to the chemotaxis and adhesion of monocytes.

  7. Performance of the HADES spectrometer for dilepton identification in the reaction C+C at 1-2 AGeV

    International Nuclear Information System (INIS)

    Toia, A.

    2004-03-01

    In the framework of the present thesis a detailed study of the performance of the HADES trigger is presented. To investigate and characterize the functionality of this trigger, all hardware components have been emulated with software. The most selective algorithm of the second level trigger is the identification of Cherenkov rings from electrons traversing the RICH, which alone can provide an event reduction factor higher than 10 for C+C collisions. The behavior of the online ring recognition has been studied with the help of simulations, where an efficiency of around 85% has been measured, and by comparing it to the o.ine analysis algorithm. Both online and offline ring recognition algorithms are dominated by misidentified rings, which have to be rejected in order to make a proper comparison. The rejection is done with the selection of a lepton candidate sample with an analysis, developed and performed in the framework of the present thesis, which makes used of the information collected by the full detector. Depending upon the conditions, the online ring finder is capable to recognize up to 80% of the lepton candidates reconstructed with the offline analysis. The second level trigger was fully operational during the beamtime of November 2002 with an event reduction by a factor 12. It has been estimated that higher reduction, up to a factor 20 are achievable without further loss of efficiency. Due to a more restrictive implementation of the ring recognition algorithm, a lepton efficiency of 62% was measured, while 84% efficiency was estimated for dileptons with opening angle larger than 4., and 92% for opening angle larger than 8. However no physical bias was introduced in the data, as the agreement between leptons and dileptons spectra for triggered and untriggered events shows. In the triggered events an enhancement by a factor 7.5 is found in the lepton yield, and by a factor 11 in the open pairs dilepton yield with respect to the untriggered ones. (orig.)

  8. Chemokine (C-C motif) receptor 5-using envelopes predominate in dual/mixed-tropic HIV from the plasma of drug-naive individuals.

    Science.gov (United States)

    Irlbeck, David M; Amrine-Madsen, Heather; Kitrinos, Kathryn M; Labranche, Celia C; Demarest, James F

    2008-07-31

    HIV-1 utilizes CD4 and either chemokine (C-C motif) receptor 5 (CCR5) or chemokine (C-X-C motif) receptor 4 (CXCR4) to gain entry into host cells. Small molecule CCR5 antagonists are currently being developed for the treatment of HIV-1 infection. Because HIV-1 may also use CXCR4 for entry, the use of CCR5 entry inhibitors is controversial for patients harboring CCR5-using and CXCR4-using (dual/mixed-tropic) viruses. The goal of the present study was to determine the proportion of CCR5-tropic and CXCR4-tropic viruses in dual/mixed-tropic virus isolates from drug-naïve patients and the phenotypic and genotypic relationships of viruses that use CCR5 or CXCR4 or both. Fourteen antiretroviral-naive HIV-1-infected patients were identified as having population coreceptor tropism readout of dual/mixed-tropic viruses. Intrapatient comparisons of coreceptor tropism and genotype of env clones were conducted on plasma virus from each patient. Population HIV-1 envelope tropism and susceptibility to the CCR5 entry inhibitor, aplaviroc, were performed using the Monogram Biosciences Trofile Assay. Twelve env clones from each patient were analyzed for coreceptor tropism, aplaviroc sensitivity, genotype, and intrapatient phylogenetic relationships. Viral populations from antiretroviral-naive patients with dual/mixed-tropic virus are composed primarily of CCR5-tropic env clones mixed with those that use both coreceptors (R5X4-tropic) and, occasionally, CXCR4-tropic env clones. Interestingly, the efficiency of CXCR4 use by R5X4-tropic env clones varied with their genetic relationships to CCR5-tropic env clones from the same patient. These data show that the majority of viruses in these dual/mixed-tropic populations use CCR5 and suggest that antiretroviral-naive patients may benefit from combination therapy that includes CCR5 entry inhibitors.

  9. Projeto da reologia de concretos refratários zero-cimento no sistema Al2O3-SiC-C Rheological design of zero-cement refractory castables in the Al2O3-SiC-C system

    Directory of Open Access Journals (Sweden)

    I. R. de Oliveira

    2001-12-01

    Full Text Available Concretos refratários no sistema Al2O3-SiC-C vêm sendo utilizados principalmente no revestimento de canais de corrida de altos-fornos. A associação dessas matérias-primas tem elevado o desempenho dos concretos refratários frente às severas condições de trabalho, devido ao aumento da resistência ao choque térmico e ao ataque por escória e metal fundido. Apesar disso, o nível de conhecimento científico sobre a dispersão das partículas desse sistema multifásico é limitado. Neste trabalho, suspensões representativas da matriz de concretos refratários zero-cimento no sistema Al2O3-SiC-C foram preparadas para a avaliação da eficiência de aditivos na dispersão simultânea de diferentes matérias-primas, bem como para a análise do comportamento reológico da matriz em função do pH e teor de aditivo. Os ácidos poliacrílico e cítrico e um surfactante não iônico foram usados como dispersantes. Os valores de viscosidade aparente e tensão de escoamento obtidos foram usados para construir mapas de estabilidade da matriz. Medidas de pH e fluidez de concretos preparados com diferentes teores de aditivo mostraram que as condições iniciais de pH não foram correspondentes à região ótima de dispersão estabelecida pelos mapas de estabilidade. O uso de altos teores de ácido cítrico, bem como, o deslocamento do pH do concreto na direção da região ótima de dispersão foram eficientes para otimizar a sua fluidez.Refractory castables in the Al2O3-SiC-C system have been used mainly as linings for blast furnace runners. The association of these raw materials has enabled the development of high quality refractory castables due to improvements on their resistance to thermal shock, slag and metal corrosion. Nevertheless, the scientific knowledge regarding particle dispersion in this system is quite limited. In this work, representative suspensions of the matrix of Al2O3-SiC-C refractory castables were prepared in order to evaluate

  10. Hemolytic disease of the newborn caused by irregular blood subgroup (Kell, C, c, E, and e) incompatibilities: report of 106 cases at a tertiary-care centre.

    Science.gov (United States)

    Karagol, Belma Saygili; Zenciroglu, Aysegul; Okumus, Nurullah; Karadag, Nilgun; Dursun, Arzu; Hakan, Nilay

    2012-06-01

    To determine the clinical spectrum of hemolytic disease due to irregular blood subgroup incompatibility in hospitalized neonates. The medical records of the all hospitalized newborn patients diagnosed with indirect hyperbilirubinemia due to subgroup incompatibility in Kell, C, c, E, and e systems were included in the study. Data from 106 newborns with hemolytic jaundice due to irregular blood subgroups were retrospectively evaluated, and clinical and laboratory findings were compared between patients . The treatment modalities given to the patients of each subgroup types and the laboratory findings and treatment modalities of the cases according to Coombs tests results were also analyzed. Fetal affection of the hemolysis and also fetal losses due to irregular red-cell alloimmunization were not detected in prenatal course, as there was no follow-up of these pregnancies. The mean postnatal hospitalizing age was 6.1 ± 5.2 days after birth. The mean total bilirubin level and the mean hemoglobin value on hospitalization were 343.7 ± 63.3 µmol/L (=20.1 ± 3.7 mg/dL) and 14.9 ± 3.4 g/dL, respectively. Of 106 patients identified with irregular subgroup incompatibility, 40 infants (37.7%) were associated with C, 22 (20.8%) with c, 30 (28.3%) with E, 9 (8.5%) with e, and 5 (4.7%) with Kell subgroup system. Positive Coombs tests (either direct and/or indirect) occurred in 28.3% of the study cases. Hydrops fetalis was determined in 5 of 106 neonates (4.7%). Twenty-two of 106 (20.8%) patients required total exchange transfusion. Positive Coombs test in cases required total exchange transfusion was 63.6%. Our data expose the magnitude and spectrum of the potential developing severe hemolytic disease and immune hydrops due to irregular subgroup incompatibility. Minor group antibody screening is recommended both in the mother and the high-risk infants with hyperbilirubinemia and hemolytic disease of the newborn. Copyright © 2012 Thieme Medical Publishers, Inc., 333 Seventh

  11. Laccase-catalyzed C-S and C-C coupling for a one-pot synthesis of 1,4-naphthoquinone sulfides and 1,4-naphthoquinone sulfide dimers

    CSIR Research Space (South Africa)

    Wellington, Kevin W

    2013-06-01

    Full Text Available Oxidative C-S and C-C bond formation with aryl and alkyl thiols was catalyzed under mild conditions in a reaction vessel open to air at pH 4.5 in the presence of a commercial laccase (Novozym 51003 or Suberase) and a cosolvent (DMF) to afford 1...

  12. Unusual C-C bond cleavage in the formation of amine-bis(phenoxy) group 4 benzyl complexes: Mechanism of formation and application to stereospecific polymerization

    KAUST Repository

    Gowda, Ravikumar R.

    2014-08-11

    Group 4 tetrabenzyl compounds MBn4 (M = Zr, Ti), upon protonolysis with an equimolar amount of the tetradentate amine-tris(phenol) ligand N[(2,4-tBu2C6H2(CH 2)OH]3 in toluene from -30 to 25 °C, unexpectedly lead to amine-bis(phenoxy) dibenzyl complexes, BnCH2N[(2,4- tBu2C6H2(CH2)O] 2MBn2 (M = Zr (1), Ti (2)) in 80% (1) and 75% (2) yields. This reaction involves an apparent cleavage of the >NCH2-ArOH bond (loss of the phenol in the ligand) and formation of the >NCH 2-CH2Bn bond (gain of the benzyl group in the ligand). Structural characterization of 1 by X-ray diffraction analysis confirms that the complex formed is a bis(benzyl) complex of Zr coordinated by a newly derived tridentate amine-bis(phenoxy) ligand arranged in a mer configuration in the solid state. The abstractive activation of 1 and 2 with B(C6F 5)3·THF in CD2Cl2 at room temperature generates the corresponding benzyl cations {BnCH2N[(2,4- tBu2C6H2(CH2)O] 2MBn(THF)}+[BnB(C6F5) 3]- (M = Zr (3), Ti, (4)). These cationic complexes, along with their analogues derived from (imino)phenoxy tri- and dibenzyl complexes, [(2,6-iPr2C6H3)N=C(3,5- tBu2C6H2)O]ZrBn3 (5) and [2,4-Br2C6H2(O)(6-CH2(NC 5H9))CH2N=CH(2-adamantyl-4-MeC 6H2O)]ZrBn2 (6), have been found to effectively polymerize the biomass-derived renewable β-methyl-α-methylene- γ-butyrolactone (βMMBL) at room temperature into the highly stereoregular polymer PβMMBL with an isotacticity up to 99% mm. A combined experimental and DFT study has yielded a mechanistic pathway for the observed unusual C-C bond cleavage in the present protonolysis reaction between ZrBn4 and N[(2,4-tBu2C 6H2(CH2)OH]3 for the formation of complex 1, which involves the benzyl radical and the Zr(III) species, resulting from thermal and photochemical decomposition of ZrBn4, followed by a series of reaction sequences consisting of protonolysis, tautomerization, H-transfer, oxidation, elimination, and radical coupling. © 2014 American Chemical Society.

  13. Thermodynamic and structural properties of the specific binding between Ag⁺ ion and C:C mismatched base pair in duplex DNA to form C-Ag-C metal-mediated base pair.

    Science.gov (United States)

    Torigoe, Hidetaka; Okamoto, Itaru; Dairaku, Takenori; Tanaka, Yoshiyuki; Ono, Akira; Kozasa, Tetsuo

    2012-11-01

    Metal ion-nucleic acid interactions have attracted considerable interest for their involvement in structure formation and catalytic activity of nucleic acids. Although interactions between metal ion and mismatched base pair duplex are important to understand mechanism of gene mutations related to heavy metal ions, they have not been well-characterized. We recently found that the Ag(+) ion stabilized a C:C mismatched base pair duplex DNA. A C-Ag-C metal-mediated base pair was supposed to be formed by the binding between the Ag(+) ion and the C:C mismatched base pair to stabilize the duplex. Here, we examined specificity, thermodynamics and structure of possible C-Ag-C metal-mediated base pair. UV melting indicated that only the duplex with the C:C mismatched base pair, and not of the duplexes with the perfectly matched and other mismatched base pairs, was specifically stabilized on adding the Ag(+) ion. Isothermal titration calorimetry demonstrated that the Ag(+) ion specifically bound with the C:C base pair at 1:1 molar ratio with a binding constant of 10(6) M(-1), which was significantly larger than those for nonspecific metal ion-DNA interactions. Electrospray ionization mass spectrometry also supported the specific 1:1 binding between the Ag(+) ion and the C:C base pair. Circular dichroism spectroscopy and NMR revealed that the Ag(+) ion may bind with the N3 positions of the C:C base pair without distorting the higher-order structure of the duplex. We conclude that the specific formation of C-Ag-C base pair with large binding affinity would provide a binding mode of metal ion-DNA interactions, similar to that of the previously reported T-Hg-T base pair. The C-Ag-C base pair may be useful not only for understanding of molecular mechanism of gene mutations related to heavy metal ions but also for wide variety of potential applications of metal-mediated base pairs in various fields, such as material, life and environmental sciences. Copyright © 2012 Elsevier

  14. Dynamic studies of cardiac valvular disease using a new fast multiphase MR imaging technique

    International Nuclear Information System (INIS)

    Pettigrew, R.; Churchwell, A.; Parks, W.J.; Dannels, W.; Smith, H. III; Baron, M.G.

    1986-01-01

    To determine the potential utility of fast multiphase (FM) imaging for the assessment of cardiac valvular disease, ten healthy volunteers and 18 patients were studied. The FM technique employed gradient echoes with TE -- 15 msec and small exitation angles with TR -- 50 msec. Cine display of the electrocardiographically gated FM images allowed clear visualization of regurgitant blood flow in each of 15 patients with tricuspid or mitral insufficiency. Magnetic field distortions in two patients with Bjork-Shiley aortic prostheses and regurgitation prevented definitive visualization of the flow patterns. An equivocal flow pattern was seen in one case of mitral stenosis. Thus, FM imaging may have significant utility as an adjunctive procedure for the assessment of atrioventricular valve insufficiently, without requiring a contrast agent. Difficulties may exist with some prosthetic valves

  15. Actualizing of calibration curves of {sup 14}C/C, {sup 90}Sr/Ca, {sup 228}Th/{sup 232}Th in ivory for the determination of the post mortal interval of elephants and consequences of the radiation protection of non-human species; Aktualisierung von Kalibierkurven von {sup 14}C/C, {sup 90}Sr/Ca und {sup 228}Th/{sup 232}Th in Elefantenelfenbein zum Zwecke der Alterbestimmung und die Konsequenzen fuer den Strahlenschutz nicht-menschlicher Arten

    Energy Technology Data Exchange (ETDEWEB)

    Schupfner, R. [Regensburg Univ. (Germany). ZRN-URA Lab.

    2016-07-01

    The determination of the activity concentration of the radionuclides {sup 14}C/C and {sup 90}Sr/Ca and {sup 228}Th/{sup 232}Th applying combined radionuclide analyses methods has been proved to be a suitable tool for the purpose of an unambiguous age determination of elephant ivory [1, 2, 3, 10, 11, 12, 13]. Analysing representative and independently dated samples (N = 28) of ivory the curves fitting the post mortal interval (PMI) versus the activity concentration of the radionuclides mentioned above produced the data base enabling a more unambiguous age determination. Data from these studies origin [1, 2, 3, 10, 11, 12, 13] in analyses of ivory samples which were available up to the 2012. During the last five years there was a gap in information of the future trend of {sup 14}C/C and {sup 90}Sr/Ca. Up to this study it was not possible to assess whether the future level of {sup 14}C/C as well as {sup 90}Sr/Ca can analytically be distinguished from the level before 1954. At about 1954 the activity concentration of radionuclides from the atmospheric nuclear explosion, as {sup 14}C and {sup 90}Sr, increased in ivory significantly. This study aims in closing this information gap. The results of analyses of {sup 14}C/C, {sup 90}Sr/Ca, {sup 228}Th/{sup 232}Th in ivory with PMI values ranging from 1 to 5 years are presented and interpreted. These data enable an actualization of the calibration curves of PMI versus specific activities. This is necessary for a better understanding of the effect of blindness of {sup 14}C/C dating and its prevention. On the base of all available results form independent dated ivory sample available up to 2015 a suitable analytical procedure is suggested which aims in a more precise and reliable age determination of elephant tusks. Results of determining of radionuclides {sup 14}C/C and {sup 90}Sr/Ca and {sup 228}Th/{sup 232}Th in ivory are shown from before 1950 to 2015. These results are discussed with respect the purposes of dating as well

  16. Mechanism of C-C and C-H bond cleavage in ethanol oxidation reaction on Cu2O(111): a DFT-D and DFT+U study.

    Science.gov (United States)

    Xu, Han; Miao, Bei; Zhang, Minhua; Chen, Yifei; Wang, Lichang

    2017-10-04

    The performance of transition metal catalysts for ethanol oxidation reaction (EOR) in direct ethanol fuel cells (DEFCs) may be greatly affected by their oxidation. However, the specific effect and catalytic mechanism for EOR of transition metal oxides are still unclear and deserve in-depth exploitation. Copper as a potential anode catalyst can be easily oxidized in air. Thus, in this study, we investigated C-C and C-H bond cleavage reactions of CH x CO (x = 1, 2, 3) species in EOR on Cu 2 O(111) using PBE+U calculations, as well as the specific effect of +U correction on the process of adsorption and reaction on Cu 2 O(111). It was revealed that the catalytic performance of Cu 2 O(111) for EOR was restrained compared with that of Cu(100). Except for the C-H cleavage of CH 2 CO, all the reaction barriers for C-C and C-H cleavage were higher than those on Cu(100). The most probable pathway for CH 3 CO to CHCO on Cu 2 O(111) was the continuous dehydrogenation reaction. Besides, the barrier for C-C bond cleavage increased due to the loss of H atoms in the intermediate. Moreover, by the comparison of the traditional GGA/PBE method and the PBE+U method, it could be concluded that C-C cleavage barriers would be underestimated without +U correction, while C-H cleavage barriers would be overestimated. +U correction was proved to be necessary, and the reaction barriers and the values of the Hubbard U parameter had a proper linear relationship.

  17. Thermal decomposition of the b.c.c. β-solid solution of titanium alloy containing 6.7 at% Mo, 3 at% Zr, and 1.8 at% Sn. 1

    International Nuclear Information System (INIS)

    Zakharova, M.I.; Khundzhua, A.K.; Kertesz, L.; Szasz, A.

    1981-01-01

    Changes in the crystal structure of the titanium alloy, containing 6.7 at% Mo, 3 at% Zr, and 1.8 at% Sn, during thermal decomposition are followed by means of X-ray and electron diffraction methods. Parallel to these tests the alteration in the electron structure and chemical bonds of the alloy are investigated with the help of the soft-x-ray emission (SXES) method. Attention is focussed on the at room temperature not equilibrated b.c.c. β-solid solution, on the metastable transition phase ω, and on the equilibrium phase α. (author)

  18. Effect of locally delivered tetracycline hydrochloride as an adjunct to scaling and root planing on Hba1c, C-reactive protein, and lipid profile in type 2 diabetes: A clinico-biochemical study

    Directory of Open Access Journals (Sweden)

    Vidya Dodwad

    2012-01-01

    Full Text Available Aim: The aim was to assess the levels of HbA1c, C-reactive protein, and lipid profile in patients with type 2 diabetes mellitus by treating the pockets using collagen impregnated sustained release resorbable tetracycline fiber (periodontal plus AB fiber following scaling and root planing (SRP. Materials and Methods: A total of 40 patients with type 2 diabetes mellitus were randomly distributed into two groups receiving either SRP and tetracycline fiber or SRP alone. Patients were evaluated clinically with gingival index, plaque index, probing depth, and relative attachment level, and bio-chemically with HbA1c, C Reactive Protein, and lipid profile at baseline, 1 month, and 3 months. Results: Significant reduction in all the clinical parameters was seen in the tetracycline group compared to the control group. Bio-chemical analysis also revealed similar results except for cholesterol and High density lipoprotein who did not show any significant reduction. Conclusion: Locally delivered tetracycline as a better treatment modality compared to SRP alone.

  19. Primary ethynamines (HC similarly ordered CNH2, PhC similarly ordere CNH2), aminopropadienone (H2NCH=C=C=O), and imidoylketene (NH=CHCH=C=O). Preparation and identification of molecules of cosmochemical interest

    International Nuclear Information System (INIS)

    Wentrup, C.; Briehl, H.; Lorencak, P.; Vogelbacher, U.J.; Winter, H.W.; Maquestiau, A.; Flammang, R.

    1988-01-01

    Ethynamine (HC similarly ordered CNH 2 ) has been prepared from three different precursors by flash vacuum pyrolysis (FVP) and observed by low-temperature infrared spectroscopy for the first time. The collision activation mass spectra (CAMS) strongly support the assignments. The Meldrum's acid derivative also gives rise to equilibrating imidoylketene and aminopropadienone observable by both IR and CAMS. Ethynamine isomerizes in part to acetonitrile in the gas phase but polymerizes in the solid state between -70 and -50 0 C. Both ketene imine (H 2 C=C=NH) and acrylonitrile are formed on FVP of 3-hydroxypropionitrile. 2-Phenylethynamine (PhC similarly ordered CNH 2 ) is readily produced by FVP of the isoxazolone

  20. Comportamiento mecánico y estudio in situ de la evolución del daño en el grafito y en un compuesto C/C a 77 y a 300 K

    Directory of Open Access Journals (Sweden)

    Salazar, A.

    2002-04-01

    Full Text Available The mechanical properties at 77 K and at 300 K were determined in two polycristalline graphites with different microstructures and in a C/C composite. The flexure strength and the fracture toughness were evaluated and the micromechanic failure was studied in situ with a long distance microscope. The results obtained showed that the mechanical properties of these carbon materials are not affected by the cryogenic temperatures. The porosity is the main responsible of the mechanical failure in the graphites while in the composite, the matrix/yarn interface deflect the crack nucleated in the mattrix, presenting the best mechanical behavior.

    En este trabajo se han evaluado las propiedades mecánicas a 77 y a 300 K de dos grafitos policristalinos con microestructuras muy diferentes y de un compuesto C/C. Se realizaron ensayos de flexión en tres puntos y de tenacidad, y en éstos últimos se midió in situ la iniciación y la evolución del daño en el fondo de la entalla con un microscopio de larga distancia focal. Los resultados obtenidos muestran que las temperaturas criogénicas no afectan el comportamiento mecánico de los compuestos de carbono estudiados. Además, la porosidad presente en los grafitos es el mecanismo de rotura dominante mientras que en el material compuesto, la intercara débil entre matriz y haz de fibras detiene y desvía las grietas nucleadas en la matriz, presentando el mejor comportamiento mecánico.

  1. Sphingosine 1-Phosphate- and C-C Chemokine Receptor 2-Dependent Activation of CD4+ Plasmacytoid Dendritic Cells in the Bone Marrow Contributes to Signs of Sepsis-Induced Immunosuppression

    Science.gov (United States)

    Smirnov, Anna; Pohlmann, Stephanie; Nehring, Melanie; Ali, Shafaqat; Mann-Nüttel, Ritu; Scheu, Stefanie; Antoni, Anne-Charlotte; Hansen, Wiebke; Büettner, Manuela; Gardiasch, Miriam J.; Westendorf, Astrid M.; Wirsdörfer, Florian; Pastille, Eva; Dudda, Marcel; Flohé, Stefanie B.

    2017-01-01

    Sepsis is the dysregulated response of the host to systemic, mostly bacterial infection, and is associated with an enhanced susceptibility to life-threatening opportunistic infections. During polymicrobial sepsis, dendritic cells (DCs) secrete enhanced levels of interleukin (IL) 10 due to an altered differentiation in the bone marrow and contribute to the development of immunosuppression. We investigated the origin of the altered DC differentiation using murine cecal ligation and puncture (CLP), a model for human polymicrobial sepsis. Bone marrow cells (BMC) were isolated after sham or CLP operation, the cellular composition was analyzed, and bone marrow-derived DCs (BMDCs) were generated in vitro. From 24 h on after CLP, BMC gave rise to BMDC that released enhanced levels of IL-10. In parallel, a population of CD11chiMHCII+CD4+ DCs expanded in the bone marrow in a MyD88-dependent manner. Prior depletion of the CD11chiMHCII+CD4+ DCs from BMC in vitro reversed the increased IL-10 secretion of subsequently differentiating BMDC. The expansion of the CD11chiMHCII+CD4+ DC population in the bone marrow after CLP required the function of sphingosine 1-phosphate receptors and C-C chemokine receptor (CCR) 2, the receptor for C-C chemokine ligand (CCL) 2, but was not associated with monocyte mobilization. CD11chiMHCII+CD4+ DCs were identified as plasmacytoid DCs (pDCs) that had acquired an activated phenotype according to their increased expression of MHC class II and CD86. A redistribution of CD4+ pDCs from MHC class II− to MHC class II+ cells concomitant with enhanced expression of CD11c finally led to the rise in the number of CD11chiMHCII+CD4+ DCs. Enhanced levels of CCL2 were found in the bone marrow of septic mice and the inhibition of CCR2 dampened the expression of CD86 on CD4+ pDCs after CLP in vitro. Depletion of pDCs reversed the bias of splenic DCs toward increased IL-10 synthesis after CLP in vivo. Thus, during polymicrobial sepsis, CD4+ pDCs are activated

  2. Sphingosine 1-Phosphate- and C-C Chemokine Receptor 2-Dependent Activation of CD4+ Plasmacytoid Dendritic Cells in the Bone Marrow Contributes to Signs of Sepsis-Induced Immunosuppression

    Directory of Open Access Journals (Sweden)

    Anna Smirnov

    2017-11-01

    Full Text Available Sepsis is the dysregulated response of the host to systemic, mostly bacterial infection, and is associated with an enhanced susceptibility to life-threatening opportunistic infections. During polymicrobial sepsis, dendritic cells (DCs secrete enhanced levels of interleukin (IL 10 due to an altered differentiation in the bone marrow and contribute to the development of immunosuppression. We investigated the origin of the altered DC differentiation using murine cecal ligation and puncture (CLP, a model for human polymicrobial sepsis. Bone marrow cells (BMC were isolated after sham or CLP operation, the cellular composition was analyzed, and bone marrow-derived DCs (BMDCs were generated in vitro. From 24 h on after CLP, BMC gave rise to BMDC that released enhanced levels of IL-10. In parallel, a population of CD11chiMHCII+CD4+ DCs expanded in the bone marrow in a MyD88-dependent manner. Prior depletion of the CD11chiMHCII+CD4+ DCs from BMC in vitro reversed the increased IL-10 secretion of subsequently differentiating BMDC. The expansion of the CD11chiMHCII+CD4+ DC population in the bone marrow after CLP required the function of sphingosine 1-phosphate receptors and C-C chemokine receptor (CCR 2, the receptor for C-C chemokine ligand (CCL 2, but was not associated with monocyte mobilization. CD11chiMHCII+CD4+ DCs were identified as plasmacytoid DCs (pDCs that had acquired an activated phenotype according to their increased expression of MHC class II and CD86. A redistribution of CD4+ pDCs from MHC class II− to MHC class II+ cells concomitant with enhanced expression of CD11c finally led to the rise in the number of CD11chiMHCII+CD4+ DCs. Enhanced levels of CCL2 were found in the bone marrow of septic mice and the inhibition of CCR2 dampened the expression of CD86 on CD4+ pDCs after CLP in vitro. Depletion of pDCs reversed the bias of splenic DCs toward increased IL-10 synthesis after CLP in vivo. Thus, during polymicrobial sepsis, CD4+ pDCs are

  3. Fabrication of steel matrix composites locally reinforced with different ratios of TiC/TiB2 particulates using SHS reactions of Ni-Ti-B4C and Ni-Ti-B4C-C systems during casting

    International Nuclear Information System (INIS)

    Yang Yafeng; Wang Huiyuan; Liang Yunhong; Zhao Ruyi; Jiang Qichuan

    2007-01-01

    Steel matrix composites locally reinforced with different molar ratios of in situ TiC/TiB 2 particulates (2:1, 1:1 and 1:2, respectively) have been fabricated successfully utilizing the self-propagating high-temperature synthesis (SHS) reactions of Ni-Ti-B 4 C and Ni-Ti-B 4 C-C systems during casting. Differential thermal analysis (DTA) and X-ray diffraction (XRD) results reveal that the exothermic reactions of the Ni-Ti-B 4 C and Ni-Ti-B 4 C-C systems proceed in such a way that Ni initially reacts with B 4 C and Ti to form Ni 2 B and Ti 2 Ni compounds, respectively, with heat evolution at 1037 deg. C; Subsequently, the external heat and the evolved heat from these exothermic reactions promote the reactions forming TiC and TiB 2 at 1133 deg. C. In the composites reinforced with 1:2 molar ratio of TiC/TiB 2 , almost all TiB 2 grains have clubbed structures, while TiC grains exhibit near-spherical morphologies. Furthermore, TiB 2 grain sizes decrease, with the increase of TiC content. In particular, in the composites reinforced with 2:1 molar ratio of TiC/TiB 2 , it is difficult to find the clubbed TiB 2 grains. Macro-pores and blowholes are absent in the local reinforcing region of the composites reinforced with 1:1 and 1:2 molar ratios of TiC/TiB 2 , while a few macro-pores can be observed in the composite reinforced with 2:1 molar ratio of TiC/TiB 2 . Moreover, the densities of the composites reinforced with 1:1 and 1:2 molar ratios of TiC/TiB 2 are higher than that of the composite reinforced with 2:1 molar ratio of TiC/TiB 2 . The composite reinforced with 1:2 molar ratio of TiC/TiB 2 has the highest hardness and the best wear resistance

  4. A new face of phenalenyl-based radicals in the transition metal-free C-H arylation of heteroarenes at room temperature: trapping the radical initiator via C-C σ-bond formation.

    Science.gov (United States)

    Ahmed, Jasimuddin; P, Sreejyothi; Vijaykumar, Gonela; Jose, Anex; Raj, Manthan; Mandal, Swadhin K

    2017-11-01

    The radical-mediated transition metal-free approach for the direct C-H bond functionalization of arenes is considered as a cost effective alternative to transition metal-based catalysis. An organic ligand-based radical plays a key role by generating an aryl radical which undergoes a subsequent functionalization process. The design principle of the present study takes advantage of a relatively stable odd alternant hydrocarbon-based phenalenyl (PLY) radical. In this study, the first transition metal-free catalyzed direct C-H arylation of a variety of heteroarenes such as azoles, furan, thiophene and pyridine at room temperature has been reported using a phenalenyl-based radical without employing any photoactivation step. This protocol has been successfully applied to the gram scale synthesis of core moieties of bioactive molecules. The phenalenyl-based radical initiator has been characterized crystallographically by trapping it via the formation of a C-C σ-bond between the phenalenyl radical and solvent-based radical species.

  5. Capillary arterialization requires the bone-marrow-derived cell (BMC)-specific expression of chemokine (C-C motif) receptor-2, but BMCs do not transdifferentiate into microvascular smooth muscle.

    Science.gov (United States)

    Nickerson, Meghan M; Burke, Caitlin W; Meisner, Joshua K; Shuptrine, Casey W; Song, Ji; Price, Richard J

    2009-01-01

    Chemokine (C-C motif) receptor-2 (CCR2) regulates arteriogenesis and angiogenesis, facilitating the MCP-1-dependent recruitment of growth factor-secreting bone marrow-derived cells (BMCs). Here, we tested the hypothesis that the BMC-specific expression of CCR2 is also required for new arteriole formation via capillary arterialization. Following non-ischemic saphenous artery occlusion, we measured the following in gracilis muscles: monocyte chemotactic protein-1 (MCP-1) in wild-type (WT) C57Bl/6J mice by ELISA, and capillary arterialization in WT-WT and CCR2(-/-)-WT (donor-host) bone marrow chimeric mice, as well as BMC transdifferentiation in EGFP(+)-WT mice, by smooth muscle (SM) alpha-actin immunochemistry. MCP-1 levels were significantly elevated 1 day after occlusion in WT mice. In WT-WT mice at day 7, compared to sham controls, arterial occlusion induced a 34% increase in arteriole length density, a 46% increase in SM alpha-actin(+) vessels, and a 45% increase in the fraction of vessels coated with SM alpha-actin, indicating significant capillary arterialization. However, in CCR2(-/-)-WT mice, no differences were observed between arterial occlusion and sham surgery. In EGFP(+)-WT mice, EGFP and SM alpha-actin never colocalized. We conclude that BMC-specific CCR2 expression is required for skeletal muscle capillary arterialization following arterial occlusion; however, BMCs do not transdifferentiate into smooth muscle.

  6. Reactions of a 16-electron Cp*Co half-sandwich complex containing a chelating 1,2-dicarba-closo-dodecaborane-1,2-dithiolate ligand with alkynones HC≡C-C(O)R (R=OMe,Me,Ph)

    Institute of Scientific and Technical Information of China (English)

    GUOYIQIBAYI; Gulnisa

    2010-01-01

    The reaction of the 16e half-sandwich complex Cp*Co(S2C2B10H10) (1) (Cp* = pentamethylcyclopentadienyl) with excess methyl acetylene monocarboxylate, HC≡C-CO2Me, affords the 18e complexes 2-6. Compound 2 bears a B-CH2 unit in which B-substitution occurs in the B(3)/B(6) position of the ortho-carborane cage. Complexes 3-6 are geometrical isomers, in which the alkyne is twofold inserted into one of the Co-S bonds in all the four possible ways. Treatment of 1 with excess 3-butyn-2-one or phenyl ethynyl ketone, HC≡C-C(O)R (R = Me, Ph), at ambient temperature leads to the 18e complexes 7-10, respectively, with two alkynes inserted into one of the Co-S bonds. All the new complexes were fully characterized by spectroscopic techniques and elemental analysis. The solid-state structures of 2, 3, 5, 7, 8, 9 and 10 were further characterized by X-ray structural analysis.

  7. Synthesis and structure determination of new open-framework chromium carboxylate MIL-105 or CrIII(OH).{O2C-C6(CH3)4-CO2}.nH2O

    International Nuclear Information System (INIS)

    Serre, Christian; Millange, Franck; Devic, Thomas; Audebrand, Nathalie; Van Beek, Wouter

    2006-01-01

    Two new three-dimensional chromium(III) dicarboxylate, MIL-105 or Cr III (OH).{O 2 C-C 6 (CH 3 ) 4 -CO 2 }.nH 2 O, have been obtained under hydrothermal conditions, and their structures solved using X-ray powder diffraction data. Both solids are structural analogs of the known Cr benzenedicarboxylate compound (MIL-53). Both contain trans corner-sharing CrO 4 (OH) 2 octahedral chains connected by tetramethylterephthalate di-anions. Each chain is linked by the ligands to four other chains to form a three-dimensional framework with an array of 1D pores channels. The pores of the high temperature form of the solid, MIL-105ht, are empty. However, MIL-105ht re-hydrates at room temperature to finally give MIL-105lt with pores channels filled with free water molecules (lt: low temperature form; ht: high temperature form). The thermal behaviour of the two solids has been investigated using TGA. Crystal data for MIL-105ht: monoclinic space group C2/c with a = 19.653(1) A, b = 9.984(1) A, c = 6.970(1) A, β = 110.67(1) o and Z = 4. Crystal data for MIL-105lt: orthorhombic space group Pnam with a = 17.892(1) A, b = 11.165(1) A, c = 6.916(1) A and Z = 4

  8. Properties and microstructure of graphitised ZrC/C or SiC/C composites

    Energy Technology Data Exchange (ETDEWEB)

    Qiu, H.P.; Han, L.J.; Liu, L.

    2005-07-01

    Doped graphites were prepared from calcined coke, coal-tar pitch and dopants (Zr, Si and Si-Zr) by hot-pressing in order to investigate the effects of the composition and amount of dopants on their thermal conductivity, electrical resistivity, bending strength and microstructure. Experimental results showed that the single element (Zr or Si) and bi-element (Si-Zr) graphitised doped-carbons exhibited highly improved conductivity, but the bending strength is lower in the case of Si-doped graphite. Microstructure analyses showed that the d(002) spacing decreased with the increasing dopant concentration for the single element (Zr or Si) doped graphite. From this result, it is inferred that the degree of graphitization increased. The thermal conductivity of a (9% Zr, 2% Si) graphitised doped-carbons is 380 W m{sup -1} K{sup -1}. Correlations between the composition and content of dopants and the microstructure of doped graphite are tentatively discussed.

  9. E.C.C.C.1 Computational Chemistry: F.E.C.S. Conference. Proceedings

    International Nuclear Information System (INIS)

    Bernardi, F.; Rivail, J.; Cernusak, I.; Gasteiger, J.; Robb, M.; Soulie, E.; Troyanowsky, C.; Varmuza, K.

    1995-01-01

    These proceedings represent the papers presented at the First European Conference on Computational Chemistry held in Nancy, France. The papers presented fall into three groups:1. Methods and applications of quantum molecular modeling, 2. Classical molecular modeling, 3. Methods and applications in the treatment of chemical information. The papers represent a fair and balanced survey of the present trends of European research in computational chemistry. There were 237 papers presented and 10 have been abstracted for the Energy Science and Technology database

  10. Enveloping σ-C C C-algebra of a smooth Frechet algebra crossed ...

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 116; Issue 2. Enveloping -*-Algebra of a Smooth Frechet Algebra Crossed Product by R R , K -Theory and Differential Structure in *-Algebras. Subhash J Bhatt. Regular Articles Volume 116 Issue 2 May 2006 pp 161-173 ...

  11. Genetic polymorphism rs3760396 of the chemokine (C-C motif) ligand 2 gene (CCL2) associated with the susceptibility of lung cancer in a pathological subtype-specific manner in Han-ancestry Chinese: a case control study

    International Nuclear Information System (INIS)

    Li, Xu; Lin, Fangcai; Zhou, Hong

    2016-01-01

    Chemokines are well known inflammatory factors critical for tumor development in diverse tissues, including lung cancer. Chemokine (C-C motif) Ligand 2 (CCL2) was one of such chemokines important for both primary tumor development and metastasis of various cancers. Polymorphism at rs3760396 of CCL2 genes is associated with the prognosis of non-small cell lung cancer (NSCLC). The goal of our study was to examine the relationship of genetic polymorphisms rs3760396 with the susceptibility of lung cancer and its pathological subtypes in Han-ancestry Chinese population. rs3760396 G/C polymorphism of CCL2 was genotyped using PCR in 394 patients with lung cancer and 545 cancer-free controls from the same Northeast region of China. After controlling for gender, age and smoking status, no significant association was observed between rs3760396 polymorphism and overall lung cancer. However, minor allele G of rs3760396 polymorphism was significantly associated with increased risk of adenosquamous lung carcinoma with either allelic genetic model (OR = 5.29, P < 0.001), or dominant genetic model (OR = 9.88, P < 0.001), or genotypic model (GC genotype vs. CC genotype, OR = 10.73, P < 0.001). Although rs3760396 polymorphism was not significantly associated with increased risk of adenocarcinoma subtype, it was nominally associated with the pooled outcome of either adenocarcinoma or adenosquamous carcinoma under allelic genetic model (OR = 1.54, P = 0.023) or dominant genetic model (OR = 1.57, P = 0.031). Our study suggested rs3760396 polymorphism of CCL2 is associated not only with prognosis of NSCLC, but also with risk of lung cancer in a subtype-specific manner. Our results further supported previous evidence of the important role of CCL2 in lung cancer development

  12. C-C bond unsaturation degree in monosubstituted ferrocenes for molecular electronics investigated by a combined near-edge x-ray absorption fine structure, x-ray photoemission spectroscopy, and density functional theory approach

    International Nuclear Information System (INIS)

    Boccia, A.; Lanzilotto, V.; Marrani, A. G.; Zanoni, R.; Stranges, S.; Alagia, M.; Fronzoni, G.; Decleva, P.

    2012-01-01

    We present the results of an experimental and theoretical investigation of monosubstituted ethyl-, vinyl-, and ethynyl-ferrocene (EtFC, VFC, and EFC) free molecules, obtained by means of synchrotron-radiation based C 1s photoabsorption (NEXAFS) and photoemission (C 1s XPS) spectroscopies, and density functional theory (DFT) calculations. Such a combined study is aimed at elucidating the role played by the C-C bond unsaturation degree of the substituent on the electronic structure of the ferrocene derivatives. Such substituents are required for molecular chemical anchoring onto relevant surfaces when ferrocenes are used for molecular electronics hybrid devices. The high resolution C 1s NEXAFS spectra exhibit distinctive features that depend on the degree of unsaturation of the hydrocarbon substituent. The theoretical approach to consider the NEXAFS spectrum made of three parts allowed to disentangle the specific contribution of the substituent group to the experimental spectrum as a function of its unsaturation degree. C 1s IEs were derived from the experimental data analysis based on the DFT calculated IE values for the different carbon atoms of the substituent and cyclopentadienyl (Cp) rings. Distinctive trends of chemical shifts were observed for the substituent carbon atoms and the substituted atom of the Cp ring along the series of ferrocenes. The calculated IE pattern was rationalized in terms of initial and final state effects influencing the IE value, with special regard to the different mechanism of electron conjugation between the Cp ring and the substituent, namely the σ/π hyperconjugation in EtFC and the π-conjugation in VFC and EFC.

  13. Correlations between polymorphisms in the uridine diphosphate-glucuronosyltransferase 1A and C-C motif chemokine receptor 5 genes and infection with the hepatitis B virus in three ethnic groups in China.

    Science.gov (United States)

    Zhang, Chan; He, Yan; Shan, Ke-Ren; Tan, Kui; Zhang, Ting; Wang, Chan-Juan; Guan, Zhi-Zhong

    2018-02-01

    Objective To determine whether genetic polymorphisms in the uridine diphosphate-glucuronosyltransferase 1A ( UGT1A) and the C-C motif chemokine receptor 5 ( CCR5) genes are associated with hepatitis B virus (HBV) infection in Yi, Yao and Han ethnic groups in the Guizhou Province of China. Methods The study enrolled subjects with and without HBV infection. Whole blood was used for DNA genotyping using standard techniques. The study determined the frequencies of several polymorphic alleles ( UGT1A6 [rs2070959], UGT1A1 [rs8175347], CCR5-59029 [rs1799987] and CCR5Δ32 [rs333]) and then characterized their relationship with HBV infection. Results A total of 404 subjects were enrolled in the study: 138 from the Yao group, 101 from the Yi group and 165 from the Han group. There was a significant difference in the frequency of UGT1A1 rs8175347 polymorphisms among the three groups. The rates of 7TA carriers of UGT1A1 rs8175347 in all three groups were significantly higher than the other genotypes. Individuals with genotype AA of UGT1A6 rs2070959 in the Yi group had a higher risk for HBV infection than in the Yao and Han groups. The frequency of genotype GG in CCR5-59029 in the Yao group was significantly higher than in the Yi group. The genotypes of CCR5Δ32 were not associated with HBV infection. Conclusion These findings provide genetic and epidemiological evidence for an association of UGT1A and CCR5-59029 polymorphisms with HBV infection in Chinese Yi and Yao populations.

  14. Normosmic idiopathic hypogonadotropic hypogonadism due to a novel homozygous nonsense c.C969A (p.Y323X) mutation in the KISS1R gene in three unrelated families.

    Science.gov (United States)

    Demirbilek, Huseyin; Ozbek, M Nuri; Demir, Korcan; Kotan, L Damla; Cesur, Yasar; Dogan, Murat; Temiz, Fatih; Mengen, Eda; Gurbuz, Fatih; Yuksel, Bilgin; Topaloglu, A Kemal

    2015-03-01

    The spectrum of genetic alterations in cases of hypogonadotropic hypogonadism continue to expand. However, KISS1R mutations remain rare. The aim of this study was to understand the molecular basis of normosmic idiopathic hypogonadotropic hypogonadism. Clinical characteristics, hormonal studies and genetic analyses of seven cases with idiopathic normosmic hypogonadotropic hypogonadism (nIHH) from three unrelated consanguineous families are presented. One male presented with absence of pubertal onset and required surgery for severe penoscrotal hypospadias and cryptorchidism, while other two males had absence of pubertal onset. Two of four female cases required replacement therapy for pubertal onset and maintenance, whereas the other two had spontaneous pubertal onset but incomplete maturation. In sequence analysis, we identified a novel homozygous nonsense (p.Y323X) mutation (c.C969A) in the last exon of the KISS1R gene in all clinically affected cases. We identified a homozygous nonsense mutation in the KISS1R gene in three unrelated families with nIHH, which enabled us to observe the phenotypic consequences of this rare condition. Escape from nonsense-mediated decay, and thus production of abnormal proteins, may account for the variable severity of the phenotype. Although KISS1R mutations are extremely rare and can cause a heterogeneous phenotype, analysis of the KISS1R gene should be a part of genetic analysis of patients with nIHH, to allow better understanding of phenotype-genotype relationship of KISS1R mutations and the underlying genetic basis of patients with nIHH. © 2014 John Wiley & Sons Ltd.

  15. Senior Senator from Florida and Chairman, Senate Committee on Space, Aeronautics and Related Sciences W. Nelson, visiting the ATLAS cavern and LHC tunnel with ATLAS Collaboration Spokesperson P. Jenni and AMS Collaboration Spokesperson S.C.C.Ting, 16 March 2008.

    CERN Multimedia

    Maximilien Brice

    2008-01-01

    Senior Senator from Florida and Chairman, Senate Committee on Space, Aeronautics and Related Sciences W. Nelson, visiting the ATLAS cavern and LHC tunnel with ATLAS Collaboration Spokesperson P. Jenni and AMS Collaboration Spokesperson S.C.C.Ting, 16 March 2008.

  16. Actualizing of calibration curves of "1"4C/C, "9"0Sr/Ca, "2"2"8Th/"2"3"2Th in ivory for the determination of the post mortal interval of elephants and consequences of the radiation protection of non-human species

    International Nuclear Information System (INIS)

    Schupfner, R.

    2016-01-01

    The determination of the activity concentration of the radionuclides "1"4C/C and "9"0Sr/Ca and "2"2"8Th/"2"3"2Th applying combined radionuclide analyses methods has been proved to be a suitable tool for the purpose of an unambiguous age determination of elephant ivory [1, 2, 3, 10, 11, 12, 13]. Analysing representative and independently dated samples (N = 28) of ivory the curves fitting the post mortal interval (PMI) versus the activity concentration of the radionuclides mentioned above produced the data base enabling a more unambiguous age determination. Data from these studies origin [1, 2, 3, 10, 11, 12, 13] in analyses of ivory samples which were available up to the 2012. During the last five years there was a gap in information of the future trend of "1"4C/C and "9"0Sr/Ca. Up to this study it was not possible to assess whether the future level of "1"4C/C as well as "9"0Sr/Ca can analytically be distinguished from the level before 1954. At about 1954 the activity concentration of radionuclides from the atmospheric nuclear explosion, as "1"4C and "9"0Sr, increased in ivory significantly. This study aims in closing this information gap. The results of analyses of "1"4C/C, "9"0Sr/Ca, "2"2"8Th/"2"3"2Th in ivory with PMI values ranging from 1 to 5 years are presented and interpreted. These data enable an actualization of the calibration curves of PMI versus specific activities. This is necessary for a better understanding of the effect of blindness of "1"4C/C dating and its prevention. On the base of all available results form independent dated ivory sample available up to 2015 a suitable analytical procedure is suggested which aims in a more precise and reliable age determination of elephant tusks. Results of determining of radionuclides "1"4C/C and "9"0Sr/Ca and "2"2"8Th/"2"3"2Th in ivory are shown from before 1950 to 2015. These results are discussed with respect the purposes of dating as well as their significance to the radiation protection of nonhuman species.

  17. Alkane Activation at Ambient Temperatures: Unusual Selectivities, C-C, C-H Bond Scission versus C-C Bond Coupling

    NARCIS (Netherlands)

    Trionfetti, C.; Agiral, A.; Gardeniers, Johannes G.E.; Lefferts, Leonardus; Seshan, Kulathuiyer

    2008-01-01

    Activating bonds: A cold plasma generated by dielectric barrier discharge in a microreactor converts alkanes (C1–C3) at atmospheric pressure. Large amounts of products with higher molecular weight than the starting hydrocarbons are observed showing that C-H activation at lower T favourably leads to

  18. C-H and C-C activation of n -butane with zirconium hydrides supported on SBA15 containing N-donor ligands: [(≡SiNH-)(≡SiX-)ZrH2], [(≡SiNH-)(≡SiX-)2ZrH], and[(≡SiN=)(≡SiX-)ZrH] (X = -NH-, -O-). A DFT study

    KAUST Repository

    Pasha, Farhan Ahmad; Bendjeriou-Sedjerari, Anissa; Huang, Kuo-Wei; Basset, Jean-Marie

    2014-01-01

    : [(≡SiNH-)(≡SiO-)ZrH2] (A), [(≡SiNH-)2ZrH2] (B), [(≡SiNH-)(≡SiO-) 2ZrH] (C), [(≡SiNH-)2(≡SiO-)ZrH] (D), [(≡SiN=)(≡Si-O-)ZrH] (E), and [(≡SiN=)(≡SiNH-)ZrH] (F). The roles of these hydrides have been investigated in C-H/C-C bond activation and cleavage

  19. Classification of heart valve condition using acoustic measurements

    Energy Technology Data Exchange (ETDEWEB)

    Clark, G. [Lawrence Livermore National Lab., CA (United States)

    1994-11-15

    Prosthetic heart valves and the many great strides in valve design have been responsible for extending the life spans of many people with serious heart conditions. Even though the prosthetic valves are extremely reliable, they are eventually susceptible to long-term fatigue and structural failure effects expected from mechanical devices operating over long periods of time. The purpose of our work is to classify the condition of in vivo Bjork-Shiley Convexo-Concave (BSCC) heart valves by processing acoustic measurements of heart valve sounds. The structural failures of interest for Bscc valves is called single leg separation (SLS). SLS can occur if the outlet strut cracks and separates from the main structure of the valve. We measure acoustic opening and closing sounds (waveforms) using high sensitivity contact microphones on the patient`s thorax. For our analysis, we focus our processing and classification efforts on the opening sounds because they yield direct information about outlet strut condition with minimal distortion caused by energy radiated from the valve disc.

  20. C-H and C-C activation of n -butane with zirconium hydrides supported on SBA15 containing N-donor ligands: [(≡SiNH-)(≡SiX-)ZrH2], [(≡SiNH-)(≡SiX-)2ZrH], and[(≡SiN=)(≡SiX-)ZrH] (X = -NH-, -O-). A DFT study

    KAUST Repository

    Pasha, Farhan Ahmad

    2014-07-01

    Density functional theory (DFT) was used to elucidate the mechanism of n-butane hydrogenolysis (into propane, ethane, and methane) on well-defined zirconium hydrides supported on SBA15 coordinated to the surface via N-donor surface pincer ligands: [(≡SiNH-)(≡SiO-)ZrH2] (A), [(≡SiNH-)2ZrH2] (B), [(≡SiNH-)(≡SiO-) 2ZrH] (C), [(≡SiNH-)2(≡SiO-)ZrH] (D), [(≡SiN=)(≡Si-O-)ZrH] (E), and [(≡SiN=)(≡SiNH-)ZrH] (F). The roles of these hydrides have been investigated in C-H/C-C bond activation and cleavage. The dihydride A linked via a chelating [N,O] surface ligand was found to be more active than B, linked to the chelating [N,N] surface ligand. Moreover, the dihydride zirconium complexes are also more active than their corresponding monohydrides C-F. The C-C cleavage step occurs preferentially via β-alkyl transfer, which is the rate-limiting step in the alkane hydrogenolysis. The energetics of the comparative pathways over the potential energy surface diagram (PES) reveals the hydrogenolysis of n-butane into propane and ethane. © 2014 American Chemical Society.

  1. Paramagnetic centers in nanocrystalline TiC/C system

    International Nuclear Information System (INIS)

    Guskos, N.; Bodziony, T.; Maryniak, M.; Typek, J.; Biedunkiewicz, A.

    2008-01-01

    Electron paramagnetic resonance is applied to study the defect centers in nanocrystalline titanium carbide dispersed in carbon matrix (TiC x /C) synthesized by the non-hydrolytic sol-gel process. The presence of Ti 3+ paramagnetic centers is identified below 120 K along with a minor contribution from localized defect spins coupled with the conduction electron system in the carbon matrix. The temperature dependence of the resonance intensity of the latter signal indicates weak antiferromagnetic interactions. The presence of paramagnetic centers connected with trivalent titanium is suggested to be the result of chemical disorder, which can be further related to the observed anomalous behavior of conductivity, hardness, and corrosion resistance of nanocrystalline TiC x /C

  2. C+C Fusion Cross Sections Measurements for Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Almaraz-Calderon, S.; Carnelli, P. F. F.; Rehm, K. E.; Albers, M.; Alcorta, M.; Bertone, P. F.; Digiovine, B.; Esbensen, H.; Fernandez Niello, J. O.; Jiang, C. L.; Lai, J.; Nusair, O.; Palchan-Hazan, T.; Pardo, R. C.; Paul, M.; Giardina, G.; Eidelman, S.; Venanzoni, G.; Battaglieri, M.; Mandaglio, G.

    2015-01-01

    Total fusion cross section of carbon isotopes were obtained using the newly developed MUSIC detector. MUSIC is a highly efficient, active target-detector system designed to measure fusion excitation functions with radioactive beams. The present measurements are relevant for understanding x-ray superbursts. The results of the first MUSIC campaign as well as the astrophysical implications are presented in this work

  3. Sodium dichloroiodate promoted C-C bond cleavage: An efficient ...

    Indian Academy of Sciences (India)

    SAKET B BHAGAT

    2018-02-01

    Feb 1, 2018 ... temperature, strong proton acids, and/or microwave irra- diation for high yields. ... indicated by TLC, the mixture was cooled to room temper- ature. The volatiles ..... A comprehensive review in current developments of benzothiazole-based ... acidic ionic liquids: Facile synthesis of 1-substituted. 1H-1,2,3 ...

  4. Search for C+ C clustering in Mg ground state

    Indian Academy of Sciences (India)

    2017-01-04

    Jan 4, 2017 ... Finite-range knockout theory predictions were much larger for (12C,212C) reaction, indicating a very small 12C−12C clustering in 24Mg. (g.s.) . Our present results contradict most of the proposed heavy cluster (12C+12C) structure models for the ground state of 24Mg. Keywords. Direct nuclear reactions ...

  5. The synthesis of [14C] C I pigment violet 19

    International Nuclear Information System (INIS)

    Filer, C.N.; Kelly, T.P.

    1990-01-01

    For the custom synthesis of radiolabeled compounds in the authors laboratory, aside from spectroscopic examination, their identity and radiochemical purity is routinely corroborated by demonstration of cochromatography with an authentic cold standard. In the synthesis of [ 14 C] red pigment 1 for the Cosmetic Toiletry and Fragrance Association, its insolubility precluded this. The preparation as well as characterization of 1 is described

  6. DSIbin : Identifying dynamic data structures in C/C++ binaries

    NARCIS (Netherlands)

    Rupprecht, Thomas; Chen, Xi; White, David H.; Boockmann, Jan H.; Luttgen, Gerald; Bos, Herbert

    2017-01-01

    Reverse engineering binary code is notoriously difficult and, especially, understanding a binary's dynamic data structures. Existing data structure analyzers are limited wrt. program comprehension: they do not detect complex structures such as skip lists, or lists running through nodes of different

  7. C+C Fusion Cross Sections Measurements for Nuclear Astrophysics

    Science.gov (United States)

    Almaraz-Calderon, S.; Carnelli, P. F. F.; Rehm, K. E.; Albers, M.; Alcorta, M.; Bertone, P. F.; Digiovine, B.; Esbensen, H.; Fernandez Niello, J. O.; Henderson, D.; Jiang, C. L.; Lai, J.; Marley, S. T.; Nusair, O.; Palchan-Hazan, T.; Pardo, R. C.; Paul, M.; Ugalde, C.

    2015-06-01

    Total fusion cross section of carbon isotopes were obtained using the newly developed MUSIC detector. MUSIC is a highly efficient, active target-detector system designed to measure fusion excitation functions with radioactive beams. The present measurements are relevant for understanding x-ray superbursts. The results of the first MUSIC campaign as well as the astrophysical implications are presented in this work.

  8. The C-C-C bending modes of PAHs : a new emission plateau from 15 to 20 mu m

    NARCIS (Netherlands)

    Van Kerckhoven, C; Hony, S; Peeters, E; Tielens, A. G. G. M.; Allamandola, LJ; Hudgins, DM; Cox, P; Roelfsema, PR; Voors, RHM; Waelkens, C; Waters, LBFM; Wesselius, PR

    We have obtained 2.5-45 mu m spectra of a sample of compact H II regions, YSOs and evolved stars in order to study the origin and evolution of interstellar Polycyclic Aromatic Hydrocarbon molecules (PAHs). Besides the well-known, strong PAH bands at 3.3, 6.2, 7.7, 8.6, and 11.2 mu m, these spectra

  9. ON THE FORMATION AND ISOMER SPECIFIC DETECTION OF PROPENAL (C{sub 2}H{sub 3}CHO) AND CYCLOPROPANONE (c-C{sub 3}H{sub 4}O) IN INTERSTELLAR MODEL ICES—A COMBINED FTIR AND REFLECTRON TIME-OF-FLIGHT MASS SPECTROSCOPIC STUDY

    Energy Technology Data Exchange (ETDEWEB)

    Abplanalp, Matthew J.; Borsuk, Aleca; Jones, Brant M.; Kaiser, Ralf I., E-mail: ralfk@hawaii.edu [W. M. Keck Research Laboratory in Astrochemistry, University of Hawaii at Manoa, Honolulu, Hawaii, HI, 96822 (United States)

    2015-11-20

    The formation routes of two structural isomers—propenal (C{sub 2}H{sub 3}CHO) and cyclopropanone (c-C{sub 3}H{sub 4}O)—were investigated experimentally by exposing ices of astrophysical interest to energetic electrons at 5.5 K thus mimicking the interaction of ionizing radiation with interstellar ices in cold molecular clouds. The radiation-induced processing of these ices was monitored online and in situ via Fourier Transform Infrared spectroscopy and via temperature programmed desorption exploiting highly sensitive reflectron time-of-flight mass spectrometry coupled with single photon ionization in the post irradiation phase. To selectively probe which isomer(s) is/are formed, the photoionization experiments were conducted with 10.49 and 9.60 eV photons. Our studies provided compelling evidence on the formation of both isomers—propenal (C{sub 2}H{sub 3}CHO) and cyclopropanone (c-C{sub 3}H{sub 4}O)—in ethylene (C{sub 2}H{sub 4})—carbon monoxide (CO) ices forming propenal and cyclopropanone at a ratio of (4.5 ± 0.9):1. Based on the extracted reaction pathways, the cyclopropanone molecule can be classified as a tracer of a low temperature non-equilibrium chemistry within interstellar ices involving most likely excited triplet states, whereas propenal can be formed at ultralow temperatures, but also during the annealing phase via non-equilibrium as well as thermal chemistry (radical recombination). Since propenal has been detected in the interstellar medium and our laboratory experiments demonstrate that both isomers originated from identical precursor molecules our study predicts that the hitherto elusive second isomer—cyclopropanone—should also be observable toward those astronomical sources such as Sgr B2(N) in which propenal has been detected.

  10. 1,2-Dichlorohexafluoro-Cyclobutane (1,2-c-C4F6Cl2, R-316c) a Potent Ozone Depleting Substance and Greenhouse Gas: Atmospheric Loss Processes, Lifetimes, and Ozone Depletion and Global Warming Potentials for the (E) and (Z) stereoisomers

    Science.gov (United States)

    Papadimitriou, Vassileios C.; McGillen, Max R.; Smith, Shona C.; Jubb, Aaron M.; Portmann, Robert W.; Hall, Bradley D.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.

    2013-01-01

    The atmospheric processing of (E)- and (Z)-1,2-dichlorohexafluorocyclobutane (1,2-c-C4F6Cl2, R-316c) was examined in this work as the ozone depleting (ODP) and global warming (GWP) potentials of this proposed replacement compound are presently unknown. The predominant atmospheric loss processes and infrared absorption spectra of the R-316c isomers were measured to provide a basis to evaluate their atmospheric lifetimes and, thus, ODPs and GWPs. UV absorption spectra were measured between 184.95 to 230 nm at temperatures between 214 and 296 K and a parametrization for use in atmospheric modeling is presented. The Cl atom quantum yield in the 193 nm photolysis of R- 316c was measured to be 1.90 +/- 0.27. Hexafluorocyclobutene (c-C4F6) was determined to be a photolysis co-product with molar yields of 0.7 and 1.0 (+/-10%) for (E)- and (Z)-R-316c, respectively. The 296 K total rate coefficient for the O(1D) + R-316c reaction, i.e., O(1D) loss, was measured to be (1.56 +/- 0.11) × 10(exp -10)cu cm/ molecule/s and the reactive rate coefficient, i.e., R-316c loss, was measured to be (1.36 +/- 0.20) × 10(exp -10)cu cm/molecule/s corresponding to a approx. 88% reactive yield. Rate coefficient upper-limits for the OH and O3 reaction with R-316c were determined to be model to be 74.6 +/- 3 and 114.1 +/-10 years, respectively, where the estimated uncertainties are due solely to the uncertainty in the UV absorption spectra. Stratospheric photolysis is the predominant atmospheric loss process for both isomers with the O(1D) reaction making a minor, approx. 2% for the (E) isomer and 7% for the (Z) isomer, contribution to the total atmospheric loss. Ozone depletion potentials for (E)- and (Z)-R-316c were calculated using the 2-D model to be 0.46 and 0.54, respectively. Infrared absorption spectra for (E)- and (Z)-R-316c were measured at 296 K and used to estimate their radiative efficiencies (REs) and GWPs; 100-year time-horizon GWPs of 4160 and 5400 were obtained for (E)- and (Z

  11. Studies on the selectivity of the reaction of (CO){sub 5}W=C(aryl)H with enynes: transfer of the carbene ligand to the C=C Bond versus insertion of the C triple bond C into the W=C Bond

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, H.; Volkland, H.P.; Stumpf, R.

    1996-10-01

    The strongly electrophilic monophenylcarbene complex [(CO){sub 5}W=C(Ph)H] (2a) reacts with the enynes H-C triple bond C-R(R=-C(Me)=CH{sub 2})(3), -C{sub 6}H{sub 4}-CH=CH{sub 2}-p (5) and subsequently with PMe{sub 3} to form the C{sub a}lpha-PMe{sub 3} adducts of the vinylidene complexes [(CO){sub 5}W-{l_brace}C(PMe{sub 3})=CH-C{sub 3}H{sub 3}(Me)Ph{r_brace}] (4) and [(CO){sub 5}W {l_brace}C(PMe{sub 3})=CH-C{sub 6}H{sub 4}-C{sub 3}H{sub 4}Ph{r_brace}] (6). The reaction very likely proceeds by transfer of the carbene ligand to the C=C bond of the enyne to form a cyclopropyl-substituted alkyne complex which is in equilibrium with its vinylidene isomer.

  12. Prosthetic Valve Endocarditis - Successful Management With Antimicrobial Treatment

    Directory of Open Access Journals (Sweden)

    Ashokan Nambiar C

    2015-07-01

    Full Text Available Middle aged male was admitted with high fever, rigor and chills of 2 days duration. He was seen in the clinic two years back for syncope. He gave history of Mitral (Starr-Edward and Aortic (Medtronic valve replacement ten years earlier from another center and was on regular anticoagulation with dose-adjusted acenocoumarol. On evaluation he had normal prosthetic valve function by trans-thoracic echo, but Holter monitoring showed Paroxysmal Atrial Fibrillation. He had mild wall motion abnormalities and left ventricular dysfunction suggestive of coronary artery disease also and was put on additional Metoprolol.

  13. Computational Study of Pincer Iridium Catalytic Systems: C-H, N-H, and C-C Bond Activation and C-C Coupling Reactions

    Science.gov (United States)

    Zhou, Tian

    Computational chemistry has achieved vast progress in the last decades in the field, which was considered to be only experimental before. DFT (density functional theory) calculations have been proven to be able to be applied to large systems, while maintaining high accuracy. One of the most important achievements of DFT calculations is in exploring the mechanism of bond activation reactions catalyzed by organometallic complexes. In this dissertation, we discuss DFT studies of several catalytic systems explored in the lab of Professor Alan S. Goldman. Headlines in the work are: (1) (R4PCP)Ir alkane dehydrogenation catalysts are highly selective and different from ( R4POCOP)Ir catalysts, predicting different rate-/selectivity-determining steps; (2) The study of the mechanism for double C-H addition/cyclometalation of phenanthrene or biphenyl by (tBu4PCP)Ir(I) and ( iPr4PCP)Ir illustrates that neutral Ir(III) C-H addition products can undergo a very facile second C-H addition, particularly in the case of sterically less-crowded Ir(I) complexes; (3) (iPr4PCP)Ir pure solid phase catalyst is highly effective in producing high yields of alpha-olefin products, since the activation enthalpy for dehydrogenation is higher than that for isomerization via an allyl pathway; higher temperatures favor the dehydrogenation/isomerization ratio; (4) (PCP)Ir(H)2(N2H4) complex follows a hydrogen transfer mechanism to undergo both dehydrogenation to form N 2 and H2, as well as hydrogen transfer followed by N-N bond cleavage to form NH3, N2, and H2; (5) The key for the catalytic effect of solvent molecule in CO insertion reaction for RMn(CO)5 is hydrogen bond assisted interaction. The basicity of the solvent determines the strength of the hydrogen bond interaction during the catalytic path and determines the catalytic power of the solvent; and (6) Dehydrogenative coupling of unactivated C-H bonds (intermolecular vinyl-vinyl, intramolecular vinyl-benzyl) is catalyzed by precursors of the (iPr4 PCP)Ir fragment. The key step for this mechanism is a Ir(III) vinyl hydride complex undergoing addition of a styrenyl ortho C-H bond to give an Ir(III) metalloindene plus H2.

  14. Fiscal 1997 survey report / R and D of important region technology. R and D of technologies giving multi-functional characteristics to C/C composites (development of high-grade surface processing technology for engine members for methane fueled air craft. 1. control technology of micro structures of ultra-high temperature members); 1997 nendo seika hokokusho juyo chiiki gijutsu kenkyu kaihatsu. Fukugo kino buzai kozo seigyo gijutsu no kenkyu kaihatsu (methane nenryo kokukiyo engine buzai no kodo hyomen kako gijutsu kaihatsu). 1. chokoon buzai micro kozo seigyo gijutsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    For the purpose of developing members most suitable for aircraft use engines with methane as fuel, the R and D were conducted of technology to reform surfaces and interfaces of materials. In the R and D, the paper took up carbon fiber reinforced carbon composite materials (C/C composites). In the surface control and reformation technology using the ion engineering method, etc., in the sealing processing of C/C composites, tried was the formation of a C/SiC/Si3N4 composite layer which was formed by Si3N4 much smaller in thermal expansion coefficient than SiC. Further, technologies on ion injection, thin film formation, giving of oxidation resistance/corrosion resistance, improving/giving of thermal shock resistance, etc. In the multi-functional coating formation technology such as high liability and corrosion resistance, the study was carried out of the dense composite functionally-gradient layer as thermal stress relaxation layer and the fiber reinforced layer by carbon fiber using pores. Besides, studies were made of technologies of the micro structure control combination, evaluation of ultra-high temperature resistant environmental characteristics, etc. 61 refs., 198 figs., 44 tabs.

  15. Double Valve Replacement (Mitral and Aortic for Rheumatic Heart Disease: A 20-year experience with 300 patients.

    Directory of Open Access Journals (Sweden)

    Prashant Mishra

    2016-09-01

    Full Text Available Introduction: Rheumatic heart disease still remains one of the leading causes of congestive heart failure and death owing to valvular pathologies, in developing countries. Valve replacement still remains the treatment of choice in such patients.The aim of this study wasto analyze the postoperative outcome of  double valve replacement (Mitral and Aortic in patients of rheumatic heart disease. Materials and Methods: Between 1988 and 2008, 300 patients of rheumatic heart disease underwent double (Mitral and Aortic valve replacement with Starr Edwards valve or St Jude mechanical valve prosthesis were implanted. These patients were studied retrospectively for preoperative data and postoperative outcome including causes of early and late deaths and the data was analyzed statistically. Results: The 30-day hospital death rate was 11.3% andlate death occurred in 11.6%. Anticoagulant regimen was followed to maintain the target pro-thrombin time at 1.5 times the control value. The actuarial survival (exclusive of hospital mortality was 92.4%, 84.6%, and 84.4%, per year at 5, 10, and 20 years, respectively Conclusions: In view of the acknowledged advantageof superior durability, increased thromboresistance in our patient population, and its cost effectiveness the Starr-Edwards ball valve or St. Jude valve is the mechanical prosthesis of choice for advanced combined valvular disease. The low-intensity anticoagulant regimen has offered suffcient protection against thromboembolism as well as hemorrhage.

  16. Functional materials - Study of process for CVD SiC/C composite material

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Doo Jin; Wang, Chae Chyun; Lee, Young Jin; Oh, Byung Jun [Yonsei University, Seoul (Korea)

    2000-04-01

    The CVD SiC coating techniques are the one of high functional material manufactures that improve the thermal, wear, oxidization and infiltration resistance of the surface of raw materials and extend the life of material. Silicon carbide films have been grown onto graphite substrates by low pressure chemical vapor deposition using MTS(CH{sub 3}SiCl{sub 3}) as a source precursor and H{sub 2} or N{sub 2} as a diluent gas. The experiments for temperature and diluent gas addition changes were performed. The effect of temperature from 900 deg. C to 1350 deg. C and the alteration of diluent gas species on the growth rate and structure of deposits have been studied. The experimental results showed that the deposition rate increased with increasing deposition temperature irrespective of diluent gases and reactant depletion effect increased especially at H{sub 2} diluent gas ambient. As the diluent gas added, the growth rate decreased parabolically. For N{sub 2} addition, surface morphology of leaf-like structure appeared, and for H{sub 2}, faceted structure at 1350 deg. C. The observed features were involved by crystalline phase of {beta}-SiC and surface composition with different gas ambient. We also compared the experimental results of the effect of partial pressure on the growth rate with the results of theoretical approach based on the Langmuir-Hinshelwood model. C/SiC composites were prepared by isothermal chemical vapor infiltration (ICVI). In order to fabricate the more dense C/SiC composites, a novel process of the in-situ whisker growing and filling during ICVI was devised, which was manipulated by alternating dilute gas species. The denser C/SiC composites were successfully prepared by the novel process comparing with the conventional ICVI process. 64 refs., 36 figs., 5 tabs. (Author)

  17. Selective C--C coupling of ir-ethene and ir-carbenoid radicals

    NARCIS (Netherlands)

    Dzik, W.I.; Reek, J.N.H.; de Bruin, B.

    2008-01-01

    The reactivity of the paramagnetic iridium(II) complex [IrII(ethene)(Me3tpa)]2+ (1) (Me3tpa=N,N,N-tris(6-methyl-2-pyridylmethyl) amine) towards the diazo compounds ethyl diazoacetate (EDA) and trimethylsilyldiazomethane (TMSDM) was investigated. The reaction with EDA gave rise to selective CC bond

  18. Diffusion of titanium and niobium in b.c.c. Ti--Nb alloys

    International Nuclear Information System (INIS)

    Pontau, A.E.

    1978-01-01

    The diffusion coefficients for titanium and niobium radioactive tracers were simultaneously measured in Ti, Ti 94 6 Nb 5 4 , Ti 80 4 Nb 19 6 , and Ti 64 3 Nb 35 . 7 over the temperature range from 950 0 C to 1511 0 C using standard lathe sectioning techniques. The samples were initially heat treated by annealing above the α-β phase transition temperature and then either cooling slowly to room temperature or quenching. The room temperature crystal morphology was then examined using x-ray diffraction. Alloy concentrations were chosen both to suppress the β-α transition and to obtain the metastable ω-phase

  19. Characterization of mechanically alloyed f.c.c. Ti–Mg–based powders

    CSIR Research Space (South Africa)

    Machio, Christopher N

    2010-05-01

    Full Text Available the reproducibility of the particle size 121distributions. 122The thermal behavior of the powders was determined in the range 123room temperature to 660 ?C in an argon atmosphere using a 124simultaneous thermal analyzer (Netzsch STA 449 F3 Jupiter). The 125...

  20. Redox noninnocence of carbene ligands: carbene radicals in (catalytic) C-C bond formation

    NARCIS (Netherlands)

    Dzik, W.I.; Zhang, X.P.; de Bruin, B.

    2011-01-01

    In this Forum contribution, we highlight the radical-type reactivities of one-electron-reduced Fischer-type carbenes. Carbene complexes of group 6 transition metals (Cr, Mo, and W) can be relatively easily reduced by an external reducing agent, leading to one-electron reduction of the carbene ligand

  1. Long-lived transient anion of c-C4F8O

    Czech Academy of Sciences Publication Activity Database

    Kočišek, Jaroslav; Janečková, R.; Fedor, Juraj

    2018-01-01

    Roč. 148, č. 7 (2018), č. článku 074303. ISSN 0021-9606 R&D Projects: GA ČR GA17-04844S Institutional support: RVO:61388955 Keywords : negative-ion * electron-attachment * chemistry * c4f8o * lifetimes * gases Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.965, year: 2016

  2. 77 FR 10004 - C$ cMoney, Inc.; Order of Suspension of Trading

    Science.gov (United States)

    2012-02-21

    ... Trading February 16, 2012. It appears to the Securities and Exchange Commission that there is a lack of... protection of investors require a suspension of trading in the securities of the above-listed company. Therefore, it is ordered, pursuant to Section 12(k) of the Securities Exchange Act of 1934, that trading in...

  3. I ~:~c~;~,:~::::;·~:;r::~tr~·!:~··.:::~a~;::~:::~:e~_on_\\_t:_:_;_e__c_ _ __c ...

    African Journals Online (AJOL)

    in past month use of cigarettes for males and marijuana for both genders. Rates of ... among youth in grades 8 · 11 in public high schools.4 The present report compares risk behaviour of grade 8 students in. Cape Town .... This approach enabled us to provide .... the reason for the change, it is encouraging that age of sexual.

  4. Amorphous SiC/c-ZnO-Based Quasi-Lamb Mode Sensor for Liquid Environments

    Directory of Open Access Journals (Sweden)

    Cinzia Caliendo

    2017-05-01

    Full Text Available The propagation of the quasi-Lamb modes along a-SiC/ZnO thin composite plates was modeled and analysed with the aim to design a sensor able to detect the changes in parameters of a liquid environment, such as added mass and viscosity changes. The modes propagation was modeled by numerically solving the system of coupled electro-mechanical field equations in three media. The mode shape, the power flow, the phase velocity, and the electroacoustic coupling efficiency (K2 of the modes were calculated, specifically addressing the design of enhanced-coupling, microwave frequency sensors for applications in probing the solid/liquid interface. Three modes were identified that have predominant longitudinal polarization, high phase velocity, and quite good K2: the fundamental quasi symmetric mode (qS0 and two higher order quasi-longitudinal modes (qL1 and qL2 with a dominantly longitudinal displacement component in one plate side. The velocity and attenuation of these modes were calculated for different liquid viscosities and added mass, and the gravimetric and viscosity sensitivities of both the phase velocity and attenuation were theoretically calculated. The present study highlights the feasibility of the a-SiC/ZnO acoustic waveguides for the development of high-frequency, integrated-circuit compatible electroacoustic devices suitable for working in a liquid environment.

  5. Unanticipated C=C bonds in covalent monolayers on silicon revealed by NEXAFS.

    Science.gov (United States)

    Lee, Michael V; Lee, Jonathan R I; Brehmer, Daniel E; Linford, Matthew R; Willey, Trevor M

    2010-02-02

    Interfaces are crucial to material properties. In the case of covalent organic monolayers on silicon, molecular structure at the interface controls the self-assembly of the monolayers, which in turn influences the optical properties and electrical transport. These properties intrinsically affect their application in biology, tribology, optics, and electronics. We use near-edge X-ray absorption fine structure spectroscopy to show that the most basic covalent monolayers formed from 1-alkenes on silicon retain a double bond in one-fifth to two-fifths of the resultant molecules. Unsaturation in the predominantly saturated monolayers will perturb the regular order and affect the dependent properties. The presence of unsaturation in monolayers produced by two different methods also prompts the re-evaluation of other radical-based mechanisms for forming covalent monolayers on silicon.

  6. Designing new catalytic C-C and C-N bond formations promoted by organoactinides

    International Nuclear Information System (INIS)

    Eisen, M.S.; Straub, T.; Haskel, A.

    1998-01-01

    Organoactinides of the type Cp 2 * AcMe 2 (Cp * =C 5 Me 5 ; Ac=Th; U) are active catalytic precursors for the oligomerization of terminal alkynes HC≡CR (R=alkyl, aryl, SiMe 3 ). The regioselectivity and the extent of oligomerization depend strongly on the alkyne substituent R, whereas the catalytic reactivity is similar for both organoactinides. Reaction with tert-butylacetylene yields regioselectively the E-2,4-disubstituted 1-buten-3-yne dimer whereas trimethylsilylacetylene is regioselective trimerized to the E,E-1,4,6-tris(trimethylsilyl)-1,3-hexa diene-5-yne, with small amounts (3-5%) of the corresponding E-2,4-disubstituted 1-buten-3-yne dimer. Oligomerization with less bulky alkyl and aryl substituted alkynes produces a mixture of higher oligomers with no regioselectivity. Using the Cp 2 * ThMe 2 catalyst, we have recently developed a strategic method to control the extent and in some cases the regioselectivity of the catalyzed oligomerization of nonbulky terminal alkynes to dimers and/or trimers. The metallocene catalytic precursors ensure the selective synthesis of small oligomers by the addition of specific amines. Catalytic ''tailoring'' to dimer and trimers can be achieved by using small or bulky amines, respectively. Kinetic and mechanistic data for the controlling experiments argue that the turnover-limiting step involves the acetylide actinide complex formation with the rapid insertion of the alkyne and protonolysis by the amine. The analog Cp 2 * UMe 2 in the presence of primary amines induce the selective C-N bond formation, producing enamines which are tautomerized to the corresponding imines. (orig.)

  7. Cloning and functional characterization of the rabbit C-C chemokine receptor 2

    Directory of Open Access Journals (Sweden)

    Hamdouchi Chafiq

    2005-07-01

    Full Text Available Abstract Background CC-family chemokine receptor 2 (CCR2 is implicated in the trafficking of blood-borne monocytes to sites of inflammation and is implicated in the pathogenesis of several inflammatory diseases such as rheumatoid arthritis, multiple sclerosis and atherosclerosis. The major challenge in the development of small molecule chemokine receptor antagonists is the lack of cross-species activity to the receptor in the preclinical species. Rabbit models have been widely used to study the role of various inflammatory molecules in the development of inflammatory processes. Therefore, in this study, we report the cloning and characterization of rabbit CCR2. Data regarding the activity of the CCR2 antagonist will provide valuable tools to perform toxicology and efficacy studies in the rabbit model. Results Sequence alignment indicated that rabbit CCR2 shares 80 % identity to human CCR2b. Tissue distribution indicated that rabbit CCR2 is abundantly expressed in spleen and lung. Recombinant rabbit CCR2 expressed as stable transfectants in U-937 cells binds radiolabeled 125I-mouse JE (murine MCP-1 with a calculated Kd of 0.1 nM. In competition binding assays, binding of radiolabeled mouse JE to rabbit CCR2 is differentially competed by human MCP-1, -2, -3 and -4, but not by RANTES, MIP-1α or MIP-1β. U-937/rabbit CCR2 stable transfectants undergo chemotaxis in response to both human MCP-1 and mouse JE with potencies comparable to those reported for human CCR2b. Finally, TAK-779, a dual CCR2/CCR5 antagonist effectively inhibits the binding of 125I-mouse JE (IC50 = 2.3 nM to rabbit CCR2 and effectively blocks CCR2-mediated chemotaxis. Conclusion In this study, we report the cloning of rabbit CCR2 and demonstrate that this receptor is a functional chemotactic receptor for MCP-1.

  8. Oxaloacetate hydrolase, the C-C bond lyase of oxalate secreting fungi

    NARCIS (Netherlands)

    Han, Y.; Joosten, H.J.; Niu, W.; Zhao, Z.; Mariano, P.S.; McCalman, M.; Kan, van J.; Schaap, P.J.; Dunaway-Mariano, D.

    2007-01-01

    Oxalate secretion by fungi is known to be associated with fungal pathogenesis. In addition, oxalate toxicity is a concern for the commercial application of fungi in the food and drug industries. Although oxalate is generated through several different biochemical pathways, oxaloacetate

  9. Theoretical study of C-C bond formation in the methanol to gasoline process

    NARCIS (Netherlands)

    Blaszkowski, S.R.; Santen, van R.A.

    1997-01-01

    Density functional theory is used to study one of the most successful routes to the production of synthetic fuels, the conversion of methanol to gasoline (MTG process) with an acidic zeolite. With our calculations we have determined transition states and adsorption complexes of reactants,

  10. The lattice dynamics of six prominent B.C.C. transition metals

    International Nuclear Information System (INIS)

    Brescansin, L.M.; Padial, N.T.; Shukla, M.M.

    1975-01-01

    The frequency versus wave vector dispersion relations along the three principal symmetry directions, [xi00], [xixi0] and [xixixi], of six prominent body centered cubic transition metals, namely that of molybdenum, α-iron, tungsten, tantalum, niobium and that of chromium, have been computed on the basis of a phenomenological model. The calculated results are in very good agreements to the experimental findings

  11. Molecular dynamics study on interfacial thermal conductance of unirradiated and irradiated SiC/C

    International Nuclear Information System (INIS)

    Wang, Qingyu; Wang, Chenglong; Zhang, Yue; Li, Taosheng

    2014-01-01

    SiC f /SiC composite materials have been considered as candidate structural materials for several types of advanced nuclear reactors. Both experimental and computer simulations studies have revealed the degradation of thermal conductivity for this material after irradiation. The objective of this study is to investigate the effect of SiC/graphite interface structure and irradiation on the interfacial thermal conductance by using molecular dynamics simulation. Five SiC/graphite composite models were created with different interface structures, and irradiation was introduced near the interfaces. Thermal conductance was calculated by means of reverse-NEMD method. Results show that there is a positive correlation between the interfacial energy and interfacial C–Si bond quantity, and irradiated models showed higher interfacial energy compared with their unirradiated counterparts. Except the model with graphite atom plane parallel to the interface, the interfacial thermal conductance of unirradiated and irradiated (1000 eV) models, increases as the increase of interfacial energy, respectively. For all irradiated models, lattice defects are of importance in impacting the interfacial thermal conductance depending on the interface structure. For the model with graphite layer parallel to the interface, the interfacial thermal conductance increased after irradiation, for the other models the interfacial thermal conductance decreased. The vibrational density of states of atoms in the interfacial region was calculated to analyze the phonon mismatch at the interface

  12. Lightweight Ultrahigh Temperature CMC-Lined C/C Combustion Chambers, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — NASA and DoD are seeking high-performance, lightweight liquid rocket combustion chambers with future performance goals that cannot be achieved using state-of-the-art...

  13. Ultralightweight Refractory-Lined C/C Ascent Engine Combustion Chambers, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Mars sample return ascent vehicles require a velocity change exceeding 4 km/s within minutes of launch and higher propellant mass fractions than are offered by...

  14. Ordinary and partial differential equation routines in C, C++, Fortran, Java, Maple, and Matlab

    CERN Document Server

    Lee, HJ

    2003-01-01

    This book provides a set of ODE/PDE integration routines in the six most widely used computer languages, enabling scientists and engineers to apply ODE/PDE analysis toward solving complex problems. This text concisely reviews integration algorithms and then analyzes the widely used Runge-Kutta method. It first presents a complete code before discussing its components in detail, focusing on integration concepts such as error monitoring and control. The format allows readers to understand the basics of ODE/PDE integration, and then calculate sample numerical solutions within the targeted program

  15. Highly enantioselective rhodium(I)-catalyzed carbonyl carboacylations initiated by C-C bond activation.

    Science.gov (United States)

    Souillart, Laetitia; Cramer, Nicolai

    2014-09-01

    The lactone motif is ubiquitous in natural products and pharmaceuticals. The Tishchenko disproportionation of two aldehydes, a carbonyl hydroacylation, is an efficient and atom-economic access to lactones. However, these reaction types are limited to the transfer of a hydride to the accepting carbonyl group. The transfer of alkyl groups enabling the formation of CC bonds during the ester formation would be of significant interest. Reported herein is such asymmetric carbonyl carboacylation of aldehydes and ketones, thus affording complex bicyclic lactones in excellent enantioselectivities. The rhodium(I)-catalyzed transformation is induced by an enantiotopic CC bond activation of a cyclobutanone and the formed rhodacyclic intermediate reacts with aldehyde or ketone groups to give highly functionalized lactones. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Acceptance of the 2015 C.C. Patterson Award by Karen H. Johannesson

    Science.gov (United States)

    Johannesson, Karen H.

    2016-01-01

    First and foremost I want to thank Berry Lyons, who obviously couldn't be here today, for nominating me for this prestigious award, and for his very complimentary citation. Thank you so much, Berry! Berry is one of the most generous people I have ever met, and it was definitely one of the best decisions I ever made to follow him to the University of Nevada to work with him on my Ph.D. I also wish to thank my friend and colleague Robyn Hannigan for being here today to read the citation in Berry's stead.

  17. Electron attachment properties of c-C4F8O\

    Czech Academy of Sciences Publication Activity Database

    Chachereau, A.; Fedor, Juraj; Janečková, R.; Kočišek, Jaroslav; Rabie, M.; Franck, C. M.

    2016-01-01

    Roč. 49, č. 37 (2016), 375201 ISSN 0022-3727 Institutional support: RVO:61388955 Keywords : C4F8O * octafluorotetrahydrofuran * attachment cross section Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.588, year: 2016

  18. Impact of genetic variations in C-C chemokine receptors and ligands on infectious diseases.

    Science.gov (United States)

    Qidwai, Tabish; Khan, M Y

    2016-10-01

    Chemokine receptors and ligands are crucial for extensive immune response against infectious diseases such as malaria, leishmaniasis, HIV and tuberculosis and a wide variety of other diseases. Role of chemokines are evidenced in the activation and regulation of immune cell migration which is important for immune response against diseases. Outcome of disease is determined by complex interaction among pathogen, host genetic variability and surrounding milieu. Variation in expression or function of chemokines caused by genetic polymorphisms could be associated with attenuated immune responses. Exploration of chemokine genetic polymorphisms in therapeutic response, gene regulation and disease outcome is important. Infectious agents in human host alter the expression of chemokines via epigenetic alterations and thus contribute to disease pathogenesis. Although some fragmentary data are available on chemokine genetic variations and their contribution in diseases, no unequivocal conclusion has been arrived as yet. We therefore, aim to investigate the association of CCR5-CCL5 and CCR2-CCL2 genetic polymorphisms with different infectious diseases, transcriptional regulation of gene, disease severity and response to therapy. Furthermore, the role of epigenetics in genes related to chemokines and infectious disease are also discussed. Copyright © 2016 American Society for Histocompatibility and Immunogenetics. Published by Elsevier Inc. All rights reserved.

  19. Reactivity differences of Pt0 phosphine complexes in C-C bond activation of asymmetric acetylenes

    NARCIS (Netherlands)

    Gunay, A.; Müller, C.; Lachicotte, R.J.; Brennessel, W.W.; Jones, W.D.

    2009-01-01

    Carbon-carbon bond activation reactions of asymmetric acetylene derivatives of the type L2Pt(PhC=CR) were studied with 1,2-bis(diisopropylphosphino)ethane (dippe), 1,2-bis(di-tert-butylphosphino)ethane (dtbpe), and 1-diisopropylphosphino-2-dimethylaminoethane (dippdmae) chelates.

  20. 76 FR 44800 - Election of Reduced Research Credit Under Section 280C(c)(3)

    Science.gov (United States)

    2011-07-27

    ... determine the amount of research credit (if any) allowable to a trade or business that at the end of its... simplified research credit method, in computing the group credit for the credit year. Explanation and Summary... small businesses engaged in research activities under section 41. The IRS has determined that the final...

  1. C. C. Li (1912–2003): his science and his spirit

    Indian Academy of Sciences (India)

    Unknown

    His style of work was amusing to many of us. ..... shall make our human society human and not return to the ways of the wild ... models for preliminary genetic analysis. Ann. Hum. ... ture – an analysis based on the American Negro. Am. J. Hum.

  2. Yttrium silicate as an oxidation protection layer for C/C-SiC materials. Synthesis, electrophoretic deposition and high temperature oxidation; Yttriumsilikat als Oxidationsschutzschicht fuer C/C-SiC-Werkstoffe. Synthese, elektrophoretische Abscheidung und Hochtemperaturoxidation

    Energy Technology Data Exchange (ETDEWEB)

    Grosse-Brauckmann, Jana

    2012-07-01

    Carbon fibre reinforced carbon composites are promising materials for high temperature applications. They exhibit excellent thermal shock resistance and nearly constant mechanical strength. A serious draw-back of this material is their poor resistivity towards oxidation at temperatures above 400 C. To make use of the very good thermal stability the material needs an outer oxidation protection coating. Silicon carbide has been successfully employed at temperatures up to 1300 C. To increase the application range towards higher temperatures an outer environmental barrier coating is needed. In the present work yttrium silicates were used to complement the silicon carbide coated carbon fibre reinforced carbon material. Both stable compounds in the quasi-binary system Y{sub 2}O{sub 3}-SiO{sub 2}, yttrium orthosilicate (Y{sub 2}SiO{sub 5}) and yttrium pyrosilicate (Y{sub 2}Si{sub 2}O{sub 7}), were separately applied to the test samples via electrophoretic deposition. Suitable suspensions were prepared in butanone with iodine as charging agent to adjust conductivity and particle charge. Galvanostatic deposition obeys a linear growth law for the selected deposition times. Alternatively the feasibility of direct electrophoretic deposition from an yttrium silicate precursor sol was tested. Emphasis was put on the development of a suitable sol-system based on alkoxide precursors. Samples coated either with Y{sub 2}SiO{sub 5} or Y{sub 2}Si{sub 2}O{sub 7} were investigated using thermogravimetric high temperature oxidation in the temperature range from 1450 C to 1650 C, respectively. The coated samples exhibited very good oxidation resistance up to temperatures of 1600 C, while the performance was reduced at 1650 C to a few hours. All samples showed a parabolic mass increase with time indicating a diffusion limited process governing the oxidation kinetics. The cross sections of the samples show a sharp border between the SiO{sub 2} that crystallizes to cristobalite and the yttrium silicate layer comprising of yttrium pyrosilicate. A glassy bonding layer is observed between the crystallized SiO{sub 2} and the yttrium silicate top coat where some impurities from the furnace atmosphere (Al, Mg) were found. The presence of pores in the intermediate SiO{sub 2} layer indicates an enrichment of oxidation products that leads to the buildup of pores.

  3. Synthesis, reactivity and complexation studies of N,S exo-heterodisubstituted o-carborane ligands. Carborane as a platform to produce the uncommon bidentate chelating (pyridine)N-C-C-C-S(H) motif

    Czech Academy of Sciences Publication Activity Database

    Teixidor, F.; Laromaine, A.; Kivekäs, R.; Sillanpää, R.; Viňas, C.; Vespalec, Radim; Horáková, Hana

    -, č. 3 (2008), s. 345-354 ISSN 1477-9226 R&D Projects: GA AV ČR IAA400310613; GA AV ČR KJB400310705 Institutional research plan: CEZ:AV0Z40310501 Keywords : boron cluster compound * transition metal * chirality Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.580, year: 2008

  4. Recombination of HIV type 1C (C'/C") in Ethiopia: possible link of EthHIV-1C' to subtype C sequences from the high-prevalence epidemics in India and Southern Africa

    NARCIS (Netherlands)

    Pollakis, Georgios; Abebe, Almaz; Kliphuis, Aletta; Rinke de Wit, Tobias F.; Fisseha, Bitew; Tegbaru, Belete; Tesfaye, Girma; Negassa, Hailu; Mengistu, Yohannes; Fontanet, Arnaud L.; Cornelissen, Marion; Goudsmit, Jaap

    2003-01-01

    The magnitude and complexity of the HIV-1 genetic diversity are major challenges for vaccine development. Investigation of the genotypes circulating in areas of high incidence, as well as their interactions, will be a milestone in the development of an efficacious vaccine. Because HIV-1 subtype C

  5. [Phonomechanocardiography in the evaluation of the functional status of valvular prosthesis].

    Science.gov (United States)

    Esquivel Avila, J; Molina Zapata, B; Martínez Ríos, M A; Flamand, E

    1975-01-01

    The FMCG in 22 patients with valvular prosthesis is analyzed and its clinical, hemodynamic and surgical correlation are established (11 from the I.N.C. and 11 from the Hospital Infantil I.M.A.N.). The average age of the patients was 15 years old, 18 had a mitral and six aortic valvulopathy, and they all required a valvular replacement. Of the mitral prosthesis, 14 were Starr-Edwards (13 of ball valve and one of disc), three Lillehei-Kaster and one Börck-Shiley. In 5 patients, the FMCG suspected disfunction that was later corroborated by catheterism in three patients and by surgery in all of them. The important differences of the FMCG between the group with good and the one with bad function were: the aparition of a rumble, a decrease in the amplitud of the closing snap, index of closing snap opering snap of less than one, lenghtening of fases PFVP and IVCP, and shortening of IVDRP. In the patients with auricular fibrilation, after long dyastoles; that would represent an adequate atrial emptying; the closing snap was more intense, the PFVP was lennthened the IVDRP was shortened when the prosthesis was not properly functioning. All the aortic prosthesis were ball valve Starr-Edwards type; in one the FMCG suspected disfunction and the patient had a sudden death outside of the Hospital. The significant differences of the FMCG were the decrease in the intensity of the opening snap, with a Hylen index of less than one, lengthening of the PFVP, IVCP and of the expulsive period (EP). The authors conclude that the FMCG is a good method for an early detection of the disfunctions of valvular prosthesis.

  6. Topotactic elimination of water across a C-C ligand bond in a dense 3-D metal-organic framework.

    Science.gov (United States)

    Yeung, Hamish H-M; Kosa, Monica; Griffin, John M; Grey, Clare P; Major, Dan T; Cheetham, Anthony K

    2014-11-11

    Upon heating, lithium L-malate undergoes topotactic dehydration to form a phase containing the unsaturated fumarate ligand, in which the original 3-D framework remains intact. Insight into this unusual transformation has been obtained by single crystal X-ray diffraction, MAS-NMR, in situ powder X-ray diffraction and DFT calculations.

  7. Structural, electronic, and optical properties of the C-C complex in bulk silicon from first principles

    Science.gov (United States)

    Timerkaeva, Dilyara; Attaccalite, Claudio; Brenet, Gilles; Caliste, Damien; Pochet, Pascal

    2018-04-01

    The structure of the CiCs complex in silicon has long been the subject of debate. Numerous theoretical and experimental studies have attempted to shed light on the properties of these defects that are at the origin of the light emitting G-center. These defects are relevant for applications in lasing, and it would be advantageous to control their formation and concentration in bulk silicon. It is therefore essential to understand their structural and electronic properties. In this paper, we present the structural, electronic, and optical properties of four possible configurations of the CiCs complex in bulk silicon, namely, the A-, B-, C-, and D-forms. The configurations were studied by density functional theory and many-body perturbation theory. Our results suggest that the C-form was misinterpreted as a B-form in some experiments. Our optical investigation also tends to exclude any contribution of A- and B-forms to light emission. Taken together, our results suggest that the C-form could play an important role in heavily carbon-doped silicon.

  8. Hyperonenproduktion in C+C- und Si+Si-Kollisionen bei 158 GeV pro Nukleon

    CERN Document Server

    Kraus, Ingrid

    2004-01-01

    Ultrarelativistische Schwerionenstöße werden seit etwa 15 Jahren untersucht, um Kernmaterie unter extremen Bedingungen zu erforschen; in Kollisionen schwerer Atomkerne kann bei hohen Einschußenergien Kernmaterie stark komprimiert und aufgeheizt werden. Die Bedeutung dieser Experimente wird durch Berechnungen der Quanten-Chromo-Dynamik auf raumzeitlichen Gittern hervorgehoben, die bei ausreichend hoher Energiedichte eine Phase voraussagen, in der die Quarks nicht mehr in Hadronen gebunden sind, sondern zusammen mit den Gluonen ein partonisches System ausbilden. Ist das System hinreichend groß und equilibriert, wird es als Quark-Gluon-Plasma bezeichnet. Die als Signatur für das Überschreiten der Phasengrenze vorgeschlagene erhöhte Produktion Seltsamkeit tragender Teilchen wurde in der Gegenüberstellung von elementaren Proton+Proton-Interaktionen und Kern+Kern-Stößen experimentell über einen weiten Energiebereich bestätigt. Eine solche Überhöhung kann aber auch durch rein hadronische Phänomene her...

  9. On the system optimum of traffic assignment in M/G/c/c state-dependent queueing networks

    NARCIS (Netherlands)

    Cruz, F.R.B.; Woensel, van T.; MacGregor Smith, J.; Lieckens, K.

    2010-01-01

    The classical Wardrop System Optimum assignment model assumes that the users will cooperate with each other in order to minimize the overall travel costs. The importance of the system optimum model lies on its well-recognized ability of producing solutions that correspond to the most efficient way

  10. Nickel-catalyzed cyclization of alpha, omega-dienes: formation vs. cleavage of C-C bonds

    Czech Academy of Sciences Publication Activity Database

    Nečas, D.; Turský, M.; Tišlerová, I.; Kotora, Martin

    2006-01-01

    Roč. 30, č. 4 (2006), s. 671-674 ISSN 1144-0546 R&D Projects: GA MŠk 1M0508; GA ČR GD203/03/H140 Institutional research plan: CEZ:AV0Z40550506 Keywords : catalysis * nickel * cyclization * diene * cyclopentane Subject RIV: CC - Organic Chemistry Impact factor: 2.647, year: 2006

  11. The Effect of the Kind of Sands and Additions on the Mechanical Behaviour of S.C.C

    Science.gov (United States)

    Zeghichi, L.; Benghazi, Z.; Baali, L.

    The sand is an inert element essential in the composition of concrete; its use ensures granular continuity between the cement and gravel for better cohesion of concrete. This paper presents the results of a study that investigated the influence of sand quality on the properties of fresh and hardened self-compacting concrete (SCC). The dune sands are very fine materials characterized by a high intergranular porosity, high surface area and low fineness modulus; on the other hand crushed (manufactured) sand has a high rate into thin and irregular shapes which are influencing the workability of concrete. The amount of dune sand varies from (0% 50%, to 100%) by weight of fine aggregates. The effect of additions is also treated (blast furnace slag and lime stone) The results show that the rheological properties favour the use of dune sands; however the mechanical properties support the use of crushed sand.

  12. Investigation of K{sup +} meson production in C+C collisions at 2 A GeV with HADES

    Energy Technology Data Exchange (ETDEWEB)

    Sadovsky, A.

    2007-12-28

    In this thesis the measurement of the double differential cross sections in K{sup +}V transverse momentum and rapidity in the reaction {sup 12}C+{sup 12}C{yields}K{sup +}+X at 2A GeV is described. (HSI)

  13. Anelastic relaxation of interstitial foreign atoms and their complexes with intrinsic defects in B.C.C. metals

    International Nuclear Information System (INIS)

    Weller, M.

    1985-01-01

    In body-centred cubic metals, heavy interstitial foreign atoms (IFA) O, N and C give rise to relaxations of Snoek type. For dilute alloys, relaxation parameters are summarized. In concentrated alloys (group Va metals containing O or N) Snoek relaxations are influenced by the interaction of IFA. The recent controversy is discussed as to whether this interaction is based on clustering or anticlustering. In irradiated metals complexes of IFA with intrinsic atomic defects (vacancies or self interstitial atoms) also give rise to relaxations

  14. Computer simulation of strain-induced ordering in interstitial solutions based on the b.c.c. Ta lattice

    International Nuclear Information System (INIS)

    Blanter, M.S.; Khachaturyan, A.G.

    1980-01-01

    A computer simulation is made of strain-induced ordering of interstitial atoms within octahedral interstices in the Ta host lattice. The calculation technique allows to take into account infinite-range strain-induced interaction. Computer simulation of ordering process enables to model the sequence of structure changes which occur during the ordering process and to find the equilibrium structure of the stable interstitial superstructures. The structures of high-temperature ordering phases obtained by the method of static concentration waves coincide with those obtained by means of computer simulation. However computer simulation enables to predict the structures of low-temperature ordered phases which cannot be obtained by the method of concentration waves. Comparison of computer simulation results and structures of observed ordered phases demonstrates good agreement. (author)

  15. C-C1-04: How to Win Friends and Influence People with the SAS Output Delivery System

    OpenAIRE

    Tolbert, William

    2010-01-01

    Background and Aims: Long-time SAS users remember the days when SAS output was embarrassingly ugly. Version 7 saw the introduction of the Output Delivery System (ODS). ODS has matured into a very capable subsystem that gives users powerful reporting options. This presentation will highlight useful features and outline a macro-based system for handling multiple ODS destinations simultaneously. Nowadays there is no excuse for ugly SAS output! When building reports, SAS users should think about ...

  16. C-C1-04: How to Win Friends and Influence People with the SAS Output Delivery System

    Science.gov (United States)

    Tolbert, William

    2010-01-01

    Background and Aims: Long-time SAS users remember the days when SAS output was embarrassingly ugly. Version 7 saw the introduction of the Output Delivery System (ODS). ODS has matured into a very capable subsystem that gives users powerful reporting options. This presentation will highlight useful features and outline a macro-based system for handling multiple ODS destinations simultaneously. Nowadays there is no excuse for ugly SAS output! When building reports, SAS users should think about the needs of those using the reports. Some people just want to review frequency tables, and are happy to do so on a monitor. Others want to be able to print data for review in a meeting. And, there are always those that want to work with the data in a spreadsheet. Consider the ideal formats for each of the users outlined above. For the casual data browser, HTML output is ideal. For printing, PDF is preferred. And for the additional analysis, Excel is a popular option. With ODS, we can meet all of these needs. Methods: Because ODS permits opening multiple output destinations simultaneously, a single procedure can be used to generate data in HTML, PDF, and Excel at once. The presentation will demonstrate the following: o- basic ODS syntax for HTML, PDF, and Excel output o- custom HTML table of contents o- using the ExcelXP tagset for multi-tab spreadsheets o- a custom macro for managing multiple ODS destinations simultaneously o- simple PROC Template code for easy customization o- techniques for consistent output from multiple platforms. Results: The techniques outlined here have been well-received in a variety of business reporting environments. Conclusions: The SAS ODS provides a wide array of reporting options. Don’t limit yourself to just one type of output.

  17. (e,2e) momentum spectroscopic study of the C=C π orbitals of the vinyl halides

    International Nuclear Information System (INIS)

    Gorunganthu, R.R.; Coplan, M.A.; Leung, K.T.; Tossell, J.A.; Moore, J.H.; Department of Chemistry, University of Waterloo, Waterloo, Ontario N2L 3G1, Canada; Department of Chemistry, University of Maryland, College Park, Maryland 20742)

    1989-01-01

    The distribution of electron momentum density has been measured for the outermost occupied orbitals of the vinyl halides and ethylene using the (e,2e) technique. In contrast to the ionization potentials for these π orbitals which decrease monotonically from vinyl fluoride to vinyl iodide, the values of the momenta where the distributions are a maximum, p max , increase from the fluoride through the bromide and then shift back to a lower value for the iodide. This observation can be analyzed in terms of B(r), the Fourier transform of the observed momentum distribution, and ΔB(r), the difference between B(r) functions. The shape of ΔB(r) for the fluoride, chloride, and bromide in comparison to ethylene reflects the effect of the carbon--halogen antibonding interaction in these vinyl halides. On the other hand, in vinyl iodide the antibonding interaction is compensated for by the diffuse iodine 5p character of the molecular orbital. The relation of these observations to chemical properties of the vinyl halides is discussed along with differences between experiment and calculations at low momentum

  18. 20 let od rozsudku Bosman Věc C - 415/1993. EU:C:1995:463

    Czech Academy of Sciences Publication Activity Database

    Hamerník, Pavel

    2016-01-01

    Roč. 5, č. 1 (2016), s. 43-47 ISSN 2453-7705 Institutional support: RVO:68378122 Keywords : sports law * football * Court of Arbitration for Sport Subject RIV: AG - Legal Sciences http://www.supcourt.gov.sk/data/files/1257_bulletin-2016-v-rocnik-c-1.pdf

  19. High prevalence of hepatitis B virus genotype C/C1 in the Minangkabau ethnic group in Indonesia

    Directory of Open Access Journals (Sweden)

    Siburian Marlinang D

    2013-01-01

    Full Text Available Abstract Background The Minangkabau is one of the major ethnic groups in Indonesia. Previous studies with a limited number of samples have shown a different prevalence of HBV/C in the Minangkabau compared to the Indonesian population in general. The aim of this study was to assess the HBV genotype distribution pattern and the prevalence of pre-S, T1753V and A1762T/G1764A mutations among the Minangkabau HBV carriers. The samples were collected from Padang, West Sumatera and from western Java. Mixed primers for specific genotypes were used to determine the HBV genotype. Pre-S or S genes were amplified, sequenced and aligned with reference sequences from GenBank to derive a phylogenetic tree for subgenotyping. Pre-S genes were also analyzed for mutations. The basal core promoter (BCP region was amplified and directly sequenced to analyze T1753V and A1762T/G1764A mutations. Results The predominant HBV genotype among the Minangkabau HBV carriers (n=117 was C (72.6% followed by B (24.8% and co-infection with B and C (2.6%. The prevalence of pre-S mutations, including both the pre-S deletion and pre-S2 start codon mutation, was 41.0%, and the T1753V and A1762T/G1764A mutations were found in 51.9% and 71.2% respectively. HBV/C1 was the predominant HBV subgenotype in the Minangkabau HBV carriers, and was found in 66.2%, followed by B3, B7, C8, B2, B9, C2, and C10 (18.3%, 7.0%, 2.8%, 1.4%, 1.4%, 1.4%, and 1.4% respectively. From samples that were found to be co-infected with HBV B and C, two samples were successfully cloned and subgenotyped, including one with mixed subgenotypes of B3 and C1, and another one with mixed subgenotypes of B7, C1, putative intergenotypic of B/A, and C/A. Furthermore, three samples from donors of non-Minangkabau ethnicity from Padang were found to be infected with an intragenotypic recombination form, including a putative recombinant of B8/B3 and B9/B7. Conclusion HBV/C with subgenotype C1 was the predominant HBV genotype among HBV carriers of Minangkabau ethnicity. The prevalence of pre-S, A1762T/G1764A, and T1753V mutations was higher among the Minangkabau compared to Indonesian HBV carriers in general.

  20. The influence of surface stress on dislocation emission from sharp and blunt cracks in f.c.c. metals

    DEFF Research Database (Denmark)

    Schiøtz, Jakob

    2000-01-01

    We use computer simulations to study the behaviour of atomically sharp and blunted cracks in various fee metals. The simulations use effective medium potentials which contain many-body interactions. We find that when using potentials representing platinum and gold a sharp crack is stable with res......We use computer simulations to study the behaviour of atomically sharp and blunted cracks in various fee metals. The simulations use effective medium potentials which contain many-body interactions. We find that when using potentials representing platinum and gold a sharp crack is stable...... with respect to the emission of a dislocation from the crack tip, whereas for all other metals studied the sharp crack is unstable. This result cannot be explained by existing criteria for the intrinsic ductile/brittle behaviour of crack tips, but is probably caused by surface stresses. When the crack...... is no longer atomically sharp dislocation emission becomes easier in all the studied metals. The effect is relatively strong; the critical stress intensity factor for emission to occur is reduced by up to 20%. This behaviour appears to be caused by the surface stress near the crack tip. The surface stress...

  1. Status of the research and development at JAERI on the C/C composite control rod for HTGR

    International Nuclear Information System (INIS)

    Eto, M.; Ishiyama, S.; Ugachi, H.

    1996-01-01

    Control rod elements made of carbon-carbon composites were prepared and fracture-tested, aiming at the development of the more heat-resistant control rod which may impose the less restriction on the operation and shutdown of the HTGR. The control rod elements included pellet holder, lace truck and pin of PAN- or pitch-based composite material. On the basis of the results of fracture tests on the unirradiated elements, those made of PAN-based material were selected for an irradiation experiment. The irradiation was carried out in JRR-3 at 900 ± 50 deg. C to a maximum neutron fluence of 1 x 10 25 n/m 2 (E>29fJ). Fracture tests of the elements indicated that both fracture load and fracture displacement enough to assure the integrity of a control rod were maintained even after the irradiation. It was also found that both fracture strength and strain increased when applied load was parallel to the fiber felt plane, whereas the strength increase and strain decrease were observed for the load applied against the plane. (author). 11 refs, 16 figs

  2. Catalytic promiscuity of 4-oxalocrotonate tautomerase : discovery and characterization of C-C bond-forming activities

    NARCIS (Netherlands)

    Zandvoort, Ellen

    2012-01-01

    Het verschijnsel katalytische promiscuïteit, waarin een enzym naast zijn natuurlijke activiteit een alternatieve reactie (of reacties) katalyseert, is een krachtig, recent opgekomen concept, dat erg relevant is voor het ontwerpen van nieuwe enzymen. Enzym promiscuïteit is een veelbelovende bron van

  3. Study of Command and Control (C&C) Structures on Integrating Unmanned Autonomous Systems (UAS) into Manned Environments

    Science.gov (United States)

    2012-09-01

    and traveled all the way around Lake Tahoe. The self - driving cars have logged over 140,000 miles since October 9, 2010 (Google 2010) pictured here...UNDERWATER VEHICLES (AUV) STARFISH is the name given to a small team of autonomous robotic fish - a project carried out by the Acoustic Research...www.scribd.com/doc/42245301/Manual-Mine- Clearance-Book1. Accessed July 23, 2012. Google. The Self - Driving Car Logs more Miles on New Wheels. August 7

  4. Investigation of irradiation strengthening of b.c.c. metals and their alloys. Progress report, January 1976--October 1976

    International Nuclear Information System (INIS)

    1976-01-01

    Research on irradiation of bcc metals and alloys is reported. Data and information are presented in appendixes on low temperature neutron irradiation of Nb, effects of tritium on the yield stress of Nb, multiple dislocation motion, dislocation group motion, dislocation kinetics, and computer simulation of dislocation motion

  5. Intramolecular Hydroalkoxylation of Non-Activated C=C Bonds Catalysed by Zeolites: An Experimental and Theoretical Study

    Czech Academy of Sciences Publication Activity Database

    Pérez-Mayoral, E.; Matos, I.; Nachtigall, P.; Položij, M.; Fonseca, I.; Vitvarová, Dana; Čejka, Jiří

    2013-01-01

    Roč. 6, č. 6 (2013), s. 1021-1030 ISSN 1864-5631 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : cyclization * density functional calculations * heterogeneous catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 7.117, year: 2013

  6. Lightweight Ultrahigh Temperature CMC-Encased C/C Structure for Reentry and Hypersonic Applications, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — The reentry spacecraft and hypersonic cruisers of the future will require advanced lightweight thermal protection systems that can provide the dual functionality of...

  7. Lightweight Ultrahigh Temperature CMC-Encased C/C Structure for Reentry and Hypersonic Applications, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — Future reentry and hypersonic vehicles require advanced lightweight leading edge thermal protection systems that can provide the dual functionality of...

  8. Point defects in B.C.C. Fe-Al, Fe-Co, and Fe-Co-V ordered alloys

    International Nuclear Information System (INIS)

    Riviere, J.P.; Dinhut, J.F.

    1982-01-01

    Radiation damage produced at 20 K by 2.5 MeV electrons is studied in three B 2 type Fe-40 at % Al, Fe-Co, Fe-Co-V ordered alloys. The resistivity damage in Fe-40 at % Al ordered single crystals is found less effective in the directions. The results suggest that replacement collision chains are difficult to propagate along the direction. Frenkel pair creation superimposed with disordering can account for the resistivity damage in the initially ordered Fe-Co alloy. Informations concerning replacement collision sequences in direction are derived. During the recovery of all the alloys, three main stages are observed and an ordering enhancement occurs. (author)

  9. Tvorba vs. štěpení C-C vazeb katalyzované komplexy niklu

    Czech Academy of Sciences Publication Activity Database

    Nečas, D.; Turský, M.; Kotora, Martin

    2005-01-01

    Roč. 99, č. 11 (2005), s. 861 ISSN 0009-2770. [Pokroky v organické, bioorganické a farmaceutické chemii /40./. 18.11.2005-20.11.2005, Nymburk] R&D Projects: GA MŠk(CZ) 1M0508; GA ČR(CZ) GD203/03/H140 Institutional research plan: CEZ:AV0Z40550506 Keywords : bipyridine * cyclotrimerization * asymmetric synthesis Subject RIV: CC - Organic Chemistry

  10. C-C3-04: Neighborhood Socioeconomic Conditions and Use of Preventive Health Care Services in Insured Populations

    Science.gov (United States)

    Doubeni, Chyke; Robinson, Scott; Fouayzi, Hassan; Roblin, Douglas; Field, Terry; Fletcher, Robert

    2010-01-01

    Background and Aims: Several studies have found variations in cancer health outcomes among persons in different socioeconomic (SES) groups, but the presence and extent of such disparities in insured populations is unclear. The objective of this study was to determine whether, among persons enrolled in HMOs, there are differences in the use of services for early detection of cancer according to neighborhood SES. Methods: This was a retrospective cohort study of men and women aged 50+ years, enrolled for at least 1 calendar year beginning in 2000 at one of 3 health plans participating in the Cancer Research Network. Follow-up was to the date of disenrollment from the health plan, or December 31, 2007, whichever was earlier. Using administrative data, we obtained dates of examinations and tests related to screening for colorectal cancer (CRC) for men and women and mammography among women. CRC tests were defined as time to the first colonoscopy or sigmoidoscopy (endoscopy) during the follow-up period; and also time to an endoscopy that was not preceded by gastrointestinal conditions in the 6 months prior to the test. SES neighborhood measure was computed using 12 US Census (2000) measures of racial and SES composition and context at the tract level. Results: A total of 123,222 members, 54% women and average age 64 years, were followed for an average of 5.5 (SD=2.8) years. During 673,938 person-years of follow-up, about 41% had at least 1 endoscopy and 32% had an endoscopy not associated with prior GI-related diagnoses. Among women, 77% had at least 1 mammogram during the study period; 7% had mammograms during each of the first 5 years of follow-up. In Cox regression models, compared to lowest quartile of SES, persons residing in the highest quartile had a hazard ratio (HR) of 0.76: (95% confidence interval (CI): 0.75–0.78) for receipt of any endoscopy; 0.72: (CI: 0.70–0.74) for ‘screening’ endoscopy; and 0.86: (CI: 0.84–0.88) for mammography. Conclusion: Even among patients receiving care in HMOs, those in socioeconomically deprived neighborhoods are less likely to undergo cancer early detection services. Interventions targeting enrollees residing in lower SES neighborhoods may help reduce cancer health disparities.

  11. Synthesis of Aromatic Compounds by Catalytic C-C Bond Activation of Biphenylene or Angular [3]Phenylene

    Czech Academy of Sciences Publication Activity Database

    Korotvička, A.; Císařová, I.; Roithová, J.; Kotora, Martin

    2012-01-01

    Roč. 18, č. 14 (2012), s. 4200-4207 ISSN 0947-6539 Grant - others:GA UK(CZ) SVV 263205/2011; GA ČR(CZ) GAP207/11/0338; GA MŠk(CZ) LC06070 Program:LC Institutional research plan: CEZ:AV0Z40550506 Keywords : arenes * cleavage reactions * iridium * reaction mechanisms * rhodium Subject RIV: CC - Organic Chemistry Impact factor: 5.831, year: 2012

  12. Reversible Sigma C-C Bond Formation Between Phenanthroline Ligands Activated by (C5Me5)2Yb

    Energy Technology Data Exchange (ETDEWEB)

    Nocton, Gr& #233; gory; Lukens, Wayne W.; Booth, Corwin H.; Rozenel, Sergio S.; Medling, Scott A.; Maron, Laurent; Andersen, Richard A.

    2014-06-26

    The electronic structure and associated magnetic properties of the 1,10-phenanthroline adducts of Cp*2Yb are dramatically different from those of the 2,2?-bipyridine adducts. The monomeric phenanthroline adducts are ground state triplets that are based upon trivalent Yb(III), f13, and (phen ) that are only weakly exchange coupled, which is in contrast to the bipyridine adducts whose ground states are multiconfigurational, open-shell singlets in which ytterbium is intermediate valent ( J. Am. Chem. Soc 2009, 131, 6480; J. Am. Chem. Soc 2010, 132, 17537). The origin of these different physical properties is traced to the number and symmetry of the LUMO and LUMO+1 of the heterocyclic diimine ligands. The bipy has only one 1 orbital of b1 symmetry of accessible energy, but phen has two orbitals of b1 and a2 symmetry that are energetically accessible. The carbon p-orbitals have different nodal properties and coefficients and their energies, and therefore their populations change depending on the position and number of methyl substitutions on the ring. A chemical ramification of the change in electronic structure is that Cp 2Yb(phen) is a dimer when crystallized from toluene solution, but a monomer when sublimed at 180190 C. When 3,8-Me2phenanthroline is used, the adduct Cp*2Yb(3,8-Me2phen) exists in the solution in a dimer monomer equilibrium in which G is near zero. The adducts with 3-Me, 4-Me, 5-Me, 3,8-Me2, and 5,6-Me2-phenanthroline are isolated and characterized by solid state X-ray crystallography, magnetic susceptibility and LIII-edge XANES spectroscopy as a function of temperature and variable-temperature 1H NMR spectroscopy.

  13. Red Knots (Calidris canutus piersmai and C. c. rogersi) depend on a small threatened staging area in Bohai Bay, China

    NARCIS (Netherlands)

    Rogers, Danny I.; Yang, Hong-Yan; Hassell, Chris J.; Boyle, Adrian N.; Rogers, Ken G.; Chen, Bing; Zhang, Zheng-Wang; Piersma, Theunis

    2010-01-01

    We monitored numbers of Red Knots (Calidris canutus) staging in Bohai Bay, China (39 degrees 02'N, 118 degrees 15'E) on northward migration. Knots were identified to subspecies, and we systematically searched for colour-banded birds from the non-breeding grounds. We modelled migratory turnover, and

  14. Investigation of irradiation strengthening of b.c.c. metals and their alloys. Progress report, January 1975--October 1975

    International Nuclear Information System (INIS)

    1975-01-01

    Results of studies on radiation strengthening of V, Mo, and Nb are presented. Information is included on deformation characteristics of low-temperature neutron-irradiated Nb, the effects of He 3+ on the low-temperature deformation characteristics of Nb, electron-transmission microscopic studies of the nature of neutron damage effects of post-irradiation annealing, microplasticity, thermally activated dislocation motion, production of high-purity Nb and V, early stages of flow in Mo, microplasticity in V, and effects of impurity interstitials on the lattice resistance to dislocation motion. (JRD)

  15. C. C. Rafn, J. J. A. Worsaae, Archaeology, History and Danish National Identity in the Schleswig-Holstein Question

    Directory of Open Access Journals (Sweden)

    C. Stephen Briggs

    2005-11-01

    Full Text Available Between 1789 and 1815 Europe was devastated by a series of intermittent Wars waged by the French. The first part came about through the French Revolution, the second, the Napoleonic Wars, were about Bonaparte’s thirst for conquest. Almost at the end of them, Denmark’s attempted neutrality was to cost her the loss of Norway by cessation to Sweden under the Treaty of Kiel in 1814. The Norwegians felt particularly aggrieved by this, a ploy on the part of the British to disarm the Scandinavians and retain British Naval access to the Baltic. Thus began a half a century of particular national insecurity for Denmark, during which she felt under constant threat from German ambition through an increasingly powerful, predatory Prussia. Schleswig-Holstein was particularly at risk of annexation, because though much of Slesvig was culturally and ethnically Danish, southern Jutland had been strongly infiltrated by German influences unchecked for many decades (Sandiford 1975: 21. With a small population (2,225,000 in 1848 and now detached from those potentially sympathetic in Scandinavia, Denmark would have difficulty effectively opposing any major industrial power. Britain and Germany aside, there was also Russia, still largely undeveloped, but a power with strong Baltic interests. Maintaining Denmark’s borders through this delicately balanced neutrality was not going to be easy for such a small nation state. Would it be remotely possible to achieve this passively by developing trade? Could enduring borders otherwise be protected by influencing perceptions of Denmark’s historic cultural identity and ethnicity?

  16. Asymmetric C-C Bond-Formation Reaction with Pd: How to Favor Heterogeneous or Homogeneous Catalysis?

    DEFF Research Database (Denmark)

    Reimann, S.; Grunwaldt, Jan-Dierk; Mallat, T.

    2010-01-01

    The enantioselective allylic alkylation of (E)-1,3-diphenylallyl acetate was studied to clarify the heterogeneous or homogeneous character of the Pd/Al2O3-(R)-BINAP catalyst system. A combined approach was applied: the catalytic tests were completed with in situ XANES measurements to follow...

  17. SiC-C Composite as A Highly Stable and Easily Regenerable Photothermal Material for Practical Water Evaporation

    KAUST Repository

    Shi, Le; Shi, Yusuf; Li, Renyuan; Chang, Jian; Zaouri, Noor A.; Ahmed, Elaf Ali; Jin, Yong; Zhang, Chenlin; Zhuo, Sifei; Wang, Peng

    2018-01-01

    to localize thermal energy at the water-air interface are three important considerations. However, one additional consideration, regenerability, has so far slipped out of the photothermal material designs at status quo. This work reveals that there is a

  18. How safe is safe?

    International Nuclear Information System (INIS)

    Hughes, C.F.; Flood, M.

    1996-01-01

    Full text: The Australian Register of Therapeutic Goods lists over 25,000 medical device types currently supplied to Australian consumers. It is widely assumed that all goods listed on this register have been fully evaluated for safety and efficacy by the Therapeutic Goods Administration. However, only 1,010 devices are registered and thereby subject to full premarket evaluation. Five classes of registerable devices were arbitrarily assigned in 1986 based on overseas experience (Canada and the USA) and the work of several Advisory Panels convened by the then Minister of Health, Dr Neal Blewett. Some products have been removed from registerable categories, while others have been added. These decisions were made after reviewing device performance and problems. In May 1987, the Therapeutic Device Evaluation Committee (TDEC) and the Therapeutic Goods Administration introduced the Australian Therapeutic Device Problem Reporting Scheme. Under this scheme, any interested person can report medical device related problems to the Department for investigation. Each problem is investigated, a cause and/or outcome assigned and appropriate action is taken. Analysis of problem reports received indicates that no regulatory action was necessary in 34% of investigations. However, 24% of products required product improvement and recalls and/or safety alerts were issued for approximately 10% of problems investigated. In only 5% was the problem not confirmed by departmental investigation. The actual effect of the problem reported was temporary or minor injury in 10% of patients. In 2%, death or serious injury resulted. Forty-four percent of problems did not lead to patient injury at all and in 44% the problem was not related to the patient and/or his well being. However, the potential effect of death or serious injury was present in 17% of device problems. In 26% of reported events, temporary or minor injury could have occurred. Specific device related problems include the Bjork Shiley

  19. An experimental estimation of the resistance against a high-temperature gas corrosion of C/C composite materials with protective plasma coating

    International Nuclear Information System (INIS)

    Babin, S.V.; Khripakov, E.V.

    2007-01-01

    Materials with well-defined structure has been proposed as corrosion- and erosion-resistant coating from the carbon-carbon composite. Experiments on heat and erosion resistance of plasma coatings at carbon-carbon composite materials demonstrate availability of multilayer with upper erosion resistant layer on the basis of aluminium oxide, intermediate layer on the basis of boron-containing components with aluminium additions and damping layer of silicon carbide. Multilayer protective coats offer demand service characteristics of details [ru

  20. FeF(3) catalyzed cascade C-C and C-N bond formation: synthesis of differentially substituted triheterocyclic benzothiazole functionalities under solvent-free condition.

    Science.gov (United States)

    Atar, Amol B; Jeong, Yeon Tae

    2014-05-01

    A series of diverse polyfunctionalized triheterocyclic benzothiazoles were easily prepared in excellent yields via the Biginelli reaction of 2-aminobenzothiazole with substituted benzaldehydes and α-methylene ketones using FeF(3) as an expeditious catalyst under solvent-free conditions. The protocol provides a practical and straightforward approach toward highly functionalized triheterocyclic benzothiazole derivatives in excellent yields. The reaction was conveniently promoted by FeF(3) and the catalyst could be recovered easily after the reaction and reused without any loss of its catalytic activity. The advantageous features of this methodology are high atom economy, operational simplicity, shorter reaction time, convergence, and facile automation.

  1. 76 FR 4423 - Proposed Collection; Comment Request for Form 1040 and Schedules A, B, C, C-EZ, D, D-1, E, EIC, F...

    Science.gov (United States)

    2011-01-25

    ... Shareholder of a Passive Foreign Investment Company or Qualified Electing Fund. 8621-A X Late Deemed Dividend or Deemed Sale Election by a Passive Foreign Investment Company. 8689 Allocation of Individual Income... Small Employer Pension Plan Startup Costs. 8882 X Credit for Employer-Provided Childcare Facilities and...

  2. 76 FR 20453 - Proposed Collection; Comment Request for Form 1040 and Schedules A, B, C, C-EZ, D, D-1, E, EIC, F...

    Science.gov (United States)

    2011-04-12

    ... Than $1,800. 8621 X Return by a Shareholder of a Passive Foreign Investment Company or Qualified... Company. 8689 Allocation of Individual Income Tax To the Virgin Islands. 8693 X Low-Income Housing Credit... Childcare Facilities and Services. 8885 Health Coverage Tax Credit. 8886 X Reportable Transaction Disclosure...

  3. 75 FR 22179 - Proposed Collection; Comment Request for Form 1040 and Schedules A, B, C, C-EZ, D, D-1, E, EIC, F...

    Science.gov (United States)

    2010-04-27

    ... Income of More Than $1,800. 8621 Return by a Shareholder of a Passive Foreign Investment Company or... Company. 8689 Allocation of Individual Income Tax To the Virgin Islands. 8693 Low-Income Housing Credit... Employer-Provided Childcare Facilities and Services. 8885 Health Coverage Tax Credit. 8886 Reportable...

  4. 77 FR 24561 - Proposed Collection; Comment Request for Form 1040 and Schedules A, B, C, C-EZ, D, D-1, E, EIC, F...

    Science.gov (United States)

    2012-04-24

    ... laws and incorporates results from a survey of tax year 2007 individual taxpayers, conducted in 2008... out-of-pocket costs vary extensively depending on the tax situation of the taxpayer, the type of... Household Employment Taxes. 1040 SCH J Income Averaging for Farmers and Fishermen. 1040 SCH R Credit for the...

  5. 76 FR 78336 - Proposed Collection; Comment Request for Form 1040 and Schedules A, B, C, C-EZ, D, D-1, E, EIC, F...

    Science.gov (United States)

    2011-12-16

    ... when complying with Federal tax laws and incorporates results from a survey of tax year 2007 individual... tax situation of the taxpayer, the type of software or professional preparer used, and the geographic... SCH H X Household Employment Taxes. 1040 SCH J Income Averaging for Farmers and Fishermen. 1040 SCH R...

  6. Bipodal surface organometallic complexes with surface N-donor ligands and application to the catalytic cleavage of C-H and C-C bonds in n -Butane

    KAUST Repository

    Bendjeriou-Sedjerari, Anissa

    2013-11-27

    We present a new generation of "true vicinal" functions well-distributed on the inner surface of SBA15: [(Sî - Si-NH 2)(≡Si-OH)] (1) and [(≡Si-NH2)2] (2). From these amine-modified SBA15s, two new well-defined surface organometallic species [(≡Si-NH-)(≡Si-O-)]Zr(CH2tBu) 2 (3) and [(≡Si-NH-)2]Zr(CH2tBu) 2 (4) have been obtained by reaction with Zr(CH2tBu) 4. The surfaces were characterized with 2D multiple-quantum 1H-1H NMR and infrared spectroscopies. Energy-filtered transmission electron microscopy (EFTEM), mass balance, and elemental analysis unambiguously proved that Zr(CH2tBu)4 reacts with these vicinal amine-modified surfaces to give mainly bipodal bis(neopentyl)zirconium complexes (3) and (4), uniformly distributed in the channels of SBA15. (3) and (4) react with hydrogen to give the homologous hydrides (5) and (6). Hydrogenolysis of n-butane catalyzed by these hydrides was carried out at low temperature (100 C) and low pressure (1 atm). While (6) exhibits a bis(silylamido)zirconium bishydride, [(≡Si-NH-)2]Zr(H) 2 (6a) (60%), and a bis(silylamido)silyloxozirconium monohydride, [(≡Si-NH-)2(≡Si-O-)]ZrH (6b) (40%), (5) displays a new surface organometallic complex characterized by an 1H NMR signal at 14.46 ppm. The latter is assigned to a (silylimido)(silyloxo)zirconium monohydride, [(≡Si-Nî)(≡Si-O-)]ZrH (5b) (30%), coexistent with a (silylamido)(silyloxo)zirconium bishydride, [(≡Si-NH-)(≡Si-O-)] Zr(H)2 (5a) (45%), and a silylamidobis(silyloxo)zirconium monohydride, [(≡Si-NH-)(≡Si-O-)2]ZrH (5c) (25%). Surprisingly, nitrogen surface ligands possess catalytic properties already encountered with silicon oxide surfaces, but interestingly, catalyst (5) with chelating [N,O] shows better activity than (6) with chelating [N,N]. © 2013 American Chemical Society.

  7. Mapping the dominant regions of the phase space associated with c c ¯ production relevant for the prompt atmospheric neutrino flux

    Science.gov (United States)

    Goncalves, Victor P.; Maciuła, Rafał; Pasechnik, Roman; Szczurek, Antoni

    2017-11-01

    We present a detailed mapping of the dominant kinematical domains contributing to the prompt atmospheric neutrino flux at high neutrino energies by studying their sensitivity to the cuts on several kinematical variables crucial for charm production in cosmic ray scattering in the atmosphere. This includes the maximal center-of-mass energy for proton-proton scattering, the longitudinal momentum fractions of partons in the projectile (cosmic ray) and target (nucleus of the atmosphere), the Feynman xF variable, and the transverse momentum of charm quark/antiquark. We find that the production of neutrinos with energies larger than Eν>107 GeV is particularly sensitive to the c.m. energies larger than the ones at the LHC and to the longitudinal momentum fractions in the projectile 10-8ranges beyond the reach of the current collider measurements.

  8. Unusual C-C bond cleavage in the formation of amine-bis(phenoxy) group 4 benzyl complexes: Mechanism of formation and application to stereospecific polymerization

    KAUST Repository

    Gowda, Ravikumar R.; Caporaso, Lucia; Cavallo, Luigi; Chen, Eugene You Xian

    2014-01-01

    Group 4 tetrabenzyl compounds MBn4 (M = Zr, Ti), upon protonolysis with an equimolar amount of the tetradentate amine-tris(phenol) ligand N[(2,4-tBu2C6H2(CH 2)OH]3 in toluene from -30 to 25 °C, unexpectedly lead to amine-bis(phenoxy) dibenzyl

  9. Integración de dispositivos físicos en un laboratorio remoto de control mediante diferentes plataformas: Labview, Matlab y C/C++

    Directory of Open Access Journals (Sweden)

    R. Costa-Castelló

    2010-01-01

    Full Text Available Resumen: Los laboratorios remotos de control posibilitan la realización de prácticas con equipos físicos reales que se encuentran ubicados en entornos remotos siendo accesibles por parte de los alumnos en cualquier instante de tiempo y desde cualquier lugar con conexión a Internet. En este artículo se presenta un conjunto de dispositivos físicos incorporados dentro de una esquema global de laboratorios remotos (AutomatL@bs que posibilitan la realización de prácticas a distancia con estos dispositivos. El rasgo principal común a estos dispositivos consiste en que posibilitan la actuación con sistemas físicos remotos para la realización de prácticas de control clásico con los mismos. Se prestará una especial atención a las diferentes posibilidades de comunicación entre la herramienta visual que dispone el usuario para su interconexión basada en Easy Java Simulations, y la conexión directa con los dispositivos físicos ubicados en los laboratorios remotos. Estos sistemas se han empleado para la realización de prácticas dentro del sistema AutomatL@bs desde el curso 1997/98. Palabras clave: Educación en Control, Laboratorio remoto, Laboratorio virtual, Control remoto, Control PID, Técnicas de Laboratorio

  10. Palladium nanoparticles immobilized on multifunctional ‎hyperbranched polyglycerol-grafted magnetic nanoparticles as a ‎sustainable and efficient catalyst for C-C coupling reactions

    Directory of Open Access Journals (Sweden)

    Mina Amini

    2016-07-01

    Full Text Available This study offers an exclusive class of magnetic nanoparticles supported hyperbranched polyglycerol (MNP/HPG that was functionalized with citric acid (MNP/HPG-CA as a host immobilization of palladium nanoparticles. The MNP/HPG-CA/Pd catalyst was fully characterized using some different techniques such as thermogravimetric analysis (TGA, x-ray diffraction (XRD, transmission electron microscopy (TEM, scanning electron microscopy (SEM, energy-dispersive x-ray spectroscopy (EDX, inductively coupled plasma (ICP and x-ray photoelectron spectroscopy (XPS. The new catalytic system showed high activity for the Suzuki–Miyaura cross-coupling and Heck reaction under mild and green conditions. Besides, the MNP/HPG-CA/Pd was found to be a convenient catalyst for copper-free Sonogashira coupling reaction in water as a green solvent at room temperature. Moreover, the catalyst could be recovered easily and reused several times without significant loss of reactivity. Ease of preparation, oxygen insensitive, phosphine-free, air- and moisture-stable, and high reusability of this immobilized palladium catalyst are the noteworthy advantages of this catalytic system.

  11. Magnetism, chemical bonding and hyperfine properties in the nanoscale antiferromagnet [Fe(O Me)2(O2 C C H2 Cl)]10

    International Nuclear Information System (INIS)

    Zeng, Z.; Duan, Y.; Guenzburger, Diana

    1996-09-01

    The electronic and magnetic properties of the nanometer-size antiferromagnet (the ferric wheel molecule) are investigated with the first-principles spin-polarized Discrete Variational Method, in the framework of Density Functional theory. Magnetic moments, densities of the states and charge and spin-density maps are obtained. The Moessbauer hyperfine parameters Isomer shift, Quadrupole Splitting and Hyperfine Field are obtained from the calculations and compared to reported experimental values when available. (author). 33 refs., 8 figs., 4 tabs

  12. Primary photodissociation pathways of epichlorohydrin and analysis of the C-C bond fission channels from an O(3P)+allyl radical intermediate

    International Nuclear Information System (INIS)

    FitzPatrick, Benjamin L.; Alligood, Bridget W.; Butler, Laurie J.; Lee, Shih-Huang; Lin, Jim Jr-Min

    2010-01-01

    This study initially characterizes the primary photodissociation processes of epichlorohydrin, c-(H 2 COCH)CH 2 Cl. The three dominant photoproduct channels analyzed are c-(H 2 COCH)CH 2 +Cl, c-(H 2 COCH)+CH 2 Cl, and C 3 H 4 O+HCl. In the second channel, the c-(H 2 COCH) photofission product is a higher energy intermediate on C 2 H 3 O global potential energy surface and has a small isomerization barrier to vinoxy. The resulting highly vibrationally excited vinoxy radicals likely dissociate to give the observed signal at the mass corresponding to ketene, H 2 CCO. The final primary photodissociation pathway HCl+C 3 H 4 O evidences a recoil kinetic energy distribution similar to that of four-center HCl elimination in chlorinated alkenes, so is assigned to production of c-(H 2 COC)=CH 2 ; the epoxide product is formed with enough vibrational energy to isomerize to acrolein and dissociate. The paper then analyzes the dynamics of the C 3 H 5 O radical produced from C-Cl bond photofission. When the epoxide radical photoproduct undergoes facile ring opening, it is the radical intermediate formed in the O( 3 P)+allyl bimolecular reaction when the O atom adds to an end C atom. We focus on the HCO+C 2 H 4 and H 2 CO+C 2 H 3 product channels from this radical intermediate in this report. Analysis of the velocity distribution of the momentum-matched signals from the HCO+C 2 H 4 products at m/e=29 and 28 shows that the dissociation of the radical intermediate imparts a high relative kinetic energy, peaking near 20 kcal/mol, between the products. Similarly, the energy imparted to relative kinetic energy in the H 2 CO+C 2 H 3 product channel of the O( 3 P)+allyl radical intermediate also peaks at high-recoil kinetic energies, near 18 kcal/mol. The strongly forward-backward peaked angular distributions and the high kinetic energy release result from tangential recoil during the dissociation of highly rotationally excited nascent radicals formed photolytically in this experiment. The data also reveal substantial branching to an HCCH+H 3 CO product channel. We present a detailed statistical prediction for the dissociation of the radical intermediate on the C 3 H 5 O potential energy surface calculated with coupled cluster theory, accounting for the rotational and vibrational energy imparted to the radical intermediate and the resulting competition between the H+acrolein, HCO+C 2 H 4 , and H 2 CO+C 2 H 3 product channels. We compare the results of the theoretical prediction with our measured branching ratios. We also report photoionization efficiency (PIE) curves extending from 9.25 to 12.75 eV for the signal from the HCO+C 2 H 4 and H 2 CO+C 2 H 3 product channels. Using the C 2 H 4 bandwidth-averaged absolute photoionization cross section at 11.27 eV and our measured relative photoion signals of C 2 H 4 and HCO yields a value of 11.6+1/-3 Mb for the photoionization cross section of HCO at 11.27 eV. This determination puts the PIE curve of HCO measured here on an absolute scale, allowing us to report the absolute photoionization efficiency of HCO over the entire range of photoionization energies.

  13. Primary photodissociation pathways of epichlorohydrin and analysis of the C-C bond fission channels from an O(3P)+allyl radical intermediate

    Science.gov (United States)

    FitzPatrick, Benjamin L.; Alligood, Bridget W.; Butler, Laurie J.; Lee, Shih-Huang; Lin, Jim-Min, Jr.

    2010-09-01

    This study initially characterizes the primary photodissociation processes of epichlorohydrin, c-(H2COCH)CH2Cl. The three dominant photoproduct channels analyzed are c-(H2COCH)CH2+Cl, c-(H2COCH)+CH2Cl, and C3H4O+HCl. In the second channel, the c-(H2COCH) photofission product is a higher energy intermediate on C2H3O global potential energy surface and has a small isomerization barrier to vinoxy. The resulting highly vibrationally excited vinoxy radicals likely dissociate to give the observed signal at the mass corresponding to ketene, H2CCO. The final primary photodissociation pathway HCl+C3H4O evidences a recoil kinetic energy distribution similar to that of four-center HCl elimination in chlorinated alkenes, so is assigned to production of c-(H2COC)=CH2; the epoxide product is formed with enough vibrational energy to isomerize to acrolein and dissociate. The paper then analyzes the dynamics of the C3H5O radical produced from C-Cl bond photofission. When the epoxide radical photoproduct undergoes facile ring opening, it is the radical intermediate formed in the O(P3)+allyl bimolecular reaction when the O atom adds to an end C atom. We focus on the HCO+C2H4 and H2CO+C2H3 product channels from this radical intermediate in this report. Analysis of the velocity distribution of the momentum-matched signals from the HCO+C2H4 products at m/e=29 and 28 shows that the dissociation of the radical intermediate imparts a high relative kinetic energy, peaking near 20 kcal/mol, between the products. Similarly, the energy imparted to relative kinetic energy in the H2CO+C2H3 product channel of the O(P3)+allyl radical intermediate also peaks at high-recoil kinetic energies, near 18 kcal/mol. The strongly forward-backward peaked angular distributions and the high kinetic energy release result from tangential recoil during the dissociation of highly rotationally excited nascent radicals formed photolytically in this experiment. The data also reveal substantial branching to an HCCH+H3CO product channel. We present a detailed statistical prediction for the dissociation of the radical intermediate on the C3H5O potential energy surface calculated with coupled cluster theory, accounting for the rotational and vibrational energy imparted to the radical intermediate and the resulting competition between the H+acrolein, HCO+C2H4, and H2CO+C2H3 product channels. We compare the results of the theoretical prediction with our measured branching ratios. We also report photoionization efficiency (PIE) curves extending from 9.25 to 12.75 eV for the signal from the HCO+C2H4 and H2CO+C2H3 product channels. Using the C2H4 bandwidth-averaged absolute photoionization cross section at 11.27 eV and our measured relative photoion signals of C2H4 and HCO yields a value of 11.6+1/-3 Mb for the photoionization cross section of HCO at 11.27 eV. This determination puts the PIE curve of HCO measured here on an absolute scale, allowing us to report the absolute photoionization efficiency of HCO over the entire range of photoionization energies.

  14. Selective oxidation catalysis with Mn and H2O2 : Conversion of alkenes to α-hydroxy ketones, C=C cleavage and mechanistic insights.

    NARCIS (Netherlands)

    Mecozzi, Francesco

    2016-01-01

    Oxidation is a term used to cover a wide range of processes that are central to life. Although we associate oxidation with ageing it is in fact central to living – from the uncontrolled radical chain reactions that drive combustion to the highly selective stepwise oxidations that your body uses to

  15. Application of “Boomerang” Linear Polystyrene-Stabilized Pd Nanoparticles to a Series of C-C Coupling Reactions in Water

    Directory of Open Access Journals (Sweden)

    Atsushi Ohtaka

    2015-02-01

    Full Text Available The application of a catch-and-release system for soluble Pd species between water (reaction medium and polystyrene (polymer support was examined in the Suzuki coupling reaction with 2-bromothiophene and the Heck reaction with styrene or bromobenzene. Although a slight increase in particle size was observed by TEM after re-stabilization of the Pd species on linear polystyrene, no agglomeration was observed.

  16. Planificación estratégica incorporando responsabilidad social de la empresa DISMAC S.C.C. Para el período 2014-2018

    OpenAIRE

    Mena Hidalgo, Graciela Maribel

    2015-01-01

    Toda empresa está consciente que el funcionamiento interno en gran medida ésta determinada por su entorno, el cual incide en su planificación estratégica y, por lo tanto, en sus resultados, ya que al no contar con una planificación estratégica, no involucra a todos los interesados a conocer su situación actual, la proyección futura y la mejor manera de relacionarse con el entorno, con el fin de crecer y dar viabilidad a los proyectos planteados en una organización, mejorando la comunicación, ...

  17. Ispra joint research center in the field of shielding; Attivita del C.C.R. di Ispra nel campo delle schermature

    Energy Technology Data Exchange (ETDEWEB)

    Kind, A.; Nicks, R.

    1963-07-01

    In the field of shielding nuclear energy plants certain problems of outstanding importance still require satisfactory solutions. Among these, particular importance is assumed by that of determining removal of sections for fission neutrons and that of calculating the propagation of neutrons and gamma rays by means of penetrations. On behalf of the Reactor Physics Department of Ispra, theoretical as well as practical research in this direction has been undertaken rather a long time ago. Two contracts have been concluded, the one with Padua University for measuring removal sections as a function of neutron energy, and the other with Sorin for measuring neutron distribution in cylindrical penetrations. At Ispra measuring activities are under way for determining gamma ray propagation by means of concrete penetrations. Theoretical studies for interpreting such measurements are also in progress. The first results obtained so far are being presented here.

  18. Clinical experience with metolazone-a new diuretic- in cases of edema and ascites due to hepatic cirrhosis, C.C.F.,, and malnutrition

    Directory of Open Access Journals (Sweden)

    Sheth U

    1977-01-01

    Full Text Available Metolazone [2-methyl-3-(0-tolyl-6-sulpharnyl-7-chloro-1, 2, 3, 4-tetra hydro-4-quinazolinone] is recently introduced as a new orally acting diuretic. It is structurally related to sulfonamides and benzo-thiazidines. 41 male patients suffering from generalised edema due to various causes including 7 cases of congestive cardiac failure, 6 cases of malnutrition and 28 cases of hepatic cirrhosis were treated with metolazone given orally in a dose varying from 5 to 60 mg per day. The optimum effective dose was found to be 5 mg per day. 36 cases responded well with a loss of body weight ranging from 2.5 kg. to 12 kg. There was a significant increase in the urine volume and the urinary sodium, potassium and chloride excretion. Saluretic response was marked. Urinary sodium increased from 8-20 mEq/ day to 100 to 120 mEq in 24 hours. No serious side effects were observed during this study. Hypokalemia and hyponatremia occurred on increase of the dose. Occasionally leg cramps and abdominal distress were observed. Metolazone was found to be an effective orally active diuretic in a dose of 5 to 10 , mg/day.

  19. Reacciones de formación de enlaces C-C catalizadas por metales de transición y factores que les afectan

    OpenAIRE

    Noverges Pedro, Bárbara

    2015-01-01

    La síntesis y funcionalización de compuestos carbonílicos ha atraído la atención de los químicos a lo largo del tiempo ya que el grupo carbonilo es una función muy versátil en química orgánica y está presente en numerosos compuestos con actividad biológica. Por su parte, las reacciones de acoplamiento cruzado de dos y tres componentes son metodologías que actualmente se aplican a nivel tanto académico como industrial debido a que requieren condiciones suaves de reacción, la extracción de los ...

  20. Possible association of 3' UTR +357 A>G, IVS11-nt 93 T>C, c.1311 C>T polymorphism with G6PD deficiency.

    Science.gov (United States)

    Sirdah, Mahmoud M; Shubair, Mohammad E; Al-Kahlout, Mustafa S; Al-Tayeb, Jamal M; Prchal, Josef T; Reading, N Scott

    2017-07-01

    Glucose-6-phosphate dehydrogenase (G6PD) deficiency is a common X-linked inherited enzymopathic disorder affecting more than 500 million people worldwide. It has so far been linked to 217 distinct genetic variants in the exons and exon-intron boundaries of the G6PD gene, giving rise to a wide range of biochemical heterogeneity and clinical manifestations. Reports from different settings suggested the association of intronic and other mutations outside the reading frame of the G6PD gene with reduced enzyme activity and presenting clinical symptoms. The present study aimed to investigate any association of other variations apart of the exonic or exonic intronic boundaries in the development of G6PD deficiency. Sixty-seven unrelated Palestinian children admitted to the pediatric hospital with hemolytic crises due to G6PD deficiency were studied. In our Palestinian cohort of 67 [59 males (M) and 8 females (F)] G6PD-deficient children, previously hospitalized for acute hemolytic anemia due to favism, molecular sequencing of the G6PD gene revealed four cases (3M and 1F) that did not have any of the variants known to cause G6PD deficiency, but the 3' UTR c.*+357A>G (rs1050757) polymorphism in association with IVS 11 (c.1365-13T>C; rs2071429), and c.1311C>T (rs2230037). We now provide an additional evidence form Palestinian G6PD-deficient subjects for a possible role of 3' UTR c.*+357 A>G, c.1365-13T>C, and/or c.1311C>T polymorphism for G6PD deficiency, suggesting that not only a single variation in the exonic or exonic intronic boundaries, but also a haplotype of G6PD should considered as a cause for G6PD deficiency.

  1. The potential of P1 site alterations in peptidomimetic protease inhibitors as suggested by virtual screening and explored by the use of C-C-coupling reagents.

    Science.gov (United States)

    Weik, Steffen; Luksch, Torsten; Evers, Andreas; Böttcher, Jark; Sotriffer, Christoph A; Hasilik, Andrej; Löffler, Hans-Gerhard; Klebe, Gerhard; Rademann, Jörg

    2006-04-01

    A synthetic concept is presented that allows the construction of peptide isostere libraries through polymer-supported C-acylation reactions. A phosphorane linker reagent is used as a carbanion equivalent; by employing MSNT as a coupling reagent, the C-acylation can be conducted without racemization. Diastereoselective reduction was effected with L-selectride. The reagent linker allows the preparation of a norstatine library with full variation of the isosteric positions including the P1 side chain that addresses the protease S1 pocket. Therefore, the concept was employed to investigate the P1 site specificity of peptide isostere inhibitors systematically. The S1 pocket of several aspartic proteases including plasmepsin II and cathepsin D was modeled and docked with approximately 500 amino acid side chains. Inspired by this virtual screen, a P1 site mutation library was designed, synthesized, and screened against three aspartic proteases (plasmepsin II, HIV protease, and cathepsin D). The potency of norstatine inhibitors was found to depend strongly on the P1 substituent. Large, hydrophobic residues such as biphenyl, 4-bromophenyl, and 4-nitrophenyl enhanced the inhibitory activity (IC50) by up to 70-fold against plasmepsin II. In addition, P1 variation introduced significant selectivity, as up to 9-fold greater activity was found against plasmepsin II relative to human cathepsin D. The active P1 site residues did not fit into the crystal structure; however, molecular dynamics simulation suggested a possible alternative binding mode.

  2. Catalytic Upgrading of Biomass-Derived Compounds via C-C Coupling Reactions. Computational and Experimental Studies of Acetaldehyde and Furan Reactions in HZSM-5

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Cong [Argonne National Lab. (ANL), Argonne, IL (United States); Evans, Tabitha J. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cheng, Lei [Argonne National Lab. (ANL), Argonne, IL (United States); Nimlos, Mark R. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mukarakate, Calvin [National Renewable Energy Lab. (NREL), Golden, CO (United States); Robichaud, David J. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Assary, Rajeev S. [Argonne National Lab. (ANL), Argonne, IL (United States); Curtiss, Larry A. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2015-10-02

    These catalytic C–C coupling and deoxygenation reactions are essential for upgrading of biomass-derived oxygenates to fuel-range hydrocarbons. Detailed understanding of mechanistic and energetic aspects of these reactions is crucial to enabling and improving the catalytic upgrading of small oxygenates to useful chemicals and fuels. Using periodic density functional theory (DFT) calculations, we have investigated the reactions of furan and acetaldehyde in an HZSM-5 zeolite catalyst, a representative system associated with the catalytic upgrading of pyrolysis vapors. Comprehensive energy profiles were computed for self-reactions (i.e., acetaldehyde coupling and furan coupling) and cross-reactions (i.e., acetaldehyde + furan) of this representative mixture. Major products proposed from the computations are further confirmed using temperature controlled mass spectra measurements. Moreover, the computational results show that furan interacts with acetaldehyde in HZSM-5 via an alkylation mechanism, which is more favorable than the self-reactions, indicating that mixing furans with aldehydes could be a promising approach to maximize effective C–C coupling and dehydration while reducing the catalyst deactivation (e.g., coke formation) from aldehyde condensation.

  3. Direct Vinylation of Alcohols or Aldehydes Employing Alkynes as Vinyl Donors: A Ruthenium Catalyzed C-C Bond Forming Transfer Hydrogenation

    Science.gov (United States)

    Patman, Ryan L.; Chaulagain, Mani Raj; Williams, Vanessa M.; Krische, Michael J.

    2011-01-01

    Under the conditions of ruthenium catalyzed transfer hydrogenation, 2-butyne couples to benzylic and aliphatic alcohols 1a–1i to furnish allylic alcohols 2a–2i, constituting a direct C-H vinylation of alcohols employing alkynes as vinyl donors. Under related transfer hydrogenation conditions employing formic acid as terminal reductant, 2-butyne couples to aldehydes 4a, 4b, and 4e to furnish identical products of carbonyl vinylation 2a, 2b, and 2e. Thus, carbonyl vinylation is achieved from the alcohol or the aldehyde oxidation level in the absence of any stoichiometric metallic reagents. Nonsymmetric alkynes 6a–6c couple efficiently to aldehyde 4b to provide allylic alcohols 2m–2o as single regioisomers. Acetylenic aldehyde 7a engages in efficient intramolecular coupling to deliver cyclic allylic alcohol 8a. PMID:19173651

  4. Bifunctional RuII -Complex-Catalysed Tandem C-C Bond Formation: Efficient and Atom Economical Strategy for the Utilisation of Alcohols as Alkylating Agents.

    Science.gov (United States)

    Roy, Bivas Chandra; Chakrabarti, Kaushik; Shee, Sujan; Paul, Subhadeep; Kundu, Sabuj

    2016-12-12

    Catalytic activities of a series of functional bipyridine-based Ru II complexes in β-alkylation of secondary alcohols using primary alcohols were investigated. Bifunctional Ru II complex (3 a) bearing 6,6'-dihydroxy-2,2'-bipyridine (6DHBP) ligand exhibited the highest catalytic activity for this reaction. Using significantly lower catalyst loading (0.1 mol %) dehydrogenative carbon-carbon bond formation between numerous aromatic, aliphatic and heteroatom substituted alcohols were achieved with high selectivity. Notably, for the synthesis of β-alkylated secondary alcohols this protocol is a rare one-pot strategy using a metal-ligand cooperative Ru II system. Remarkably, complex 3 a demonstrated the highest reactivity compared to all the reported transition metal complexes in this reaction. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Análisis y propuesta de mejoras para la eficiencia energética del edificio principal del Instituto c.c. Eduardo Torroja-CSIC

    Directory of Open Access Journals (Sweden)

    Martín-Consuegra, F.

    2014-12-01

    Full Text Available As part of the 80th anniversary of IETcc-CSIC, a proposal for the rehabilitation of the 1953 building is made. The analysis of the main building’s energy performance concludes that it is not energy efficient. Energy efficiency improvement measures based on European directives are proposed, It is recommended to incorporate them step by step, starting with passive measures to reduce energy needs. Afterwards active measures, such as improving the performance of facilities, are proposed, so that the least possible amount of final energy is used to meet the comfort standards. To complete the operation, the use of renewable energy sources is proposed to reduce the consumption of non-renewable primary energy. Energy and building rehabilitation improvement measures in the IETcc-CSIC should be demonstrators for other public buildings with heritage values.En el marco del 80 aniversario del IETcc-CSIC se elabora una propuesta para la rehabilitación del edificio construido en 1953. Partiendo del análisis del comportamiento energético del edificio principal, se concluye que este no es eficiente energéticamente. Se proponen mejoras para la eficiencia energética del edificio tomando en cuenta las directivas europeas. Se recomienda incorporar las mejoras de forma escalonada, comenzando por las medidas pasivas para reducir sus necesidades energéticas. A continuación se proponen medidas activas, como la mejora del rendimiento de las instalaciones, de manera que se emplee la menor cantidad posible de energía final para satisfacer el confort de los usuarios. Para completar la intervención se propone el uso de fuentes de generación de energías renovables en la parcela con el objetivo de reducir el consumo de energía primaria no renovable. Las acciones para la rehabilitación energética e integral del edificio del IETcc-CSIC, deben ser demostradoras para otros edificios públicos con valores patrimoniales.

  6. C-C coupling of N-heterocycles at the fac-Re(CO)(3) fragment: synthesis of pyridylimidazole and bipyridine ligands.

    Science.gov (United States)

    Viguri, Maialen Espinal; Pérez, Julio; Riera, Lucía

    2014-05-05

    A new family of cationic rhenium tricarbonyl complexes with either two N-alkylimidazole (N-RIm) and one pyridine (Py) ligand, or two pyridine and one N-RIm ligand, [Re(CO)3 (N-RIm)(3-x) (Py)x ](+) , has been prepared. The reaction of these complexes with a strong base, followed by an oxidant, selectively afforded 2,2'-pyridylimidazole complexes as the result of intramolecular dehydrogenative CC coupling reactions. For tris(pyridine) complexes [Re(CO)3 (Py)3 ](+) the reaction pattern upon a deprotonation/oxidation sequence is maintained, which allows the generation of complexes with 2,2'-bipyridine ligands. In the particular combination of two different types of pyridine ligand in the cationic fac-Re(CO)3 complexes only the cross-coupling products with asymmetric 2,2'-bipyridine ligands were obtained; the homocoupling products were not observed. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Morphological Variation and Ecological Structure of Iroko (Milicia excelsa Welw. C.C. Berg) Populations across Different Bio geographical Zones in Benin

    International Nuclear Information System (INIS)

    Ouinsavi, C.; Sokpon, N.

    2010-01-01

    Iroko (Milicia excelsa) is a commercially important timber tree species formerly known by local people in Benin. Because of the highly attractive technological properties of its wood and its multipurpose uses, the species was subjected to intensive human pressure. Apart from strong climate oscillation during the Pleistocene, human caused habitat fragmentation through continuous land clearing for agriculture, extensive forests exploitation and urbanization induced the occurrence of many isolated forest plots and trees species among which Milicia excelsa trees. As fragmentation was proved to have deleterious effects on genetic diversity within a species and its morphological structure, it was of interest to investigate the current demographic, morphological and genetic structure of M. excelsa before coming up with conservation strategies. In the current study, morphological variation and ecological structure of M. excelsa populations were assessed in Benin using transect sampling method and multivariate analyses including principal component, cluster and canonical discriminant analyses. On the basis of morphological parameters, M. excelsa individuals and populations were clustered into four and discrimination of groups indicated that most of variations were highly related to edaphic factors and annual rainfall. Erratic diameter distribution was found for many populations although most of them showed bell shaped diameter distribution.

  8. Approach to calculation of mass spectra and two-photon decays of c c¯ mesons in the framework of Bethe-Salpeter equation

    Science.gov (United States)

    Bhatnagar, Shashank; Alemu, Lmenew

    2018-02-01

    In this work we calculate the mass spectra of charmonium for 1 P ,…,4 P states of 0++ and 1++, for 1 S ,…,5 S states of 0-+, and for 1 S ,…,4 D states of 1- along with the two-photon decay widths of the ground and first excited states of 0++ quarkonia for the process O++→γ γ in the framework of a QCD-motivated Bethe-Salpeter equation (BSE). In this 4 ×4 BSE framework, the coupled Salpeter equations are first shown to decouple for the confining part of the interaction (under the heavy-quark approximation) and are analytically solved, and later the one-gluon-exchange interaction is perturbatively incorporated, leading to mass spectral equations for various quarkonia. The analytic forms of wave functions obtained are used for the calculation of the two-photon decay widths of χc 0. Our results are in reasonable agreement with data (where available) and other models.

  9. Human bone-derived cells on C-C composites treated by grinding, a-C:H coating, laser irradiation and laser perforation

    Czech Academy of Sciences Publication Activity Database

    Bačáková, Lucie; Beránek, L.; Bačáková, Markéta; Soukup, Dalibor; Lisá, Věra; Dvořák, R.

    2008-01-01

    Roč. 11, č. 75 (2008), s. 2-6 ISSN 1429-7248 R&D Projects: GA ČR(CZ) GA101/06/0226 Institutional research plan: CEZ:AV0Z50110509 Keywords : carbon * surface modification * osteoblast adhesion Subject RIV: EI - Biotechnology ; Bionics

  10. HIV-1 Nef down-modulates C-C and C-X-C chemokine receptors via ubiquitin and ubiquitin-independent mechanism.

    Directory of Open Access Journals (Sweden)

    Prabha Chandrasekaran

    Full Text Available Human and Simian Immunodeficiency virus (HIV-1, HIV-2, and SIV encode an accessory protein, Nef, which is a pathogenesis and virulence factor. Nef is a multivalent adapter that dysregulates the trafficking of many immune cell receptors, including chemokine receptors (CKRs. Physiological endocytic itinerary of agonist occupied CXCR4 involves ubiquitinylation of the phosphorylated receptor at three critical lysine residues and dynamin-dependent trafficking through the ESCRT pathway into lysosomes for degradation. Likewise, Nef induced CXCR4 degradation was critically dependent on the three lysines in the C-terminal -SSLKILSKGK- motif. Nef directly recruits the HECT domain E3 ligases AIP4 or NEDD4 to CXCR4 in the resting state. This mechanism was confirmed by ternary interactions of Nef, CXCR4 and AIP4 or NEDD4; by reversal of Nef effect by expression of catalytically inactive AIP4-C830A mutant; and siRNA knockdown of AIP4, NEDD4 or some ESCRT-0 adapters. However, ubiquitinylation dependent lysosomal degradation was not the only mechanism by which Nef downregulated CKRs. Agonist and Nef mediated CXCR2 (and CXCR1 degradation was ubiquitinylation independent. Nef also profoundly downregulated the naturally truncated CXCR4 associated with WHIM syndrome and engineered variants of CXCR4 that resist CXCL12 induced internalization via an ubiquitinylation independent mechanism.

  11. C-C4-02: Improving Survivorship Care for Long-Term Colorectal Cancer Survivors: Key Findings of a 5-Year Study

    Science.gov (United States)

    McMullen, Carmit K; Hornbrook, Mark C; Herrinton, Lisa J; Altschuler, Andrea; Grant, Marcia; Wendel, Christopher; Coons, Stephen Joel; Green, Sylvan B; Mohler, M Jane; Baldwin, Carol M; Ramirez, Michelle; Krouse, Robert S

    2010-01-01

    Aims: Understand the determinants of health related quality of life (HRQOL) and the lived experiences among colorectal cancer (CRC) survivors, and identify strategies to help maintain or enhance CRC survivors’ HRQOL. Methods: Mail survey and focus groups. Subjects were 283 ostomy and 392 anastomosis long-term CRC survivors within an HMO. Focus groups for subjects with ostomy were divided by gender and high and low HRQOL. Outcome measures were the modified City of Hope Quality of Life (mCOH-QOL)-Ostomy (abridged for anastomosis) and SF-36v2 questionnaires. The SF-6D scoring algorithm was used to calculate an overall HRQOL score from SF-36v2 data. Focus groups were conducted to explore ostomy-related barriers to effective self-care and adaptation strategies. Results: CRC survivors with an ostomy experienced multiple persistent HRQOL losses that differ between men and women. Women CRC survivors with ostomies, for example, reported more sleep disruption and fatigue than men. Living with an ostomy, co-morbidities, socioeconomic status, self-reported depression, and employment status were independent predictors of SF-6D scores. Among CRC survivors with ostomy, fistulas had important implications for HRQOL. Psychological wellbeing among CRC survivors was positively associated with income. Intestinal stomas significantly influenced spiritual HRQOL. Provision or withdrawal of a partners’ support affected both short- and long-term psychosocial adjustment of female CRC ostomy patients. Focus group participants identified dietary changes to control bowel output and odor, demands of coping and adjustment, and the time it took to accept the reality of daily living with an ostomy as significant challenges. Conclusions: The greatest challenges reported by CRC survivors confirmed the IOMs findings that survivorship is a distinct, chronic phase of cancer care, and that cancer effects are broad and pervasive. CRC survivors could benefit from dietary and behavioral interventions even 5+ years after their cancer surgery. Women with ostomies seem to do worse than men with ostomies and report a different profile of HRQOL challenges, including sleep disruption and fatigue. Depression screening and psychosocial interventions should be part of survivorship care for CRC patients. CRC survivors should be assessed for income and financial need. Survivorship care should aim at minimizing hospitalizations, depression, and ostomy-related complications among long- term CRC survivors.

  12. Rediscovering Antiquity: Karl Weber and the Excavation of Herculaneum, Pompeii, and Stabiae, by C.C. Parslow. Cambridge University Press, 1995

    Directory of Open Access Journals (Sweden)

    James E. Snead

    1997-11-01

    Full Text Available Rediscovering Antiquity is an example of the genre of historical writing which seeks to recast the careers of little-known figures who have fallen into obscurity. This is typically intended to move them and their work into the proper "lineage," that is, the select group of ancestral figures from which modern practices are derived. Parslow is interested in the 18th century excavations of the Vesuvian cities, which, he argues, have been misunderstood by historians of archaeology. Indeed, common sources, such as Daniel (1981:55, describe the initial explorations of Pompeii, Herculaneum, and Stabiae, sponsored by the Bourbon kings of Naples as "...treasure hunts and not serious excavations." While the Roman artifacts removed from the sites are credited with spurring interest in antiquity in Enlightenment Europe, modern scholars have until now devoted little attention to the means through which they were recovered.

  13. Bipodal surface organometallic complexes with surface N-donor ligands and application to the catalytic cleavage of C-H and C-C bonds in n -Butane

    KAUST Repository

    Bendjeriou-Sedjerari, Anissa; Azzi, Joachim; Abou-Hamad, Edy; Anjum, Dalaver H.; Pasha, Fahran A.; Huang, Kuo-Wei; Emsley, Lyndon; Basset, Jean-Marie

    2013-01-01

    We present a new generation of "true vicinal" functions well-distributed on the inner surface of SBA15: [(Sî - Si-NH 2)(≡Si-OH)] (1) and [(≡Si-NH2)2] (2). From these amine-modified SBA15s, two new well-defined surface organometallic species [(≡Si-NH-)(≡Si-O-)]Zr(CH2tBu) 2 (3) and [(≡Si-NH-)2]Zr(CH2tBu) 2 (4) have been obtained by reaction with Zr(CH2tBu) 4. The surfaces were characterized with 2D multiple-quantum 1H-1H NMR and infrared spectroscopies. Energy-filtered transmission electron microscopy (EFTEM), mass balance, and elemental analysis unambiguously proved that Zr(CH2tBu)4 reacts with these vicinal amine-modified surfaces to give mainly bipodal bis(neopentyl)zirconium complexes (3) and (4), uniformly distributed in the channels of SBA15. (3) and (4) react with hydrogen to give the homologous hydrides (5) and (6). Hydrogenolysis of n-butane catalyzed by these hydrides was carried out at low temperature (100 C) and low pressure (1 atm). While (6) exhibits a bis(silylamido)zirconium bishydride, [(≡Si-NH-)2]Zr(H) 2 (6a) (60%), and a bis(silylamido)silyloxozirconium monohydride, [(≡Si-NH-)2(≡Si-O-)]ZrH (6b) (40%), (5) displays a new surface organometallic complex characterized by an 1H NMR signal at 14.46 ppm. The latter is assigned to a (silylimido)(silyloxo)zirconium monohydride, [(≡Si-Nî)(≡Si-O-)]ZrH (5b) (30%), coexistent with a (silylamido)(silyloxo)zirconium bishydride, [(≡Si-NH-)(≡Si-O-)] Zr(H)2 (5a) (45%), and a silylamidobis(silyloxo)zirconium monohydride, [(≡Si-NH-)(≡Si-O-)2]ZrH (5c) (25%). Surprisingly, nitrogen surface ligands possess catalytic properties already encountered with silicon oxide surfaces, but interestingly, catalyst (5) with chelating [N,O] shows better activity than (6) with chelating [N,N]. © 2013 American Chemical Society.

  14. New Concept of the Biosynthesis of 4-Alkyl-L-Proline Precursors of Lincomycin, Hormaomycin, and Pyrrolobenzodiazepines: Could a gamma-Glutamyltransferase Cleave the C-C Bond?

    Czech Academy of Sciences Publication Activity Database

    Jirásková, Petra; Gažák, Radek; Kameník, Zdeněk; Steiningerová, Lucie; Najmanová, Lucie; Kadlčík, Stanislav; Novotná, Jitka; Kuzma, Marek; Janata, Jiří

    2016-01-01

    Roč. 7, Mar 7 (2016), s. 276 ISSN 1664-302X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk(CZ) EE2.3.30.0003 Institutional support: RVO:61388971 Keywords : anticancer drug * antibiotics * natural product biosynthesis Subject RIV: EE - Microbiology, Virology Impact factor: 4.076, year: 2016

  15. On the electronic structure of a dianion, a radical anion, and a neutral biradical (HB)11C-C­=C-C(BH)11 carborane dimer

    Czech Academy of Sciences Publication Activity Database

    Oliva, J. M.; Serrano-Andrés, L.; Havlas, Zdeněk; Michl, Josef

    2009-01-01

    Roč. 912, 1/3 (2009), s. 13-20 ISSN 0166-1280 R&D Projects: GA AV ČR IAA400550708 Institutional research plan: CEZ:AV0Z40550506 Keywords : (Bi)radical * DFT * CASPT2 * molecular architecture * triplet Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.216, year: 2009

  16. Velocity and shear stress distribution downstream of mechanical heart valves in pulsatile flow.

    Science.gov (United States)

    Giersiepen, M; Krause, U; Knott, E; Reul, H; Rau, G

    1989-04-01

    Ten mechanical valves (TAD 27 mm): Starr-Edwards Silastic Ball, Björk-Shiley Standard, Björk-Shiley Concave-Convex, Björk-Shiley Monostrut, Hall-Kaster (Medtronic-Hall), OmniCarbon, Bicer Val, Sorin, Saint-Jude Medical and Hemex (Duromedics) are investigated in a comparative in vitro study. The velocity and turbulent shear stress profiles of the valves were determined by Laser Doppler anemometry in two different downstream axes within a model aortic root. Depending on the individual valve design, velocity peaks up to 1.5 m/s and turbulent shear stress peaks up to 150 N/m2 were measured during the systolic phase. These shear stress peaks mainly occurred in areas of flow separation and intense momentum exchange. Directly downstream of the valves (measuring axis 0.55.dAorta) turbulent shear stress peaks occurred at peak systole and during the deceleration phase, while in the second measuring axis (1.5.dAorta) turbulence levels were lower. Shear stress levels were high at the borders of the fluid jets. The results are discussed from a fluid-dynamic point of view.

  17. Identification and analysis of e{sup +}e{sup -}-pairs in C+C collisions at 1 AGeV; Identifikation und Analyse von e{sup +}e{sup -}-Paaren in C+C Stoessen bei 1 AGeV

    Energy Technology Data Exchange (ETDEWEB)

    Christ, T.

    2007-10-22

    The object of this thesis is the analysis of the data that have be recorded with HADES for the system {sup 12}C+{sup 12}C at a beam energy of E=1 AGeV. Within this work a probabilistic algorithm for efficient e{sup +}/e{sup -} identification and hadron suppression has been developed and integrated into the HADES analysis software. The method has been tested with extensive simulations and achieves an identification efficiency above 95% for momenta below p=600 MeV/c. Hadronic background in the e{sup +}/e{sup -}-sample up to p=600 MeV/c is reduced to less than 2%. For larger momenta the contamination with charged pions remains below 5%, for protons at polar angles below 44 it does not exceed 14%. After combination of the identified e{sup +}/e{sup -}-trajectories into pairs und subtraction of the combinatorial background there remains a physics signal of 47687{+-}1528 e{sup +}e{sup -}-pairs, for which distributions of invariant mass, transverse momentum and rapidity are determined. The signal-to-background ratio S/B for pair masses between 80 und 450 MeV/c{sup 2} is between 0.2 und 1. By applying further cuts upon the pair-sample the background induced by leptons from conversion processes is reduced substantially. After all cuts 11000{+-}432 e{sup +}e{sup -}-pairs remain. For M{sub e{sup +}}{sub e{sup -}} > 200 MeV/c{sup 2} S/B rises exponentially from about 2 to values of up to 10. The systematic error of the analysis for pairs with masses below 150 MeV/c{sup 2} is determined to be 17.5%, for higher masses a value of 23% is found. For transverse momentum and rapidity one finds below (above) M{sub e{sup +}}{sub e{sup -}}=150 MeV/c{sup 2} systematic errors of 17.5% (21.4%) and 15.3% (33.5%) respectively. Together with e{sup +}e{sup -} multiplicities published by HADES for the system {sup 12}C+{sup 12}C at E=2 AGeV the excitation function of the excess-multiplicity is determined from the measurement results. (orig.)

  18. Magnetism, chemical bonding and hyperfine properties in the nanoscale antiferromagnet [Fe(O Me){sub 2}(O{sub 2} C C H{sub 2} Cl)]{sub 10}

    Energy Technology Data Exchange (ETDEWEB)

    Zeng, Z.; Duan, Y.; Guenzburger, Diana [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil)

    1996-09-01

    The electronic and magnetic properties of the nanometer-size antiferromagnet (the ferric wheel molecule) are investigated with the first-principles spin-polarized Discrete Variational Method, in the framework of Density Functional theory. Magnetic moments, densities of the states and charge and spin-density maps are obtained. The Moessbauer hyperfine parameters Isomer shift, Quadrupole Splitting and Hyperfine Field are obtained from the calculations and compared to reported experimental values when available. (author). 33 refs., 8 figs., 4 tabs.

  19. El Arbitraje Internacional en el marco de la Cámara de Comercio Internacional (C.C.I “Panorama actual y principales tópicos” 10.5102/uri.v12i2.2959

    Directory of Open Access Journals (Sweden)

    Juan Manuel Rivero Godoy

    2015-01-01

    Full Text Available El artículo a continuación pretende describir en forma general la temática del arbitraje como medio de solución de controversias, el cuál muestra un significativo crecimiento en el mundo. Por otro lado, el arbitraje internacional, y en especial el aplicado a los negocios o comercio internacional plantea varias dudas. En especial al derecho aplicable al fondo del asunto. En este sentido, no siempre es seguro la aplicación de reglas entendidas como obligatorias, ejemplo de ello son los principios de la UNIDROIT o de la lex mercatoria. A su vez, se detalla la actualidad de forma estadística sobre el desarrollo del arbitraje desde los últimos años y un panorama general desde sus inicios en el marco de la Corte Internacional de Arbitraje. Además, se describirán los tópicos más importantes cuando de arbitraje se habla como lo es la ejecución de los laudos, las medidas cautelares, el derecho de fondo, etc. Finalmente, habrán de mencionarse algunos aspectos ya señalados, pero extraídos de algunos casos de la Corte y que refieren a la aplicación del derecho de fondo. Asimismo, se hará referencia a aquellas cuestiones que podrían ser importantes cuando una de las partes (Estado o particulares suscribe una cláusula arbitral; y lo que ello significa.

  20. Genetic characterization of enterovirus strains identified in Hand, Foot and Mouth Disease (HFMD): Emergence of B1c, C1 subgenotypes, E2 sublineage of CVA16, EV71 and CVA6 strains in India.

    Science.gov (United States)

    Ganorkar, Nital N; Patil, Pooja R; Tikute, Sanjay S; Gopalkrishna, Varanasi

    2017-10-01

    Hand, Foot and Mouth disease (HFMD) is a common childhood disease and caused due to Enterovirus-A (EV-A), EV-B and EV-C species worldwide. Cases of HFMD were reported from, Ahmedabad (Gujarat, 2012) and Pune (Maharashtra, 2013-2014) in India. The present study highlights the identification of EV strains (CVA16, CVA6, CVA4 and Echo12), characterization of subgenotypes of CVA16, CVA6 strains during 2012-14 and CVA16, CVA6, EV71 strains reported from the earlier study (2009-10) in HFMD cases from India. A total 158 clinical specimens collected from 64 HFMD cases (2012-2014) were included in the study. EV detection was carried out by 5'NCR based RT-PCR, molecular typing and subgenotyping was by VP1/2A junction or VP1, full VP1 gene amplification respectively followed by phylogenetic analysis. The present study reports 63.92% (101/158) EV positivity by RT-PCR. Ninety four of the 101 (93.06%) EV positive strains were amplified by VP1/2A junction or VP1 regions. Sequence analysis revealed the presence of CVA16 (61.7%), CVA6 (34.04%), CVA4 and Echo12 (4.3%). A total of 114 EV positive strains were genotyped using full and partial VP1 region. All CVA16 Indian strains (n=70) clustered with rarely reported B1c subgenotype, CVA6 (n=43) and EV71 (n=1) strains clustered with sub-lineage E2 and C1 subgenotypes respectively. In summary, the study reports genetic characterization of CVA16, CVA6, CVA4 and Echo12 strains in HFMD cases from India. Circulation of B1c subgenotype of CVA16, E2 sub-lineage of CVA6 and C1 subgenotype of EV 71 strains in HFMD cases were reported for the first time from India. This study helps to understand the genotype distribution, genetic diversity of EV strains associated with HFMD from Eastern, Western and Southern regions in India. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. Thermodynamical and structural properties of solid surfaces in the high temperature range by molecular dynamics solution: evidence for a roughening transition on the F.C.C. {110} surface

    International Nuclear Information System (INIS)

    Rosato, Vittorio

    1986-01-01

    We have studied by Molecular Dynamics simulation the thermodynamical and structural properties of the {110} solid Argon surface as a function of temperature up to T m . The following results have been obtained: 1) the Arrhenius plot indicates that for T> 0.7 T m the defect creation becomes a nearly athermal process. The measured surface diffusion coefficients are very high and are comparable with those observed in the liquid state. 2) the long range order is preserved at least up to T= 0.94 T m . The thermal disorder is related to the onset of a roughening transition on that surface at T ≅ 0.7 T m . Surface layers are not melted in the whole range of temperature we have studied. Furthermore we have investigated the influence of constraints on the surface structure for the same model system previously used at T = 0.48 T m . We have shown that both temperature and constraints induce disorder on surface: for constraints corresponding to elastic deformations of -5 pc applied along the dense axis {110}, the surface structure results to be very similar to that obtained, without constraints, at a higher temperature (T = 0.68 T m ). The implications of our bindings in several areas of Materials Science are briefly discussed. (author) [fr

  2. Synthesis and structural characterization of PHP[(C(5)Me(4))(2)], a monodentate chiral phosphine derived from intramolecular C-C coupling of tetramethylcyclopentadienyl groups: an evaluation of steric and electronic properties.

    Science.gov (United States)

    Shin, J H; Bridgewater, B M; Churchill, D G; Parkin, G

    2001-10-22

    The chiral monodentate phosphine PhP[(C(5)Me(4))(2)] is readily obtained by oxidation of the lithium complex Li(2)[PhP(C(5)Me(4))(2)] with I(2), which couples the two cyclopentadienyl groups to form a five-membered heterocyclic ring. The steric and electronic properties of PhP[(C(5)Me(4))(2)] have been evaluated by X-ray diffraction and IR spectroscopic studies on a variety of derivatives, including Ph[(C(5)Me(4))(2)]PE (E = S, Se), Cp*MCl(4)[P[(C(5)Me(4))(2)]Ph] (M = Mo, Ta), Ir[P[(C(5)Me(4))(2)]Ph](2)(CO)Cl, and CpFe(CO)[PhP[(C(5)Me(4))(2)

  3. Thermodynamic data bases and calculation code adapted to the modelling of molten core concrete interaction (M.C.C.I.) phenomena, developed jointly by Thermodata and the ''Institut de Protection et de Surete Nucleaire'' (France)

    International Nuclear Information System (INIS)

    Cenerino, G.

    1992-01-01

    An oxide data base containing the main five oxides Al 2 O 3 , CaO, SiO 2 , UO 2 and ZrO 2 of a corium obtained if the reactor core melts through the vessel and slumps into the concrete reactor cavity is developed using the GEMINI2 code. This oxide quinary system study takes into account physical realistic thermodynamical modeling of all the possible equilibrium species of the system. Two applications are presented: the determination of liquidus and solidus temperatures of some selected mixtures of the quinary system (core: UO 2 -ZrO 2 and concrete: Al 2 O 3 -CaO-SiO 2 ), a better modeling of the fission products release by vaporization from the corium. (A.B.). 5 refs., 2 figs

  4. Diseño de un sistema de coste por órdenes de producción como instrumento para el control de costos en la empresa de servicios galvanizados industriales S.C.C

    OpenAIRE

    Claudio Oña, María Belén

    2012-01-01

    La contabilidad es la base fundamental que permite un registro, análisis e interpretación de todos los movimientos dentro de una empresa, ya que de ella dependen los resultados operacionales alcanzados en cada período contable. Es primordial reconocer las clases de contabilidad que requieren las empresas previo a su funcionamiento empresarial, en caso de las empresas industriales se requiere la contabilidad de costos, la cual permite la determinación y acumulación de los costos de producci...

  5. Protección contra la oxidación de materiales compuestos SiC(C/SiC mediante la combinación de recubrimientos de silicatos de itrio y sílice

    Directory of Open Access Journals (Sweden)

    Aparicio, M.

    2001-12-01

    Full Text Available The factor which currently precludes the use of carbon fibre reinforced silicon carbide (C/SiC in high temperature structural applications is the oxidation of carbon fibres at temperatures greater than 450ºC (1. For this reason, it is necessary to develop coatings capable of protecting C/SiC components from oxidation for extended periods at 1600ºC. Conventional coatings consist of multilayers of different materials with complementary antioxidant properties. The objective of this work was to develop a multilayer coating consisted by a bonding layer of SiC, a intermediate layer of yttrium silicates: Y2Si2O7 and Y2SiO5, and an external layer of SiO2. Different techniques have been used to prepare the layers: painting with policarbosilane solutions, slip-coating and sol-gel, respectively. The behaviour against oxidation of coated composite material has been evaluated, and the samples before and after oxidation has been characterised by SEM. The cracking of SiC coating leads to a very low oxidation resistance at low temperatures. Only when the substrate is protected by the trilayer coating the reduction of the oxidation rate is considerable, and the weight loss is reduced from 50% (with a SiC coating to 15%.

    El principal inconveniente para la utilización de los materiales compuestos C/SiC en aplicaciones estructurales de alta temperatura es la elevada velocidad de oxidación de la fibra de carbono por encima de 450°C (1. Por esta razón, es necesario el desarrollo de recubrimientos capaces de proteger de la oxidación a estos materiales durante periodos prolongados a temperaturas de hasta 1600°C. Habitualmente, los recubrimientos están formados por multicapas con características antioxidantes complementarias. El objetivo de este trabajo ha sido el desarrollo de un recubrimiento multicapa formado por una capa interior de SiC, una intermedia de silicatos de itrio: Y2Si2O7 y Y2SiO5, y una exterior de SiO2. En su procesamiento se han empleado diferentes técnicas: pulverizado con soluciones de policarbosilanos, inmersión en suspensiones coloidales y técnica solgel, respectivamente. Se ha analizado la influencia sobre la resistencia a la oxidación del material, y se ha realizado un estudio microestructural por MEB previo y posterior al ensayo de oxidación. Las presencia de fisuras en la capa interior de SiC origina una resistencia a la oxidación muy reducida a baja temperatura. Solamente cuando el substrato está protegido por la triple capa la reducción de la velocidad de oxidación es considerable y la pérdida de peso se reduce del 50%, cuando el substrato está protegido por la capa de SiC, al 15% con la triple capa.

  6. THERMAL PERFORMANCE OF ROOFTOP GREENERY SYSTEM AT THE TROPICAL CLIMATE OF MALAYSIA A case study of a 10 storied building R.C.C flat rooftop at UTM, Johor Bahru, Malaysia

    Directory of Open Access Journals (Sweden)

    Rumana Rashid

    2009-07-01

    Full Text Available In tropical countries rooftop greenery is more sympathetic to the prevailing climate and provides comfortable indoor environment. This paper analyses the above hypothesis on a 10 storied residential apartments in Universiti Teknologi Malaysia (UTM. The analysis of actual performance of the rooftop greenery can provide the information on effectiveness of its application on contemporary houses for tropical climate in Malaysia. Empirical studies have been performed an internal and external roof surface, where temperature and air temperature were measured for a period of three days in two phases. The first phase of measurement was carried out when the rooftop was empty. After the rooftop greenery was built then the second phase of measurement was conducted. Expected findings of the research are that the green rooftop will tend to experience lower surface temperature than the original exposed roof surface. So this research work will provide an introduction or preliminary guide line for thermally responsive architecture on the basis of thermal performance of the rooftop greenery system. Temperature is the main criteria of human comfort. To provide an indoor comfortable environment through the greening of the rooftop of the building is more appropriate in the tropical climate of Malaysia.

  7. Page 1 "C e:::::l0•..Cl e: -" s: (,) c: c. .•..

    African Journals Online (AJOL)

    The unit once again got a new commanding officer when Lt D. Mills was promoted to captain on 29 October 1952. On 9 March 1953 tragedy struck the Squa- dron when two Harvards collided in mid-air over Blaauwberg. 2 Lt M. Crous and 2 Lt P. Theron were killed instantly when their air- craft was struck by a Harvard piloted ...

  8. Crystal structure of poly[N,N-diethyl-2-hy-droxy-ethan-1-aminium [μ3-cyanido-κ(3) C:C:N-di-μ-cyanido-κ(4) C:N-dicuprate(I)

    Science.gov (United States)

    Corfield, Peter W R; Cleary, Emma; Michalski, Joseph F

    2016-07-01

    In the title compound, {(C6H16NO)[Cu2(CN)3]} n , the cyanide groups link the Cu(I) atoms into an open three-dimensional anionic network, with the mol-ecular formula Cu2(CN)3 (-). One Cu(I) atom is tetra-hedrally bound to four CN groups, and the other Cu(I) atom is bonded to three CN groups in an approximate trigonal-planar coordination. The tetra-hedrally coordinated Cu(I) atoms are linked into centrosymmetric dimers by the C atoms of two end-on bridging CN groups which bring the Cu(I) atoms into close contact at 2.5171 (7) Å. Two of the cyanide groups bonded to the Cu(I) atoms with trigonal-planar surrounding link the dimeric units into columns along the a axis, and the third links the columns together to form the network. The N,N-di-ethyl-ethano-lamine mol-ecules used in the synthesis have become protonated at the N atoms and are situated in cavities in the network, providing charge neutrality, with no covalent inter-actions between the cations and the anionic network.

  9. Crystal structure of poly[N,N-diethyl-2-hydroxyethan-1-aminium [μ3-cyanido-κ3C:C:N-di-μ-cyanido-κ4C:N-dicuprate(I

    Directory of Open Access Journals (Sweden)

    Peter W. R. Corfield

    2016-07-01

    Full Text Available In the title compound, {(C6H16NO[Cu2(CN3]}n, the cyanide groups link the CuI atoms into an open three-dimensional anionic network, with the molecular formula Cu2(CN3−. One CuI atom is tetrahedrally bound to four CN groups, and the other CuI atom is bonded to three CN groups in an approximate trigonal-planar coordination. The tetrahedrally coordinated CuI atoms are linked into centrosymmetric dimers by the C atoms of two end-on bridging CN groups which bring the CuI atoms into close contact at 2.5171 (7 Å. Two of the cyanide groups bonded to the CuI atoms with trigonal-planar surrounding link the dimeric units into columns along the a axis, and the third links the columns together to form the network. The N,N-diethylethanolamine molecules used in the synthesis have become protonated at the N atoms and are situated in cavities in the network, providing charge neutrality, with no covalent interactions between the cations and the anionic network.

  10. Coral growth rings and the temporal history of nuclear 14C/C and 90Sr/Sr in the surface ocean: Final report, June 1, 1982-December 31, 1984

    International Nuclear Information System (INIS)

    Broecker, W.S.; Cember, R.P.; Toggweiler, J.R.; Trumbore, S.E.; White, J.

    1987-08-01

    This report summarizes the history and scientific results of the Lamont-Doherty Geological Observatory coral radioisotope project. The report includes abstracts of works in the literature or in preparation resulting from the coral project and a complete listing of the radiocarbon and 90 Sr data measured in the course of the project. Also, some possible future research directions for the coral project are suggested

  11. A two-state computational investigation of methane C--H and ethane C--C oxidative addition to [CpM(PH3)]n+ (M = Co, Rh, Ir; n = 0, 1).

    Science.gov (United States)

    Petit, Alban; Richard, Philippe; Cacelli, Ivo; Poli, Rinaldo

    2006-01-11

    Reductive elimination of methane from methyl hydride half-sandwich phosphane complexes of the Group 9 metals has been investigated by DFT calculations on the model system [CpM(PH(3))(CH(3))(H)] (M = Co, Rh, Ir). For each metal, the unsaturated product has a triplet ground state; thus, spin crossover occurs during the reaction. All relevant stationary points on the two potential energy surfaces (PES) and the minimum energy crossing point (MECP) were optimized. Spin crossover occurs very near the sigma-CH(4) complex local minimum for the Co system, whereas the heavier Rh and Ir systems remain in the singlet state until the CH(4) molecule is almost completely expelled from the metal coordination sphere. No local sigma-CH(4) minimum was found for the Ir system. The energetic profiles agree with the nonexistence of the Co(III) methyl hydride complex and with the greater thermal stability of the Ir complex relative to the Rh complex. Reductive elimination of methane from the related oxidized complexes [CpM(PH(3))(CH(3))(H)](+) (M = Rh, Ir) proceeds entirely on the spin doublet PES, because the 15-electron [CpM(PH(3))](+) products have a doublet ground state. This process is thermodynamically favored by about 25 kcal mol(-1) relative to the corresponding neutral system. It is essentially barrierless for the Rh system and has a relatively small barrier (ca. 7.5 kcal mol(-1)) for the Ir system. In both cases, the reaction involves a sigma-CH(4) intermediate. Reductive elimination of ethane from [CpM(PH(3))(CH(3))(2)](+) (M = Rh, Ir) shows a similar thermodynamic profile, but is kinetically quite different from methane elimination from [CpM(PH(3))(CH(3))(H)](+): the reductive elimination barrier is much greater and does not involve a sigma-complex intermediate. The large difference in the calculated activation barriers (ca. 12.0 and ca. 30.5 kcal mol(-1) for the Rh and Ir systems, respectively) agrees with the experimental observation, for related systems, of oxidatively induced ethane elimination when M = Rh, whereas the related Ir systems prefer to decompose by alternative pathways.

  12. Early beneficial effect of preservation of papillo-annular continuity in mitral valve replacement on left ventricular function.

    Science.gov (United States)

    Dilip, D; Chandra, A; Rajashekhar, D; Padmanabhan, M

    2001-05-01

    Impairment of left ventricular (LV) function after mitral valve replacement (MVR) has been the most important factor to determine morbidity and mortality. With this in mind, LV performance in the postoperative period was assessed with and without preservation of papillo-annular continuity in MVR. Between March 1994 and August 1998, a total of 383 valve prostheses (202 MVR, 65 AVR, 58 MVR+AVR) were implanted in 325 patients, 177 of whom underwent MVR with Starr Edwards ball cage prostheses (the study group). Of these 177 patients, 105 had MVR with preservation of the posterior mitral leaflet (group I), and 72 had conventional MVR (group II). Predominant lesions were mitral stenosis in 81, mitral regurgitation in 42, and mixed mitral lesion (MS/MR) in 54. Concomitant tricuspid valve annuloplasty was performed in 13, and atrial septal defect repair in five. Sixteen patients underwent MVR for mitral restenosis. In-vivo performance of the prostheses and LV function was evaluated by M-mode and Doppler echocardiography. At 3-6 months clinical improvement was seen in NYHA class, with reduction in cardiothoracic ratio among patients with preserved papillo-annular continuity, irrespective of lesion type. Significant reductions (p versus 44.64 +/- 8.54 postop.; p versus 41.21 +/- 7.16 postop.; p versus 28.81 +/- 5.79 postop.; p versus 64.47 +/- 7.93; p <0.05). Further analysis of data in group I patients showed significant reductions in left atrial dimensions, LVESD and peak gradient, along with improved ejection fraction compared with conventional (group II) patients. Deterioration in LV function in patients undergoing conventional MVR indicates chordal resection as a putative mechanism. This study supports the concept that maintenance of continuity between the mitral annulus and papillary muscles has a beneficial effect on postoperative LV function, and is particularly important in patients with mitral stenosis with depressed preoperative LV systolic function.

  13. Droplet Size and Liquid Water Characteristics of the USAAEFA (CH-47) Helicopter Spray System and Natural Clouds as Sampled by a JUH-1H Helicopter.

    Science.gov (United States)

    1980-08-01

    o080Atalea Cal lolna 9" C’ lelephone 121 3) 79, .I 9" lee f6 5A2i A S.,&,osa’fr o MC CALIBRAT ION REPORT Date: 1/8/80 Instrument: ASSP-l 00-1 Size Size...c% c l a a 0 -1 a*’ ac e a***cca *a c a am a*ca c acca =aac ca~ac caaa U𔃺 C C C C0 C C C C C C C C Q C C C C C C C> C C C C C C C CD C C C C CD 0 a C...C C atI 0 l C 0 .C C 0 0 QC 0 0 0 c CD C c 0 C C 0 Q 0 CIC C C0 C 0 C C> C go 1 C 0j C C C QC 0 QQO0COQC=C0c 00CC =1C Q0c cC aCCa CSQ --- -V -, -7

  14. National Dam Safety Program. Lake Wanda Dam (NJ00510), Hudson River Basin, Tributary to Wawayanda Creek, Sussex County, New Jersey. Phase 1 Inspection Report.

    Science.gov (United States)

    1980-03-01

    8217 7rA’Al’A𔄀 /O’ 3 4 5 $-eS 7W# 55 Af1--7;72 6 10 12 - . . . . . ... . . . . . .’ . . .. 13 l 14 15 £ F6 3I f’f . 16 A6 18 19 200 _.._. . . . .. . . . 21’ 22...191, ~ C! . .. .. C.C C C L. C . C W .C . . . .C .C . . . .C .C . . . . .C . C . C C. . C . C 4 4 . . . a CC aa acca a aa aa C C

  15. Wave refraction patterns and their role in sediment redistribution along South Konkan, Maharashtra, India

    Digital Repository Service at National Institute of Oceanography (India)

    Gujar, A.R.; Angusamy, N.; Rajamanickam, G.V.

    1 D C D C C C CDC D D D C C C D D D C C 1 6 C D C D D C D C SW 8 10 12 C C C D D D C C C D D D D C D C D C D D D C C C 6 C D C D D C D C wsw 8 10 D D D D C C D C D C C D D D C C 12 C C D D D C D C D - wave divergence C - wave...

  16. Nucleophilic addition to olefins. 5. Reaction of 1,1-dinitro-2,2-diphenylethylene with water and hydroxide ion in 50% Me2SO-50% water. Complete kinetic analysis of hydrolytic cleavage of the C=C double bond in acidic and basic solution

    International Nuclear Information System (INIS)

    Bernasconi, C.F.; Carre, D.J.; Kanavarioti, A.

    1981-01-01

    Hydrolysis of 1,1-dinitro-2,2-diphenylethylene (2) to form benzophenone and dinitromethane (or its anion) was studied in 50% Me 2 SO-50% H 2 O and also in 50% Me 2 SO-50% D 2 O at pHs of 1 to 16. Solvent isotope effects general acid and general base catalysis, and structure-reactivity relationships were used to study the kinetics. The conclusions are the following: (1) the equilibrium constants for OH - and water addition to 2 to form T/sub OH/ - are comparable to those for the corresponding reactions of benzylidene Meldrum's acid (1), but the rate constants are much lower for 2 than for 1; (2) carbon protonation of T/sub OH/ - follows an Eigen curve similar to that for 1,1-dinitroethane anion but which is displaced upward by nearly 1 log unit. This indicates a higher intrinsic protonation rate because of a smaller charge delocalization in T/sub OH/ - owing to an enhanced steric hindrance to coplanarity of the nitro groups in T/sub OH/ - ; (3) intramolecular proton transfer from the OH group to the carbanionic site in T/sub OH/ - is insignificant, which is in contrast to the behavior of the addition complex between 2 and morpholine; (4) the base-catalyzed breakdown of T/sub OH/ 0 into benzophenone and dinitromethane anion occurs by rate-limiting oxygen deprotonation, which implies that k 4 for CH(NO 2 ) 2 - departure from T/sub OH/ 0- is much greater than 2 x 10 9 s -1 , a remarkably high rate for a carbanionic leaving group. The water-catalyzed breakdown of T/sub OH/ 0 proceeds by a different mechanism, which is most likely concerted, with a transition state; (5) the acid-catalyzed breakdown of T/sub OH/ 2- occurs by rate-limiting carbon protonation (k 6 /sup BH/), but the water-catalyzed breakdown follows a different mechanism. Various possibilities are discussed, and a slight preference is given to a preassociation mechanism

  17. Puesta al día de la colaboración científico-técnica española del I.E.T.C.C. con Iberoamérica en el campo del cemento y del hormigón

    Directory of Open Access Journals (Sweden)

    Calleja, José

    1981-03-01

    Full Text Available Not available

    Se trata de actualizar la exposición de la labor llevada a cabo durante los años 1978 a 1980 por el autor de este trabajo en Brasil y en Argentina, a invitación personal de entidades oficiales de ambos países relacionadas con los campos de la docencia, de la ingeniería, dela construcción y de sus materiales. Labor consistente en el desarrollo de cursos, conferencias, coloquios y mesas redondas sobre temas relativos a la tecnología y a la durabilidad del cemento y del hormigón, y al empleo racional de los cementos en los diferentes tipos de obras, como solución a los problemas que el hormigón puede presentar en ellas. Dicha labor se presenta en forma resumida, sin perjuicio de que una buena parte de ella se ofrezca desarrollada in extenso en otras publicaciones técnicas.

  18. (Carbonyl-1κC)bis-[2,3(η)-cyclo-penta-dien-yl][μ(3)-(S-methyl trithio-carbonato)methylidyne-1:2:3κC,S'':C:C](triphenyl-phosphine-1κP)(μ(3)-sulfido-1:2:3κS)dicobalt(II)iron(II) trifluoro-methane-sulfonate.

    Science.gov (United States)

    Manning, Anthony R; McAdam, C John; Palmer, Anthony J; Simpson, Jim

    2008-04-10

    The asymmetric unit of the title compound, [FeCo(2)(C(5)H(5))(2)(C(3)H(3)S(3))S(C(18)H(15)P)(CO)]CF(3)SO(3), consists of a triangular irondicobalt cluster cation and a trifluoro-methane-sulfonate anion. In the cation, the FeCo(2) triangle is symmetrically capped on one face by an S atom and on the other by a C atom linked to a methyl trithio-carbonate residue that bridges the Fe-C bond. Each Co atom carries a cyclo-penta-dienyl ligand while the Fe atom coordinates to one carbonyl and one triphenyl-phosphine ligand. In the crystal structure, the cation is linked to the anion by a number of weak non-classical C-H⋯O and C-H⋯F hydrogen bonds and weak S⋯O (3.317 Å) and S⋯F (3.198 Å) inter-actions. The structure is further stabilized by additional inter-molecular C-H⋯O, C-H⋯F and O⋯O (2.942 Å) contacts, together with an unusual S⋯π(Cp) inter-action (S⋯centroid distance = 3.385 Å), generating an extended network.

  19. Degradation of mangrove tissues by arboreal termites (Nasutitermes acajutlae) and their role in the mangrove C cycle (Puerto Rico): Chemical characterization and organic matter provenance using bulk δ13C, C/N, alkaline CuO oxidation-GC/MS, and solid-state 13C NMR

    Science.gov (United States)

    Vane, Christopher H.; Kim, Alexander W.; Moss-Hayes, Vicky; Snape, Colin E.; Diaz, Miguel Castro; Khan, Nicole S.; Engelhart, Simon E.; Horton, Benjamin P.

    2013-08-01

    Arboreal termites are wood decaying organisms that play an important role in the first stages of C cycling in mangrove systems. The chemical composition of Rhizophora mangle, Avicennia germinans, and Laguncularia racemosa leaf, stem, and pneumatophore tissues as well as associated sediments was compared to that of nests of the termite Nasutitermes acajutlae. Nests gave δ13C values of -26.1 to -27.2‰ (±0.1) and C/N of 43.3 (±2.0) to 98.6 (±16.2) which were similar to all stem and pneumatophores but distinct from mangrove leaves or sediments. Organic matter processed by termites yielded lignin phenol concentrations (Λ, lambda) that were 2-4 times higher than stem or pneumatophores and 10-20 times higher than that of leaves or sediments, suggesting that the nests were more resistant to biodegradation than the mangrove vegetation source. 13C NMR revealed that polysaccharide content of mangrove tissues (50-69% C) was higher than that of the nests (46-51% C). Conversely, lignin accounted for 16.2-19.6% C of nest material, a threefold increase relative to living mangrove tissues; a similar increase in aromatic methoxyl content was also observed in the nests. Lipids (aliphatic and paraffinic moieties) were also important but rather variable chemical components of all three mangrove species, representing between 13.5 and 28.3% of the C content. Termite nests contained 3.14 Mg C ha-1 which represents approximately 2% of above ground C storage in mangroves, a value that is likely to increase upon burial due to their refractory chemical composition.

  20. C-C bond formation and related reactions at the CNC backbone in (smif)FeX (smif = 1,3-di-(2-pyridyl)-2-azaallyl): dimerizations, 3 + 2 cyclization, and nucleophilic attack; transfer hydrogenations and alkyne trimerization (X = N(TMS)2, dpma = (di-(2-pyridyl-methyl)-amide)).

    Science.gov (United States)

    Frazier, Brenda A; Williams, Valerie A; Wolczanski, Peter T; Bart, Suzanne C; Meyer, Karsten; Cundari, Thomas R; Lobkovsky, Emil B

    2013-03-18

    Molecular orbital analysis depicts the CNC(nb) backbone of the smif (1,3-di-(2-pyridyl)-2-azaallyl) ligand as having singlet diradical and/or ionic character where electrophilic or nucleophilic attack is plausible. Reversible dimerization of (smif)Fe{N(SiMe3)2} (1) to [{(Me3Si)2N}Fe]2(μ-κ(3),κ(3)-N,py2-smif,smif) (2) may be construed as diradical coupling. A proton transfer within the backbone-methylated, and o-pyridine-methylated smif of putative ((b)Me2(o)Me2smif)FeN(SiMe3)2 (8) provides a route to [{(Me3Si)2N}Fe]2(μ-κ(4),κ(4)-N,py2,C-((b)Me,(b)CH2,(o)Me2(smif)H))2 (9). A 3 + 2 cyclization of ditolyl-acetylene occurs with 1, leading to the dimer [{2,5-di(pyridin-2-yl)-3,4-di-(p-tolyl-2,5-dihydropyrrol-1-ide)}FeN(SiMe3)2]2 (11), and the collateral discovery of alkyne cyclotrimerization led to a brief study that identified Fe(N(SiMe3)2(THF) as an effective catalyst. Nucleophilic attack by (smif)2Fe (13) on (t)BuNCO and (2,6-(i)Pr2C6H3)NCO afforded (RNHCO-smif)2Fe (14a, R = (t)Bu; 14b, 2,6-(i)PrC6H3). Calculations suggested that (dpma)2Fe (15) would favorably lose dihydrogen to afford (smif)2Fe (13). H2-transfer to alkynes, olefins, imines, PhN═NPh, and ketones was explored, but only stoichiometric reactions were affected. Some physical properties of the compounds were examined, and X-ray structural studies on several dinuclear species were conducted.

  1. Evaluation of uterine cervix cancer hypoxia by PET with {sup 18}F-F.E.T.N.I.M.. Relation with squamous cell carcinoma (S.C.C.) and osteopontin tumoral markers; Evaluation de l'hypoxie du cancer du col uterin par la TEP au {sup 18}F-FETNIM. Relation avec les marqueurs tumoraux SCC et osteopontine

    Energy Technology Data Exchange (ETDEWEB)

    Barre, E.; Schlageter, M.H.; Groheux, D.; Vercellino, L.; Lussato, D.; Thoury, A.; Hennequin, V.; Hindie, E.; Barranger, E.; Moretti, J.L. [CHU Saint-Louis-Lariboisiere, universite Paris-7, IMDCT, 75 - Paris (France)

    2010-07-01

    Purpose: to evaluate the imaging feasibility of hypoxia of cervical squamous cell carcinoma by PET with {sup 18}F-F.E.T.N.I.M. (Iason). to compare the {sup 18}F-F.E.T.N.I.M. uptake to the metabolic uptake in {sup 18}F-F.D.G. and to study their relationship with the squamous cell carcinoma, tumoral marker and osteoponin, circulating tracer of hypoxia. Conclusions: the F.E.T.N.I.M. uptake by the tumor is always of lower level than the {sup 18}F-F.D.G. uptake. By using the ratio Tumor/Muscle, these preliminary results do not enlighten any correlation between the circulating hypoxia tracer and the tumor uptake of {sup 18}F-F.E.T.N.I.M.. (N.C.)

  2. Acoustic and Perceptual-Cognitive Factors in the Identification of 41 Environmental Sounds

    Science.gov (United States)

    1989-10-20

    buoy 1912 2.81 I 9. Foghorn 2135 2.24 10. Water bubbling 2325 2.75 11. Bugle charge 2356 2.19 12. Rifle shot indoors 2371 2.97 13. Lawn mower 2596 3.65...1.2374 -1.4659 13. Lawn mower -0.2245 0.5973 0.1640 14. Church bell 0.9158 0.0325 -1.4782 15. Oar rowing 0.7036 -1.3898 -0.2945 16. Door knock 0.4689...600 Time (ms) I Lawn mower DBV RMS 30 + 20 +I * * 10 + * 0 + -10 0 0 0 0 0 00 0 0000 0 00 0 C C C C C C C C C C C C C C C C C F F F F F F F F F F F F F

  3. Beach Nourishment Techniques. Report 4. Wave Climates for Selected U.S. Offshore Beach Nourishment Projects. Appendixes A-K.

    Science.gov (United States)

    1981-04-01

    05Li - 7o C, C. o i > 8d0 C 0 0 r C’ C i ’ 0 0 0 0 C0 C’ C, SUCO C CC’ CO C’ ’ C ccU 0 0 C) C 0 C’C C’ C’ C’ C C 0)0 0~~~ 00 ’ C C CC C C N_ ( C1 C

  4. Factores de riesgo/protección y prevalencias del consumo de sustancias psicoactivas en adolescentes de enseñanza media del “ I n s t i t u t o N a c i o n a l d e O c c i d e n t e ” L e ó n , J u n i o - m a y o

    OpenAIRE

    Flores Dolmus, Lenin A.; Medina Sandino, Claudia

    2014-01-01

    La investigación se centró en determinar edad de inicio, factores de riesgo/protección, prevalencia e incidencia del consumo de sustancias psicoactivas lícitas e ilícitas. Se utilizó la metodología de la CICAD-OEA-SIDUC (sistema de vigilancia contra las drogas en el hemisferio) empleada en estudios nacionales, de Latinoamérica y el Caribe. La presente tesis contiene un enfoque clínico epidemiológico en la salud pública basada en un estudio descriptivo de corte transversal con una población co...

  5. (Carbonyl-1κC)bis­[2,3(η5)-cyclo­penta­dien­yl][μ3-(S-methyl trithio­carbonato)methylidyne-1:2:3κ4 C,S′′:C:C](triphenyl­phosphine-1κP)(μ3-sulfido-1:2:3κ3 S)dicobalt(II)iron(II) trifluoro­methane­sulfonate

    Science.gov (United States)

    Manning, Anthony R.; McAdam, C. John; Palmer, Anthony J.; Simpson, Jim

    2008-01-01

    The asymmetric unit of the title compound, [FeCo2(C5H5)2(C3H3S3)S(C18H15P)(CO)]CF3SO3, consists of a triangular irondicobalt cluster cation and a trifluoro­methane­sulfonate anion. In the cation, the FeCo2 triangle is symmetrically capped on one face by an S atom and on the other by a C atom linked to a methyl trithio­carbonate residue that bridges the Fe—C bond. Each Co atom carries a cyclo­penta­dienyl ligand while the Fe atom coordinates to one carbonyl and one triphenyl­phosphine ligand. In the crystal structure, the cation is linked to the anion by a number of weak non-classical C—H⋯O and C—H⋯F hydrogen bonds and weak S⋯O (3.317 Å) and S⋯F (3.198 Å) inter­actions. The structure is further stabilized by additional inter­molecular C—H⋯O, C—H⋯F and O⋯O (2.942 Å) contacts, together with an unusual S⋯π(Cp) inter­action (S⋯centroid distance = 3.385 Å), generating an extended network. PMID:21202187

  6. History of Command and Control at KSC: Kennedy Engineering Academy Series

    Science.gov (United States)

    Hurt, George Richard

    2007-01-01

    Agenda for this presentation is: Evolution of Command and Control (C&C), C&C history, Launch Processing System overview, Core System Overview, Checkout & Launch Control System, Overview and Commercial-Off-The-Shelf guidelines

  7. Dental Porcelain Furnaces: Test and Evaluation.

    Science.gov (United States)

    1988-01-01

    D Q)L a ) a) C ) C C C C c *. . 3a)0. >4 a)->4 >4 -, Z 0 -a-’- 4-% a) ( nca )m m nU Cs C ) (3 ) 11) a) a) a3) Q) a) W) a2) C C~~ >4 L > > >1 >1 4 > 4...Fig. 1) is a computerized programmable porcelain furnace with 45 open programs. This unit has a large detachable cathode -ray tube (CRT) screen which

  8. An Aerobic Digestion of Lime Sludge.

    Science.gov (United States)

    1982-07-01

    removal. 1,2 After lime addition, phosphorus is considered to be in the form of calcium hydroxyapatite (Ca5-(OH)(P04 )3 ), which will not resolubilize...U: c a e - ~ -’ tr *cr. V. (r. C . -~~~ C c C C&c cj Ir u -. C Fy. - U C C - C F.~-cc 0.c gC - - gg MFC - - C -66 TABLE 20. SUMMARY OF LEAST

  9. Application of comparative vibrational spectroscopic and mechanistic studies in analysis of fisetin structure.

    Science.gov (United States)

    Dimitrić Marković, Jasmina M; Marković, Zoran S; Milenković, Dejan; Jeremić, Svetlana

    2011-12-01

    This paper addresses experimental and theoretical research in fisetin (2-(3,4-dihydroxyphenyl)-3,7-dihydroxychromen-4-one) structure by means of experimental IR and Raman spectroscopies and mechanistic calculations. Density Functional Theory calculations, with M05-2X functional and the 6-311+G (2df, p) basis set implemented in the Gaussian 09 package, are performed with the aim to support molecular structure, vibrational bands' positions and their intensities. Potential energy distribution (PED) values and the description of the largest vibrational contributions to the normal modes are calculated. The most intense bands appear in the 1650-1500 cm(-1) wavenumber region. This region involves a combination of the CO, C2C3 and C-C stretching vibrational modes. Most of the bands in the 1500-1000 cm(-1) range involve C-C stretching, O-C stretching and in-plane C-C-H, C-O-H, C-C-O and C-C-C bending vibrations of the rings. The region below 1000 cm(-1) is characteristic to the combination of in plane C-C-C-H, H-C-C-H, C-C-C-C, C-C-O-C and out of plane O-C-C-C, C-C-O-C, C-C-C-C torsional modes. The Raman spectra of baicalein and quercetin were used for qualitative comparison with fisetin spectrum and verification of band assignments. The applied detailed vibrational spectral analysis and the assignments of the bands, proposed on the basis of fundamentals, reproduced the experimental results with high degree of accuracy. Copyright © 2011 Elsevier B.V. All rights reserved.

  10. Application of comparative vibrational spectroscopic and mechanistic studies in analysis of fisetin structure

    Science.gov (United States)

    Dimitrić Marković, Jasmina M.; Marković, Zoran S.; Milenković, Dejan; Jeremić, Svetlana

    2011-12-01

    This paper addresses experimental and theoretical research in fisetin (2-(3,4-dihydroxyphenyl)-3,7-dihydroxychromen-4-one) structure by means of experimental IR and Raman spectroscopies and mechanistic calculations. Density Functional Theory calculations, with M05-2X functional and the 6-311+G (2df, p) basis set implemented in the Gaussian 09 package, are performed with the aim to support molecular structure, vibrational bands' positions and their intensities. Potential energy distribution (PED) values and the description of the largest vibrational contributions to the normal modes are calculated. The most intense bands appear in the 1650-1500 cm -1 wavenumber region. This region involves a combination of the C dbnd O, C2 dbnd C3 and C-C stretching vibrational modes. Most of the bands in the 1500-1000 cm -1 range involve C-C stretching, O-C stretching and in-plane C-C-H, C-O-H, C-C-O and C-C-C bending vibrations of the rings. The region below 1000 cm -1 is characteristic to the combination of in plane C-C-C-H, H-C-C-H, C-C-C-C, C-C-O-C and out of plane O-C-C-C, C-C-O-C, C-C-C-C torsional modes. The Raman spectra of baicalein and quercetin were used for qualitative comparison with fisetin spectrum and verification of band assignments. The applied detailed vibrational spectral analysis and the assignments of the bands, proposed on the basis of fundamentals, reproduced the experimental results with high degree of accuracy.

  11. Microbial removal of weathered hydrocarbons by well adapted ...

    African Journals Online (AJOL)

    ELSA

    2013-02-27

    Feb 27, 2013 ... It is well known that light oil fractions are the first to evaporate so .... flame ionization detector (GC-FID), where 1 µl was injected into an. Agilent 6850 ... in the signal. ..... 1), weak symmetric stretch C=C-C=C (1640 cm-1), C=C.

  12. The Dorstenia species (Moraceae) of north-western tropical America

    NARCIS (Netherlands)

    Berg, C.C.; Leeuwen, van R.W.J.

    1982-01-01

    Four new species of Dorstenia are described: D. panamensis C.C. Berg, D. boliviana C.C. Berg, D. peruviana C.C. Berg, and D. belizensis C.C. Berg. A list of and a key to the 21 Dorstenia species distinguished in north-western tropical America are presented, together with synonyms and distributions.

  13. Studies on the flora of the Guianas 20. The Dorstenia species (Moraceae) of south-eastern tropical America

    NARCIS (Netherlands)

    Berg, C.C.

    1983-01-01

    One new species of Dorstenia from Brazil is described: D. carautae C.C. Berg, and four new combinations are made: D. cayapia Vellozo subsp. asaroides (Hooker) C.C. Berg, D. cayapia Vellozo subsp. paraguariensis (Hassler) C.C. Berg, D. cayapia Vellozo subsp. vitifolia (Gardner) C.C. Berg, and D.

  14. Design of Robust Controllers for a Multiple Input-Multiple Output Control System with Uncertain Parameters Application to the Lateral and Longitudinal Modes of the KC-135 Transport Aircraft

    Science.gov (United States)

    1984-12-01

    input/output relationship. These are obtained from the design specifications (10:68i-684). Note that the first digit of the subscript of bkj refers...to the output and the second digit to the input. Thus, bkj is.a function of the response requirements on the output, Yk’ due to the input, r.. 169 . A...NXPMAX pNYPMAX, IPLOT) C C C* LIBARY OF PLOT SUBR(OUTINES PSNTCT NLIEPRINTER ONLY~ C* C C C SUP’ LPLOTS C C C DIMENSION IXY(101,71)918UF(100) COMMON /HOPY

  15. (4S)-4-(3,4-Dichloro?phen?yl)-1?-methyl-4?-phenyl-3,4-dihydronaphthalene-2-spiro-3?-pyrrolidine-2?-spiro-1??-acenaphthyl?ene-1,2??(2H,1??H)-dione

    OpenAIRE

    Murugan, R.; Gunasekaran, B.; Narayanan, S. Sriman; Manivannan, V.

    2008-01-01

    In the title compound, C37H27Cl2NO2, the 3,4-dichloro?phenyl ring makes a dihedral angle of 46.66?(6)? with the phenyl ring. The mol?ecular structure is stabilized by weak intra?molecular C?H?O inter?actions and the crystal structure is stabilized by weak inter?molecular C?H?O inter?actions. The C?C?C?C?C five-membered ring is planar, while the C?C?C?C?N five-membered ring adopts a half-chair conformation.

  16. Supplementary material to: Cartesian Coordinates The LANL2DZ ...

    African Journals Online (AJOL)

    NJD

    1 2 1 2 1 2 1 1 1 1 1 1. C C_3. 0 3.000437 2.919753 1.793455 L. C C_3. 0 1.516224 3.298370 1.622555 L. C C_3. 0 0.813077 1.914794 1.570235 L H H_ 5. 0.0000. C C_3. 0 2.949870 1.366115 1.849651 L. C C_3. 0 1.156069 1.236826 0.202447 M. C C_3. 0 2.671674 0.895098 0.381006 L H H_ 5. 0.0000. C C_3.

  17. Development of a Model of Soldier Effectiveness: Retranslation Materials and Results

    Science.gov (United States)

    1987-05-01

    CD3 C CCC CCa MC C CC C C *~~ ~ dCoN 0C CCC do C C 42 CD 4C C c D Cn N =a CD C2 P2 C 0 m CD C Ca Ca c C C on en C C C Ul Ci C2 C C C2 C W) Cu. Cn CC...J.Q 0 0 ZO3 I M0 0*Qo00c a ’ Acca .Oe0~z 00000300 aC4 C00 01 130 0000 003. a’ 00 1 1 0.0 033’.303U0Ga0O OQQ3 00 .0030c..: -A30 3..03jcoo A 6.0.G.C

  18. Environmental Variability of the Jordan Basin, Gulf of Maine, August 1982, NRL (Naval Research Laboratory) Cruise 712-82.

    Science.gov (United States)

    1983-11-01

    aa oO-N oiO ni-ofl4-0no fln0 4In0nr14-4In -a. ILrn 40... M 4 *10 -4 0 0 N M N n M M flJ ~~~ I-0 . .- I 0 D 0-C N n Nd V M’ 0- M N 0- 0 M 0 a. - Nd 0 V...m N t Cu t d ( Cd C, d Cd md Cd NdCd Cd Cd Cd rd Cd Cd td CV cv cv rd CV Cd cd Od Nd Cd C9 Ld CU d NNNNNN~NNN-r’N" 44444444444444444444444...00000 Cii ---- V U ~fllC iiirnc fftw ----------- ----------------- J a V VVVC VVVr~crt i~~ td C C C C C C . ~ ~ ~ C ~ C C .V .VC VC .VC .V V VC C C

  19. Design of Mobile Photovoltaic Power Systems: 0.5-3 kW

    Science.gov (United States)

    1981-10-01

    o o . . .tI "• I’, X I6%, 6% S=’ -% 6% 0 6% -. 6% •60% 60%060 60%, .•v P2 o o• . 6%• 0% 6 0 6% 6%*• • •o 04 0 6% 0 % 6%6. Ix •, 6% 0 ,.6-. -*Z*w...C C C C’ Cc v C a a. e c. (1 -1. a, a C C c c. c 0 c. C’ @. C. C ara . a C CCEa C, 0 C ’ a c a, a. a c * . a a a. co C. a. 0: a. a. 1. 9. a a aCCa

  20. A Theoretical and Experimental Investigation of Transonic Flow in the Throat Region of Annular Axisymmetric, Supersonic Nozzles.

    Science.gov (United States)

    1980-01-01

    B36 014 =88BI1 + 48202 + (4y-2)B B2 (B-37) 2 D =4B2B + 4BD + (4y-2)BoB2 (B-38) 15 1 2 002 (y2) 0 1 n0 y3 +( 1- 13 Yy 17 4 130o 215 4 14yo +21 4ofy...D =2BD + 282D +2 12 D (2y+)B3B( 2 D = 4BD + 2B2D + (4y-2)BoBIB 2 + 2BID + 2BIB 2 (B-51)27 0 11 2 10 21 16 1 2 O 2 oD + (2y-I)B2B1 + 2B 2B + 2B B (B...C) C) C) C) C C) CD* I.- = () LA m~ LA) cn LA N. LA C) LA < LU (NJ N. N. C) N. tD N. C) N. 1-- - -m ) o (n J m CDL w/ c) C) C:) C) C) C); C) c) ; C al

  1. Analysis of Algorithms Predicting Blood: Air and Tissue: Blood Partition Coefficient from Solvent Partition Coefficients for Use in Complex Mixture Physiological Based Pharmacokinetic/Pharmacodynamic Modeling

    Science.gov (United States)

    2004-03-01

    8217)~)a EA~U M) 12. Cu 05 𔃺 ). C C a) a’r - (a 04 W- a’ En a 0 4) 0X0 a’ 1 En I W M*E .x 0 a 00o0 0 CLu 0 n4~) 0 S 5 cc 02. 0 3 02 0 0 0 0~ ~> CDL- F5 ...0 E E 0 0 0 E0 0 0 0 0 0 0 0 F5 Fn i Fn Fn Fn Fn Fn in Fn Fn Fn #AC U C U C U C C U C U () C) C C C C CC C C CC C C1 o) t_- c) c c o t)O L- C14- ) CD...a a W 4 0 0 Mu CD EL a..M C 0 -am- o uWMWWZZM W IL IL WWWWIM:Ma 0- Il (L(LWW WWI w t I 0) 0 a) a000) 0 C0 0r0 CcC_ C C C acCa .03 0 03 03 2 M 2

  2. AcEST: BP918435 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ++ + +S G + C C YQ Sbjct: 223 VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQ 265 >sp|O70585|DTNB_MOUSE Dystrobr...P + A V + P+ C++ + +S G + C C YQ Sbjct: 223 VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQ

  3. Measurement of multinucleon transfer cross-sections

    Indian Academy of Sciences (India)

    Keywords. Ni(C, ), Fe(C, ), =C, C, B, B, Be, Be, Be, Be, Li, Li; = 60 MeV; measured reaction cross-section; elastic scattering angular distribution; deduced transfer probabilities and enhancement factors.

  4. Selective Adsorption of Uranium (VI) on NaHCO Leached ...

    African Journals Online (AJOL)

    NICO

    with a variety of organic and inorganic ligands to form complex species of different ... approach for the synthesis of magnetic particles for uranium .... equations (1) and (2), respectively. Extraction efficiency. (C. C ). C o e o. = −. × 100. (1).

  5. Practical C++ programming

    National Research Council Canada - National Science Library

    Oualline, Steve

    2003-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xv Part I. The Basics 1. What Is C++? A Brief History of C++ C++ Organization How to Learn C++...

  6. Polynuclear Iron-Oxo/Hydroxy Complexes of Ketoacidoximate Ligands: Synthesis, Structures and Conversion to Ferric Oxide

    KAUST Repository

    Davaasuren, Bambar; Khanderi, Jayaprakash; Rothenberger, Alexander

    2017-01-01

    The polynuclear iron-oxo/hydroxy complexes containing ketoacidoximate ligands described in this report are [Fe3(μ3-O){O2C-C(C6H5)=NOCH3}6(py)3] (1) (py=pyridine), [Fe2(μ3-O){O2C-C(CH2-C6H5)=NO}2(H2O)(CH3OH)]2 (2) and [{Fe(μ2-OH)(O2C-C(CH3)=NO

  7. Untitled

    Indian Academy of Sciences (India)

    where E, is class A pan evaporation, Risextraterrestrial radiation;C, C, C, C, and C. are coefficients of temperature, wind velocity, relative humidity, sunshine percentage and elevation. These coefficients for node 40 are presented in table B.1. Cropping pattern. Evapotranspiration (consumptive use) of a crop is the product of ...

  8. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    (I.R.C.C.S.), 94018 Troina (EN), Italy; Unità Operativa di Malattie Neuromuscolari, Associazione Oasi Maria SS. (I.R.C.C.S.), 94018 Troina (EN), Italy; Genetica Medica ARNAS Garibaldi Nesima, 95122 Catania, Italy; Unità Operativa di Neurologia per il Ritardo Mentale, Associazione Oasi Maria SS. (I.R.C.C.S.), 94018 Troina ...

  9. Consequences of non-uniformity in the stoichiometry of component fractions within one and two loops models of alpha-helical peptides

    Science.gov (United States)

    Atoms in biomolecular structures like alpha helices contain an array of distances and angles which include abundant multiple patterns of redundancies. Thus all peptides backbones contain the three atom sequence N-C*C, whereas the repeating set of a four atom sequences (N-C*C-N, C*-C-N-C*, and C-N-C...

  10. Review of Cycadophila Xu, Tang & Skelley (Coleoptera: Erotylidae: Pharaxonothinae) inhabiting Cycas (Cycadaceae) in Asia, with descriptions of a new subgenus and thirteen new species.

    Science.gov (United States)

    Skelley, Paul; Xu, Guang; Tang, William; Lindström, Anders J; Marler, Thomas; Khuraijam, Jibankumar Singh; Singh, Rita; Radha, P; Rich, Stephen

    2017-05-12

    The genus Cycadophila Xu, Tang & Skelley (Coleoptera: Erotylidae: Pharaxonothinae) associated with Cycas L. (Cycadacaeae) in Asia is reviewed. Strobilophila, new subgenus, with five species is described: Cycadophila (Strobilophila) assamensis new species, C. (S.) hiepi new species, C. (S.) kwaiensis new species, C. (S.) tansachai new species and C. (S.) yangi new species, all associated with Cycas. For the nominate subgenus Cycadophila eight new species are described, Cycadophila (Cycadophila) abyssa new species, C. (C.) collina new species,C. (C.) samara new species, C. (C.) convexa new species, C. (C.) cyclochasma new species, C. (C.) eurynota new species, C. (C.) papua new species, and C. (C.) torquata new species and four new generic combinations are proposed: C. (C.) vittata (Arrow) new combination, C. (C.) discimaculata (Mader) new combination, C. (C.) intermedia (Chûjô) new combination, and C. (C.) lata (Grouvelle) new combination. Only the first three listed species of the nominate subgenus have known associations with Cycas. Species are distinguished on the basis of morphology and/or by analysis of 16S rRNA gene sequences. The larva of subgenus Strobilophila is described based on individuals collected together with adults and matched with analysis of 16S rRNA gene sequences. Keys to subgenera and species of known adults and larvae are provided.

  11. Yields of primary products from chloroethylenes in air under electron beam irradiation

    International Nuclear Information System (INIS)

    Hakoda, Teruyuki; Hashimoto, Shoji; Kojima, Takuji

    2003-01-01

    The quantitative analysis of toxic primary irradiation products was carried out for the development of the purification technology of chloroethylenes/air mixtures using an electron beam (EB). Degradation of chloroethylenes in humid air proceeded through the formation of primary products retaining a carbon-carbon (C-C) bond such as chloroacetyl chlorides and chloroacetyl aldehyde as well as that of primary products of COCl 2 and HCOCl through C-C bond cleavage. Chloroethylenes having one carbon bonded to two Cl atoms was decomposed into the primary products retaining a C-C bond prior to breaking a C-C bond. The number of Cl atoms of a chloroethylene molecule enhanced the formation ratio of primary products retaining a C-C bond. On the other hand, chloroethylene having two carbons bonded to one Cl atom was degraded thought the scission of a C-C bond predominantly C-C bond maintenance. (author)

  12. An Evaluation of an Automatic Cell Detection and Tracking Algorithm.

    Science.gov (United States)

    1982-11-03

    OUTPUT CENTRCIC 2 N 5 fR %F4 Q 11 Ct, VE L CC. ’ SER Ar MM X R CZL L 2 TRA A1M RNG AV PK V x L A KC IC AV CELL MSK# "T I[ IC AOT. DIV . uL NC OEC K DO8 CE...C go Km EC EP/ ISK.4/ K ,C tC 0 Sk 1 CS 333 164 4? 44 I CoC C.C c 1 2C.2 1. 1.1 ; 5 C C C.CC C.-C C, Yft HMM AREA *FLUX NEAR NEIGMEQR ACT kC NC...InIt Iof It e ru. , ng p I sihbt areas of ailgorjithi breaikdoari. A~n aver-aIe 5V~ ’f the I"u. 11 teo ’ b% 1try toe A Il are tAi(ti ’iti ar)tiet

  13. Synthesis and structural characterization of an unusual heterometallic europium(III) amidinate complex

    International Nuclear Information System (INIS)

    Sroor, Farid M.; Hrib, Cristian G.; Hilfert, Liane; Edelmann, Frank T.

    2015-01-01

    The reaction of EuI_2(THF)_2 with 3 equiv. of the recently discovered lithium-cyclopropylethinylamidinate Li[c-C_3H_5-C≡C-C(NCy)_2] (1) (Cy = cyclohexyl) unexpectedly afforded the heterometallic europium(III) amidinate complex [{c-C_3H_5-C≡C-C(NCy)_2}Li{c-C_3H_5-C≡C-C(NCy)_2}_2Eu(μ-I)_2Li(THF)_2] (2) in the form of bright yellow, air- and moisture-sensitive crystals. An X-ray diffraction study of 2 revealed several unusual structural features. It comprises a double ''ate'' complex of the tentative trivalent europium(III) bis(cyclopropylethinylamidinate) derivative [c-C_3H_5-C≡C-C(NCy)_2]_2Eu"I"I"II. ''Ate'' complex formation occurred not only through retention of one equiv. of lithium iodide but also through addition of one equiv. of Li[c-C_3H_5-C≡C-C(NCy)_2]. The Li atom in the iodo-bridged Eu(μ-I)_2Li(THF)_2 part of the molecule is tetrahedrally coordinated, whereas the second lithium atom is only tricoordinate through the presence of a rare monodentate (dangling) amidinate ligand. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. An investigation of structural design methodology for HTGR reactor internals with ceramic materials (Contract research)

    International Nuclear Information System (INIS)

    Sumita, Junya; Shibata, Taiju; Nakagawa, Shigeaki; Iyoku, Tatsuo; Sawa, Kazuhiro

    2008-03-01

    To advance the performance and safety of HTGR, heat-resistant ceramic materials are expected to be used as reactor internals of HTGR. C/C composite and superplastic zirconia are the promising materials for this purpose. In order to use these new materials as reactor internals in HTGR, it is necessary to establish a structure design method to guarantee the structural integrity under environmental and load conditions. Therefore, C/C composite expected as reactor internals of VHTR is focused and an investigation on the structural design method applicable to the C/C composite and a basic applicability of the C/C composite to representative structures of HTGR were carried out in this report. As the results, it is found that the competing risk theory for the strength evaluation of the C/C composite is applicable to design method and C/C composite is expected to be used as reactor internals of HTGR. (author)

  15. An illegitimate microRNA target site within the 3' UTR of MDM4 affects ovarian cancer progression and chemosensitivity

    DEFF Research Database (Denmark)

    Wynendaele, Jessika; Böhnke, Anja; Leucci, Eleonora

    2010-01-01

    /A) is more frequent (57.8% vs. 42.2% for A/C and C/C, respectively) in patients with high-grade carcinomas than in patients with low-grade carcinomas (47.2% vs. 52.5% for A/A and A/C + C/C, respectively). Moreover, A/A patients who do not express the estrogen receptor had a 4.2-fold [95% confidence interval...

  16. Comment on 'Magic strains in face-centered and body-centered cubic lattices'

    Energy Technology Data Exchange (ETDEWEB)

    Waal, B.W. van de (Technische Hogeschool Twente, Enschede (Netherlands). Dept. of Physics)

    1990-03-01

    The six symmetry-related so-called magic strain tensors that transform a f.c.c. lattice (or a b.c.c. lattice) into itself, which have been reported recently by Boyer are not unique: An infinite number of displacement tensors can be constructed that transform one lattice into another, or into itself. There is no connection with fivefold symmetry, other than that in any f.c.c. crystal. (orig.).

  17. Partial oxidation of n-hexadecane through decomposition of hydrogen peroxide in supercritical water

    KAUST Repository

    Alshammari, Y.M.

    2015-01-01

    © 2014 The Institution of Chemical Engineers. This work reports the experimental analysis of partial oxidation of n-hexadecane under supercritical water conditions. A novel reactor flow system was developed which allows for total decomposition of hydrogen peroxide in a separate reactor followed partial oxidation of n-hexadecane in a gasification reactor instead of having both reactions in one reactor. The kinetics of hydrothermal decomposition of hydrogen peroxide was studied in order to confirm its full conversion into water and oxygen under the desired partial oxidation conditions, and the kinetic data were found in a good agreement with previously reported literature. The gas yield and gasification efficiency were investigated under different operating parameters. Furthermore, the profile of C-C/C=C ratio was studied which showed the favourable conditions for maximising yields of n-alkanes via hydrogenation of their corresponding 1-alkenes. Enhanced hydrogenation of 1-alkenes was observed at higher O/C ratios and higher residence times, shown by the increase in the C-C/C=C ratio to more than unity, while increasing the temperature has shown much less effect on the C-C/C=C ratio at the current experimental conditions. In addition, GC-MS analysis of liquid samples revealed the formation of heavy oxygenated compounds which may suggest a new addition reaction to account for their formation under the current experimental conditions. Results show new promising routes for hydrogen production with in situ hydrogenation of heavy hydrocarbons in a supercritical water reactor.

  18. LA FORMACIÓN UNIVERSITARIA Y EL EJERCICIO PROFESIONAL DE LOS EGRESADOS DE LAS CARRERAS DE COMPLEMENTACIÓN CURRICULAR DEL ÁREA DE EDUCACIÓN DE LA UNTREF.

    OpenAIRE

    Liliana, Mandolesi; Roberto, Canabal Ariel; Liliana, Varano

    2013-01-01

    Como todas las carreras de grado, las de complementación curricular (C.C.C) del área de Educación de la UNTREF, tienen como objetivo la formación de egresados para desempeñarse en las actividades y campo ocupacional vinculados a las respectivas titulaciones. En particular, al ser C.C.C. su especificidad es que la mayoría de sus alumnos han transitado por experiencias laborales en el ámbito educativo. Además, es requisito para incorporarse a estas carreras el poseer un título...

  19. Selective hydrogen atom abstraction by hydrogen atoms in photolysis of cyclohexane-normal pentane mixtures at 77 K

    International Nuclear Information System (INIS)

    Miyazaky, T.; Guedes, S.M.L.; Andrade e Silva, L.G. de; Fernandes, L.

    1977-01-01

    The reaction of H atoms, produced by the photolysis of HI, has been studied in c-C 6 H 12 -n-C 5 H 12 mixtures at 77K. H atoms in c-C 6 H 12 matrix react more effectively with solute n-C 5 H 12 than solvent c-C 6 H 12 , while H atoms in n-C 5 H 12 matrix react more effectively with solute c-C 6 H 12 than solvent n-C 5 H 12 [pt

  20. Carbon-On-Carbon Manufacturing

    Science.gov (United States)

    Mungas, Gregory S. (Inventor); Buchanan, Larry (Inventor); Banzon, Jr., Jose T. (Inventor)

    2017-01-01

    The presently disclosed technology relates to carbon-on-carbon (C/C) manufacturing techniques and the resulting C/C products. One aspect of the manufacturing techniques disclosed herein utilizes two distinct curing operations that occur at different times and/or using different temperatures. The resulting C/C products are substantially non-porous, even though the curing operation(s) substantially gasify a liquid carbon-entrained filler material that saturates a carbon fabric that makes up the C/C products.

  1. Single Assignment C (SAC): High Productivity meets High Performance

    NARCIS (Netherlands)

    Grelck, C.; Zsók, V.; Horváth, Z.; Plasmeijer, R.

    2012-01-01

    We present the ins and outs of the purely functional, data parallel programming language SaC (Single Assignment C). SaC defines state- and side-effect-free semantics on top of a syntax resembling that of imperative languages like C/C++/C# or Java: functional programming with curly brackets. In

  2. Afrimedic Journal - Vol 6, No 1 (2018)

    African Journals Online (AJOL)

    The epidemiology of female genital mutilation in Nigeria – a twelve year review · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. U.U. Epundu, A.L. Ilika, C.C. Ibeh, A.S. Nwabueze, O.F. Emelumadu, C.C. Nnebue, 1-10 ...

  3. Untitled

    Indian Academy of Sciences (India)

    respects and mixed melting point With it was undepressed. The same product Was obtained when dianilino-gossypol was employed. Methylation of the Anilin.0 compound-The tetraanilino-compound. (0.5 g) was dissolved in 20% alcoholic alkali (5 c.c.) and the solution treated with dimethyl Sulphate (3 C.C.) With vigorous ...

  4. Continued Development of the AF/SGR Tricorder Program for Homeland Security, Military, Public Health, and Medical Operations

    Science.gov (United States)

    2012-05-15

    narrow 0.2 degree beam is difficult to scan a scene with because it is such a small angular sub tense. If detecting targets of that magnitude at...algorithm in 7-zip, sometimes called 7-z. A free development kit with the LZMA source code is available to modify the code in C, C+, C++, or Java . It can

  5. DHAP-dependent aldolases from (hyper)thermophiles: biochemistry and applications

    NARCIS (Netherlands)

    Falcicchio, P.; Wolterink-van Loo, S.; Franssen, M.C.R.; Oost, van der J.

    2014-01-01

    Generating new carbon-carbon (C-C) bonds in an enantioselective way is one of the big challenges in organic synthesis. Aldolases are a natural tool for stereoselective C-C bond formation in a green and sustainable way. This review will focus on thermophilic aldolases in general and on

  6. Table:2

    Indian Academy of Sciences (India)

    CHC+ 0.042261 -115.619792 -115.577531 -115.291056 -115.482384. c-C3H3+ 0.045333 -115.733846 -115.688513 -115.396826 -115.589954. H2CCCH+ +HF 0.052087 -216.111454 -215.059367 -215.631844 -215.944155. c-C3H3+ +HF ...

  7. Requirement of the coiled-coil domain of PML-RARα oncoprotein for localization, sumoylation, and inhibition of monocyte differentiation

    International Nuclear Information System (INIS)

    Kim, Young-Eui; Kim, Dong-Yeon; Lee, Jang-Mi; Kim, Seong-Tae; Han, Tae-Hee; Ahn, Jin-Hyun

    2005-01-01

    Homo-oligomerization via a coiled-coil (C-C) domain has been shown to be necessary for the promyelocytic leukemia (PML)-retinoic acid receptor-α (RARα) fusion protein to acquire oncogenic potential in acute promyelocytic leukemia. We show here that PML(ΔC-C)-RARα, which contains a deletion in its C-C domain, is neither localized as characteristic microspeckles nor modified by small ubiquitin-like modifiers (SUMO). The absence of sumoylation of the ΔC-C mutant was due to the lack of binding to Ubc9, a SUMO conjugation enzyme. The integrity of RING finger domain was also needed for both sumoylation and microspeckle formation. In GAL4-DNA tethering assays, the ΔC-C mutant completely lost the inhibitory effect on retinoic acid (RA)-mediated transactivation. Furthermore, the expression of CD14 in U937 cells expressing the ΔC-C mutant in response to vitamin D3 was markedly higher than in cells expressing PML-RARα. However, the RA-mediated induction of C/EBPβ in cells expressing the ΔC-C mutant was comparable to that of control cells. Thus, our results suggest that the C-C domain-associated functions of sumoylation, localization as microspeckles, and the inhibition of monocyte differentiation all contribute to the oncogenic activity of PML-RARα

  8. Determination of Patients’ Breast Tumor-Specific Immunity and Its Enhancement with In Vitro Stimulation and Gene Therapy

    Science.gov (United States)

    1998-03-01

    cancer therapy. Am. J. Clin. Oncol., 22:368-380. Overgaard, J., Gonzalez Gonzalez, D., Hulshof , M.C.C.M., Arcangeli, G., Dahl, O., Mella, O., and... Hulshof , M.C.C.M., Arcangeli, G., Dahl, O., Mella, O., and Bentzen, S.M. (1996) Hyperthermia as an adjuvant to radiation therapy of recurrent or

  9. Untitled

    Indian Academy of Sciences (India)

    methoxy-5-ethoxy-4-methyl coumarin.--. Methoxy-ethoxy counarin from the previous experiment (2 g.) was dissolved in aqueous sodium hydroxide (50 c.c., 10%) by heating and also adding pyridine (10 c.c.). A saturated solution of potassium ...

  10. Untitled

    Indian Academy of Sciences (India)

    In 5% sodium hydroxide it readily dissolved to a deep brown red solution which quickly changed to pale blue on shaking with air,. The trihydroxy compound (0.1 g) was methylated by boiling with dimethyl sulphate (0.3 c.c.) and potassium carbonate (3 g.) in dry acetone. (20 c.c.) for 30 hours. The methyl ether crystallised ...

  11. Untitled

    Indian Academy of Sciences (India)

    and crystallised from alcohol from which it separated out as pale brown needles melting at 165-66. Yield 1 g. Oxidation of tectochrysin to isowogonin.--To a stirred solution of tecto- chrysin (1 g) in a mixture of pyridine (20 c.c.) and aqueous potassium hydroxide (1 g. in 25 c.c.) was added a Solution of potassium persulphate.

  12. COMPARATIVE YIELD AND CHARACTERIZATION OF ...

    African Journals Online (AJOL)

    userpc

    Special Conference Edition, November, 2017. Table 6: Absorption band for the infrared spectroscopy of isolated flavonoid from stem- bark of. Blighia sapida. PEAK VALUE (CM). ABSORPTION(CM-1). FUNCTIONAL. GROUP. REMARKS. 635.57. 700-610(b.s). -C=C:C-H bend. Alkynes. 960.58. 650-1000(s). =C-H bend.

  13. Investigation of defect structures in solids

    Energy Technology Data Exchange (ETDEWEB)

    Dienel, G; Hubrig, W H; Schenk, M; Syhre, H [Zentralinstitut fuer Kernforschung, Rossendorf bei Dresden (German Democratic Republic)

    1976-01-01

    Some central points of interest of research in the field of defect structures in solids dealt with at the Central Institute of Nuclear Research at Rossendorf in the last years are presented. Studies on f.c.c. and b.c.c. metals, radiation-induced phase transitions in perovskites and ion-implanted silicon are described in some detail.

  14. Poorer frontolimbic white matter integrity is associated with chronic cannabis use, FAAH genotype, and increased depressive and apathy symptoms in adolescents and young adults

    Directory of Open Access Journals (Sweden)

    Skyler G. Shollenbarger

    2015-01-01

    Conclusions: Consistent with prior findings, cannabis use was associated with reduced frontolimbic WM integrity. WM integrity was also moderated by FAAH genotype, in that cannabis-using FAAH C/C carriers and A carrying controls had reduced WM integrity compared to control C/C carriers. Observed frontolimbic white matter abnormalities were linked with increased depressive and apathy symptoms in the cannabis users.

  15. Conformational Preferences of Amphibian Peptides Brevinin-Ya and ...

    African Journals Online (AJOL)

    NICO

    180 to 180) in its Phi angle (C-N-C~-C), while its Psi angle. (N-C~-C-N) remains relatively fixed (–100), adopting theД-sheet conformation. The transformation of initial right-handed~-heli- cal (~R) configuration of Asn11 into Д-sheet after ~20 ns of.

  16. Quantitative measures of corrosion and prevention: application to corrosion in agriculture

    NARCIS (Netherlands)

    Schouten, J.C.; Gellings, P.J.

    1987-01-01

    The corrosion protection factor (c.p.f.) and the corrosion condition (c.c.) are simple instruments for the study and evaluation of the contribution and efficiency of several methods of corrosion prevention and control. The application of c.p.f. and c.c. to corrosion and prevention in agriculture in

  17. The Coast Artillery Journal. Volume 78, Number 2, March-April 1935

    Science.gov (United States)

    1935-04-01

    Craig, C.A.C., assigned to command Battery "B" Captain Oren A. Mulkey, Infantry, assigned to Headquarters Company Pacific Sec- tor; and Lieutenant Norman ...a blow to the pride of our :1ble corps of instructors. By Lieutenant Eugene C. Smallwood , C.A .C. JENROLL~vrENT for additional members in the C.c.c

  18. Frutescent species of the genus Dorstenia L. (Moraceae) in the Paleotropics

    NARCIS (Netherlands)

    Hijman, Maria E.E.

    1980-01-01

    A revision is presented of the group of frutescent Dorstenia species with a single row of appendages on the margin of the receptacle which occur in rain-forest areas of tropical Africa. The group comprises : D. dorstenioides (Engl.) M. Hijman & C. C. Berg, D. involuta M. Hijman & C. C. Berg, D.

  19. Long-Term Effects of Rotational Tillage On Visual Evaluation of Soil Structure, Soil Quality and Crop Yield

    DEFF Research Database (Denmark)

    Munkholm, Lars Juhl; Heck, Richard; Deen, Bill

    year old long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Measurements were carried out in the topsoil for three different rotations: R1 (C-C-C-C) continuous corn (Zea mays L.), R6. (C-C-O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare...... L.) and R8, (C-C-S-S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard plowing, MP. Topsoil...

  20. Clinical significance of computed tomographic arteriography for minute hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Itoh, H; Matsui, O; Suzuki, M; Ida, M; Kitagawa, K [Kanazawa Univ. (Japan). School of Medicine

    1982-03-01

    Computed tomographic arteriography (CTA) can clearly demonstrate minute hepatocellular carcinoma (H.C.C.) more than 2 cm in diameter as an enhanced mass lesion. In this case the precise localization of H.C.C. becomes so obvious that CTA plays an important role to evaluate its resectability. However, H.C.C. of the size from 2 cm to 1 cm indiameter, which is visualized with celiac and infusion hepatic angiography, becomes more difficult in detection, and particularly H.C.C. of less than 1 cm in diameter can hardly be recognized, nor be diagnosed as a malignant nodule by CTA, therefore it appears that in these sizes of H.C.C. the detectability of CTA is not superior to the hepatic angiography.

  1. Department of Defense Prime Contracts over $25,000 for Services. Fiscal Year 1992. Part 2 (K010 Analysis & Technology Inc-T099 Xerox Corp)

    Science.gov (United States)

    1993-01-01

    0000 (000 1. 0 z z acca at "rto "r ;,- at or a t U tut t C t at a aU. > or t-CC C C C C C C 10a at at c at at at at at @ 0 C 0 0~~~~~~~~ >at >t 4 1 t...6 . F . . 11 . . - L I- & UI f6 )V A c ) 0 ( A V ) ( A 0 t A ( A L A ( I m - r U)0 0 0 𔃺 a 60 t C a I u I 1’ : 666ý q 0 - r4 - 4 - 4 -4 r4 - - 4 ý

  2. Application of carbon fiber reinforced carbon composite to nuclear engineering

    International Nuclear Information System (INIS)

    Ishihara, Masahiro

    2003-01-01

    Carbon fiber reinforced carbon matrix composite (C/C composite) is thought to be one of promising structural materials with high temperature resistivity in the nuclear engineering field. In the high temperature gas-cooled reactors with gas outlet temperature maximum around 1000degC, high performance core internal structures, such as control rod sheath, core restraint mechanism, will be expected to achieve by the C/C composite application. Moreover, in the fusion reactors, plasma facing structures having high temperature with high neutron irradiation and particle collision will be expected to achieve by the C/C composite application. In this paper, current research and development studies of the C/C composite application on both reactors are reviewed and vista of the future on the C/C composite application is mentioned. (author)

  3. Compendium of Abstracts on Statistical Applications in Geotechnical Engineering.

    Science.gov (United States)

    1983-09-01

    motion and eogiteering prcedures for importnt i.t-la ions teo r ec fiv fault. 213. Lar A siat o o:iPft ea quk ampliftio specr frsuhern Celi frl site 213...iincck ’in tbcc n, ,acc.c -,c I- for.~~i .c.ccsc .o -o lf2 ~ ~ ~ ~ ~ ~ ~ ’ Ara ohrcc h-f c kc .,ccc v c ocl- ,c.c 184.c Iaelsosc I ccpecc-tc ot thecccall...Ii r. L’ Lf v. -C C Et KC . -C CIc c a, > LE r a o 7C -3C -C- - XC C . - C L- 0 L 0 1 f* *L U L c~ mC1 cc wz f ,c or -ft CL Q-t I C EC a a u C3’ a

  4. A dense and strong bonding collagen film for carbon/carbon composites

    International Nuclear Information System (INIS)

    Cao, Sheng; Li, Hejun; Li, Kezhi; Lu, Jinhua; Zhang, Leilei

    2015-01-01

    Graphical abstract: - Highlights: • Significantly enhancement of biocompatibility on C/C composites by preparing a collagen film. • The dense and continuous collagen film had a strong bonding strength with C/C composites after dehydrathermal treatment (DHT) crosslink. • Numerous oxygen-containing functional groups formed on the surface of C/C composites without matrix damage. - Abstract: A strong bonding collagen film was successfully prepared on carbon/carbon (C/C) composites. The surface conditions of the modified C/C composites were detected by contact angle measurements, scanning electron microscope (SEM), X-ray photoelectron spectroscopy (XPS) and Raman spectra. The roughness, optical morphology, bonding strength and biocompatibility of collagen films at different pH values were detected by confocal laser scanning microscope (CLSM), universal test machine and cytology tests in vitro. After a 4-h modification in 30% H 2 O 2 solution at 100 °C, the contact angle on the surface of C/C composites was decreased from 92.3° to 65.3°. Large quantities of hydroxyl, carboxyl and carbonyl functional groups were formed on the surface of the modified C/C composites. Then a dense and continuous collagen film was prepared on the modified C/C substrate. Bonding strength between collagen film and C/C substrate was reached to 8 MPa level when the pH value of this collagen film was 2.5 after the preparing process. With 2-day dehydrathermal treatment (DHT) crosslinking at 105 °C, the bonding strength was increased to 12 MPa level. At last, the results of in vitro cytological test showed that this collagen film made a great improvement on the biocompatibility on C/C composites

  5. A dense and strong bonding collagen film for carbon/carbon composites

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Sheng; Li, Hejun, E-mail: lihejun@nwpu.edu.cn; Li, Kezhi; Lu, Jinhua; Zhang, Leilei

    2015-08-30

    Graphical abstract: - Highlights: • Significantly enhancement of biocompatibility on C/C composites by preparing a collagen film. • The dense and continuous collagen film had a strong bonding strength with C/C composites after dehydrathermal treatment (DHT) crosslink. • Numerous oxygen-containing functional groups formed on the surface of C/C composites without matrix damage. - Abstract: A strong bonding collagen film was successfully prepared on carbon/carbon (C/C) composites. The surface conditions of the modified C/C composites were detected by contact angle measurements, scanning electron microscope (SEM), X-ray photoelectron spectroscopy (XPS) and Raman spectra. The roughness, optical morphology, bonding strength and biocompatibility of collagen films at different pH values were detected by confocal laser scanning microscope (CLSM), universal test machine and cytology tests in vitro. After a 4-h modification in 30% H{sub 2}O{sub 2} solution at 100 °C, the contact angle on the surface of C/C composites was decreased from 92.3° to 65.3°. Large quantities of hydroxyl, carboxyl and carbonyl functional groups were formed on the surface of the modified C/C composites. Then a dense and continuous collagen film was prepared on the modified C/C substrate. Bonding strength between collagen film and C/C substrate was reached to 8 MPa level when the pH value of this collagen film was 2.5 after the preparing process. With 2-day dehydrathermal treatment (DHT) crosslinking at 105 °C, the bonding strength was increased to 12 MPa level. At last, the results of in vitro cytological test showed that this collagen film made a great improvement on the biocompatibility on C/C composites.

  6. Assessment of an Innovative Voluntary Substance Abuse Treatment Program Designed to Replace Compulsory Drug Detention Centers in Malaysia.

    Science.gov (United States)

    Khan, Farrah; Krishnan, Archana; Ghani, Mansur A; Wickersham, Jeffrey A; Fu, Jeannia J; Lim, Sin How; Dhaliwal, Sangeeth Kaur; Kamarulzaman, Adeeba; Altice, Frederick L

    2018-01-28

    As part of an ongoing initiative by the Malaysian government to implement alternative approaches to involuntary detention of people who use drugs, the National Anti-Drug Agency has created new voluntary drug treatment programs known as Cure and Care (C&C) Centers that provide free access to addiction treatment services, including methadone maintenance therapy, integrated with social and health services.   We evaluated early treatment outcomes and client satisfaction among patients accessing C&C treatment and ancillary services at Malaysia's second C&C Center located in Kota Bharu, Kelantan. In June-July 2012, a cross-sectional convenience survey of 96 C&C inpatients and outpatients who entered treatment >30 days previously was conducted to assess drug use, criminal justice experience, medical co-morbidities, motivation for seeking treatment, and attitudes towards the C&C. Drug use was compared for the 30-day-period before C&C entry and the 30-day-period before the interview. Self-reported drug use levels decreased significantly among both inpatient and outpatient clients after enrolling in C&C treatment. Higher levels of past drug use, lower levels of social support, and more severe mental health issues were reported by participants who were previously imprisoned. Self-reported satisfaction with C&C treatment services was high. Conclusions/Importance: Preliminary evidence of reduced drug use and high levels of client satisfaction among C&C clients provide support for Malaysia's ongoing transition from compulsory drug detention centers (CDDCs) to these voluntary drug treatment centers. If C&C centers are successful, Malaysia plans to gradually transition away from CDDCs entirely.

  7. Carbon Fiber Reinforced Carbon-Al-Cu Composite for Friction Material.

    Science.gov (United States)

    Cui, Lihui; Luo, Ruiying; Ma, Denghao

    2018-03-31

    A carbon/carbon-Al-Cu composite reinforced with carbon fiber 2.5D-polyacrylonitrile-based preforms was fabricated using the pressureless infiltration technique. The Al-Cu alloy liquids were successfully infiltrated into the C/C composites at high temperature and under vacuum. The mechanical and metallographic properties, scanning electron microscopy (SEM), X-ray diffraction (XRD), and energy dispersive spectroscopy (EDS) of the C/C-Al-Cu composites were analyzed. The results showed that the bending property of the C/C-Al-Cu composites was 189 MPa, whereas that of the pure carbon slide material was only 85 MPa. The compressive strength of C/C-Al-Cu was 213 MPa, whereas that of the pure carbon slide material was only 102 MPa. The resistivity of C/C-Al-Cu was only 1.94 μΩm, which was lower than that of the pure carbon slide material (29.5 μΩm). This finding can be attributed to the "network conduction" structure. Excellent wettability was observed between Al and the carbon matrix at high temperature due to the existence of Al₄C₃. The friction coefficients of the C/C, C/C-Al-Cu, and pure carbon slide composites were 0.152, 0.175, and 0.121, respectively. The wear rate of the C/C-Al-Cu composites reached a minimum value of 2.56 × 10 -7 mm³/Nm. The C/C-Al-Cu composite can be appropriately used as railway current collectors for locomotives.

  8. C/SiC/MoSi2-Si multilayer coatings for carbon/carbon composites for protection against oxidation

    International Nuclear Information System (INIS)

    Zhang Yulei; Li Hejun; Qiang Xinfa; Li Kezhi; Zhang Shouyang

    2011-01-01

    Highlights: → A C/SiC/MoSi 2 -Si multilayer coating was prepared on C/C by slurry and pack cementation. → Multilayer coating can protect C/C for 300 h at 1873 K or 103 h at 1873 K in air. → The penetration cracks in the coating result in the weight loss of the coated C/C. → The fracture of the coated C/C in wind tunnel result from the excessive local stress. - Abstract: To improve the oxidation resistance of carbon/carbon (C/C) composites, a C/SiC/MoSi 2 -Si multilayer oxidation protective coating was prepared by slurry and pack cementation. The microstructure of the as-prepared coating was characterized by scanning electron microscopy, X-ray diffraction and energy dispersive spectroscopy. The isothermal oxidation and erosion resistance of the coating was investigated in electrical furnace and high temperature wind tunnel. The results showed that the multilayer coating could effectively protect C/C composites from oxidation in air for 300 h at 1773 K and 103 h at 1873 K, and the coated samples was fractured after erosion for 27 h at 1873 K h in wind tunnel. The weight loss of the coated specimens was considered to be caused by the formation of penetration cracks in the coating. The fracture of the coated C/C composites might result from the excessive local stress in the coating.

  9. Study of the Effects of Drugs upon the Cardiovascular and Respiratory Systems

    Science.gov (United States)

    1986-06-01

    gave no response (See figures la & 1b). Blood plasma samples have been taken before and after each injection of liposome suspension and may be sent...cholinesterase activity with cardiovascular and pulmonary function before, during and after administracion of pyridostigmine. The formulation of this drug...Composite Summaries - Beagles Note: All variation bars represent S.E.M. Best Available Copy C% C 0 % C% 0(1C) C0 C C 0 C 0 0 C% % 0 0 % - - - - - - . 84 CT LA

  10. Maritime Analytics Prototype: Phase 3 Validation

    Science.gov (United States)

    2014-01-01

    different so we need a flexible analysis set hierarchy encoded as directories or groups – like a recipe [C.3.1.4n] Improve the GUI:  Provide more...Problems zooming and panning on the timeline [C.1.2.1c, C.1.2.4e, C.1.3.1c, C.1.1.4c, C.1.1.4b]  Selected the wrong year and then the vessel...Scholtz_VAMetrics_2006.pdf] [21] J. Thomas, and K. Cook , Illuminating the Path, the Research and Development Agenda for Visual analytics: IEEE, 2005. [22

  11. Dayton Aircraft Cabin Fire Model, Version 3. Volume II. Program User’s Guide and Appendices.

    Science.gov (United States)

    1982-06-01

    HEAT RELEASE RATE (BTU/FT*FT*SEC) FOR A FIRE C FLML - FLAME LENGTH OF A FIRE. SUBSCR IS FIRE NUMBER (FT) C FSN1 - COUNTER OF NUMBER OF FLAMING...53H ENTRMNT FLAME LENGTH ABSN COEFF SMOKE GEN RATE 0 2 *14HXY CNSPTN RATE/ 3 9X,53H(SG FT) (CU FT/SEC) (BTU/SEC) (CU FT/SEC) 4 .53H (FT) (l/FT) (PART...THE CENTER OF THE FIRE BASE FROM THE C FLOOR C C YZ - THE HYDRAULIC RADIUS OF THE FIRE BASE AREA C C FLML - THE FLAME LENGTH FOR THE FIRE C C ALPC

  12. Achieving Generality over Conditions: Combining the Multitrait Multimethod Matrix and the Representative Design of Experiments.

    Science.gov (United States)

    1984-08-02

    We take that aim to have been achieved in principle (no one has challenged it), if not in practice. We aim therefore to build upon that achievement by...NJ + (J + C~ C + 2 C EU E E 4-)C o.C ~ ~+ (NJ + (N Er E o - ~.. ~____ U) C fl - C C C CE E le E0 I0 U.- E EEa E - Ui Ei . U (alKE E E E 2 2- 2 E Ca...RESEARCH Engineering Psychology Group • TECHNICAL REPORTS DISTRIBUTION LIST OSD Department of the Nay CAPT Paul R. Chatelier Tactical Development

  13. Technical Considerations for Improvement of USAF Operational Training, Testing and Evaluation (OTT and E)

    Science.gov (United States)

    1975-06-30

    L LJ C9 - aCCa C= co =mp XE 0 a aLa C~= =b & -JA 0’-𔃺 z - -Lai’ = WE w.. _A oMac G = cm - cc0j -0, e 125 The total instrument error is a combination...C77 C/) V-C) r:C 7:C-) 0.. C:) f3 . C-) cC./) C) F-I = LU LUJ CAC: peripheral firmware devices. Any well defined process can and should be done by a

  14. Naval Reserve Annual Operating Costs

    Science.gov (United States)

    1975-10-29

    C. c ) CPi i 0 0 00 0 le C C.C~r In 1]1 In 00 It .- I to C-38 ’U2 WIX ’W~ - m u. -C-LC m4 C v , v ul FA ?w % -D 1 o r cl jc j, II t %c oK W)i Ir of... platform programs, while Program 11 contains 26 sub-programs each having a separate Reserve program sponsor. The distribution of Program 11 resources is...a mix of specific skills required to bring an active Navy oper-Iating platform to organizational manning. Each SRU is tailored to a specific ship

  15. 3-Lie bialgebras (Lb,Cd and (Lb,Ce

    Directory of Open Access Journals (Sweden)

    Bai Ruipu

    2016-05-01

    Full Text Available Four dimensional $3$-Lie coalgebras with two-dimensional derived algebras, and four-dimensional $3$-Lie bialgebras of type $(L_b, C_c$ are classified. It is proved that there exist three classes of four dimensional $3$-Lie coalgebras with two-dimensional derived algebra which are $(L, C_{c_i}$, $i=1, 2, 3$ (Lemma 3.1, and ten classes of four dimensional $3$-Lie bialgebras of type $(L_b, C_c$ (Theorem 3.2.

  16. Hydrazine APU Starter Development.

    Science.gov (United States)

    1983-06-01

    electrical solenoid valve is energized. Flywheel speed is monitored independently of the drive shaft speed (rotor speed) via a photo cell mounted in the...center of the top plate. The photocell detects the passage of a black stripe that is painted on the flywheel. Stall torque is monitored with a load cell ...zi Nt1 0m < -C3C C=, * r C ~ L 13 *36 *Si 0 IP *45 a T a *z a oz *it a *t a i a-a 1381 C,3( ( C ( C rcr ~ (C~rrC .C 6v 20 c, f4- 0 *0 0 04 *0 El 06 *0b

  17. 2D/3D Face Recognition

    Science.gov (United States)

    2010-06-18

    MB > CD > m o I • • o • • CC • • 3 3 s = DC LU u. LL « i v* flj 3. » c- c "(0 (/) <D O O Q. CD CL Q) U) (0 £ HI Vr*"\\ s...o _ (J) CM .S — .c c 0 0 i_ CD ^^ ŝ Lf) LO <^" ^t 0 1° 03 TD 0 0 C _C 0^ 03 E o o * 03 w 0 • = 1 CO * 03

  18. Management of Bottom Sediments Containing Toxic Substances: Proceedings of the U.S. Japan Experts Meeting (7th) held at New York City on 2-4 November 1981

    Science.gov (United States)

    1983-10-01

    a a a A C,* 4A 2C NI N S .1.4 .S2 - . -’ - 1 *5 C. - AM A NI ’CI .C C C, C A NIC C NIo I* NI t.. -o 1.jI.v : -,-IC. oN col...Portland Districi that day and the hopper dredge BIDDLE , working uct the mouth of the Columbia River, was immediately ordered to proceed to th, area...resumption of river traffic. On 20 May the plan for dredging was established as indicated in Figure 12. The hopper dredge BIDDLE started work on the

  19. NATO Reference Mobility Model. Edition I. Users Guide. Volume I

    Science.gov (United States)

    1979-10-01

    C TOTAL ERAKING FCRCE - SCIL /SLOPE/VEHICLE C --- ----.----------- C 275 R-2WJ58# VCLUIJE I PAGE A-103 APPEND-IX A - LISTING CF O.CFAt’ NRtPM C 1...sGCW vN1RAV ,SFTYPC 9TBF I- c r-------------------------~e e C tPAXIMUP BRAKING FCRCE * SCIL /SL OP E/V ENICLE/ DRIVER C --------------------- C C 1. VAR...CONTINUE GO TC 2160 ,ýObO IFl IST ,NE, 21 GC TG 2110i 317 R-20358, VOLUME I PAGE A-145 APPENDIX A - LISTING CF FRGG/iAM NAMM C 8. COARSE GRAINED SCIL IF

  20. Teismų praktikos aktualijos baudžiamosiose bylose dėl korupcinio pobūdžio nusikalstamų veikų

    OpenAIRE

    Petkus, Artūras

    2014-01-01

    A significant number of changes in Articles of the Criminal Code of Lithuania (hereinafter – C.C.) was made in the year 2011. Some important changes were made in chapter XXXIII of the C.C., providing criminal liability for crimes and misdemeanors against the civil service and the public interest. The essence of the above mentioned changes is the objective to reconcile the rules of the C.C. with the recommendations of European Union institutions report, as well as to ensure the effectiveness o...

  1. Model-independent study of light cone current commutators

    International Nuclear Information System (INIS)

    Gautam, S.R.; Dicus, D.A.

    1974-01-01

    An attempt is made to extract information on the nature of light cone current commutators (L. C. C.) in a model independent manner. Using simple assumptions on the validity of the DGS representation for the structure functions of deep inelastic scattering and using the Bjorken--Johnston--Low theorem it is shown that in principle the L. C. C. may be constructed knowing the experimental electron--proton scattering data. On the other hand the scaling behavior of the structure functions is utilized to study the consistency of a vanishing value for various L. C. C. under mild assumptions on the behavior of the DGS spectral moments. (U.S.)

  2. Solid-phase synthesis of 2{sup '}-O-methoxyethyl oligonucleotides using dimeric phosphoramidate blocks

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Gi Weon; Kang, Yong Han [Dept. of Applied Chemistry, Hanyang University, Ansan (Korea, Republic of)

    2016-11-15

    This research focused on the method of using dimeric phosphoramidite blocks to synthesize oligonucleotides for development as oligonucleotide drugs. A 16-mer oligonucleotide with the randomly selected sequence of C*C*T*C*G*C *T*C*T*C*G*C*C* C*G*C was synthesized using CC, GC, and TC dimers, a combination of monomers and dimers, or only monomers as building blocks. Using dimer blocks in this synthetic method provided a significant decrease in critical impurities that had similar properties to the main product, which was confirmed by LC-MS and HPLC analysis.

  3. Biomechanics of North Atlantic Right Whale Bone: Mandibular Fracture as a Fatal Endpoint for Blunt Vessel-Whale Collision Modeling

    Science.gov (United States)

    2007-09-01

    considered sexually mature according to their size or age (Kraus, et al., 2007). The number of calves 27 produced in a given year is also highly variable...C~ ~ ~ -~un cz I ~ a -D E -Z Ou = r.. a.) cz toC u n c c E o .) 0 E ’ A u cz r. CA & C.) c.. .. C.) 0 E - " . Wounds or scars from propeller...note is the lower 127 value (21.8%) obtained when a juvenile male was measured. It is unknown if sexual dimorphism or allometry were leading factors

  4. Production of radiation crosslinked polymeric compositions using diacetylenes

    International Nuclear Information System (INIS)

    Patel, G.N.

    1979-01-01

    Crosslinked polymeric compositions, useful as electrical insulators, heat shrinkable packaging, and lightweight foam plastics, are described. The crosslinked polymeric compositions are produced by admixing a diacetylene monomer, oligomer, polymer or mixture thereof, wherein the monomer has the formula, RNHCO-O-CH 2 -C==C-C==C-CH- 2 -O-OCNHR' in which R and R' are the same or different and are alkyl containing 1 to 20 carbon atoms, with a thermoplastic crosslinkable polymer and then subjecting the resulting mixture to actinic radiation

  5. Linear-chain model to explain density of states and Tsub(c) changes with atomic ordering

    International Nuclear Information System (INIS)

    Junod, A.

    1978-01-01

    The effect of long-range atomic order on the electronic density of states has been recalculated for the A15-type structure within the linear-chain model. It is found that a defect concentration c reduces the density of states at the Fermi level by a factor (1 + c/c 0 )(c/c 0 ) -3 [ln(1 + c/c 0 )] 3 . This result is in qualitative agreement with experimental data on the specific heat, magnetic susceptibility and superconducting transition temperature of V 3 Au. (author)

  6. Push-pull alkenes: structure and p-electron distribution

    Directory of Open Access Journals (Sweden)

    ERICH KLEINPETER

    2006-01-01

    Full Text Available Push-pull alkenes are substituted alkenes with one or two electron-donating substituents on one end of C=C double bond and with one or two electron-accepting substituents at the other end. Allowance for p-electron delocalization leads to the central C=C double bond becoming ever more polarized and with rising push-pull character, the p-bond order of this double bond is reduced and, conversely, the corresponding p-bond orders of the C–Don and C–Acc bonds are accordingly increased. This push-pull effect is of decisive influence on both the dynamic behavior and the chemical reactivity of this class of compounds and thus it is of considerable interest to both determine and to quantify the inherent push-pull effect. Previously, the barriers to rotation about the C=C, C–Don and/or C–Acc partial double bonds (DG±, as determined by dynamic NMR spectroscopy or the 13C chemical shift difference of the polarized C=C partial double bond (DdC=C were employed for this purpose. However, these parameters can have serious limitations, viz. the barriers can be immeasurable on the NMR timescale (either by being too high or too low; heavily-biased conformers are present, etc. or DdC=C behaves in a non-additive manner with respect to the combination of the four substituents. Hence, a general parameter to quantify the push-pull effect is not yet available. Ab initio MO calculations on a collection of compounds, together with NBO analysis, provided valuable information on the structure, bond energies, electron occupancies and bonding/antibonding interactions. In addition to DG±C=C (either experimentally determined or theoretically calculated and DdC=C, the bond length of the C=C partial double bond was also examined and it proved to be a reliable parameter to quantify the push-pull effect. Equally so, the quotient of the occupation numbers of the antibonding andbonding p orbitals of the central C=C partial double bond ( p*C=C/ pC=C could also be employed for

  7. Lightweight, Ultra-High-Temperature, CMC-Lined Carbon/Carbon Structures

    Science.gov (United States)

    Wright, Matthew J.; Ramachandran, Gautham; Williams, Brian E.

    2011-01-01

    Carbon/carbon (C/C) is an established engineering material used extensively in aerospace. The beneficial properties of C/C include high strength, low density, and toughness. Its shortcoming is its limited usability at temperatures higher than the oxidation temperature of carbon . approximately 400 C. Ceramic matrix composites (CMCs) are used instead, but carry a weight penalty. Combining a thin laminate of CMC to a bulk structure of C/C retains all of the benefits of C/C with the high temperature oxidizing environment usability of CMCs. Ultramet demonstrated the feasibility of combining the light weight of C/C composites with the oxidation resistance of zirconium carbide (ZrC) and zirconium- silicon carbide (Zr-Si-C) CMCs in a unique system composed of a C/C primary structure with an integral CMC liner with temperature capability up to 4,200 F (.2,315 C). The system effectively bridged the gap in weight and performance between coated C/C and bulk CMCs. Fabrication was demonstrated through an innovative variant of Ultramet fs rapid, pressureless melt infiltration processing technology. The fully developed material system has strength that is comparable with that of C/C, lower density than Cf/SiC, and ultra-high-temperature oxidation stability. Application of the reinforced ceramic casing to a predominantly C/C structure creates a highly innovative material with the potential to achieve the long-sought goal of long-term, cyclic high-temperature use of C/C in an oxidizing environment. The C/C substructure provided most of the mechanical integrity, and the CMC strengths achieved appeared to be sufficient to allow the CMC to perform its primary function of protecting the C/C. Nozzle extension components were fabricated and successfully hot-fire tested. Test results showed good thermochemical and thermomechanical stability of the CMC, as well as excellent interfacial bonding between the CMC liner and the underlying C/C structure. In particular, hafnium-containing CMCs on

  8. Low-Cost Repairable Oxidation Resistant Coatings for Carbon-Carbon Composites via CCVD

    National Research Council Canada - National Science Library

    Hendrick, Michelle

    2000-01-01

    ...) thin film process to yield oxidation resistant coatings on carbon-carbon (C-C) composites. Work was on simple coatings at this preliminary stage of investigation, including silicon dioxide, platinum and aluminum oxide...

  9. The use of a versatile o-vanilloyl hydrazone ligand to prepare SMM-like Dy3 molecular cluster pair.

    Science.gov (United States)

    Xue, Shufang; Zhao, Lang; Guo, Yun-Nan; Zhang, Peng; Tang, Jinkui

    2012-09-14

    A novel lanthanide molecular cluster pair (MCP), displaying single molecule magnet behaviour, was assembled using the novel o-vanilloyl hydrazone ligand, versatile in terms of denticity, tautomerism and the rotatable C-C bond.

  10. Download this PDF file

    African Journals Online (AJOL)

    Femi Olorunniji

    2014-09-30

    Sep 30, 2014 ... attendant health-seeking behaviours of educated Nigerians. Chukwunonso E.C.C. Ejike ..... westernisation of diets) coupled with the biased focus on the prevention and ... thesis. Universiti Kebangsaan Malaysia. Buchwald D ...

  11. Determinants of Public Policies and the Manufacturing Sector in ...

    African Journals Online (AJOL)

    Toshiba

    potential for growth and development within the Nigerian economy. Adenikinji and Chete (2002), conducted ... a fall in the performance level of the manufacturing sector in the country. However ..... Academic Book Press. Ugwuh, C.C. (2004).

  12. African Zoology - Vol 27, No 3 (1992)

    African Journals Online (AJOL)

    A new record of Craspedacusta sowerbii (Cnidaria: Limnomedusae) from southern Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Nancy A. Rayner, C.C. Appleton, 143-145 ...

  13. Failure Modes of a Unidirectional Ultra-High-Modulus Carbon-Fiber/Carbon-Matrix Composite

    National Research Council Canada - National Science Library

    Zaldivar, R

    1998-01-01

    The objective of this study was to observe the effects of various microstructural features on the in situ, room-temperature tensile fracture behavior of an ultra-high-modulus, unidirectional carbon/carbon (C/C...

  14. 75 FR 66187 - Review of Commodity, Boxcar, and TOFC/COFC Exemptions

    Science.gov (United States)

    2010-10-27

    ... rail (and truck) operations provided in connection with intermodal (TOFC/COFC) services, under 49 CFR.... 2d 969 (1993); Exemption from Regulation--Rail Transp. Frozen Food, 367 I.C.C. 859 (1983); Liquid...

  15. In Situ Densification Utilizing a Low-Viscosity Wetting Impregnant that Greating Reduces Processing Time to Produce Uniform Density Carbon-Carbon Composites

    National Research Council Canada - National Science Library

    Hoffman, Wesley

    2002-01-01

    High-performance carbon-carbon (C-C) composites possess a unique set of properties that make them desirable materials for high-temperature structural uses such as in rocket propulsion components, hypersonic vehicles, and aircraft brakes...

  16. Trestní odpovědnost právnických osob

    OpenAIRE

    Skřivanová, Monika

    2010-01-01

    A# @ ; ! ' .' ! / + ! , > , ! = ! *+ ! + > ' - > ' ! / + *- ! = ! ! ! D ,3 + ! ' .' ! / + ! , - - > D ' *-. . 3 ! ' C! , ! - /- , *- - 6F ! > - 3 = ,3 -. ,/ ' .' ! / + ! , B - - ' ! > . > >- B - !+ ' / = - C * > > ' ! > -. - -* ,3 G +3 3 > ' * ! 3 * ! , - ! ! > 4 3= > - + ' 'C 'C ' ! ' .' ! / + ! , ! - ' ' ! . > ' = *- . ' A9 ', > ! ! !+ ' > - D = ! / + ! , ! 3! 3 > D > ' ! - ! = ! /- 'C! ' 3 * > D ' ! N C! ' ! ' *! ! ' .' ! , ' ! = - - ! ! > *+ > ' ! ! E' + *+ ! ' '. ' , . ! , > *! B 3 = ! /...

  17. Infrared and Raman spectroscopic study of BDA-TTP [2,5-bis(1,3-dithian-2-ylidene) 1,3,4,6-tetrathiapentalene] and its charge-transfer salts

    Science.gov (United States)

    Uruichi, Mikio; Nakano, Chikako; Tanaka, Masayuki; Yakushi, Kyuya; Kaihatsu, Takayuki; Yamada, Jun-ichi

    2008-09-01

    Infrared and Raman spectra in the frequency range of 1200-1600 cm -1 were observed using BDA-TTP and (BDA-TTP)CuCl 2 crystals. The C =C stretching and CH 2 bending modes in this frequency region were assigned based on quantum chemical calculation of the normal modes by the density functional theory (DFT) method. The three C =C stretching modes of BDA-TTP showed a significant low-frequency shift upon oxidation. One of the Raman-active C =C stretching modes is strongly coupled with the charge-transfer excited state. Vibrational analysis was applied to β-(BDA-TTP) 2I 3. The infrared-active C =C stretching mode strongly suggests that the insulating state of β-(BDA-TTP) 2I 3 is characterized as a dimer-Mott state below 150 K.

  18. In vitro anti-leukemic activity and chemical transformation of the 5'-chloro-5'-deoxy derivative of cyclo-cytidine

    International Nuclear Information System (INIS)

    Stankovicova, M.; Bachrata, M.; Sveda, P.; Rauko, P.; Blesova, P.

    1995-01-01

    Hydrochloride of 5'-chloro-5'-deoxy-cytocytidine (Cl-cC) is an analogue of hydrochloride (cC), a pro-drug of the compound with of the compound with the strong anti-leukemic activity arabinosylcytosine (araC). This paper is devoted to the study of its cytotoxic activity in vitro and to the effect of acid alkaline conditions and temperature on its stability. Cl-cC inhibits not only the growth of L1210 leukemia cells in vitro and the DNA synthesis (IC 50 = 0.09 μmol/dm 3 ) but, at the same time, it has a weak effect on RNA synthesis (IC 50 > 250 μmol/dm 3 ) and no effect on proteosynthesis. In alkaline conditions Cl-cC is transformed to 5'-chloro-araC and 2',5'-anhydro-araC but is more stable in acid solutions. (author)

  19. Synthesis and characterization of metal ion-imprinted polymers

    Indian Academy of Sciences (India)

    2018-03-29

    Mar 29, 2018 ... polymers (CPs) were synthesized through the same method without using metal ion. Characterization of the ... tizanidine obtained from MMIP-NPs showed that signifi- .... C=C vari- able alkene stretching band at 1636 cm. −1.

  20. Band Model Parameters for the 2.7 Micrometer Bands of H2O and CO2 in the 100 to 3000 deg K Temperature Range

    Science.gov (United States)

    1975-07-31

    ARE THOSE OF THE AUTHORS AND SHOULD NOT BE INTERPRETED AS NECESSARILY REPRESENTING THE OFFICIAL POLICIES , EITHER EXPRESSED OR IMPLIED, OF THE DEFENSE...authors and should not be interpreted as necessarily representing the official policies , either expressed or implied, of The Defense Advanced Research...4-4ý4 cx:lp cnCD r-- qM =&= C C3 c:, C)c: C2gn CaC CDC) CDC C3C)A=C Cý %=CýC dMC3C:l CC) C)Cp, bo of I i I I I I f 1 4 1 1 1 0 1 1 1 # I I I I I I I

  1. Ettekäändeks "Romeo ja Julia" / Mai Murdmaa, Lloyd Sobel, Charles Cusick Smith ; interv. Kristiina Garancis

    Index Scriptorium Estoniae

    Murdmaa, Mai, 1938-

    1998-01-01

    13. veebr. 1998 "Estonia" teatris esietendunud balleti "Romeo ja Julia" lavastusmeeskonna liikmed esietendunud tantsuetenduse teemadel. C. C. Smith oma vabaloomingust. L. Sobel oma tööprotsessist jm

  2. Peregrine Software Toolchains | High-Performance Computing | NREL

    Science.gov (United States)

    Group (PGI) C/C++ and Fortran (partially supported) The PGI Accelerator compilers include NVIDIA GPU support via the directive-based OpenACC 2.5 programming model, as well as full support for NVIDIA CUDA C

  3. THE AGINCOURT FIELD SITE - EVOLUTION AND CURRENT ...

    African Journals Online (AJOL)

    teaching, research and practice since C C Chen's impressive efforts at the ... HSDU tended to emphasise human resource development, for example ... innovative subdistrict and health centre programmes could be ... Agincourt Study Area. Fig.

  4. 1-O-Acetyl-3,4,6-tri-O-benzyl-2-C-bromomethyl-2-deoxy-α-d-glucopyranose

    Directory of Open Access Journals (Sweden)

    Henok H. Kinfe

    2013-01-01

    Full Text Available In the title compound, C30H33BrO6, the pyranose ring adopts a chair conformation. Two of the O-benzyl phenyl rings lie almost perpendicular to C/C/C/O plane formed by the ring atoms not attached to these O-benzyl phenyl rings, and form dihedral angles of 85.1 (2 and 64.6 (2°, while the third O-benzyl phenyl ring is twisted so that it makes a dihedral angle 34.9 (2° to this C/C/C/O plane. This twist is ascribed to the formation of an S(8 loop stabilized by a weak intramolecular C—H...O hydrogen bond.

  5. Reduced Cost Composite Hot Structures with Oxidation Protection, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Innovative, low cost high performance technologies are critical to the affordability of future space missions. Carbon/carbon (C/C) composites have significant...

  6. Experimental evidence for rhombohedral phase of C70 after irradiation

    International Nuclear Information System (INIS)

    Misof, K.; Fratzl, P.; Vogl, G.

    1993-01-01

    Purely f.c.c. C 70 was irradiated with high-energy heavy ions at low temperature. This led to the appearance of additional Bragg peaks attributed to an irradiation-induced f.c.c.-to-rhombohedral phase transition. On heating to about 570 K the retrasition to the pure f.c.c. phase occurred. Since no irradiation-induced phase transition was obsered in C 60 , the rhombohedral phase appears to be connected with the ''rugby-ball shape'' of C 70 which favours the alignment of the molecules. We propose that irradiation provides the agitation enabling the C 70 molecules to overcome the small energy barriers which otherwise prevent the alignment of the rugby balls over larger regions. (orig.)

  7. 78 FR 21007 - Indexing the Annual Operating Revenues of Railroads

    Science.gov (United States)

    2013-04-08

    ... Rulemaking With Respect to 49 CFR 1201, 8 I.C.C. 2d 625 (1992), raised the revenue classification level for...- 8339] By the Board, William F. Huneke, Director, Office of Economics. Jeffrey Herzig, Clearance Clerk...

  8. SOFTWARE FOR DESIGNING PARALLEL APPLICATIONS

    Directory of Open Access Journals (Sweden)

    M. K. Bouza

    2017-01-01

    Full Text Available The object of research is the tools to support the development of parallel programs in C/C ++. The methods and software which automates the process of designing parallel applications are proposed.

  9. An example of one-against-all support vector machine image ...

    African Journals Online (AJOL)

    onuwa

    MATLAB is a programming language just like C, C++, and python. In this ... The concept of the SVM was introduced by Cortes and ... found by solving the following constrained optimization problem (or primal problem) (Vapnik, 2000),. Minimise.

  10. 25 CFR 170.212 - What is the timeline for IRRHPPs?

    Science.gov (United States)

    2010-04-01

    ...-Governance for selected IRRHPP. (b) If total funding for accepted projects does not equal the total funds... accordance with Appendix C to subpart C. (c) All IRRHPP funds must be obligated on or before August 15. If it...

  11. CLEAN CHEMICAL SYNTHESIS IN WATER

    Science.gov (United States)

    Newer green chemistry approach to accomplish chemical synthesis in water is summarized. Recent global developments pertaining to C-C bond forming reactions using metallic reagents and direct use of the renewable materials such as carbohydrates without derivatization are described...

  12. Presidential Green Chemistry Challenge: 2007 Academic Award

    Science.gov (United States)

    Presidential Green Chemistry Challenge 2007 award winner, Professor Michael J. Krische, developed selective C-C bond-forming hydrogenation without organometallic reagents, eliminating hazardous reagents and hazardous waste.

  13. Nonlinear genetic-based simulation of soil shear strength parameters

    Indian Academy of Sciences (India)

    stress and the excess pore water pressure. If the pore water pressures are measured during the test, the effective ..... A sedimentation test was carried out throughout a hydrometer ...... a C/C++ Simulation Model of a Waste Incinerator Sci-.

  14. Group IB Organometallic Chemistry XXXIV: Thermal behavior and chemical reactivity of tetranuclear Me2N-substituted diarylpropenylcopper-copper anion (Vi2Cu4X2) and mixed diarylpropenyl/organocopper (Vi2Cu4R2) compounds

    NARCIS (Netherlands)

    Koten, G. van; Hoedt, R.W.M. ten; Noltes, J.G.

    1980-01-01

    Thermal decomposition of configurationally pure 1, 2-diarylpropenylcopper compounds Z-Vi{2}CU{4}Br{2} and Z-Vi{2}Cu{4}R{2} [Vi @? (2-Me{2}NC{6}H{4})C@?C(Me)-(C{6}H{4}Me-4), R @? 2-Me{2}NC{6}H{4} or 4-MeC{6}H{4}C@?C] predominantly results in the formation of ViH. In contrast, only dimers (ViVi) were

  15. Linguistics, cognitive psychology, and the Now-or-Never bottleneck.

    Science.gov (United States)

    Endress, Ansgar D; Katzir, Roni

    2016-01-01

    Christiansen & Chater (C&C)'s key premise is that "if linguistic information is not processed rapidly, that information is lost for good" (sect. 1, para. 1). From this "Now-or-Never bottleneck" (NNB), C&C derive "wide-reaching and fundamental implications for language processing, acquisition and change as well as for the structure of language itself" (sect. 2, para. 10). We question both the premise and the consequentiality of its purported implications.

  16. Multiple Time Series Node Synchronization Utilizing Ambient Reference

    Science.gov (United States)

    2014-12-31

    4) Integration with other developing environments (C, C++, Matlab, Java ); 5) Quality, compactness, maturity; 6) Cost. During the duration...Flexibility of parameters; 3) Number and type of supported sensors; 4) Integration with other developing environments (C, C++, Matlab, Java ); 5) Quality...and 9 Hz for the HR-monitor. The IMU collected acceleration at two different scales, 16 and 6 , angular velocity ( / ), magnetometer ( ) and

  17. Properties of the Excited States of Molecular Ions.

    Science.gov (United States)

    1981-04-13

    FIg. 1). techniques have beest applied to the study of quartet states of Oi. The four potential curves most relevant Guyon et al., using a synchrotron...8217 a’ a a C ’U ~ ~ ~ ~ ~ ~ ~ 2 2,~ C a ’I C~- C ’ 𔃺 𔃺 𔃺 ’ ’ C- ~ C-E-38- ’- u A() A09a 265 SRI INTERNATIONAL 14FNLO PARK CA MOLECULAR PHYSICS LAB F

  18. Cross calibration of IRS-P4 OCM satellite sensor

    Digital Repository Service at National Institute of Oceanography (India)

    Suresh, T.; Desa, E.; Mascarenhas, A.A.M.Q.; Matondkar, S.G.P.; Naik, P.; Nayak, S.R.

    Vol. 6404 640414-2 Proc. of SPIE Vol. 6404 640414-3 Proc. of SPIE Vol. 6404 640414-4 S. ..t . . Proc. of SPIE Vol. 6404 640414-5 Proc. of SPIE Vol. 6404 640414-6 0,E 0,E VC) I-a C C) C) Cu Cl) 1.0 0.8 0.6 0.2 0.0 0.0 0.6 Measured (mg/rn3) Proc...

  19. Energy Conservation and Management Study of Aircraft Hangars at Selected Air Force Bases.

    Science.gov (United States)

    1980-01-01

    0 C 00 > >0 s- M2 ol F)0 - LD -0C ) 4 C C -c0 c,- -- 41 a) *-’.T 𔃺 (n L Z >-l L. o- C) ( ~ ~L) C:oaa > Z 4 . - 0 0 oL co~ (jI 0 C’. cnCD CC 00-’ 0 n...current gas policy discourages the use of gas-fired devices. Special variance must be obtained to use the recommended heaters. Another observation is

  20. Oceanographic and Acoustical Survey of the East Ionian Sea

    Science.gov (United States)

    1990-09-01

    Notation The views expressed-in this thesis are those of the author and do not reflect the official policy or po- sition -of-the Department of Defense...8217 ,_ ,=--- . OLo • :. LU _ -09 5 /- S US8 0)6 0 • OU G I:: -CD *.. LU Uz CD_ _ _ Li C) . LU M -- cN C.8 C C - ------- CD CnCD C:) C81 m 0- ’an 0 0

  1. Research on high-energy chemical reactions. Annual progress report, August 1, 1974--October 31, 1975

    International Nuclear Information System (INIS)

    Cross, R.J. Jr.

    1975-10-01

    Product yields for the reactions T* + c - C 6 D 12 → c - C 6 D 11 T, DT have been measured using a beam of T* formed by charge exchange in the energy range of 25 eV to 100 eV. A computer program was written to calculate the probability of collision vs. energy of a beam of T* moderated by He gas

  2. Structure-activity relationships of N-beta-phenylpropionyl-L-tyrosine and its derivatives on the inhibition of an identifiable giant neurone of an African giant snail (Achatina fulica Férussac).

    Science.gov (United States)

    Ariyoshi, Y.; Takeuchi, H.

    1982-01-01

    1 Inhibitory effects of N-beta-phenylpropionyl-L-tyrosine, N-beta-phenylpropionyl-L-tryptophan and their derivatives on an identifiable giant neurone, TAN (tonically autoactive neurone) of an African giant snail (Achatina fulica Férussac) were examined in an attempt to elucidate which structural features are necessary to produce the effect. 2 Of the compounds examined, N-beta-cyclohexylpropionyl-L-tyrosine showed the strongest effect. Its critical concentration (c.c.) was 3 X 10(-8)-10(-7)M, about ten times lower than that of N-beta-phenylpropionyl-L-tyrosine (c.c., 3 X 10(-7)-10(-6)M). N-beta-cyclohexylpropionyl-L-tryptophan (c.c., 10(-6)M) had an effect almost similar to that of N-beta-phenylpropionyl-L-tryptophan (c.c., 10(-6)M). 3 N-beta-Phenylpropionyl-N-methyl-L-tyrosine had no effect at a high concentration. 4 Effects of N-beta-phenylpropionyl-L-tyrosine amide (c.c., 3 X 10(-7)-10(-6)M) and N-beta-phenylpropionyl-L-tryptophan amide (c.c., 10(-6)M) were very similar to those of N-beta-phenylpropionyl-L-tyrosine and N-beta-phenylpropionyl-L-tryptophan respectively. 5 N-beta-Phenylpropionyl-p-amino-L-phenylalanine (c.c., 3 X 10(-5)-10(-4)M) and N-beta-phenylpropionyl-p-chloro-L-phenylalanine (c.c., 10(-4)M) had only a weak effect. 6 It is proposed that the structural features producing the effect are as follows: the active compound has a phenyl or a cyclohexyl group (hydrophobic binding group), after a suitable distance a peptide bond (proton donor and proton acceptor), adjacently a carbonyl group (proton acceptor), and a phenolic hydroxyl or an indolyl imino group (proton donor) in the molecule. PMID:7150871

  3. Environmental Containment Property Estimation Using QSARs in an Expert System

    Science.gov (United States)

    1993-01-15

    Soil Adsorption , Octanol- Water Partition Coefficients, Water Solubilities, Bioconcentration Factors and the Parachor. J. Agric. Food Chý’m., 1981. 29...CCOO CH3CO CH3SH CH3SH CH2COO CH2SH HCOO HCOO Furfural Furfural CH20 CH30 DOH (CH2OH)2 CH20 I I CH-O Br Br FCH20 C=C CH=C CNH2 CJ’-NH2 C=C Ci,2NH2 DMSO

  4. Big River Reservoir Project - Pawcatuck River and Narragansett Bay Drainage Basins - Water and Related Land Resources Study. Volume III. Appendices H-K.

    Science.gov (United States)

    1981-07-01

    House wren --- -*- --- --- R Mockingbird --- --- --- -- Catbird Q R C C C Brown thrasher --- -- - --- R Robin R - C R 0 Wood thrush --- --- 0...new growth and kill it. At this stage, the terrestrial ecosystem will have been all but replaced by a large area of standing water. Hilltops vegetated...mice, voles, shrews, etc.) will be unavoidably killed or injured as clearing and construction occurs. Animals occu- pying burrows will suffer high

  5. A SAIL Compatible Three Channel Acoustic Navigation Interrogator

    Science.gov (United States)

    1990-09-01

    REFOtJSE 0DB5’ D)4C 0186’ 0145’ C 0M18 9C C ODB9’ CA 0939’ C 018C 8C C 018D’ FB 59 C XRT MpY"J IT YS? ODBF’ CA ODXB’ C 123 DE7ARM ;IF N~ rEXI 0DC2’ F8 43 C

  6. Due Regard Encounter Model Version 1.0

    Science.gov (United States)

    2013-08-19

    Note that no existing model covers encoun- ters between two IFR aircraft in oceanic airspace. The reason for this is that one cannot observe encounters...encounters between instrument flight rules ( IFR ) and non- IFR traffic beyond 12NM. 2 TABLE 1 Encounter model categories. Aircraft of Interest Intruder...Aircraft Location Flight Rule IFR VFR Noncooperative Noncooperative Conventional Unconventional CONUS IFR C C U X VFR C U U X Offshore IFR C C U X VFR C U

  7. GENOMIC DIVERSITY AND THE MICROENVIRONMENT AS DRIVERS OF PROGRESSION IN DCIS

    Science.gov (United States)

    2017-10-01

    subsequent DNA extraction. Additional sections (every other one) are also stored for immunohistochemical (IHC) analysis of key measures of tumor and micro ...mutation content. PLoS Computational Biology , 12:e1004413, 2016. Published. Acknowledged federal support. 13. Andor, N., Maley, C.C., Ji, H. P...M., Boddy, A. M., Maley, C.C ,. Peto’s Paradox: How has evolution solved the problem of cancer prevention? BMC Biology 15:60, 2017. Published

  8. On the origin of brittle fracture of entangled polymer solutions and melts

    DEFF Research Database (Denmark)

    Wagner, Manfred H.; Narimissa, Esmaeil; Huang, Qian

    2018-01-01

    A novel criterion for brittle fracture of entangled polymer liquids is presented: Crack initiation follows from rupture of primary C-C bonds, when the strain energy of an entanglement segment reaches the energy of the covalent bond. Thermal fluctuations lead to a short-time concentration...... of the strain energy on one C-C bond of the entanglement segment, and the chain ruptures. This limits the maximum achievable stretch of entanglement segments to a critical stretch of f(c)...

  9. V. C. Ogarawu', F.i. Abdulrahman and L.T. Zaria"

    African Journals Online (AJOL)

    gry •ę ---- c - c c o 3. 8 3 3 5 5 3 3 3 8 3 ...

  10. Modelling of Rigid-Body and Elastic Aircraft Dynamics for Flight Control Development.

    Science.gov (United States)

    1986-06-01

    AMAT MATSAV AUGMENT MI NV BMAT MMULT EVAL RLPLOT FASTCHG STABDER The subroutines are fairly well commented so that a person familiar with the theory...performed as in a typical flutter solution. C C Subroutine BMAT computes the B matrix from the forcing function C matrix Q. B is a function of dynamic...and BMAT multiplies matrices. C This is used to form the A and B matrices. C C Subroutine EVAL computes the eigenvalues of the A matrix C The

  11. Study of Modern Instrumentation and Methods for Astronomic Positioning in the Field

    Science.gov (United States)

    1987-03-01

    CALL AMAT(A.Y, UKK, KALPHA, DELTA) DO 40 kl.,2*K WR ITE( 3.300 )( A( I.M),.M=1,3) 300 FORMAT M, 3F18.12) 40 CONTINUE CALL BMAT (BY, UKKK, ALPHA, DELTA...1 20 CONTINUE RETURN END C C C SUBROUTINE BMAT (B, YU, KK, KALPHA, DELTA) C BMAT constructs the matrix 8 DIMENSION B(2*KK,3*KK)LY(KK,3),U(3),ALPHA(KK

  12. Water Resources Investigation. Cape Girardeau - Jackson Metropolitan Area, Missouri. Volume 4. Appendix C. Public Views and Responses.

    Science.gov (United States)

    1983-12-01

    and Corps of Engineers response. C-21 APPUWIX C C-3 Letter Pg m. Cape Girardeau Chamber of Commerce , 27 December 1983. C-24 n. U.S. Department of the...of erosion. Sincerely, Jack F. Rasmussen, P.E. Chief, Planning D ivision APPENDIX C C-23 Cape Girardeau Chamber of Commerce EXECUTIVE OFFICE December...Girardeau Chamber of Commerce has received and studied the Water Resources and Investigation, Cape Girardeau - Jackson area dated December, 1983 and we

  13. On the nature of the olefination reaction involving ditungsten hexaalkoxides and aldehydes or ketones

    Energy Technology Data Exchange (ETDEWEB)

    Chisholm, M.H.; Huffman, J.C.; Lucas, E.A.; Sousa, A.; Streib, W.E. [Indiana Univ., Bloomington, IN (United States)

    1992-03-25

    Reductive coupling of aldehydes and ketones to olefins under the action of ditungsten hexaalkoxides was investigated. In these reactions, reductive cleavage of the aldehyde or ketone carbonyl is followed by formation of the olefinic C-C bond and breaking of the carbonyl C-O bond of the second aldehyde or ketone. Observations concerning the initial C-O bond cleavage and subsequent C-C bond formation are presented. 10 refs., 4 figs.

  14. La nuova disciplina del matrimonio degli stranieri alla luce del pacchetto sicurezza. I suoi riflessi sul matrimonio concordatario

    Directory of Open Access Journals (Sweden)

    Pierluigi Consorti

    2011-02-01

    Full Text Available SOMMARIO: 1. La capacità matrimoniale dello straniero prima del pacchetto sicurezza - 2. La novella dell’art. 116 c.c. - 3. Il diritto al matrimonio nel pacchetto sicurezza - 4. Art. 116 c.c. e matrimonio concordatario - 5. Pubblicazioni civili e matrimonio concordatario - 6. Trascrivibilità del matrimonio concordatario di cittadino straniero che non documenta la regolarità del soggiorno - 7. Matrimonio concordatario degli stranieri non cattolici - 8. Conclusione

  15. Dispersion of low frequency vibrations in the deuterated naphthalene crystal

    International Nuclear Information System (INIS)

    Bokhenkov, E.L.; Sheka, E.; Natkaniec, I.

    1977-01-01

    The dispersion curves of the lattice vibrations and of the two lowest intramolecular vibrations in d 8 -naphthalene (C 10 D 8 ) crystal have been measured by coherent inelastic neutron scattering for the [010] and the [100] directions at the temperature of 98 K and partially at 5 K. The results are compared with calculations based on the Kitaigorodskii parameters for C-C, C-H and H-H interactions in organic molecular crystals. (author)

  16. The genetic variation of SORCS1 is associated with late-onset Alzheimer's disease in Chinese Han population.

    Directory of Open Access Journals (Sweden)

    Wei Xu

    Full Text Available The variations of SORCS1 gene may play potential key roles in late-onset Alzheimer's disease (LOAD. To evaluate the relationship between the polymorphism of SORCS1 gene and LOAD in the ethnic Han Chinese, we conducted a case-control study to investigate the association between the single-nucleotide polymorphisms (SNPs in intron 1 of SORCS1 and LOAD in Chinese Han population. Six reported SNPs in intron 1 of SORCS1 were analyzed by Snapshot, genotyping and haplotyping in 236 Chinese LOAD cases and 233 matched controls. The significant differences in frequencies of two SNPs (rs10884402, rs950809 were found between the two groups. In addition, haplotype analyses revealed that, in the LOAD group, the frequency of haplotypes C-C-G-T-C (alleles in order of rs17277986, rs6584777, rs10884402, rs7078098, rs950809 polymorphisms were significantly higher (Psim<0.0001 while haplotype C-C-A-T-C, C-C-A-C-C, T-T-A-C-C were significantly lower (Psim<0.0001. Our data suggested that the genetic variation of the rs10884402 and rs950809 in intron 1 of SORCS1 was associated with the late-onset AD in the Chinese Han population.

  17. The SLANG/CIAO Synergy: Using S-Lang within CIAO

    Science.gov (United States)

    Germain, G.; Milaszewski, R.; McLaughlin, W.; Miller, J.

    2004-07-01

    The integration of S-Lang into the Chandra Interactive Analysis of Observations (CIAO) infrastructure has transformed the capabilities of CIAO. There are several ways to use S-Lang. One is to write a S-Lang function which can be called from C/C++, CIAO applications, or any S-Lang prompt. Another is to write a C/C++ program which is made into a S-Lang intrinsic, allowing it to be called from any S-Lang script. The key element is that a C/C++ or CIAO application can call a S-Lang function/intrinsic, and that a S-Lang function/intrinsic can call a C/C++ or CIAO application. To use this capability, data must be exchanged between the C/C++ space and S-Lang space. This paper describes some of the mechanisms available for that data exchange. These mechanisms are illustrated through simple C/C++ and S-Lang program pairs, the S-Lang intrinsic methodology used by the CIAO S-Lang function ``univar'', and the use of the VARMM library by CIAO functions: Chandra Imaging and Plotting Software (ChIPS) UNIVAR, and the Graphical File Browser (PRISM) ``histogram''.

  18. 4-Bromo-N-(di-n-propyl-carbamothioyl)-benzamide.

    Science.gov (United States)

    Binzet, Gün; Flörke, Ulrich; Külcü, Nevzat; Arslan, Hakan

    2009-02-04

    The synthesis of the title compound, C(14)H(19)BrN(2)OS, involves the reaction of 4-bromo-benzoyl chloride with potassium thio-cyanate in acetone followed by condensation of the resulting 4-bromo-benzoyl isothio-cyanate with di-n-propyl-amine. Typical thio-urea carbonyl and thio-carbonyl double bonds, as well as shortened C-N bonds, are observed in the title compound. The short C-N bond lengths in the centre of the mol-ecule reveal the effects of resonance in this part of the mol-ecule. The asymmetric unit of the title compound contains two crystallographically independent mol-ecules, A and B. There is very little difference between the bond lengths and angles of these mol-ecules. In mol-ecule B, one di-n-propyl group is twisted in a -anti-periplanar conformation with C-C-C-H = -179.1 (3)° and the other adopts a -synclinal conformation with C-C-C-H = -56.7 (4)°; in mol-ecule A the two di-n-propyl groups are twisted in + and -anti-periplanar conformations, with C-C-C-H = -179.9 (3) and 178.2 (3)°, respectively. In the crystal, the mol-ecules are linked into dimeric pairs via pairs of N-H⋯S hydrogen bonds.

  19. A polymorphism near IL28B is associated with spontaneous clearance of acute hepatitis C virus and jaundice.

    Science.gov (United States)

    Tillmann, Hans L; Thompson, Alex J; Patel, Keyur; Wiese, Manfred; Tenckhoff, Hannelore; Nischalke, Hans D; Lokhnygina, Yuliya; Kullig, Ulrike; Göbel, Uwe; Capka, Emanuela; Wiegand, Johannes; Schiefke, Ingolf; Güthoff, Wolfgang; Grüngreiff, Kurt; König, Ingrid; Spengler, Ulrich; McCarthy, Jeanette; Shianna, Kevin V; Goldstein, David B; McHutchison, John G; Timm, Jörg; Nattermann, Jacob

    2010-11-01

    A single nucleotide polymorphism (SNP) upstream of the IL28B gene has been associated with response of patients with chronic hepatitis C to therapy with pegylated interferon and ribavirin and also with spontaneous clearance of acute hepatitis C in a heterogeneous population. We analyzed the association between IL28B and the clinical presentation of acute hepatitis C virus (HCV) infection in a homogeneous population. We analyzed the SNP rs12979860 in 190 women from the German anti-D cohort (infected with HCV genotype 1b via contaminated rhesus prophylaxis) and its association with spontaneous clearance. Clinical data were available in 136 women with acute infection who were also evaluated for IL28B genotype. Based on results of a TaqMan polymerase chain reaction assay, the rs12979860 SNP genotypes studied were C/C, C/T, or T/T. Spontaneous clearance was more common in patients with the C/C genotype (43/67; 64%) compared with C/T (22/90; 24%) or T/T (2/33; 6%) (P Jaundice during acute infection was more common among patients with C/C genotype (32.7%) than non-C/C patients (with C/T or T/T) (16.1%; P = .032). In C/C patients, jaundice during acute infection was not associated with an increased chance of spontaneous clearance (56.3%) compared with those without jaundice (60.6%). In contrast, in non-C/C patients, jaundice was associated with a higher likelihood of spontaneous clearance (42.9%) compared with those without jaundice (13.7%). The SNP rs12979860 upstream of IL28B is associated with spontaneous clearance of HCV. Women with the C/T or T/T genotype who did not develop jaundice had a lower chance of spontaneous clearance of HCV infection. Copyright © 2010 AGA Institute. Published by Elsevier Inc. All rights reserved.

  20. Thermal and structural analysis of the TPX divertor

    International Nuclear Information System (INIS)

    Reis, E.E.; Baxi, C.B.; Chin, E.; Redler, K.M.

    1995-01-01

    The high heat flux on the surfaces of the TPX divertor will require a design in which a carbon-carbon (C-C) tile material is brazed to water cooled copper tubes. Thermal and structural analyses were performed to assist in the design selection of a divertor tile concept and C-C material. The relevancy of finite element analysis (FEA) for evaluating tile design was examined by conducting a literature survey to compare FEA stress results to subsequent brazing and thermal test results. The thermal responses for five tile concepts and four C-C materials were analyzed for a steady-state heat flux of 7.5 MW/m 2 . Elastic-plastic stress analyses were performed to calculate the residual stresses due to brazing C-C tiles to soft copper heat sinks for the various tile designs. Monoblock and archblock divertor tile concepts were analyzed for residual stresses in which elevated temperature creep effects were included with the elastic-plastic behavior of the copper heat sink for an assumed braze cooldown cycle. As a result of these 2D studies, the archblock concept with a 3D fine weave C-C was initially found to be a preferred design for the divertor. A 3D elastic-plastic analysis for brazing of the arch block tile was performed to investigate the singularity effects at the C-C to copper interface in the direction of the tube axis. This analysis showed that the large residual stresses at the tube and tile edge intersection would produce cracks in the C-C and possible delamination along the braze interface. These results, coupled with the difficulties experienced in brazing archblocks for the Tore Supra Limiter, required that other tile designs be considered