
Sample records for spirulina platensis protean

  1. Response of Spirulina Platensis to Sulfamethazine Contamination (United States)

    Xu, Xiankuan; Lu, Xiaohong; Ma, Xiangjuan; Xia, Huilong


    The interaction between a positive important biological energy source algae Spirulina platensis and an antimicrobial drug sulfamethazine was studied by a panel of bioassays. The result demonstrated that the acute toxicity of sulfadimidine on Spirulina platensis gradually increased with the increasing of the concentration of sulfadimidine. During the exposure, the toxicity of sulfamethazine on Spirulina platensis enlarged at first and reduced thereafter, and the summit was at 48 h, showing a typical “bell” curve. The EC50 in 48 h was 6.06 mg/L. Spirulina platensis was able to accumulate and degrade sulfamethazine simultaneously. The amounts of sulfamethazine accumulated and degraded by Spirulina platensis were 1.40 mg/kg and 0.64 mg/kg (dry weight) at 24 h, respectively. After 96 h of exposure, the accumulation decreased to 0.47 mg/kg, however, the degradation of sulfamethazine increased to 6.57 mg/kg. Due to biological activity, the removal rate of sulfamethazine was 5.2 times in the nutrient solution with Spirulina platensis as that of without Spirulina platensis. The results of this study implied that Spirulina platensis had a potential to remove sulfamethazine in the sulfamethazine contaminated aquatic ecosystems.

  2. Effect of Spirulina platensis powder on metabolic syndrome in ...

    African Journals Online (AJOL)

    S. platensis inhibits also hemolysis of erythrocytes induced by AAPH. In conclusion, S. platensis powder prevent metabolic syndrome induced by high fructose and fat diet. These results justify the use of the plant in the treatment of diabetes in Benin. Keywords: Spirulina platensis, metabolic syndrome, fructose, diabetes, ...

  3. The nutritional quality of Spirulina platensis of Tamenrasset, Algeria

    African Journals Online (AJOL)



    May 13, 2015 ... Key words: Spirulina platensis, nutritional, quality, proteins, fatty acids. ... advantages make S. platensis a good raw material for the healthy food (Anitha and ... The fat content is determined by the Soxhlet extraction method by using .... human milk and some expensive vegetable oils according to Pierlovisi ...

  4. Effect of feeding duration of Spirulina platensis on growth ...

    African Journals Online (AJOL)

    Spirulina platensis is a good candidate as an in-feed antibiotics substitute for broilers. However, its use seems impractical owing to its high price, especially when being administered throughout the whole rearing period. This study aimed to investigate the effects of feeding duration of S. platensis on growth, haematological ...

  5. The nutritional quality of Spirulina platensis of Tamenrasset, Algeria ...

    African Journals Online (AJOL)

    Spirulina platensis, a blue green microalga, has been used since ancient times as a source of food because of its high protein content (65%) and nutritional value. Lipids isolated from S. platensis have been shown to contain high levels of polyunsaturated fatty acids, including linolenic acid which is a precursor of ...

  6. Antioxidant potential of selected Spirulina platensis preparations. (United States)

    Dartsch, Peter C


    Recent studies suggest that Spirulina, a unicellular blue-green alga, may have a variety of health benefits and therapeutic properties and is also capable of acting as an antioxidant and antiinflammatory agent. In this study, a cell-free and a cell-based test assay were used to examine the antioxidant and antiinflammatory properties of four selected Spirulina platensis preparations: (1) Biospirulina, (2) SpiruComplex, a preparation with naturally bound selenium, chromium and zinc, (3) SpiruZink, a preparation with naturally bound zinc, (4) Zinkspirulina + Acerola, a preparation with naturally bound zinc and acerola powder. The cell-free test assay used potassium superoxide as a donor for superoxide radicals, whereas the cell-based test assay used the formation of intracellular superoxide radicals of functional neutrophils upon stimulation by phorbol-12-myristate-13-acetate as a model to investigate the potential of Spirulina preparations to inactivate superoxide radicals. In accordance with the recommended daily dosage, test concentrations ranging from 50 to 1000 microg/mL were chosen. The results showed a dose-dependent inactivation of free superoxide radicals (antioxidant effect) as well as an antiinflammatory effect characterized by a dose-dependent reduction of the metabolic activity of functional neutrophils and a dose-dependent inactivation of superoxide radicals generated during an oxidative burst. The results demonstrate that the tested Spirulina preparations have a high antioxidant and antiinflammatory potential. Especially SpiruZink and Zinkspirulina + Acerola might be useful as a supportive therapeutic approach for reducing oxidative stress and/or the generation of oxygen radicals in the course of inflammatory processes.

  7. Formulation of Red Seaweed and Spirulina platensis Based Jelly Drinks

    Directory of Open Access Journals (Sweden)

    Wini Trilaksani


    Full Text Available Generally, jelly drinks in the market contain synthetic sweeteners, coloring and flavoring agents, as well as low in nutrients content, therefore it needs to be developed in order to obtain more healthy product by adding seaweed and Spirulina. The aims of this research were to determine the best formula of jelly drinks with seaweed (Eucheuma cottonii and Spirulina platensis and to compare the characteristics (nutrients and antioxidant activity of jelly drinks made from culture-based Spirulina and from commercial Spirulina. Jelly drinks made from commercial Spirulina (0.2%; 0.4%; and 0.6% had protein content 1.218-2.750% (db and the IC50 value was 3363.5-6070 ppm. Bayes test showed that jelly drink with commercial Spirulina 0.4% was the selected product and was used as the reference formula on this research. Types of Spirulina (commercial and culture gave no significant effect (p>0.05 to the hedonic test results and antioxidant activity however affected significantly on protein content (p<0.05. Jelly drink supplemented with 0.4% of culture-based Spirulina produced 92 kcal of energy; meanwhile the jelly drink with 0.4% of commercial Spirulina produced 79 kcal of energy. Keywords: Dietary fiber, jelly drink, protein, seaweed, Spirulina platensis

  8. Formulation of Red Seaweed and Spirulina platensis Based Jelly Drinks

    Directory of Open Access Journals (Sweden)

    Wini Trilaksani


    Full Text Available Generally, jelly drinks in the market contain synthetic sweeteners, coloring and flavoring agents, as well as low in nutrients content, therefore it needs to be developed in order to obtain more healthy product by adding seaweed and Spirulina. The aims of this research were to determine the best formula of jelly drinks with seaweed (Eucheuma cottonii and Spirulina platensis and to compare the characteristics (nutrients and antioxidant activity of jelly drinks made from culture-based Spirulina and from commercial Spirulina. Jelly drinks made from commercial Spirulina (0.2%; 0.4%; and 0.6% had protein content 1.218-2.750% (db and the IC50 value was 3363.5-6070 ppm. Bayes test showed that jelly drink with commercial Spirulina 0.4% was the selected product and was used as the reference formula on this research. Types of Spirulina (commercial and culture gave no significant effect (p>0.05 to the hedonic test results and antioxidant activity however affected significantly on protein content (p<0.05. Jelly drink supplemented with 0.4% of culture-based Spirulina produced 92 kcal of energy; meanwhile the jelly drink with 0.4% of commercial Spirulina produced 79 kcal of energy.

  9. Extraction and In Vitro Antimalarial Activity Phycocyanin from Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Diah Anggraini


    Full Text Available Phycocyanin is biopigment found only in a conductor such as Spirulina platensis. Phycocyanin from Nostoc can inhibit Plasmodium falciparum with IC50 8.4 μg/mL so that phycocyanin from S. platensis also can inhibit P. falciparum like Nostoc. The aim of this study was to determine the best method for phycocyanin extraction using three solvents. They were phosphate buffer, water, and aseton. Spirulina were cultured in the conditions intensity of light 3000 Lux, salinity 15 ppt, dark-light 8-16 hours. The response parameters of this study were C-phycocyanin (C-PC content, yield, and protein content. Yield biomass of Spirulina which cultivated using toplest was higher than the aquarium. The best solvent for phycocyanin extraction was a phosphate buffer with C-PC content, yield, and protein content 8 mg/mL, 202.26 mg/g, and 1.88%.

  10. Production of Spirulina platensis by adding sodium bicarbonate and ...

    African Journals Online (AJOL)

    In this study, dry chicken manure (DCM) was used as the source of nitrogen in the production of Spirulina platensis. Experiment was conducted in two different types of nutrition. In the type I nutrition, the highest average cell increase was recorded as 289.70 filaments mL-1 in value in the type I group (DCM+urea). In the type ...

  11. Effets des extraits ou de la poudre de Spirulina platensis et Jatropha ...

    African Journals Online (AJOL)


    30 juin 2015 ... générale, les extraits ou la poudre de Spirulina platensis ont eu des ... Mots clés: Biostimulant, croissance, Spirulina platensis, Jatropha curcas, Solanum lycopersicum .... Le test de ..... in antioxidant metabolites, enzymes, and.

  12. Improvement the Yoghurt Nutritional Value, Organoleptic Properties and Preferences by Spirulina (Spirulina platensis) Supplementation (United States)

    Suzery, M.; Hadiyanto; Sutanto, H.; Widiastuti, Y.; Judiono


    Spirulina sp has been identified as potential source food functional such as protein, amino acids and other high added value compounds from microalgae. One of the compounds is phycocyanin as also known for antioxidant use. This research was aimed to increase the nutritional value and organoleptic properties and preferences yoghurt by Spirulina platensis supplementation. Completely randomized controlled group design conducted by 31 respondents. Spirulina Research accomplished in Food Technology, Microbiology and Chemistry Laboratory at Bandung Health Polytechnic in Bandung. Samples divided randomly into three groups: (1) yoghurt standard supplemented 50 ml, (2) yoghurt and spirulina 1% supplemented 50 ml, (3) yoghurt and spirulina 1,2% supplemented 50 ml. Spirulina was added concentration by 0, 1, 1,2 % calculated by dx trial. Proximate analysis revealed the highest protein in enriched by spirulina 1%. However fat was lower 3.48 – 3.56 compare to control. All products found growing Lactobacillus acidophilus with a pH of 4.0 range. There was no microbial contamination such as E coli, Salmonella sp, Pseudomonas sp. Supplementation of spirulina to yoghurt products can be accepted by organoleptic, chemical and microbiological tests of concentrations of 1 and 1.2%. The material makes the blue colours more attractive and can be accepted by the expert panellist.


    Directory of Open Access Journals (Sweden)

    Zainal Syam Arifin


    Full Text Available Increasing the population impact on increasing energy demand. On the other hand, the energy generation industry has been blamed as one of the contributors of carbon dioxide about 25% of total CO2 emissions worldwide. Meanwhile, the production of biogas, which aims to address the increasing need of energy, produces carbon dioxide in the range of 25–50% by volume. To overcome this, a cheap method, optimum and efficient as well as environmentally friendly in reducing CO2 levels by using Spirulina platensis is needed. This research aims to created a mathematical models and found the optimum flow rate to reduced levels of CO2 by using Spirulina platensis. This study used a glass tubular bioreactor (D = 2.6 cm at a temperature of 30°C and irradiated with a fluorescent lamp Philips TL 36 Watt, color temperature: 6,200K cool daylight, light output: 2,600 lm, 72 lm/W. Tubular reactor was placed in a box lined with silver foil walls on three sides. With mathematical models of tubular reactor, the reaction rate constants could be predicted. Based on calculations of data and graphs, optimum volumetric velocity could also be predicted. Variation of flowrate to observed the reduction rate of CO2 was 0.25 mL/sec, 0.35 mL/sec, 0.5 mL/sec, 0.75 mL/sec, 1 mL/sec. Carbon source was 99.99% CO2.Observations of Spirulina growth was made on the flow rate of 0.25 mL/sec at the initial levels of dry weight 2.1208 g/L. The results of this study indicated that the low flowratewas a more effective way to reduced carbon dioxide levels using Spirulina platensis (= 2.82×10-4 sec-1. The highest conversion was obtained at a volumetric flow rate of 0.25 mL/sec and optimum speeds in the range of 0.3 to 0.4 mL/sec. The rate of incoming CO2 flux should be less than 0.047 mL/cm2.detik. Specific Growth Rate (µ of Spirulina platensis in this study was 2.56×10-2 minute-1.   Keywords: Spirulina platensis, a vertical tubular bioreactor, CO2 reduction     ABSTRAK

  14. Development of cassava doughnuts enriched with Spirulina platensis biomass Desenvolvimento de 'sonho de mandioca' enriquecido com biomassa de Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Samantha Ferreira Rabelo


    Full Text Available The cyanobacteria Spirulina platensis has been cultivated in a fed batch process with urea as the nitrogen source, in order to obtain dehydrated biomass for incorporation into food, aiming at nutritional enrichment and the production of a functional character, due to the amount of proteins, vitamins and several bioactive compounds found in this cyanobacterium. In this study, response surface methodology was used to analyze the substitution of wheat flour by cassava in the development of doughnuts with added Spirulina platensis biomass and inverted sugar, in order to increase the rate of the Maillard's reaction and mask the green colour of the biomass. The formulations were evaluated in relation to their proximate, sensory and technological compositions, which, when compared to the standard formulation, without the addition of S. platensis biomass and inverted sugar, showed the feasibility of adding the biomass to bestow nutritional enrichment without significantly affecting the sensory acceptance of the product or its typical characteristics.Cultivos da cianobactéria Spirulina platensis vêm sendo conduzidos utilizando-se ureia como fonte de nitrogênio, em processo descontínuo alimentado, para obtenção de biomassa desidratada para ser incorporada em alimentos visando enriquecimento nutricional e conferir caráter funcional em virtude da composição rica em proteínas, vitaminas e diversos componentes bioativos. Neste trabalho, foi estudada a substituição da farinha de trigo pela mandioca, além da adição de biomassa de Spirulina platensis e açúcar invertido, para desenvolver um 'sonho' com elevada taxa da Reação de Maillard para mascarar a coloração verde da biomassa, por meio da metodologia de superfície de resposta. As formulações foram avaliadas em relação aos aspectos de composição centesimal, sensoriais e tecnológicos que, quando comparados com o padrão, sem adição de biomassa de S. platensis e açúcar invertido

  15. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis

    International Nuclear Information System (INIS)

    Fang Linchuan; Zhou Chen; Cai Peng; Chen Wenli; Rong Xingmin; Dai Ke; Liang Wei; Gu Jidong; Huang Qiaoyun


    Highlights: → The carboxyl groups play a vital role in the binding of Cu(II) and Cd(II) to S. platensis cells. → Ion exchange and complexation are the dominating mechanism for Cu(II) and Cd(II) adsorption. → XAFS analysis provided evidence for the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. - Abstract: Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH 4 NO 3 , respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface.

  16. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis

    Energy Technology Data Exchange (ETDEWEB)

    Fang Linchuan [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Zhou Chen; Cai Peng [Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China); Chen Wenli [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Rong Xingmin; Dai Ke; Liang Wei [Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China); Gu Jidong [Department of Ecology and Biodiversity, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong); Huang Qiaoyun, E-mail: [State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural University, Wuhan 430070 (China); Key Laboratory of Subtropical Agricultural Resources and Environment, Ministry of Agriculture, College of Resources and Environment, Huazhong Agricultural University, Wuhan 430070 (China)


    Highlights: {yields} The carboxyl groups play a vital role in the binding of Cu(II) and Cd(II) to S. platensis cells. {yields} Ion exchange and complexation are the dominating mechanism for Cu(II) and Cd(II) adsorption. {yields} XAFS analysis provided evidence for the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. - Abstract: Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH{sub 4}NO{sub 3}, respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface.

  17. Binding characteristics of copper and cadmium by cyanobacterium Spirulina platensis. (United States)

    Fang, Linchuan; Zhou, Chen; Cai, Peng; Chen, Wenli; Rong, Xingmin; Dai, Ke; Liang, Wei; Gu, Ji-Dong; Huang, Qiaoyun


    Cyanobacteria are promising biosorbent for heavy metals in bioremediation. Although sequestration of metals by cyanobacteria is known, the actual mechanisms and ligands involved are not very well understood. The binding characteristics of Cu(II) and Cd(II) by the cyanobacterium Spirulina platensis were investigated using a combination of chemical modifications, batch adsorption experiments, Fourier transform infrared (FTIR) spectroscopy and X-ray absorption fine structure (XAFS) spectroscopy. A significant increase in Cu(II) and Cd(II) binding was observed in the range of pH 3.5-5.0. Dramatical decrease in adsorption of Cu(II) and Cd(II) was observed after methanol esterification of the nonliving cells demonstrating that carboxyl functional groups play an important role in the binding of metals by S. platensis. The desorption rate of Cu(II) and Cd(II) from S. platensis surface was 72.7-80.7% and 53.7-58.0% by EDTA and NH(4)NO(3), respectively, indicating that ion exchange and complexation are the dominating mechanisms for Cu(II) and Cd(II) adsorption. XAFS analysis provided further evidence on the inner-sphere complexation of Cu by carboxyl ligands and showed that Cu is complexed by two 5-membered chelate rings on S. platensis surface. Copyright © 2011 Elsevier B.V. All rights reserved.

  18. Fresh pasta production enriched with Spirulina platensis biomass

    Directory of Open Access Journals (Sweden)

    Ailton Cesar Lemes


    Full Text Available The aim of this work was to study the enrichment of Spirulina platensis in wheat flour to prepare fresh pasta to evaluate the green color and nutritional enrichment in addition to functional properties due to the presence of the bioactive compounds in the cyanobacterium. The pastas were evaluated for the centesimal composition, microbiological contamination, sensorial acceptance and technological characteristics such as cooking time, water absorption, volume displacement and loss of solids. The superior protein contents and the satisfactory technological and sensorial attributes compared with the control with no cyanobacterium showed the usefulness of incorporating S. platensis biomass in the fresh pastas. The microbiological quality was in compliance with the legislation in force. The sensorial quality was considered satisfactory (“liked very much” and purchase intention high (“probably would buy”.

  19. Effect of microalga Spirulina platensis (Arthrospira platensis on hippocampus lipoperoxidation and lipid profile in rats with induced hypercholesterolemia

    Directory of Open Access Journals (Sweden)

    Telma Elita Bertolin


    Full Text Available Studies have been conducted on microalga Spirulina platensis (Arthrospira platensis due to its therapeutic potential in several areas, including the capacity for preventing and decreasing the damages caused by hyperlipidemia and the antioxidant activity. The aim of the study was to evaluate the effect of microalga Spirulina platensis on hippocampus lipoperoxidation and lipid profile in rats with induced hypercholesterolemia during 60 days. The measurement of hippocampus lipoperoxidation did not demonstrate significant difference (p>0.05 when Spirulina platensis was added to hypercholesterolemic diet. The evaluation of lipid profile showed that the administration of the microalga in therapeutic and preventive ways led to a significant protective effect (pA microalga Spirulina platensis (Arthrospira platensis vem sendo fonte de pesquisas devido a evidências de seu potencial terapêutico em diversas áreas, dentre elas a capacidade de prevenção e diminuição dos danos causados por dislipidemias e sua atividade antioxidante. Objetivou-se avaliar o efeito da microalga Spirulina platensis sobre a lipoperoxidação no hipocampo e perfil lipídico sérico em ratos com hipercolesterolemia induzida durante 60 dias. A dosagem da lipoperoxidação no hipocampo não demonstrou diferença significativa (p>0,05 quando Spirulina platensis foi adicionada na dieta hipercolêsterolemica. A avaliação do perfil lipídico demonstrou que a administração da microlaga de forma terapêutica e preventiva demonstrou efeito significativo (p<0,05 na proteção do desenvolvimento de hipercolesterolemia.


    Directory of Open Access Journals (Sweden)

    Bakti Jos


    Full Text Available The growing awareness of the importance of natural colours especially food and cosmetic colorants has placedgreat demand on biological sources of natural colours. It is for this reason that the phycobiliproteins inSpirulina platensis is gaining increasing attention as an alternative colour for these products. Numerousscientific reports confirm the fact that Phycocyanin from Spirulina platensis, is not only an effective naturalblue colorant, but also a compound that is beneficial to the health of the consumer. The aim of this research is toconduct evaluation studies phycocyanin production by extraction with polar solvents at various concentrationsto obtain extracts for maximum yield. The methods in this study has several stages, namely preparation ofmaterials, extraction, solubility studies of phycocyanin, phycocyanin’s stability test. Changing variables in thisstudy are water, acetic acid 70%, 75%, 80%, ammonium sulphate 50%, 55%, 60%. The analysis of the extractsof phycocyanin’s content using spectrophotometric methods. The observations produces a blue pigment whichhas the highest color intensity with maximum absorbance of 620 nm. Acetic acid 80% is the most effectivesolvent to extract the blue pigment phycocyanin than water and ammonium sulfate. Extraction is influenced bythe pH of the increase in absorption (absorbance with increasing pH and was not influenced by storagetemperature and time

  1. Culture of microalgae Spirulina platensis with isotope stable Carbon-13

    International Nuclear Information System (INIS)

    Cronemberger, Luiz C.A.; Costa, Vladimir E.


    Gastric emptying time abnormalities cause complications that affect the quality of life in humans and scintigraphy is the gold standard for this diagnosis. However its application has restrictions due to the use of the radiopharmaceutical 99m Tc. An alternative to this method is the stable carbon isotope respiratory test. This is a non-radioactive, noninvasive technique with no contraindications. Its application varies according to the substrate used. For evaluation of gastric emptying time one of the substrates that can be used in the respiratory test is Spirulina platensis labeled at 97% carbon atoms with the stable isotope carbon-13 ( 13 C). In Brazil, there is no production of this substrate and its high cost (US$475.00/g, excluding import taxes) makes it difficult to apply the test. Thus, the objective of the work is to cultivate labeled S. platensis at 97% of 13 C for use in the respiratory test for gastric emptying and to establish optimization parameters for the best cost-benefit of this culture. In the cultivation process the microalgae will be kept in a closed sterilized glass volumetric flask, with deionized water and a pure 13 C source. The light (photoperiod 12h light / dark), pH (∼ 9.5) and temperature (30 deg C) will be controlled and after 35-40 days of growth, the cyanobacteria will be lyophilized and ground for the acquisition of a powder that will be analyzed by IRMS and compared to S. platensis, which will be our reference standard

  2. Experimental grounds for developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Frontas'eva, M.V.; Pavlov, S.S.; Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.


    The possibility of using blue-green algae Spirulina platensis as a matrix for production of the selenium- and iodine-containing pharmaceuticals was studied. The dependence of Se and I accumulation in Spirulina biomass during the cultivation in a nutrient medium loading of above elements was determined more precisely. The dynamics of Spirulina biomass growth was observed with nutrient medium loading of selenium. It is found that Spirulina platensis biomass quality may be used for pharmaceutical purposes

  3. Equilibrium and thermodynamics of azo dyes biosorption onto Spirulina platensis

    Directory of Open Access Journals (Sweden)

    G. L. Dotto


    Full Text Available The equilibrium and thermodynamics of azo dye (tartrazine and allura red biosorption onto Spirulina platensis biomass were investigated. The equilibrium curves were obtained at 298, 308, 318 and 328 K, and four isotherm models were fitted the experimental data. Biosorption thermodynamic parameters (ΔG, ΔH and ΔS were estimated. The results showed that the biosorption was favored by a temperature decrease. For both dyes, the Sips model was the best to represent the equilibrium experimental data (R²>0.99 and ARE<5.0% and the maximum biosorption capacities were 363.2 and 468.7 mg g-1 for tartrazine and allura red, respectively, obtained at 298 K. The negative values of ΔG and ΔH showed that the biosorption of both dyes was spontaneous, favorable and exothermic. The positive values of ΔS suggested that the system disorder increases during the biosorption process.

  4. JST Thesaurus Headwords and Synonyms: Spirulina platensis [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Spirulina platensis 名詞 一般 * * * *... スピルリナ スピルリナ スピルリナ Thesaurus2015 200906003891090957 C LS06 UNKNOWN_2 Spirulina platensis

  5. Epithermal neutron activation analysis of blue-green algae Spirulina Platensis as a matrix for selenium-containing pharmaceuticals

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Kirkesali, E.I.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Gundorina, S.F.; Oprea, C.D.


    To evaluate the potentiality of the blue-green algae Spirulina Platensis as a matrix for the production of Se-containing pharmaceuticals, the background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p)-reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina Platensis biomass were determined by means of epithermal neutron activation analysis. The possibility of the purpose-oriented incorporation of Se into Spirulina Platensis biomass was demonstrated. The polynomial dependence of the Se accumulation on nutritional medium loading was revealed. The employed analytical technique allows one to reliably control the amount of toxic elements in algae Spirulina Platensis. Based on this study, a conclusion of the possibility to use Spirulina Platensis as a matrix for the production of Se-containing pharmaceuticals was drawn

  6. Technological and nutritional assessment of dry pasta with oatmeal and the microalga Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Fernanda Arnhold Pagnussatt


    Full Text Available Wheat flour is the most important raw material in the production of pasta. The production process consists of mixing water and flour, kneading, extrusion and drying. Oats and the microalga Spirulina platensis play a physiological role in the growth, development and maintenance of the human organism due to their high nutritional value. The aim of this study was to assess the technological and nutritional properties of dry pasta prepared with the addition of oatmeal and Spirulina platensis. The wheat flour was characterized and the effect of partial replacement by oatmeal and Spirulina platensis (Arthrospira platensis was evaluated using response surface methodology (RSM. The mixtures were analysed for moisture, protein, ash, colour, particle size, falling number and alveography. The formulated pastas were dried and evaluated for moisture, colour, cooking test, acidity, proximate composition and amino acids. Generally, the addition of Spirulina platensis influenced the soluble solids content and colour of the pasta, while the oatmeal mainly affected the acid content. The oatmeal increased the values of crude protein and total dietary fibre (13.06% when compared with the commercial pasta (2.40% and may be considered as a source of fibre.

  7. Medical Application of Spirulina platensis Derived C-Phycocyanin

    Directory of Open Access Journals (Sweden)

    Qian Liu


    Full Text Available Along with the development of marine biological pharmaceutical research, high-effective and low-toxic drugs and functional foods isolated from marine organisms have become a new field of pharmacy and bromatology. The pharmacological actions, such as anti-inflammation, antioxidation, antitumor, immunological enhancement, and hepatorenal protection of C-phycocyanin (C-PC from Spirulina platensis, have been reported, and C-PC has important value of development and utilization either as drug or as functional food. There are many researches about the various pharmacological actions and mechanisms of C-PC, but related reports are only to some extent integrated deeply and accurately enough, which put some limitations to the further application of C-PC in medicine. Particularly, with the improvement of living standards and attention to health issues, C-PC being a functional food is preferred by more and more people. C-PC is easy to get, safe, and nontoxic; thus, it has a great potential of research and development as a drug or functional food. Here, the separation and purification, physicochemical properties, physiological and pharmacological activities, safety, and some applications are reviewed to provide relevant basis for the development of natural medicine and applied products.

  8. Effect of Spirulina platensis Supplementation by Different Concentration in Diet on Red Color Intensity of Kohaku Koi (Cyprinus carpio L.

    Directory of Open Access Journals (Sweden)

    N.B.P Utomo


    Full Text Available Kohaku koi (Cyprinus carpio is one of the fancy koi that has a high price.  Red color intensity of kohaku determines its market price.  This study was performed to verify the effect of Spirulina platensis supplementation in diet  with different dosages (1, 3 and 5% on red color intensity of kohaku koi.  The result of study show that inclusion of Spirulina platensis in the diet increased intensity of koi color.  Feeding with  1% of Spirulina platensis enriched paste diet for 5 weeks resulted in  a brighter red color compared to other treatments and control.   Alteration of red color intensity has not been followed by its patch length.  No effect of Spirulina supplementation on koi growth by weight and length were observed. Keywords: Spirulina platensis, color, kohaku, koi, Cyprinus carpio   ABSTRAK Ikan koi kohaku (Cyprinus carpio L merupakan salah satu jenis ikan koi yang memiliki harga tinggi.  Kecerahan warna merah ikan koi kohaku menentukan harga jualnya.  Penelitian ini untuk mengetahui pengaruh penambahan Spirulina platensis in the diet dengan dosis berbeda (1, 3 dan 5% terhadap kualitas warna merah koi kohaku.  Hasil penelitian ini menunjukkan bahwa penambahan Spirulina platensis melalui pakan dapat meningkatkan kualitas warna pada ikan koi. Pemberian pakan berupa pasta yang diperkaya dengan Spirulina platensis sebanyak 1% selama 5 minggu menghasilkan warna merah lebih cerah dibandingkan perlakuan lainnya dan kontrol. Perubahan warna yang terjadi tidak diikuti oleh perubahan panjang bercak warnanya. Penambahan Spirulina pada pakan tidak berpengaruh pada pertumbuhan berat dan panjang ikan koi. Kata kunci: Spirulina platensis, warna, kohaku, koi, Cyprinus carpio

  9. Arthrospira (Spirulina) platensis supplementation affects folliculogenesis, progesterone and ghrelin levels in fattening pre-pubertal gilts

    NARCIS (Netherlands)

    Abadjieva, Desislava; Nedeva, Radka; Marchev, Yordan; Jordanova, Gergana; Chervenkov, Mihail; Dineva, Julieta; Shimkus, Almantas; Shimkiene, Aldona; Teerds, Katja; Kistanova, Elena


    The aim of the present investigation was to study the effect of Arthrospira (Spirulina) platensis supplemented diet on follicular development and related endocrine parameters, such as estradiol and progesterone levels as well as ghrelin levels in pre-pubertal gilts. Twenty-one 60-day-old Danube

  10. Epithermal neutron activation analysis of Spirulina platensis biomass, of the C-phycocianin and of DNA extracted from it

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Pomyakushina, E.V.


    The epithermal neutron activation analysis (ENAA) was used for study of the biomass of Spirulina platensis. The background levels of concentration of 27 macro-, micro- and trace elements ranging from 10 -3 up to 10 4 ppm were determined. It was found that the biomass of Spirulina does not contain toxic elements above the tolerance levels and can be utilized as a matrix of pharmaceuticals based on it. The concentrations of basic elements in C-phycocianin and DNA extracted from Spirulina platensis were determined by ENAA. A comparison of the element content of a whole Spirulina biomass with that of a refined C-phycocianin preparation was made

  11. Epithermal Neutron Activation Analysis of Spirulina platensis Biomass, of the C-Phycocianin and of DNA Extracted from It

    CERN Document Server

    Mosulishvili, L M; Belokobylsky, A I; Kirkesali, E I; Khizanishvili, A I; Pomyakushina, E V


    The epithermal neutron activation analysis (ENAA) was used for study of the biomass of Spirulina platensis. The background levels of concentration 27 macro-, micro- and trace elements ranging from 10^{-3} up to 10^{4} ppm were determined. It was found that the biomass of spirulina does not contain toxic elements above the tolerance levels and can be utilized as a matrix of pharmaceuticals based on it. The concentrations of basic elements in C-phycocianin and DNA extracted from Spirulina platensis were determined by ENAA. A comparison of the element content of a whole spirulina biomass with that of a refined C-phycocianin preparation was made.


    Directory of Open Access Journals (Sweden)

    Haryo Kuntoro Adi


    Full Text Available The using of Spirulina platensis as Supplement of Single-Celled Protein (SCP to Mice. High protein in Spirulina platensis can be used as a source of Single-Celled Protein. By using mice (Mus musculus as a animal laboratory, the objective of this research is to know the influence of Biomass S. platensis to the increase of body weight of mice. The name of species is Mus musculus, strain is Swiss derivate. Utilized mice were male, 30-50 weighing gram, and 5-7 weeks of age. Treatment group was given by palette and given by biomass of S. Platensis, while control also fed palette but did not give biomass of S. platensis. Yielded biomass was used as food mixed with palette with composition of dry biomass S. platensis with palette was 0%, 10%, 20%, 30%, 40%, and 50%. Data analysis was conducted by using t-tes and analysis of variance. The results showed that by giving of dry biomass of S. platensis affected to the increasement of body weight from the first day until twelfth day of observation, and decrease on the thirteenth and fourteenth day. Pursuant to result of statistic, there is a significant difference (p < 0,05 between before giving and after giving of dry biomass S. platensis during 17 day. By giving dry biomass of S. platensis to mice (Mus musculus at first and second week, it was found the difference of average mice body weight among six concentrations of biomass but did not at the third week. It means that not all concentration of biomass have same effect to the increase of mice body weight as a Single-Celled Protein.

  13. Influence of Spirulina platensis powder on the microflora of yoghurt and acidophilus milk

    Directory of Open Access Journals (Sweden)

    Metin Guldas


    Full Text Available The main purpose of this research was to monitor the influence of the powdered Cyanobacterium Spirulina platensis addition to plain yoghurt and the yoghurt containing Lactobacillus acidophiluson survival of the microbiota during the refrigerated storage. The cell viability of yoghurt starter cultures (Lactobacillus delbrueckii subsp. bulgaricus and Streptococcus thermophilus and Lactobacillus acidophilus under refrigeration conditions in yoghurts prepared with (0.5 or 1.0 (w/w % and without the addition of Spirulina powder was investigated. The yoghurts were prepared under hygienic laboratory conditions and their pH and acidity were controlled during the process. The samples of yoghurts were stored at 4 °C and investigated on days 1, 5, 10, 15, 20, 25 and 30. Viable counts of the lactic acid bacteria were above 6 cfu g-1of all “spirulina powder” added samples whereas control yoghurt samples contained lower lactic acid bacteria count at the end of the storage period. Addition of 1 % Spirulina platensis powder into the yoghurts did not cause significant differences on the viable lactic acid bacteria (p≤0.05. The results showed the positive effect of S. platensis powder on the survival of the lactic acid bacteria during storage of yoghurt (P≤0.05. The sensory analysis was also performed for the yoghurt samples. Sensory scores of 0.5 % spirulina powder added yoghurt samples were better than 1 % spirulina powder added ones. It was determined that spirulina powder added yoghurt is a good medium of lactic acid bacteria during the 30 days of refrigerated storage.

  14. Cultivation of microalgae Spirulina platensis (Arthrospira platensis from biological treatment of swine wastewater Cultivo da microalga Spirulina platensis (Arthrospira platensis a partir de tratamento biológico de efluente suíno

    Directory of Open Access Journals (Sweden)

    Natália Mezzomo


    Full Text Available The microalgae biomass production from swine wastewater is a possible solution for the environmental impact generated by wastewater discharge into water sources. The biomass can be added to fish feed, which can be used in the formulation of meat products. This work addresses the adaptation of the microalgae Spirulina platensis (Arthrospira platensis in swine wastewater and the study of the best dilution of the wastewater for maximum biomass production and for removal of Chemical Oxygen Demand (COD, ammonia and phosphorous to the microalgae. The cultivation of Spirulina platensis, strain Paracas presented maximum cellular concentrations and maximum specific growth rates in the wastewater concentration of 5.0 and 8.5%. The highest COD removals occurred with 26.5 and 30.0% of wastewater in the medium. The maximum removal of total phosphorous (41.6%, was with 8.5% of wastewater, which is related to the microalgae growth. The results of Spirulina culture in the swine wastewater demonstrated the possibility of using these microalgae for the COD and phosphorous removal and for biomass production.A produção de biomassa de microalgas a partir de efluente suíno consiste em uma possível solução para o impacto ambiental gerado pela descarga de efluentes em fontes naturais. A biomassa produzida pode ser adicionada a rações de peixes, os quais podem ser utilizados na formulação de produtos cárneos. O objetivo deste trabalho foi a adaptação da microalga Spirulina platensis (Arthrospira platensis em efluente suíno e o estudo da diluição ideal de efluente para obter a máxima produção de biomassa e remoção de Demanda Química de Oxigênio (DQO, amônia e fósforo do efluente pela microalga. O cultivo da Spirulina platensis, cepa Paracas apresentou máxima concentração celular e máxima taxa específica de crescimento em concentrações de efluente de 5,0 e 8,5%. As maiores remoções de DQO ocorreram com 26,5 e 30,0% de efluente no meio. A

  15. Semicontinuous cultivation of the Cyanobacterium Spirulina platensis in a closed photobioreactor

    Energy Technology Data Exchange (ETDEWEB)

    Reichert, C.C.; Costa, J.A.V. [Fundacao Universidade Federal do Rio Grande (FURG), Rio Grande, RS (Brazil). Dept. de Quimica], Email:; Reinehr, C.O. [Universidade de Passo Fundo, RS (Brazil). Centro de Pesquisa em Alimentacao], Email:


    The cultivation of photosynthetic microorganisms such as the cyanobacterium Spirulina platensis has been studied by researchers in many countries because these organisms can produce products with industrial potential. We studied the specific growth rate ({mu}{sub x}, day{sup -1}) and productivity (P{sub x}, in mg/L/day of Spirulina platensis biomass, dry weight basis) of two S. platensis strains (LEB-52 and Paracas) growing in aerated semicontinuous culture in two-liter Erlenmeyer flasks for 90 days (2160 h) at 30 deg C under 2500 lux of illumination in a 12 h photoperiod. Independent of the S. platensis strain used we found that low biomass concentrations (0.50 g/L) and high renewal rates (50% v/v) resulted in a high specific growth rate ({mu}{sub x} = 0.111 day{sup -1}) and high productivity (P{sub x} = 42.3 mg/L/day). These values are two to four times higher than those obtained in simple batch cultivation and indicate that the semicontinuous cultivation of S. platensis is viable. (author)

  16. Semicontinuous cultivation of the cyanobacterium Spirulina platensis in a closed photobioreactor

    Directory of Open Access Journals (Sweden)

    C. C. Reichert


    Full Text Available The cultivation of photosynthetic microorganisms such as the cyanobacterium Spirulina platensis has been studied by researchers in many countries because these organisms can produce products with industrial potential. We studied the specific growth rate (µx, day-1 and productivity (Px, in mg/L/day of Spirulina platensis biomass, dry weight basis of two S. platensis strains (LEB-52 and Paracas growing in aerated semicontinuous culture in two-liter Erlenmeyer flasks for 90 days (2160 h at 30°C under 2500 lux of illumination in a 12 h photoperiod. Independent of the S. platensis strain used we found that low biomass concentrations (0.50 g/L and high renewal rates (50% v/v resulted in a high specific growth rate (µx = 0.111 day-1 and high productivity (Px = 42.3 mg/L/day. These values are two to four times higher than those obtained in simple batch cultivation and indicate that the semicontinuous cultivation of S. platensis is viable.


    Directory of Open Access Journals (Sweden)

    Leilson Rocha Bezerr a


    Full Text Available The experiment was carried out in Maria Paz Ranch/SheepProduction Department, in São José de Espinharas, PB. Analyseswere performed in the Laboratory of Animal Nutrition/Centrode Saúde e Tecnologia Rural/Universidade Federal de CampinaGrande. The objectives of this study were to evaluate the effectof the supplementation with cow milk enriched with Spirulinaplatensis (Sp on lamb performance submitted to creep feeding,and determine the most adequate period to suplemet nursinglambs with Spirulina platensis. Data on dry matter (DMC andcrude protein (CPC consumptions, body weight (BW, and meandaily body weight gain (MDBWG were colleted. The three levelsof Spirulina supplementation were assigned to 30 lambs (plotsaccording to a randomized block (lamb weight design with 10replications. Data were collected in four consecutive periods,characterizing a split plot in time. DM and CP consumptions werenot affected by spirulina level x period interaction, and increasedwith periods (animal age. BW and MDBWG were affected bythe spirulina level x period interaction. Spirulina levels affectedMDBWG only from day 0 to day 15, when the MDBWG (300gwas higher at level 10g than at level zero of Spirulina that resulted in 205g in MDBWG. Live body weight at the end of each periodwas also higher when the lambs were supplemented with 10 g ofSpirulina (12.00 17.02, 19.71 and 25.30kg, respectively, for thefour consecutive periods. The dilution of Spirulina platensis incow milk showed to be efficient on the daily performance of lambswhen utilized in concentration of 10g/day and from period 15 to30 days of age.

  18. Spirulina platensis attenuates the associated neurobehavioral and inflammatory response impairments in rats exposed to lead acetate. (United States)

    Khalil, Samah R; Khalifa, Hesham A; Abdel-Motal, Sabry M; Mohammed, Hesham H; Elewa, Yaser H A; Mahmoud, Hend Atta


    Heavy metals are well known as environmental pollutants with hazardous impacts on human and animal health because of their wide industrial usage. In the present study, the role of Spirulina platensis in reversing the oxidative stress-mediated brain injury elicited by lead acetate exposure was evaluated. In order to accomplish this aim, rats were orally administered with 300 mg/kg bw Spirulina for 15 d, before and simultaneously with an intraperitoneal injection of 50 mg/kg bw lead acetate [6 injections through the two weeks]. As a result, the co-administration of Spirulina with lead acetate reversed the most impaired open field behavioral indices; however, this did not happen for swimming performance, inclined plane, and grip strength tests. In addition, it was observed that Spirulina diminished the lead content that accumulated in both the blood and the brain tissue of the exposed rats, and reduced the elevated levels of oxidative damage indices, and brain proinflammatory markers. Also, because of the Spirulina administration, the levels of the depleted biomarkers of antioxidant status and interleukin-10 in the lead-exposed rats were improved. Moreover, Spirulina protected the brain tissue (cerebrum and cerebellum) against the changes elicited by lead exposure, and also decreased the reactivity of HSP70 and Caspase-3 in both cerebrum and cerebellum tissues. Collectively, our findings demonstrate that Spirulina has a potential use as a food supplement in the regions highly polluted with heavy metals. Copyright © 2018 Elsevier Inc. All rights reserved.

  19. Influence of Spirulina platensis exudates on the endocrine and nervous systems of a mammalian model


    Samah M.M. Fathy; Ashraf M.M. Essa


    Objective: To investigate the effect of intra-peritoneal injection of purified exudates of axenic Spirulina platensis on the mammalian endocrine and nervous systems. Methods: The intra-peritoneal injection of the cyanobacterial exudates in mice was applied. Sex hormonal levels of testosterone and progesterone were measured using radioimmunoassay while the follicular stimulating hormone and luteinizing hormone were evaluated by direct chemiluminescence. In addition, superoxide dismutase, ca...

  20. Antioxidative activity of ethanol extracts from Spirulina platensis and Nostoc linckia measured by various methods


    Liliana CEPOI; Ludmila RUDI; Vera MISCU; Angela COJOCARI; Tatiana CHIRIAC; Daniela SADOVNIC


    The goal of this work is to determine the level of antioxidative activity of various ethanol extracts from Spirulina platensis and Nostoc linckia biomass, and also to demonstrate the possibility to select suitable methods for evaluation of these characteristics. The methods for determination of antioxidative activity were selected concerning their possible use for complex preparations: phosphomolybdenum method for evaluation of antioxidant capacity (PMRC), radical-scavenging activity by DPPH ...

  1. Spirulina platensis feeding inhibited the anemia- and leucopenia-induced lead and cadmium in rats

    Energy Technology Data Exchange (ETDEWEB)

    Simsek, Nejdet [University of Atatuerk, Faculty of Veterinary Medicine, Department of Histology and Embryology, 25700 Erzurum (Turkey); Karadeniz, Ali, E-mail: [University of Atatuerk, Faculty of Veterinary Medicine, Department of Physiology, 25700 Erzurum (Turkey); Kalkan, Yildiray; Keles, Osman N.; Unal, Buenyami [University of Atatuerk, Faculty of Medicine, Department of Histology and Embryology, 25240 Erzurum (Turkey)


    In the present investigation, the effect of Spirulina platensis (Sp) was undertaken on rats fed with lead and cadmium including diet by using physiological, enzymehistochemical and stereological methods. For this aim, 50 rats were equally divided into five groups as control (C), lead (Pb), Spirulina + lead (Sp + Pb), cadmium (Cd), and Spirulina + cadmium (Sp + Cd). Red blood cell (RBC) and white blood cell (WBC) counts, packed cell volume (PCV), and haemoglobine (Hb) concentrations were determined by haemocytometric methods in blood samples collected on 30th day. Population of T lymphocyte was counted by the {alpha}-naphthyl acetate esterase (ANAE) staining method, and reticulocytes were counted by stereological method. The counts of RBC, WBC, and ANAE positive T lymphocyte, and the values of Hb, PCV, and MCHC were decreased in the Pb and Cd groups compared to control group. Also, the number of reticulocytes (polychromatofilic erythrocyte) increased in the Pb groups, whereas it decreased in the Cd group. On the other hand, these values were ceased by S. platensis in the treated groups. These results suggest that S. platensis supplementation may be useful in adjuvant treatment of leukemia and anemia caused by lead and cadmium toxication.

  2. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals

    Directory of Open Access Journals (Sweden)

    Radhakrishnan Ammu


    Full Text Available Abstract Background Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protective effect against cell death induced by free radicals. Methods The antioxidant activity of the cold water extract from food-grade Spirulina platensis was assessed using both chemical and cell-based assays. In the cell-based assay, mouse fibroblast cells (3T3 cells were incubated for 1 h in medium containing aqueous extract of Spirulina or vitamin C (positive control at 25, 125 and 250 μg/mL before the addition of 50 μM 1,1-diphenyl-2-picrylhydrazyl (DPPH or 3-ethylbenzothiazoline-6-sulfonic acid (ABTS. The cells were incubated for another 24 h before being assessed for cell death due to apoptosis using the Cell Death Detection ELISA Kit. Spectrophotometric assays based on DPPH and ABTS were also used to assess the antioxidant activity of the extract compared to vitamin C and vitamin E (positive controls. Results Spirulina extract did not cause cytotoxic effect on 3T3 cells within the range of concentrations tested (0 - 250 μg/mL. The extract reduced significantly (p Conclusions The results showed that aqueous extract of Spirulina has a protective effect against apoptotic cell death due to free radicals. The potential application of incorporating Spirulina into food products and beverages to enhance their antioxidant capacity is worth exploring.

  3. Synthesis of gold nanoparticles by blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Kalabegishvili, T.; Kirkesali, E.; Rcheulishvili, A.


    The synthesis of gold nanoparticles by one of the many popular microorganisms - blue-green algae Spirulina platensis was studied. The complex of optical and analytical methods was applied for investigation of experimental samples after exposure to chloroaurate (HAuCl 4 ) solution at different doses and for different time intervals. To characterize formed gold nanoparticles UV-vis, TEM, SEM, EDAX, and XRD were used. It was shown that after 1.5-2 days of exposure the extracellular formation of nanoparticles of spherical form and the distribution peak within the interval of 20-30 nm took place. To determine gold concentrations in the Spirulina platensis biomass, neutron activation analysis (NAA) and atomic absorption spectrometry (AAS) were applied. The results obtained evidence that the concentration of gold accumulated by Spirulina biomass is rapidly growing in the beginning, followed by some increase for the next few days. The obtained substance of Spirulina biomass with gold nanoparticles may be used for medical, pharmaceutical, and technological purposes

  4. Microbiological decontamination of Spirulina Platensis and green coffee using accelerated electron beams

    International Nuclear Information System (INIS)

    Nemtanu, Monica R.; Brasoveanu, Mirela; Minea, R.; Mitru, Ecaterina; Grecu, Maria Nicoleta; Albulescu, Mihaela


    Biological raw materials can be contaminated with microorganisms and to make them suitable for commercialization, the quality relative to microbial content is necessary to be achieved. Irradiation is a decontamination method for numerous foodstuffs, being a feasible, very effective and environment friendly procedure. The aim of the paper is to evaluate the possibility to apply the electron beam treatment on Spirulina Platensis and green coffee for biological decontamination. The cyanobacterium Spirulina and green coffee have been irradiated with electron beams up to 40 kGy. To determine the microbial load, antioxidant activity, and rheological behaviour the techniques of electron paramagnetic resonance (EPR) and absorption spectroscopy have been applied. The results showed that accelerated electron beams could be efficient to decontaminate Spirulina as well as green coffee without significant changes in their properties. (authors)

  5. Application of Epithermal Neutron Activation Analysis to Investigate Accumulation and Adsorption of Mercury by Spirulina platensis Biomass

    CERN Document Server

    Mosulishvili, L M; Khizanishvili, A I; Frontasyeva, M V; Kirkesali, E I; Aksenova, N G


    Epithermal neutron activation analysis was used to study interaction of blue-green alga Spirulina platensis with toxic metal mercury. Various concentrations of Hg(II) were added to cell cultures in a nutrient medium. The dynamics of accumulation of Hg was investigated over several days in relation to Spirulina biomass growth. The process of Hg adsorption by Spirulina biomass was studied in short-time experiments. The isotherm of adsorption was carried out in Freindlich coordinates. Natural Spirulina biomass has potential to be used in the remediation of sewage waters at Hg concentrations \\sim 100 {\\mu}g/l.

  6. Application of epithermal neutron activation analysis to investigate accumulation and adsorption of mercury by Spirulina platensis biomass

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Kirkesali, E.I.; Aksenova, N.G.


    Epithermal neutron activation analysis was used to study interaction of blue-green alga Spirulina platensis with toxic metal mercury. Various concentrations of Hg(II) were added to cell cultures in a nutrient medium. The dynamics of accumulation of Hg was investigated over several days in relation to Spirulina biomass growth. The process of Hg adsorption by Spirulina biomass was studied in short-time experiments. The isotherm of adsorption was carried out in Freindlich coordinates. Natural Spirulina biomass has potential to be used in the remediation of sewage waters at Hg concentrations ∼100 μg/1

  7. The Role of Gamma Irradiation on Growth and Some Metabolic Activities of Spirulina platensis

    International Nuclear Information System (INIS)

    Moussa, H.R.; El-Shaer, E.A.; Ismaiel, M.M.S.; Shabana, E.F.; Gabr, M.A.


    Spirulina platensis cells were exposed to different doses of gamma irradiation 0.0; (control), 0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 Kilo Gray (kGy) using Co 60 as a gamma source at the Cyclotron Unit, Nuclear Research Center, Egyptian Atomic Energy Authority. After which, the cells were cultivated on Zarrouk medium for 14 days (the exponential phase of growth). The optimum growth of Spirulina platensis was recorded at 2.0 kGy as compared to the control after the 14th day of incubation. All of the following analyses were done after 10 days of growth. The results of pigments analysis revealed that the chlorophyll a and carotenoid contents of Spirulina platensis were reached their maximum rate at a dose of 2.0 kGy, Which induces the same trend for phycobiliproteins fractions. The photosynthetic activity and total carbohydrate content of the irradiated Spirulina cells increased with elevating the doses of gamma irradiation and reached a maximum value at a dose of 2.0 kGy as compared to the control. The activity of ribulose-1,5-bisphosphate-carboxylase/oxygenase (RUBISCO) was increased up to irradiation dose of 2.0 kGy. whereas, the maximum activity of the phosphoenol pyruvate carboxylase (PEPCASE) was recorded at the irradiation dose of 1.0 kGy Spirulina platensis cells were exposed to different doses of gamma irradiation 0.0; (control), 0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 Kilo Gray (kGy) using Co 60 as a gamma source at the Cyclotron Unit, Nuclear Research Center, Egyptian Atomic Energy Authority. After which, the cells were cultivated on Zarrouk medium for 14 days (the exponential phase of growth). The optimum growth of Spirulina platensis was recorded at 2.0 kGy as compared to the control after the 14th day of incubation. All of the following analyses were done after 10 days of growth. The results of pigments analysis revealed that the chlorophyll a and carotenoid contents of Spirulina platensis were reached their maximum rate at a dose of 2.0 kGy, Which induces the same

  8. Pão sem gluten enriquecido com a microalga Spirulina platensis Elaboration of gluten-free bread enriched with the microalgae Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Felipe da Silva Figueira


    Full Text Available Com a finalidade de oferecer pão sem glúten para consumidores com síndrome celíaca, em razão da intolerância ao glúten, elaboraram-se produtos com farinha de arroz em substituição à farinha de trigo. Para aumentar o conteúdo proteico dos pães adicionou-se a microalga Spirulina platensis seca, na faixa de 2 a 5% (base farinha. Os pães foram avaliados pelo volume específico, dureza do miolo uma e 24h após o forneamento e a cor do miolo. Verificou-se que o volume específico e a dureza dos pães não sofreram alteração com a adição de até 4% da alga, porem mostraram redução de 22% nos valores de volume e aumento de 113% na dureza quando se adicionou-se 5% (em base de farinha. Quando comparados ao pão não enriquecido, a adição de Spiriulina platensis provocou uma melhoria da qualidade nutricional dos pães, confirmada pelo aumento significativo de 39,04% do conteúdo protéico, alem de vários aminoácidos essenciais (treonina, metionina, isoleucina e leucina. Com relação a cor, os pães com Spirulina apresentaram redução de luminosidade com o aumento de adição de microalga, sendo também observada tendência de aumento de tonalidade verde. Na avaliação sensorial, não se verificou diferença significativa quanto a preferência entre os pães adicionados com 3% e 5% de Spirulina na formulação.With the objective of offering a product for people with celiac disease, due to their gluten intolerance, gluten-free bread made with rice flour was elaborated, in substitution of the wheat flour. To increase the protein content of the bread, dried Spirulina platensis, a microalga, was added to the products in the range from 2 to 5% (flour basis. The bread samples were evaluated according to their specific volume (V/W, crumb hardness, measured with a texturometer, and the crumb color. It was shown that the specific volume and crumb hardness were not affected by the addition of up to 4% of alga, but a decrease of 22% in the

  9. In vitro activity of Spirulina platensis water extract against different Candida species isolated from vulvo-vaginal candidiasis cases.

    Directory of Open Access Journals (Sweden)

    Antonella Marangoni

    Full Text Available The high incidence of vulvo-vaginal candidiasis, combined with the growing problems about azole resistance and toxicity of antifungal drugs, highlights the need for the development of new effective strategies for the treatment of this condition. In this context, natural compounds represent promising alternatives. The cyanobacterium Spirulina platensis, a blue-green alga, exhibits antimicrobial activities against several microorganisms. Nevertheless, only few data about the antifungal properties of Spirulina platensis are available and its potential toxic effects have not been largely investigated. The aim of this study was to evaluate the in vitro activity of a fully-characterized water extract of Spirulina platensis against 22 strains of Candida spp. Prior to considering its potential topical use, we both investigated whether the extract exerted target activities on guinea pig uterine smooth muscle, and the impact of Spirulina platensis on the dominant microorganisms of the vaginal microbiota (i.e., lactobacilli, in order to exclude possible adverse events. By means of a broth microdilution assay, we found that the microalga extract possesses good antifungal properties (MIC: 0.125-0.5 mg/ml, against all the Candida species with a fungicidal activity. At the concentrations active against candida, Spirulina platensis did not modify the spontaneous basic waves pattern of uterine myometrium as underlined by the absence of aberrant contractions, and did not affect the main health-promoting bacteria of the vaginal ecosystem. Finally, we evaluated the selectivity index of our extract by testing its cytotoxicity on three different cell lines and it showed values ranging between 2 and 16. Further in vivo studies are needed, in particular to evaluate the use of control-release formulations in order to maintain Spirulina platensis concentrations at anti-Candida active doses but below the toxic levels found in the present work.


    Directory of Open Access Journals (Sweden)

    M. G. MORAIS


    Full Text Available

    As microalgas, como Spirulina, podem ser fonte de proteínas para alimentação humana, com a possibilidade de obter outros produtos como biopigmentos, vitaminas e lipídios. A biomassa obtida pode ser introduzida diretamente na dieta podendo auxiliar em casos de desnutrição. O objetivo deste trabalho foi avaliar as características físico-química, sensorial e digestibilidade de biscoitos de chocolate enriquecidos com a microalga Spirulina platensis. Foram elaborados quatro biscoitos de chocolate: controle (sem Spirulina e biscoitos contendo 1,0; 3,0 e 5,0% de Spirulina platensis. O biscoito com adição de 5,0% de Spirulina platensis apresentou o conteúdo protéico 7,7% maior que o controle. Os biscoitos com adição de 1,0% de S. platensis apresentaram maior digestibilidade (86,9% que os demais. Volume específico, espessura e fator de expansão não foram alterados pela adição de Spirulina. Não houve diferença significativa entre o biscoito controle e os biscoitos com adição de 5,0% nos atributos cor, crocância, mastigabilidade e maciez. Na avaliação questionamento de intenção de compra, comparando os biscoitos com adição de S. platensis, a amostra com maior aceitação pelos julgadores foi com 1,0% de S. platensis.

  11. In vitro activity of Spirulina platensis water extract against different Candida species isolated from vulvo-vaginal candidiasis cases. (United States)

    Marangoni, Antonella; Foschi, Claudio; Micucci, Matteo; Nahui Palomino, Rogers Alberto; Gallina Toschi, Tullia; Vitali, Beatrice; Camarda, Luca; Mandrioli, Mara; De Giorgio, Marta; Aldini, Rita; Corazza, Ivan; Chiarini, Alberto; Cevenini, Roberto; Budriesi, Roberta


    The high incidence of vulvo-vaginal candidiasis, combined with the growing problems about azole resistance and toxicity of antifungal drugs, highlights the need for the development of new effective strategies for the treatment of this condition. In this context, natural compounds represent promising alternatives. The cyanobacterium Spirulina platensis, a blue-green alga, exhibits antimicrobial activities against several microorganisms. Nevertheless, only few data about the antifungal properties of Spirulina platensis are available and its potential toxic effects have not been largely investigated. The aim of this study was to evaluate the in vitro activity of a fully-characterized water extract of Spirulina platensis against 22 strains of Candida spp. Prior to considering its potential topical use, we both investigated whether the extract exerted target activities on guinea pig uterine smooth muscle, and the impact of Spirulina platensis on the dominant microorganisms of the vaginal microbiota (i.e., lactobacilli), in order to exclude possible adverse events. By means of a broth microdilution assay, we found that the microalga extract possesses good antifungal properties (MIC: 0.125-0.5 mg/ml), against all the Candida species with a fungicidal activity. At the concentrations active against candida, Spirulina platensis did not modify the spontaneous basic waves pattern of uterine myometrium as underlined by the absence of aberrant contractions, and did not affect the main health-promoting bacteria of the vaginal ecosystem. Finally, we evaluated the selectivity index of our extract by testing its cytotoxicity on three different cell lines and it showed values ranging between 2 and 16. Further in vivo studies are needed, in particular to evaluate the use of control-release formulations in order to maintain Spirulina platensis concentrations at anti-Candida active doses but below the toxic levels found in the present work.

  12. Investigation of the interaction of chrome compounds with blue-green microalgae Spirulina platensis

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Belokobyl'skij, A.I.; Kirkesali, E.I.; Frontas'eva, M.V.; Pavlov, S.S.; Aksenova, N.G.


    The interaction of CrIII with the cells of blue-green microalgae Spirulina platensis in course of cultivation in a nutrient medium loaded with corresponding chrome compounds is studied. It is shown that the rate of absorption of CrVI ions by spirulina biomass from the nutrient medium is approximately two orders of magnitude lower as compared to that of CrIII ions. At the same time the presence of CrVI in a nutrient medium is accompanied by a significant decrease in the cell growth rate and by deteriorating the quality of spirulina biomass. It is established that at endogenous insertion of CrIII into the biocomplex of spirulina no change in the valence state of chromium in the nutrient medium is observed and the natural properties of the biomass do not change. On the basis of the obtained concentration dependences, the recommended doses of CrIII in the preparation 'Cr-Spirulina' within the ranges of 30-100 μg/g as a food addition, and 200-250 μg/g for a medical preventive treatment are determined. (author)

  13. Compostos fenólicos totais, atividade antioxidante e antifúngica demultimisturas enriquecidas com a microalga Spirulina platensis


    Bierhals, Vânia da Silva; Machado, Vanessa Goulart; Echevenguá, Walesca Oliveira; Costa, Jorge Alberto Vieira; Furlong, Eliana Badiale


    Com o objetivo de avaliar o conteúdo fenólico e as atividades antioxidantes e antifúngicas de multimisturas enriquecidas com Spirulina platensis, foram formuladas quatro multimisturas com farelo de arroz ou trigo, duas contendo Spirulina platensis e duas com sementes de girassol. Os compostos fenólicos foram estimados pela técnica de Folin-Ciocalteau. A atividade antioxidante foi avaliada por meio de inibição do radical livre DPPH e a atividade antifúngica foi analisada por meio de ensaio de ...

  14. Synthesis of CdSe nanoparticles and their effect on the antioxidant activity of Spirulina platensis and Porphyridium cruentum cells

    International Nuclear Information System (INIS)

    Rudic, V.; Cepoi, L.; Rudi, L.; Chiriac, T.; Nicorici, A.; Todosiciuc, A.; Gutsul, T.


    Single-crystalline cadmium selenide nanoparticles were obtained using high-temperature solution phase synthesis (HTSPS) synthesis. X-Ray powder diffraction and transmission electron microscopy were used to confirm the crystallinity and morphology of the resulting nanoparticles. To study the action of CdSe on antioxidant activity, we selected two biotechnological important strains of microalgae: cyanobacteria Spirulina platensis and red microalgae Porphyridium cruentum. In the case of Porphyridium cruentum, the obtained results demonstrated an increase in the productivity. For Spirulina platensis, the presence of the compound in the cultivating medium decreased the productivity of cyanobacteria.

  15. Cultivo mixotrófico da microalga Spirulina platensis em batelada alimentada Mixotrophic growth of Spirulina platensis in fed-batch mode

    Directory of Open Access Journals (Sweden)

    Adriana Muliterno


    Full Text Available A Spirulina platensis tem sido estudada devido a seu alto valor protéico, digestibilidade e por apresentar quantidades significativas de ácidos graxos poliinsaturados, vitaminas, fenólicos e ficocianina, podendo ser utilizada na alimentação humana. A utilização de nutrientes de baixo custo é um fator importante na produção da cianobactéria por possibilitar a redução de custos de processo. Objetivou-se com este trabalho estudar o cultivo mixotrófico da S. platensis por meio da adição de uma fonte orgânica de carbono (glicose em modo bateladaalimentada. Foi utilizado um Planejamento Fatorial Completo 2³ para o cultivo e as variáveis de estudo foram a concentração de glicose (0,5 gL-1 e 1,0 gL-1, a diluição do meio Zarrouk (50% e 75% e a iluminância (1800 lux e 3000 lux. A concentração celular máxima obtida foi de 5,38 gL-1 com uma velocidade específica máxima de crescimento de 0,0063 h-1, nas condições de 0,5 gL-1 de glicose, diluição do meio de 75% e iluminância de 3000 lux.The cyanobacterium Spirulina platensis has been studied due to its high content (~65% of highly digestible protein as well as significant amounts of polyunsaturated fatty acids, phenolics, vitamins, minerals and phycocyanin which could be useful in the human nutrition. The use of nutrients of low costs in the cyanobacterium growth could reduce the costs of production. We studied the fed-batch mixotrophic growth of the S. platensis in Zarrouk's medium with glucose (0.5 gL-1 and 1.0 gL-1 as carbon source and also investigated the effects of dilution (50% and 75%, with water and illumination (1,800 lux and 3,000 lux using a 2³ factorial design. The maximum celular concentration of 5.38 gL-1 and maximum specific growth rate of 0.0063 h-1 were obtained with a glucose concentration of 0.5 gL-1, 50% dilution and 1800 lux of illuminance.

  16. Application of an Ultrafine Shearing Method for the Extraction of C-Phycocyanin from Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Jianfeng Yu


    Full Text Available Cell disruption is an important step during the extraction of C-phycocyanin from Spirulina platensis. An ultrafine shearing method is introduced and combined with soaking and ultrasonication to disrupt the cell walls of S. platensis efficiently and economically. Five kinds of cell disruption method, including soaking, ultrasonication, freezing-thawing, soaking-ultrafine shearing and soaking-ultrafine shearing-ultrasonication were applied to break the cell walls of S. platensis. The effectiveness of cell breaking was evaluated based on the yield of the C-phycocyanin. The results show that the maximum C-phycocyanin yield was 9.02%, achieved by the soaking-ultrafine shearing-ultrasonication method, followed by soaking (8.43%, soaking-ultrafine shearing (8.89%, freezing and thawing (8.34%, and soaking-ultrasonication (8.62%. The soaking-ultrafine shearing-ultrasonication method is a novel technique for breaking the cell walls of S. platensis for the extraction of C-phycocyanin.

  17. Production of Spirulina platensis using dry chicken manure supplemented with urea and sodium bicarbonate

    Directory of Open Access Journals (Sweden)

    Thepparath Ungsethaphand


    Full Text Available The cyanobacterium Spirulina platensis is an attractive source of valuable protein for both human and animal consumption. The conventional nitrogen source for S. platensis is nitrate. However, recent research has evaluated the potential of using animal waste as a low-cost nitrogen source. In this work, the cultivation of S. platensis was done using dry chicken manure (DCM, collected from a closed-system poultry house, as nitrogen source. The experiment was carried out in open concrete tanks with 100 litres of culture medium and an initial biomass concentration of 0.5 g/L. The culture media were prepared to test the effect of unsupplemented DCM, DCM supplemented with 2.0 mg/L of urea (DCM+U, and/or 40 mg/L of sodium bicarbonate (DCM+U+B or DCM+B. The best cellular growth and highest protein production were observed for S. platensis in the biomass harvested from the culture medium containing DCM supplemented with 2.0 mg/L of urea (DCM+U.

  18. Antioxidant Activity of Purified Active Peptide Derived from Spirulina platensis Enzymatic Hydrolysates

    Directory of Open Access Journals (Sweden)

    Nur Maulida Safitri


    Full Text Available The aim of this study is to isolate the antioxidative peptide from Spirulina platensis. Peptide was obtained by proteolytic digestion, ultrafiltration, fractionation by RP-HPLC, identified by LC-MS/MS—MASCOT Distiller and measured its antioxidant activity by DPPH (2.2-Diphenyl-1-picrylhydrazyl assay. Results showed that thermolysin was the most effective enzyme to digest this algae. The active peptide Phe-Ser-Glu-Ser-Ser-Ala-Pro-Glu-Gln-His-Tyr (m/z 1281.51 was identified and synthetized, which exhibited 45.98 ± 1.7% at concentration 128.15 µg/mL. Therefore, S. platensis is indicated as a potential therapeutic source for combating oxidative stress.

  19. Antioxidant Activity of Purified Active Peptide Derived from Spirulina platensis Enzymatic Hydrolysates


    Nur Maulida Safitri; Endang Yuli Herawati; Jue Liang Hsu


    The aim of this study is to isolate the antioxidative peptide from Spirulina platensis. Peptide was obtained by proteolytic digestion, ultrafiltration, fractionation by RP-HPLC, identified by LC-MS/MS—MASCOT Distiller and measured its antioxidant activity by DPPH (2.2-Diphenyl-1-picrylhydrazyl) assay. Results showed that thermolysin was the most effective enzyme to digest this algae. The active peptide Phe-Ser-Glu-Ser-Ser-Ala-Pro-Glu-Gln-His-Tyr (m/z 1281.51) was identified and synthetized, w...

  20. Phyocyanin extraction from microalgae Spirulina platensis assisted by ultrasound irradiation: effect of time and temperature

    Directory of Open Access Journals (Sweden)



    Full Text Available This research was aimed to extract phycocyanin from microalgae Spirulina platensis using an extraction assisted by ultrasound irradiation. The extraction was conducted by using variable of extraction time, temperature and ultrasound frequency, while ethanol was used as solvent. The results show that the yield of phycocyanin extract was 15.97% at constant frequency of 42 kHz and 11.24% at constant frequency of 28 kHz, while the soxhlet extraction method obtained yield at 11.13%. The ultrasound could reduce the extraction time from 4 hrs (conventional to 20 minutes, while the optimum temperature of extraction was found at 55°C.

  1. Culture of microalgae Spirulina platensis with isotope stable Carbon-13; Cultivo da microalga Spirulina platensis com isótopo estável Carbono-13

    Energy Technology Data Exchange (ETDEWEB)

    Cronemberger, Luiz C.A.; Costa, Vladimir E., E-mail:, E-mail: [Universidade Estadual Paulista Julio de Mesquita Filho (CIE/UNESP), Botucatu, SP (Brazil). Centro de Isótopos Estáveis Prof. Dr. Carlos Ducatti


    Gastric emptying time abnormalities cause complications that affect the quality of life in humans and scintigraphy is the gold standard for this diagnosis. However its application has restrictions due to the use of the radiopharmaceutical {sup 99m}Tc. An alternative to this method is the stable carbon isotope respiratory test. This is a non-radioactive, noninvasive technique with no contraindications. Its application varies according to the substrate used. For evaluation of gastric emptying time one of the substrates that can be used in the respiratory test is Spirulina platensis labeled at 97% carbon atoms with the stable isotope carbon-13 ({sup 13}C). In Brazil, there is no production of this substrate and its high cost (US$475.00/g, excluding import taxes) makes it difficult to apply the test. Thus, the objective of the work is to cultivate labeled S. platensis at 97% of {sup 13}C for use in the respiratory test for gastric emptying and to establish optimization parameters for the best cost-benefit of this culture. In the cultivation process the microalgae will be kept in a closed sterilized glass volumetric flask, with deionized water and a pure {sup 13}C source. The light (photoperiod 12h light / dark), pH (∼ 9.5) and temperature (30 deg C) will be controlled and after 35-40 days of growth, the cyanobacteria will be lyophilized and ground for the acquisition of a powder that will be analyzed by IRMS and compared to S. platensis, which will be our reference standard.

  2. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals. (United States)

    Chu, Wan-Loy; Lim, Yen-Wei; Radhakrishnan, Ammu Kutty; Lim, Phaik-Eem


    Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protective effect against cell death induced by free radicals. The antioxidant activity of the cold water extract from food-grade Spirulina platensis was assessed using both chemical and cell-based assays. In the cell-based assay, mouse fibroblast cells (3T3) cells were incubated for 1 h in medium containing aqueous extract of Spirulina or vitamin C (positive control) at 25, 125 and 250 μg/mL before the addition of 50 μM 1,1-diphenyl-2-picrylhydrazyl (DPPH) or 3-ethylbenzothiazoline-6-sulfonic acid (ABTS). The cells were incubated for another 24 h before being assessed for cell death due to apoptosis using the Cell Death Detection ELISA Kit. Spectrophotometric assays based on DPPH and ABTS were also used to assess the antioxidant activity of the extract compared to vitamin C and vitamin E (positive controls). Spirulina extract did not cause cytotoxic effect on 3T3 cells within the range of concentrations tested (0 - 250 μg/mL). The extract reduced significantly (p assay, the radical scavenging activity of the extract was higher than phycocyanin and was at least 50% of vitamin C and vitamin E. Based on the ABTS assay, the antioxidant activity of the extract at 50 μmug/mL was as good as vitamin C and vitamin E. The results showed that aqueous extract of Spirulina has a protective effect against apoptotic cell death due to free radicals. The potential application of incorporating Spirulina into food products and beverages to enhance their antioxidant capacity is worth exploring.

  3. Anti-cancer effects of blue-green alga Spirulina platensis, a natural source of bilirubin-like tetrapyrrolic compounds

    Czech Academy of Sciences Publication Activity Database

    Koníčková, R.; Vaňková, K.; Vaníková, J.; Váňová, K.; Muchová, L.; Subhanová, I.; Zadinová, M.; Zelenka, Jaroslav; Dvořák, Aleš; Kolář, Michal; Strnad, Hynek; Rimpelová, S.; Ruml, T.; Wong, R.J.; Vítek, L.


    Roč. 13, č. 2 (2014), s. 273-283 ISSN 1665-2681 Institutional support: RVO:67985823 ; RVO:68378050 Keywords : bilirubin * chlorophyll * heme oxygenase * phycocyanin * phycocyanobilin * Spirulina platensis * tetrapyrroles Subject RIV: FD - Oncology ; Hematology Impact factor: 2.065, year: 2014

  4. Spirulina platensis: process optimization to obtain biomass Spirulina platensis: otimização de processo para a obtenção de biomassa

    Directory of Open Access Journals (Sweden)

    Iracema de Oliveira Moraes


    Full Text Available Spirulina platensis is a photoautotrophic mesophilic cyanobacterium. Its main sources of nutrients are nitrate, urea, and ammonium salts. Spirulina cultivation requires temperature, light intensity, and nutrient content control. This microalgae has been studied and used commercially due to its therapeutic and antioxidant potential. In addition, several studies have reported its ability to use CO2, its immune activity, and use as an adjuvant nutritive factor in the treatment of obesity. The objective of this study is the production of biomass of S. platensis using different rates of stirring, nitrogen source, amount of micronutrients, and luminosity. A 2(4 experimental design with the following factors: stirring (120 and 140 RPM, amount of nitrogen (1.5 and 2.5 g/L, amount of micronutrients (0,25 and 0,75 mL/L (11 and 15 W, and luminosity was used. Fermentation was performed in a 500 mL conical flask with 250 mL of culture medium and 10% inoculum in an incubator with controlled stirring and luminosity. Fermentation was monitored using a spectrophotometer (560 nm, and each fermentation lasted 15 days. Of the parameters studied, luminosity is the one with the highest significance, followed by the amount of nitrogen and the interaction between stirring and micronutrients. Maximum production of biomass for 15 days was 2.70 g/L under the following conditions: luminosity15W; stirring, 120 RPM; source of nitrogen, 1.5 g/L; and micronutrients, 0.75 mL/L.A Spirulina platensis é uma cianobactéria mesofílica, fotoautotrófica, que utiliza como nutrientes os nitratos, ureia e sais de amônio. O cultivo necessita de controle de temperatura, intensidade de luz e do teor de nutrientes utilizados. Esta microalga tem sido estuda pelo seu potencial nutricional, antioxidante, terapêutico e adjuvante em tratamento de obesidade. O objetivo deste trabalho foi a produção de biomassa de S. platensis em diferentes níveis de agitação, fonte de nitrog

  5. Antibacterial and anticancerous biocompatible silver nanoparticles synthesised from the cold-tolerant strain of Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Selvaraj Karthick Raja Namasivayam


    Full Text Available Objective: To synthesize silver nanoparticles from the biomass of cold tolerant strain of Spirulina platensis and evalute the synthesized nanoparticles against antibacterial and anticancer activity. Methods: Silver nanoparticles were synthesized by the algal culture and characterized by UV-vis spectroscopy, Fourier transform infrared spectroscopy, field emission scanning electron microscopy and X ray diffraction studies. Antibacterial activity has been studied with free nanoparticles adopting agar diffusion assay, biofilm inhibition assay and nanoparticles fabricated wound dressing against representative Gram-negative organism Pseudomonas aeruginosa and Gram-positive organism Staphylococcus aureus respectively. The in vitro anticancer activity of silver nanoparticles were screened against human Hep2 cell lines by means of MTT assay. Results: Reduction of silver ions by the algal culture was observed during 72 h of incubation and the synthesized nanoparticles were further characterized. Antibacterial study reveals both the strains were susceptible to free nanoparticles and fabricated wound dressing treatment. The in vitro anticancer activity of silver nanoparticles were screened against human Hep 2 cell lines by means of MTT assay which reveals that cell viability has been reduced as dose dependent manner. Conclusions: The observed results imply that silver nanoparticles synthesized from Spirulina platensis cold tolerant strain can be used as potential antibacterial and anticancerous agent.

  6. Antibacterial and anticancerous biocompatible silver nanoparticles synthesised from the cold-tolerant strain of Spirulina platensis

    Institute of Scientific and Technical Information of China (English)

    Duraisamy Jayakumar; Ramesh Kumar; Rajan SowriArvind Bharani


    Objective: To synthesize silver nanoparticles from the biomass of cold tolerant strain of Spirulina platensis and evalute the synthesized nanoparticles against antibacterial and anticancer activity. Methods: Silver nanoparticles were synthesized by the algal culture and characterized by UV-vis spectroscopy, Fourier transform infrared spectroscopy, field emission scanning electron microscopy and X ray diffraction studies. Antibacterial activity has been studied with free nanoparticles adopting agar diffusion assay, biofilm inhibition assay and nanoparticles fabricated wound dressing against representative Gram-negative organism Pseudomonas aeruginosa and Gram-positive organism Staphylococcus aureus respectively. The in vitro anticancer activity of silver nanoparticles were screened against human Hep2 cell lines by means of MTT assay. Results: Reduction of silver ions by the algal culture was observed during 72 h of incubation and the synthesized nanoparticles were further characterized. Antibacterial study reveals both the strains were susceptible to free nanoparticles and fabricated wound dressing treatment. The in vitro anticancer activity of silver nanoparticles were screened against human Hep 2 cell lines by means of MTT assay which reveals that cell viability has been reduced as dose dependent manner. Conclusions: The observed results imply that silver nanoparticles synthesized from Spirulina platensis cold tolerant strain can be used as potential antibacterial and anticancerous agent.

  7. Functional Properties and Amino Acid Profile of Spirulina Platensis Protein Isolates

    International Nuclear Information System (INIS)

    Bashir, S.; Sharif, M. K.; Butt, M. S.; Shahid, M.


    Protein malnutrition and food insecurity represent serious obstructions to sustainable development, poverty reduction and food quality throughout the world. The present study has been designed to evaluate the Spirulina platensis (SP) as a protein alternative source for the utilization in food products. A protein isolate was prepared from S. platensis powder through extraction with 0.1N NaOH, precipitation at pH 3, neutralization of the dispersed precipitate to pH 6.8-7.0, and subsequent freeze drying. The S. platensis isolate amino acids compositions revealed that the total essential amino acids contribution was comparatively higher in SPI (31.16±1.43 g/100 g) as compared with SP (27.75±1.21 g/100 g). Moreover, oil and water absorption capacities, foaming and emulsifying properties, surface hydrophobicity and nitrogen solubility index were found better functional properties under laboratory conditions except emulsion properties. Conclusively, SP and its isolates might be used in various food products to curtail protein energy malnutrition. (author)

  8. Spirulina platensis effects on the levels of total cholesterol, HDL and triacylglycerols in rabbits fed with a hypercholesterolemic diet

    Directory of Open Access Journals (Sweden)

    Luciane Maria Colla


    Full Text Available In this work, hypercholesterolemia was induced in rabbits by feeding them a high cholesterol diet (CD, 350 mg/d and the effects of supplementing this diet with 0.5 g/d Spirulina platensis was evaluated by measuring the levels of serum total-cholesterol (TC, triacylglycerols (TAG and high-density lipoprotein (HDL-cholesterol at the start of the experiment and after 30 d and 60 d. It was found that the levels of serum cholesterol decreased from 1,054±101 mg.dL-1 in the rabbits fed a CD without S. platensis to 516±163 mg.dL-1 to those fed with a high cholesterol diet supplemented with S. platensis (significant at p A microalga Spirulina é cultivada e comercializada no mundo devido a suas características nutricionais (elevada concentração de proteínas, em torno de 65%, vitaminas e sais minerais e ao seu potencial terapêutico no tratamento de inúmeras doenças, inclusive a hipercolesterolemia. Neste trabalho foi avaliada a inibição da hipercolesterolemia induzida em coelhos por uma dieta adicionada de colesterol (350 mg.d-1, pela suplementação de 0,5 g.dia-1 de biomassa de Spirulina platensis, sendo avaliados os níveis de colesterol total, triglicerídeos e HDL nos tempos de 0 d, 30 d e 60 d de tratamento. Os resultados indicaram que a adição de Spirulina platensis na dieta ocasionou decréscimo nos níveis de colesterol total de 1054±101 mg.dL-1 para 516±163 mg.dL-1 (p<0,0001, para os coelhos alimentados com a dieta colesterolêmica em comparação com os que receberam a dieta adicionada de Spirulina platensis. A adição de Spirulina a dieta colesterolêmica não ocasionou decréscimo significativo nos níveis de triglicerídios dos coelhos. Os valores de HDL aumentaram de 73±31 mg.dL-1 para 91,0±15,7 mg.dL-1, comparando-se os coelhos alimentados com a dieta colesterolêmica e os alimentados com a dieta adicionada de Spirulina, estatisticamente diferentes a um nível de significância maior que 0,1533.

  9. Optimization of Arthrospira platensis (Spirulina Growth: From Laboratory Scale to Pilot Scale

    Directory of Open Access Journals (Sweden)

    Florian Delrue


    Full Text Available Arthrospira platensis (Spirulina is the most cultivated microalga worldwide. Improving its cultivation in terms of biomass productivity, quality, or production cost could significantly impact the Spirulina industry. The objectives of this paper were defined as to contribute to this goal. Spirulina biomass productivity was investigated through medium choice. A modified Zarrouk’s medium was selected as it gave higher final dry weights and longer sustained growth than Hiri’s and Jourdan’s media. Then, in order to reduce Spirulina production cost, modified Zarrouk’s medium was rationalized by testing different dilutions. It was found that modified Zarrouk’s medium could be diluted up to five times without impacting the growth rates in a 28-days batch cultivation. Higher dry weights were even observed after 21 days of batch cultivation (1.21 g/L for 20%-modified Zarrouk’s medium in comparison to 0.84 g/L for modified Zarrouk’s medium. Iron uptake was then investigated as one of the major contributors to Spirulina nutritional quality. An increase in iron content was obtained by replacing iron sulfate by iron EDTA at a concentration of 10 mgFe/L (2.11 ± 0.13 mgFe/gbiomass for EDTA-FeNa, 3 H2O at 10 mgFe/L compared to 0.18 ± 0.13 for FeSO4,6H2O at 2 mgFe/L. Impact of light intensity on Spirulina biomass productivity was also investigated in a 2 L Photobioreactor (PBR. Specific growth rates were calculated for Photosynthetically Photon Flux Densities (PPFD from 85 to 430 µmol/m2/s. At 430 µmol/m2/s, photoinhibition was not observed and the specific growth rate was maximum (0.12/day. Finally, a 40-day cultivation experiment was conducted in a 1000 L PBR giving a maximum daily areal productivity of 58.4 g/m2/day. A techno-economic analysis gave production cost two to 20 times higher for PBR (from 18.71 to 74.29 €/kg than for open ponds (from 3.86 to 9.59 €/kg depending on Spirulina productivity.

  10. In vitro evaluation of Spirulina platensis extract incorporated skin cream with its wound healing and antioxidant activities. (United States)

    Gunes, Seda; Tamburaci, Sedef; Dalay, Meltem Conk; Deliloglu Gurhan, Ismet


    Algae have gained importance in cosmeceutical product development due to their beneficial effects on skin health and therapeutical value with bioactive compounds. Spirulina platensis Parachas (Phormidiaceae) is renowned as a potential source of high-value chemicals and recently used in skincare products. This study develops and evaluates skin creams incorporated with bioactive S. platensis extract. Spirulina platensis was cultivated, the aqueous crude extract was prepared and in vitro cytotoxicity of S. platensis extract in the range of 0.001-1% concentrations for 1, 3 and 7 d on HS2 keratinocyte cells was determined. Crude extracts were incorporated in skin cream formulation at 0.01% (w/w) concentration and in vitro wound healing and genotoxicity studies were performed. Immunohistochemical staining was performed to determine the collagen activity. 0.1% S. platensis extract exhibited higher proliferation activity compared with the control group with 198% of cell viability after 3 d. Skin cream including 1.125% S. platensis crude extract showed enhanced wound healing effect on HS2 keratinocyte cell line and the highest HS2 cell viability % was obtained with this concentration. The micronucleus (MN) assay results indicated that S. platensis extract incorporated creams had no genotoxic effect on human peripheral blood cells. Immunohistochemical analysis showed that collagen 1 immunoreactivity was improved by increased extract concentration and it was strongly positive in cells treated with 1.125% extract incorporated skin cream. The cell viability, wound healing activity and genotoxicity results showed that S. platensis incorporated skin cream could be of potential value in cosmeceutical and biomedical applications.

  11. Microbial synthesis of silver nanoparticles by Streptomyces glaucus and Spirulina platensis

    International Nuclear Information System (INIS)

    Tsibakhashvili, N.Ya.; Kirkesali, E.I.; Pataraya, D.T.


    For the first time in Georgia a novel actinomycete strain Streptomyces glaucus 71 MD isolated from a soy rhizosphere has been used for microbial synthesis of silver nanoparticles. The Transmission Electron Microscopy (TEM) images revealed that most of the particles produced by these microorganisms from AgNO 3 are spherical-like in shape with an average size of 13 nm. The Scanning Electron Microscope (SEM) allowed one to observe extracellular synthesis of nanoparticles, which has many advantages from the point of view of applications. Production of silver nanoparticles proceeds extracellularly with the participation of another microorganism, blue-green microalgae Spirulina platensis. It is shown that the production rate of the nanoparticles depends not only on the initial concentration of AgNO 3 but also varies with time in a no monotonic way

  12. Scavenging of peroxynitrite by phycocyanin and phycocyanobilin from Spirulina platensis: protection against oxidative damage to DNA. (United States)

    Bhat, V B; Madyastha, K M


    Peroxynitrite (ONOO(-)) is known to inactivate important cellular targets and also mediate oxidative damage in DNA. The present study has demonstrated that phycocyanin, a biliprotein from spirulina platensis and its chromophore, phycocyanobilin (PCB), efficiently scavenge ONOO(-), a potent physiological inorganic toxin. Scavenging of ONOO(-) by phycocyanin and PCB was established by studying their interaction with ONOO(-) and quantified by using competition kinetics of pyrogallol red bleaching assay. The relative antioxidant ratio and IC(50) value clearly indicate that phycocyanin is a more efficient ONOO(-) scavenger than PCB. The present study has also shown that PCB significantly inhibits the ONOO(-)-mediated single-strand breaks in supercoiled plasmid DNA in a dose-dependent manner with an IC(50) value of 2.9 +/- 0.6 microM. These results suggest that phycocyanin, has the ability to inhibit the ONOO(-)-mediated deleterious biological effects and hence has the potential to be used as a therapeutic agent. Copyright 2001 Academic Press.

  13. Elaboration of gluten-free bread enriched with the microalgae Spirulina platensis


    Figueira, Felipe da Silva; Crizel, Tainara de Morais; Silva, Camila Rubira; Salas-Mellado, Myriam de las Mercedes


    Com a finalidade de oferecer pão sem glúten para consumidores com síndrome celíaca, em razão da intolerância ao glúten, elaboraram-se produtos com farinha de arroz em substituição à farinha de trigo. Para aumentar o conteúdo proteico dos pães adicionou-se a microalga Spirulina platensis seca, na faixa de 2 a 5% (base farinha). Os pães foram avaliados pelo volume específico, dureza do miolo uma e 24h após o forneamento e a cor do miolo. Verificou-se que o volume específico e a dureza dos pães ...

  14. Stable Isolation of Phycocyanin from Spirulina platensis Associated with High-Pressure Extraction Process

    Directory of Open Access Journals (Sweden)

    Kyung-Hwan Jung


    Full Text Available A method for stably purifying a functional dye, phycocyanin from Spirulina platensis was developed by a hexane extraction process combined with high pressure. This was necessary because this dye is known to be very unstable during normal extraction processes. The purification yield of this method was estimated as 10.2%, whose value is 3%–5% higher than is the case from another conventional separation method using phosphate buffer. The isolated phycocyanin from this process also showed the highest purity of 0.909 based on absorbance of 2.104 at 280 nm and 1.912 at 620 nm. Two subunits of phycocyanin namely α-phycocyanin (18.4 kDa and β-phycocyanin (21.3 kDa were found to remain from the original mixtures after being extracted, based on SDS-PAGE analysis, clearly demonstrating that this process can stably extract phycocyanin and is not affected by extraction solvent, temperature, etc. The stability of the extracted phycocyanin was also confirmed by comparing its DPPH (α,α-diphenyl-β-picrylhydrazyl scavenging activity, showing 83% removal of oxygen free radicals. This activity was about 15% higher than that of commercially available standard phycocyanin, which implies that the combined extraction method can yield relatively intact chromoprotein through absence of degradation. The results were achieved because the low temperature and high pressure extraction effectively disrupted the cell membrane of Spirulina platensis and degraded less the polypeptide subunits of phycocyanin (which is a temperature/pH-sensitive chromoprotein as well as increasing the extraction yield.

  15. Purification and Identification of Antioxidant Peptides from Enzymatic Hydrolysate of Spirulina platensis. (United States)

    Yu, Jie; Hu, Yuanliang; Xue, Mingxiong; Dun, Yaohao; Li, Shenao; Peng, Nan; Liang, Yunxiang; Zhao, Shumao


    The aim of this study was to isolate antioxidant peptides from an enzymatic hydrolysate of Spirulina platensis. A novel antioxidant peptide was obtained by ultrafiltration, gel filtration chromatography, and reverse-phase high-performance liquid chromatography, with the 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging assay used to measure the antioxidant activity, and the sequence was determined to be Pro-Asn-Asn (343.15 Da) by electrospray ionization tandem mass spectrometry. This peptide was synthesized to confirm its antioxidant properties, and it exhibited 81.44 ± 0.43% DPPH scavenging activity at 100 µg/ml, which was similar to that of glutathione (82.63 ± 0.56%). Furthermore, the superoxide anion and hydroxyl free-radical scavenging activities and the SOD activity of the peptide were 47.84 ± 0.49%, 54.01 ± 0.82%, and 12.55 ± 0.75%, respectively, at 10 mg/ml. These results indicate that S. platensis is a good source of antioxidant peptides, and that its hydrolysate may have important applications in the pharmaceutical and food industries.

  16. Biological Synthesis of Silver Nanoparticles by Cell-Free Extract of Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Gaurav Sharma


    Full Text Available The present study explores biological synthesis of silver nanoparticles (AgNPs using the cell-free extract of Spirulina platensis. Biosynthesised AgNPs were characterised by UV-Vis spectroscopy, SEM, TEM, and FTIR analysis and finally evaluated for antibacterial activity. Extracellular synthesis using aqueous extract of S. platensis showed the formation of well scattered, highly stable, spherical AgNPs with an average size of 30–50 nm. The size and morphology of the nanoparticles were confirmed by SEM and TEM analysis. FTIR and UV-Vis spectra showed that biomolecules, proteins and peptides, are mainly responsible for the formation and stabilisation of AgNPs. Furthermore, the synthesised nanoparticles exhibited high antibacterial activity against pathogenic Gram-negative, that is, Escherichia coli, MTCC-9721; Proteus vulgaris, MTCC-7299; Klebsiella pneumoniae, MTCC-9751, and Gram-positive, that is, Staphylococcus aureus, MTCC-9542; S. epidermidis, MTCC-2639; Bacillus cereus, MTCC-9017, bacteria. The AgNPs had shown maximum zone of inhibition (ZOI that is 31.3±1.11 in P. vulgaris. Use of such a microalgal system provides a simple, cost-effective alternative template for the biosynthesis of nanomaterials of silver in a large scale that could be of great use in biomedical applications.

  17. Pressurized liquid extracts from Spirulina platensis microalga Determination of their antioxidant activity and preliminary analysis by micellar electrokinetic chromatography


    Herrero, Miguel; Ibáñez, Elena; Señorans, F. Javier; Cifuentes, Alejandro


    In this work, different extracts from the microalga Spirulina platensis are obtained using pressurized liquid extraction (PLE) and four different solvents (hexane, light petroleum, ethanol andwater). Different extraction temperatures (115 and 170 ◦C) were tested using extraction times ranging from 9 to 15 min. The antioxidant activity of the different extracts is determined by means of an in vitro assay using a free radical method. Moreover, a new and fast method is developed using m...

  18. Chromium (VI) biosorption and removal of chemical oxygen demand by Spirulina platensis from wastewater-supplemented culture medium. (United States)

    Magro, Clinei D; Deon, Maitê C; De Rossi, Andreia; Reinehr, Christian O; Hemkemeier, Marcelo; Colla, Luciane M


    The inappropriate discharge of wastewater containing high concentrations of toxic metals is a serious threat to the environment. Given that the microalga Spirulina platensis has demonstrated a capacity for chromium VI (Cr (VI) biosorption, we assessed the ideal concentration of chromium-containing wastewater required for maximum removal of Cr (VI) and chemical oxygen demand (COD) from the environment by using this microalga. The Paracas and Leb-52 strains of S. platensis, with initial wastewater concentrations of 0%, 12.5%, 25%, and 50%, were cultured in Zarrouk medium diluted to 50% under controlled air, temperature, and lighting conditions. The cultures were maintained for 28 days, and pH, biomass growth, COD, and Cr (VI) were assessed. The wastewater concentration influenced microalgal growth, especially at high concentrations. Removal of 82.19% COD and 60.92% Cr (VI) was obtained, but the COD removal was greater than the Cr (VI) removal in both strains of S. platensis.

  19. Phytoremediation of kitchen wastewater by Spirulina platensis (Nordstedt Geiteler: pigment content, production variable cost and nutritional value

    Directory of Open Access Journals (Sweden)

    Siripen Traichaiyaporn1


    Full Text Available Phytoremediation of domestic wastewater by Spirulina platensis was carried out using kitchen wastewater. A complete randomised design (CRD was created for the experiment which was performed on modified Zarrouk’s medium (Zm, 100% kitchen wastewater (100%Kw and 90% kitchen wastewater (90%Kw. Water quality, biomass production, pigment content and nutritional value of Spirulina platensis were determined from cultures harvested every 5 days for a period of 15 days. The physico-chemical properties of cultivated wastewater were: water temperature 27-28 oC, pH 8.73-9.77 and DO 0.20-7.20 mg L-1. The 100%Kw and 90%Kw produced lower BOD, COD, TP, NH3-N, ON, TKN, NO3-N, NO2-N, TON and TN compared to Zm with p< 0.05. After cultivation, the treated kitchen wastewater met the standards for safe discharge in Thailand. The highest level of -carotene of S. platensis was achieved in Zm (0.29 mg g-1 and 100%Kw (0.29 mg g – 1 while the highest levels of C-phycocyanin were obtained in 100%Kw (17.95 mg g -1 and 90%Kw (16.31 mg g-1. The highest production variable cost for dry weight of S. platensis was in Zm (310.6 Baht kg -1 and 90%Kw (303.6 Baht kg -1 as compared to 100%Kw (276.6 Baht kg -1, with p<0.05. The highest biomass production of S. platensis was achieved in Zm (0.84 g L-1 and 100%Kw (0.82 g L-1, with protein content of 54.44% and 35.86%, respectively. Implications for the use of S. platensis for phytoremediation and C-phycocyanin production using of 100%Kw and 90% Kw are discussed.

  20. The potential effects of Spirulina platensis (Arthrospira platensis on tissue protection of Nile tilapia (Oreochromis niloticus through estimation of P53 level

    Directory of Open Access Journals (Sweden)

    Mai D. Ibrahem


    Full Text Available The current study was designed to investigate the potential effect of Spirulina platensis, Arthrospira platensis, (SP on tissue protection of Nile tilapia (Oreochromis niloticus through estimation of P53 level. Five isonitrogenous and isocaloric rations containing graded levels of dried SP 5, 7.5,10, 15, and 20 g/kg diet were fed separately to five equal groups of O. niloticus fingerlings, additional control group was assigned for 3 months. Liver samples were separately collected from each group by the end of each month. The expression level of P53 showed a substantial decrease among the treated groups in a time-dependent manner. It is therefore advisable to incorporate SP in diets for tissue protection and antioxidant effects in cultured O. niloticus.

  1. Removal of Nitrate and Phosphate from Municipal Wastewater Sludge by Chlorella vulgaris, Spirulina platensis and Scenedesmus quadricauda

    Directory of Open Access Journals (Sweden)

    Jalal K.C.A


    Full Text Available Nitrate and phosphorus in wastewater contribute to health and environmental threats as they are linked to illnesses as well as ecosystem disruption via algal blooms in contaminated water bodies. Based on above perspectives a comparative study was conducted on three local freshwater microalgae:Chlorella vulgaris, Spirulina platensis and Scenedesmus quadricauda to evaluate their effects on nitrate and phosphorus removal from municipal wastewater sludge (MWS. Algae performance in removing nitrate and phosphorus was evaluated by measuring nitrate and phosphorus content of MWS incubated with the strains for 7 days. Instantaneous readings were taken every 48 hours to determine periodic levels of the nutrients phosphate and nitrate. BOD5 was also evaluated to identify the strain with the most robust growth that would demand for oxygen the most in the dark. Spirulina platensis was shown as the most efficient microalgae to reduce nitrate in MWS and the best-growing among the three strains, while Chlorella vulgaris removed phosphorus the most effectively. Thus Spirulina and Chlorella could be potential candidates by showing their intrinsic merit for the reduction of phosphate and nitrate in wastewater treatment.ABSTRAK: Nitrat dan fosforus dalam air sisa menggugat kesihatan dan mengancam alam sekitar memandangkan ia berkait dengan penyakit-penyakit serta gangguan terhadap ekosistem melalui pembiakan alga dalam air yang tercemar. Berdasarkan perspektif di atas, satu kajian perbandingan telah dijalankan terhadap tiga mikro alga air tawar tempatan : Chlorella vulgaris, Spirulina platensis dan Scenedesmus quadricauda untuk dinilai kesannya terhadap penyingkiran nitrat dan fosforus dari enap cemar air sisa bandaran (municipal wastewater sludge (MWS. Kebolehan alga dalam penyingkiran nitrat dan fosforus dikaji dengan menyukat kandungan nitrat dan fosforus dalam MWS yang dieramkan dengan strain ini selama 7 hari. Bacaan serta-merta diambil setiap 48 jam untuk

  2. Energy values and chemical composition of spirulina (Spirulina platensis evaluated with broilers Valores energéticos e composição química da espirulina (Spirulina platensis avaliada com frangos de corte

    Directory of Open Access Journals (Sweden)

    Renata Ribeiro Alvarenga


    Full Text Available The objective of this study was to determine the chemical and energy composition of spirulina (Spirulina platensis, the nutrient metabolizability coefficients, and the values of apparent metabolizable energy (AME and the apparent metabolizable energy corrected for nitrogen balance (AMEn in broilers. A digestibility trial was carried out by using total excreta collection method, with 90 Cobb 500 lineage chicks, with initial weight of 256 ± 5 g at 11 days of age. Birds were allotted in metabolic cages for 10 days, distributed in a completely randomized design, with three treatments and six repetitions with five birds each. Diets consisted on a reference-ration based on corn and soybean meal and two test diets, one containing spirulina (30% and the other one with soybean meal (30%. Spiruline was superior to soybean meal for contents of dry matter (DM, gross energy (9.60%, crude protein (26.56%, ether extract (54.45%, mineral matter (42.77%, calcium (100% and total phosphorus (130.77% and also for most amino acids, except lysine, glutamate, histidine and proline. Nevertheless, spiruline presented lower values of gross fiber (83.95%, acid detergent fiber (85.12% and neutral detergent fiber (6.15. The AME and AMEn values (kcal/kg of DM were, respectively, 2,906 and 2,502 for the spirulina and 2,646 and 2,340 for the soybean meal and AMEn of spirulina was 6.92% higher than soybean meal.Objetivou-se determinar a composição química e energética da espirulina (Spirulina platensis, os coeficientes de metabolizabilidade dos nutrientes e os valores de energia metabolizável aparente (EMA e aparente corrigida pelo balanço de nitrogênio (EMAn em frangos de corte. Realizou-se um ensaio de digestibilidade utilizando-se a metodologia de coleta total de excretas com 90 pintos machos da linhagem Cobb 500, com peso inicial de 256 ± 5 g aos 11 dias de idade. As aves foram alojadas em gaiolas de metabolismo durante dez dias, distribuídas em delineamento

  3. Spirulina platensis

    African Journals Online (AJOL)



    Aug 28, 2013 ... techniques for cultivation of useful microalgae ... cheaper nutritional sources such as ammonia and urea. (Bezerra et al., 2008; .... The analysis was conducted with .... tion effect was less marked with urea due to enzymatic.

  4. Spirulina platensis versus silymarin in the treatment of chronic hepatitis C virus infection. A pilot randomized, comparative clinical trial

    Directory of Open Access Journals (Sweden)

    Yakoot Mostafa


    Full Text Available Abstract Background Spirulina platensis, a cynobacterium used frequently as a dietary supplement had been found to exhibit many immune-stimulating and antiviral activities. It had been found to activate macrophages, NK cells, T cells, B cells, and to stimulate the production of Interferon gamma (IFN-γ and other cytokines. Natural substances isolated from Spirulina platensis had been found to be potent inhibitors against several enveloped viruses by blocking viral absorption/penetration and some replication stages of progeny viruses after penetration into cells. We aimed to study whether this dietary supplement possesses any therapeutically feasible activity worthy of further larger controlled clinical evaluation. Methods Sixty six patients with chronic hepatitis C virus infection and eligible for inclusion had been randomized to either Spirulina or Silymarin treated groups for a period of six months treatment. The two groups were followed up and blindly compared for early (after 3 months and end of 6 months treatment virological response. The effects of both treatments on each of alanine aminotransferase (ALT, Chronic Liver Disease Questionnaire scores (CLDQ, Arizona Sexual Experience Scale scores (ASEX and the occurrence of any attributable adverse events were also compared. Results Among the 30 patients who had been treated with Spirulina and completed the 6 months protocol, 4 patients (13.3% had a complete end of treatment virological response and 2 patients (6.7% had a partial end of treatment response defined as significant decrease of virus load of at least 2-logs10. Though the proportion of responders in Spirulina group was greater than in the Silymarin group, the difference was not statistically significant at the end of both 6 months (p = 0.12 and 3 months treatment (p = 0.22 by Exact test. Alanine aminotransferase as well as CLDQ and ASEX scores were found to be more significantly improved in Spirulina than in Silymarin treated group

  5. Effects of Spirulina platensis on DNA damage and chromosomal aberration against cadmium chloride-induced genotoxicity in rats. (United States)

    Aly, Fayza M; Kotb, Ahmed M; Hammad, Seddik


    Todays, bioactive compounds extracted from Spirulina platensis have been intensively studied for their therapeutical values. Therefore, in the present study, we aimed to evaluate the effects of S. platensis extract on DNA damage and chromosomal aberrations induced by cadmium in rats. Four groups of male albino rats (n = 7 rats) were used. The first group served as a control group and received distilled water. The second group was exposed intraperitoneally to cadmium chloride (CdCl 2 ) (3.5 mg/kg body weight dissolved in 2 ml distilled water). The third group included the rats that were orally treated with S. platensis extract (1 g/kg dissolved in 5 ml distilled water, every other day for 30 days). The fourth group included the rats that were intraperitoneally and orally exposed to cadmium chloride and S. platensis, respectively. The experiment in all groups was extended for 60 days. The results of cadmium-mediated toxicity revealed significant genetic effects (DNA fragmentation, deletion or disappearance of some base pairs of DNA, and appearance of few base pairs according to ISSR-PCR analysis). Moreover, chromosomes showed structural aberrations such as reduction of chromosomal number, chromosomal ring, chromatid deletions, chromosomal fragmentations, and dicentric chromosomes. Surprisingly, S. platensis extract plus CdCl 2 -treated group showed less genetic effects compared with CdCl 2 alone. Further, S. platensis extract upon CdCl 2 toxicity was associated with less chromosomal aberration number and nearly normal appearance of DNA fragments as indicated by the bone marrow and ISSR-PCR analysis, respectively. In conclusion, the present novel study showed that co-treatment with S. platensis extract could reduce the genotoxic effects of CdCl 2 in rats.

  6. Proteomic analysis and qRT-PCR verification of temperature response to Arthrospira (Spirulina platensis.

    Directory of Open Access Journals (Sweden)

    Wang Huili

    Full Text Available Arthrospira (Spirulina platensis (ASP is a representative filamentous, non-N2-fixing cyanobacterium that has great potential to enhance the food supply and possesses several valuable physiological features. ASP tolerates high and low temperatures along with highly alkaline and salty environments, and can strongly resist oxidation and irradiation. Based on genomic sequencing of ASP, we compared the protein expression profiles of this organism under different temperature conditions (15°C, 35°Cand 45°C using 2-DE and peptide mass fingerprinting techniques. A total of 122 proteins having a significant differential expression response to temperature were retrieved. Of the positively expressed proteins, the homologies of 116 ASP proteins were found in Arthrospira (81 proteins in Arthrospira platensis str. Paraca and 35 in Arthrospira maxima CS-328. The other 6 proteins have high homology with other microorganisms. We classified the 122 differentially expressed positive proteins into 14 functions using the COG database, and characterized their respective KEGG metabolism pathways. The results demonstrated that these differentially expressed proteins are mainly involved in post-translational modification (protein turnover, chaperones, energy metabolism (photosynthesis, respiratory electron transport, translation (ribosomal structure and biogenesis and carbohydrate transport and metabolism. Others proteins were related to amino acid transport and metabolism, cell envelope biogenesis, coenzyme metabolism and signal transduction mechanisms. Results implied that these proteins can perform predictable roles in rendering ASP resistance against low and high temperatures. Subsequently, we determined the transcription level of 38 genes in vivo in response to temperature and identified them by qRT-PCR. We found that the 26 differentially expressed proteins, representing 68.4% of the total target genes, maintained consistency between transcription and

  7. Cultivation of Arthrospira (Spirulina platensis using confectionary wastes for aquaculture feeding

    Directory of Open Access Journals (Sweden)

    Hala Y. El-Kassas


    Full Text Available The microalga biomass production from confectionary effluent is a possible solution for the urgent need for a live food in aquaculture. Arthrospira (Spirulina platensis was the dominant alga in effluent of “Biscomisr a confectionary factory”, in Alexandria–Egypt. Therefore, it was isolated from the effluent samples and used throughout the study. The cyanobacterium, A. platensis was grown on the effluent using 22 Central Composite Design (22 CCD. This work addresses the best effluent dilution (WC, % as well as sodium bicarbonate concentration (SBC on the alga growth and biochemical composition. Total protein, carbohydrate, lipid contents and fatty acid profiles of the produced algal biomass were highly improved. The statistical analyses suggested that the main effect of (WC, % is significant negative influences on the algal contents of proteins, lipids and carbohydrates (p > 0.01. Although it had a significant positive influence on chlorophyll (p > 0.01, no significant effect on algal β carotenes (p > 0.05 had been reported. The inter action effect of SBC together with WC, % exerted a significant negative influence on the algal proteins (p > 0.01 and no significant effect on the other responses (p > 0.05. The produced alga biomass was used for feeding the rotifer, Brachionus plicatilis for further application in aquaculture. Growth rate, reproductive rate and fecundity attributes, fatty acid content of B. plicatilis were amended. The Pearson correlation test indicated that β carotenes displayed a highly positive significant correlation with the growth rate of B. plicatilis (r = 0.733, p < 0.01 and the carbohydrates showed significant positive correlations with Egg % (r = 0.657, p < 0.05.

  8. Role of pH on antioxidants production by Spirulina (Arthrospira platensis

    Directory of Open Access Journals (Sweden)

    Mostafa Mahmoud Sami Ismaiel


    Full Text Available Abstract Algae can tolerate a broad range of growing conditions but extreme conditions may lead to the generation of highly dangerous reactive oxygen species (ROS, which may cause the deterioration of cell metabolism and damage cellular components. The antioxidants produced by algae alleviate the harmful effects of ROS. While the enhancement of antioxidant production in blue green algae under stress has been reported, the antioxidant response to changes in pH levels requires further investigation. This study presents the effect of pH changes on the antioxidant activity and productivity of the blue green alga Spirulina (Arthrospira platensis. The algal dry weight (DW was greatly enhanced at pH 9.0. The highest content of chlorophyll a and carotenoids (10.6 and 2.4 mg/g DW, respectively was recorded at pH 8.5. The highest phenolic content (12.1 mg gallic acid equivalent (GAE/g DW was recorded at pH 9.5. The maximum production of total phycobiliprotein (159 mg/g DW was obtained at pH 9.0. The antioxidant activities of radical scavenging activity, reducing power and chelating activity were highest at pH 9.0 with an increase of 567, 250 and 206% compared to the positive control, respectively. Variation in the activity of the antioxidant enzymes superoxide dismutase (SOD, catalase (CAT and peroxidase (POD was also reported. While the high alkaline pH may favor the overproduction of antioxidants, normal cell metabolism and membrane function is unaffected, as shown by growth and chlorophyll content, which suggests that these conditions are suitable for further studies on the harvest of antioxidants from S. platensis.

  9. Experimental Substantiation of the Possibility of Developing Selenium- and Iodine-Containing Pharmaceuticals Based on Blue-Green Algae Spirulina Platensis

    CERN Document Server

    Mosulishvili, L M; Belokobylsky, A I; Khisanishvili, L A; Frontasyeva, M V; Pavlov, C C; Gundorina, S F


    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using -reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loding of the above elements was characterised. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed.

  10. Experimental substantiation of the possibility of developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis

    International Nuclear Information System (INIS)

    Mosulishvili, L.M.; Kirkesali, E.I.; Belokobyl'skij, A.I.; Khizanishvili, A.I.; Frontas'eva, M.V.; Pavlov, S.S.; Gundorina, S.F.


    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p)-reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in Spirulina platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loading of the above elements was characterised. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed

  11. Mutant strains of Spirulina (Arthrospira) platensis to increase the efficiency of micro-ecological life support systems (United States)

    Brown, Igor

    The European Micro-Ecological Life Support System Alternative (MELiSSA) is an advanced idea for organizing a bioregenerative system for long term space flights and extraterrestrial settlements (Hendrickx, De Wever et al., 2005). Despite the hostility of both lunar and Martian environments to unprotected life, it seems possible to cultivate photosynthetic bacteria using closed bioreactors illuminated and heated by solar energy. Such reactors might be employed in critical processes, e.g. air revitalization, foodcaloric and protein source, as well as an immunomodulators production. The MELiSSA team suggested cyanobacterium Spirulina as most appropriate agent to revitalize air and produce a simple "fast" food. This is right suggestion because Spirulina was recently shown to be an oxygenic organism with the highest level of O2 production per unit mass (Ananyev et al., 2005). Chemical composition of Spirulina includes proteins (55Aiming to make Spirulina cultivation in life support systems like MELiSSA more efficient, we selected Spirulina mutant strains with increased fraction of methionine in the biomass of this cyanobacterium and compared the effect of parental wild strain of Spirulina and its mutants on the tendency of such experimental illnesses as radiationinduced lesions and hemolythic anemia. Results: It was found that mutant strains 198B and 27G contain higher quantities of total protein, essential amino acids, c-phycocyanin, allophycocyanin and chlorophyll a than parental wild strain of S. platensis. The strain 198B is also characterized with increased content of carotenoids. Revealed biochemical peculiarities of mutant strains suggest that these strains can serve as an additional source of essential amino acids as well as phycobiliproteins and carotenoids for the astronauts. Feeding animals suffering from radiation-induced lesions, c-phycocyanin, extracted from strain 27G, led to a correction in deficient dehydrogenase activity and energy-rich phosphate levels

  12. Valores energéticos e composição química da espirulina (Spirulina platensis) avaliada com frangos de corte


    Alvarenga, Renata Ribeiro; Rodrigues, Paulo Borges; Cantarelli, Vinícius de Souza; Zangeronimo, Márcio Gilberto; Silva Júnior, José Walter da; Silva, Leonardo Rafael da; Santos, Luziane Moreira dos; Pereira, Luciano José


    The objective of this study was to determine the chemical and energy composition of spirulina (Spirulina platensis), the nutrient metabolizability coefficients, and the values of apparent metabolizable energy (AME) and the apparent metabolizable energy corrected for nitrogen balance (AMEn) in broilers. A digestibility trial was carried out by using total excreta collection method, with 90 Cobb 500 lineage chicks, with initial weight of 256 ± 5 g at 11 days of age. Birds were allotted in metab...

  13. Optimization of phycocyanin extraction from microalgae Spirulina platensis by sonication as antioxidant (United States)

    Dianursanti, Indraputri, Claudia Maya; Taurina, Zarahmaida


    Cardiovascular disease is known as an epidemic disease which has high casualty in the world. One of its trigger factors is the amount of reactive oxygen species (ROS) inside the body. In order to regulate its amount, antioxidant ingestion is compulsory. Microalgae can be adopted as a source of antioxidant. Spirulina platensis is one of the consistently produced microalgae. It contains phycocyanin, a blue pigment, which is known as a nutritious food agent. Phycocyanin could be assumed as an antioxidant and has been clinically validated both in vitro and in vivo. This research is proposed to determine the optimum extraction time. The experiment was conducted by sonication at 37 kHz using phosphate buffer as the solvent. The result exhibited that increasing the sonication time would increase the yield until it achieved the optimum yield. Based on the experiment, the optimum extraction time was 25 minutes with yield of 8.25 mg/g dry biomass and purity of 0.6. It can be summarized that extraction time also affected the extraction efficiency and its antioxidant activity. This paper shows a prospect on future development in cultivating micro flora in Indonesia, particularly in Depok.

  14. Antioxidative activity of ethanol extracts from Spirulina platensis and Nostoc linckia measured by various methods

    Directory of Open Access Journals (Sweden)

    Liliana CEPOI


    Full Text Available The goal of this work is to determine the level of antioxidative activity of various ethanol extracts from Spirulina platensis and Nostoc linckia biomass, and also to demonstrate the possibility to select suitable methods for evaluation of these characteristics. The methods for determination of antioxidative activity were selected concerning their possible use for complex preparations: phosphomolybdenum method for evaluation of antioxidant capacity (PMRC, radical-scavenging activity by DPPH method (DPPH, antioxidant activity by the ABTS+ radical cation assay (ABTS, Folin-Ciocalteu reducing capacity (FCRC. We showed the presence of antioxidative substances in ethanol extractions from 2 species of cyanobacteria, and possibility to increase their activity varying ethanol concentration. It facilitates the extraction both water- and lipid-soluble components from biomass. Regarding used methods for antioxidative activity determination, we have used only those based on reaction of electrons return (which widely used nowadays in vitro. Obtained in different ways results demonstrate high reduction capacity of the extracts and possibility to select suitable analytical methods for each case.

  15. Subcellular proteomic characterization of the high-temperature stress response of the cyanobacterium Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Cheevadhanarak Supapon


    Full Text Available Abstract The present study examined the changes in protein expression in Spirulina platensis upon exposure to high temperature, with the changes in expression analyzed at the subcellular level. In addition, the transcriptional expression level of some differentially expressed proteins, the expression pattern clustering, and the protein-protein interaction network were analyzed. The results obtained from differential expression analysis revealed up-regulation of proteins involved in two-component response systems, DNA damage and repair systems, molecular chaperones, known stress-related proteins, and proteins involved in other biological processes, such as capsule formation and unsaturated fatty acid biosynthesis. The clustering of all differentially expressed proteins in the three cellular compartments showed: (i the majority of the proteins in all fractions were sustained tolerance proteins, suggesting the roles of these proteins in the tolerance to high temperature stress, (ii the level of resistance proteins in the photosynthetic membrane was 2-fold higher than the level in two other fractions, correlating with the rapid inactivation of the photosynthetic system in response to high temperature. Subcellular communication among the three cellular compartments via protein-protein interactions was clearly shown by the PPI network analysis. Furthermore, this analysis also showed a connection between temperature stress and nitrogen and ammonia assimilation.

  16. Antioxidant Potential of Spirulina platensis Mitigates Oxidative Stress and Reprotoxicity Induced by Sodium Arsenite in Male Rats (United States)

    Bashandy, Samir A. E.; El Awdan, Sally A.; Ebaid, Hossam; Alhazza, Ibrahim M.


    The present study aimed to examine the protective role of Spirulina platensis (S. platensis) against arsenic-induced testicular oxidative damage in rats. Arsenic (in the form of NaAsO2 at a dose of 6.3 mg/kg body weight for 8 weeks) caused a significant accumulation of arsenic in testicular tissues as well as a decrease in the levels of testicular superoxide dismutase (SOD), catalase (CAT), reduced glutathione, and zinc. Moreover, it significantly decreased plasma testosterone, luteinizing hormone (LH), triiodothyronine (T3), and thyroxine (T4) levels and reduced sperm motility and sperm count. Arsenic (AS) led to a significant increase in testicular malondialdehyde (MDA), tumour necrosis factor alpha (TNF-α), nitric oxide (NO), and sperm abnormalities. S. platensis at a dose of 300 mg/kg was found to attenuate As-induced oxidative stress, testicular damage, and sperm abnormalities by its potent antioxidant activity. S. platensis may represent a potential therapeutic option to protect the testicular tissue from arsenic intoxication. PMID:26881036

  17. Antioxidant Potential of Spirulina platensis Mitigates Oxidative Stress and Reprotoxicity Induced by Sodium Arsenite in Male Rats

    Directory of Open Access Journals (Sweden)

    Samir A. E. Bashandy


    Full Text Available The present study aimed to examine the protective role of Spirulina platensis (S. platensis against arsenic-induced testicular oxidative damage in rats. Arsenic (in the form of NaAsO2 at a dose of 6.3 mg/kg body weight for 8 weeks caused a significant accumulation of arsenic in testicular tissues as well as a decrease in the levels of testicular superoxide dismutase (SOD, catalase (CAT, reduced glutathione, and zinc. Moreover, it significantly decreased plasma testosterone, luteinizing hormone (LH, triiodothyronine (T3, and thyroxine (T4 levels and reduced sperm motility and sperm count. Arsenic (AS led to a significant increase in testicular malondialdehyde (MDA, tumour necrosis factor alpha (TNF-α, nitric oxide (NO, and sperm abnormalities. S. platensis at a dose of 300 mg/kg was found to attenuate As-induced oxidative stress, testicular damage, and sperm abnormalities by its potent antioxidant activity. S. platensis may represent a potential therapeutic option to protect the testicular tissue from arsenic intoxication.

  18. Investigation of the Structure and Element Composition of C-Phycocyanin Extracted from the Microalgae Spirulina platensis

    CERN Document Server

    Mosulishvili, L M; Kirkesali, E I; Khizanishvili, A I; Frontasyeva, M V; Pavlov, S S; Gundorina, S F


    The structure and element composition of C-phycocyanin (C-PC) extracted from the blue-green alga Spirulina platensis were studied. The behavior of structural subunits forming phycobilisomes in the purification process was studied by capillary electrophoresis. Their proportion in high-purity C-PC was determined. The element composition of C-PC of different purity was studied by means of epithermal neutron activation analysis, and metals which may form macromolecular complexes with C-PC were determined (Zn, Cr, Ni, Co, As, Sr, Mo, Ag, Hg). It was shown that contents of toxic metals did not exceed accepted permissible levels for the human organism.

  19. Protective effects of a polysaccharide from Spirulina platensis on dopaminergic neurons in an MPTP-induced Parkinson′s disease model in C57BL/6J mice

    Directory of Open Access Journals (Sweden)

    Fang Zhang


    Full Text Available The present study aimed to determine whether a polysaccharide obtained from Spirulina platensis shows protective effects on dopaminergic neurons. A Parkinson′s disease model was established through the intraperitoneal injection of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP in C57BL/6J mice. Prior to the MPTP injection, some mice were pretreated with intraperitoneal injections of a polysaccharide derived from Spirulina platensis once daily for 10 days. The results showed that the immunoreactive staining and mRNA expression of the dopamine transporter and tyrosine hydroxylase, the rate-limiting enzyme in dopamine synthesis, in the substantia nigra, were significantly increased in mice pretreated with 800 mg/kg of the polysaccharide compared with those in MPTP-treated mice. The activities of superoxide dismutase and glutathione peroxidase in the serum and midbrain were also increased significantly in mice injected with MPTP after pretreatment with the polysaccharide from Spirulina platensis. By contrast, the activity of monoamine oxidase B in serum and midbrain maintained unchanged. These experimental findings indicate that the polysaccharide obtained from Spirulina platensis plays a protective role against the MPTP-induced loss of dopaminergic neurons in C57BL/6J mice, and that the antioxidative properties of this polysaccharide likely underlie its neuroprotective effect.

  20. Sequence of the gamma-subunit of Spirulina platensis : a new principle of thiol modulation of F0F1 ATP synthase?

    NARCIS (Netherlands)

    Steinemann, D.; Lill, H


    The gene encoding the gamma subunit of Spirulina platensis F0F1, the relative of the chloroplast F1 subunit responsible for thiol activation, has been cloned and sequenced. As in other cyanobacteria, a specific couple of cysteines like those involved in thiol modulation of the chloroplast enzyme was

  1. Anti-Inflammatory Effects of Spirulina platensis Extract via the Modulation of Histone Deacetylases

    Directory of Open Access Journals (Sweden)

    Tho X. Pham


    Full Text Available We previously demonstrated that the organic extract of Spirulina platensis (SPE, an edible blue-green alga, possesses potent anti-inflammatory effects. In this study, we investigated if the regulation of histone deacetylases (HDACs play a role in the anti-inflammatory effect of SPE in macrophages. Treatment of macrophages with SPE rapidly and dose-dependently reduced HDAC2, 3, and 4 proteins which preceded decreases in their mRNA levels. Degradation of HDAC4 protein was attenuated in the presence of inhibitors of calpain proteases, lysosomal acidification, and Ca2+/calmodulin-dependent protein kinase II, respectively, but not a proteasome inhibitor. Acetylated histone H3 was increased in SPE-treated macrophages to a similar level as macrophages treated with a pan-HDAC inhibitor, with concomitant inhibition of inflammatory gene expression upon LPS stimulation. Knockdown of HDAC3 increased basal and LPS-induced pro-inflammatory gene expression, while HDAC4 knockdown increased basal expression of interleukin-1β (IL-1β, but attenuated LPS-induced inflammatory gene expression. Chromatin immunoprecipitation showed that SPE decreased p65 binding and H3K9/K14 acetylation at the Il-1β and tumor necrosis factor α (Tnfα promoters. Our results suggest that SPE increased global histone H3 acetylation by facilitating HDAC protein degradation, but decreases histone H3K9/K14 acetylation and p65 binding at the promoters of Il-1β and Tnfα to exert its anti-inflammatory effect.

  2. Composition and functional property of photosynthetic pigments under circadian rhythm in the cyanobacterium Spirulina platensis. (United States)

    Kumar, Deepak; Kannaujiya, Vinod K; Richa; Pathak, Jainendra; Sundaram, Shanthy; Sinha, Rajeshwar P


    Circadian rhythm is an important endogenous biological signal for sustainable growth and development of cyanobacteria in natural ecosystems. Circadian effects of photosynthetically active radiation (PAR), ultraviolet-A (UV-A) and ultraviolet-B (UV-B) radiations on pigment composition have been studied in the cyanobacterium Spirulina platensis under light (L)/dark (D) oscillation with a combination of 4/20, 8/16, 12/12, 16/8, 20/4 and 24/24 h time duration. Circadian exposure of PAR + UV-A (PA) and PAR + UV-A + UV-B (PAB) showed more than twofold decline in Chl a, total protein and phycocyanin (PC) in light phase and significant recovery was achieved in dark phase. The fluorescence emission wavelength of PC was shifted towards lower wavelengths in the light phase of PAB in comparison to P and PA whereas the same wavelength was retrieved in the dark phase. The production of free radicals was accelerated twofold in the light phase (24 h L) whereas the same was retrieved to the level of control during the dark phase. Oxidatively induced damage was alleviated by antioxidative enzymes such as catalase (CAT), peroxidase (POD), superoxide dismutase (SOD) and ascorbate peroxidase (APX) in the light phase (0-24-h L) whereas the dark phase showed significant inhibition of the same enzymes. Similar characteristic inhibition of free radicals and recovery of PC was observed inside cellular filament after circadian rhythm of 24/24 h (L/D). Circadian exposure of P, PA and PAB significantly altered the synthesis and recovery of pigments that could be crucial for optimization and sustainable production of photosynthetic products for human welfare.

  3. Experimental substantiation of the possibility of developing selenium- and iodine-containing pharmaceuticals based on blue-green algae Spirulina platensis. (United States)

    Mosulishvili, L M; Kirkesali, E I; Belokobylsky, A I; Khizanishvili, A I; Frontasyeva, M V; Pavlov, S S; Gundorina, S F


    The great potential of using blue-green algae Spirulina platensis as a matrix for the production of selenium- and iodine-containing pharmaceuticals is shown experimentally. The background levels of 31 major, minor and trace elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni (using (n,p) reaction), As, Br, Zn, Rb, Mo, Ag, Sb, I, Ba, Sm, Tb, Tm, Hf, Ta, W, Au, Hg, Th) in S. platensis biomass were determined by means of epithermal neutron activation analysis. The dependence of selenium and iodine accumulation in spirulina biomass on a nutrient medium loading of the above elements was characterized. To demonstrate the possibilities of determining toxic element intake by spirulina biomass, mercury was selected. The technological parameters for production of iodinated treatment-and-prophylactic pills are developed.

  4. The effect of spirulina (Arthrospira platensis (Oscillatoriales: Cyanobacteria on the experimental breeding of Pseudosuccinea columella (Basommatophora: Lymnaeidae

    Directory of Open Access Journals (Sweden)

    Lucila Prepelitchi


    Full Text Available Snails of the family Lymnaeidae, as Pseudosuccinea columella, are the intermediate hosts of Fasciola hepatica, the causative agent of fasciolosis in human and livestock all over the world. A thorough knowledge of snail biology is essential for describing the transmission dynamics and for controlling this disease. Since food quality has had a significant effect on snail growth, fecundity and fertility, in this study we evaluated the use of spirulina (Arthrospira platensis as a food resource for the artificial breeding of P. columella, an invasive snail and the main intermediate host of F. hepatica in Northeastern Argentina. The main purpose was to measure the effect of spirulina on fitness parameters such as survival rate, growth rate, size at first reproduction, lifetime fecundity and viable offspring. A total of 20 676 newly-laid F2 eggs were used; half of them were fed with lettuce (treatment L and the other half with lettuce plus spirulina (treatment L+S. In comparison with P. columella snails fed only with lettuce, we found that P. columella fed with lettuce plus spirulina: 1 showed higher survival rates, 2 grew faster and showed higher growth increments, 3 attained sexual maturity earlier in time (L+S:60 days vs. L:120 days and at a smaller size (L+S:4.8mm vs. L:8.2mm, 4 had a longer reproductive period (L+S:150 days vs. L:90 days, 5 produced a higher number of eggs/snail (L+S:29.6 vs. L:13.3, and 6 showed a higher offspring hatching rate (L+S:70% vs. L:40%. The supplementation of P. columella diet with commercial spirulina enhances it fitness and improved the artificial breeding of this species. Spirulina may have a direct positive effect on P. columella development by consuming it, along with an indirect positive effect by improving the water quality. This rearing technique provided large number of reproducing adults and a continuous production of offspring, which are essential for developing future experimental studies in order to

  5. Optimization growth of Spirulina platensis in bean sprouts extract medium with urea fertilizer for phycocyanin production as antioxidant (United States)

    Dianursanti, Taurina, Zarahmaida; Indraputri, Claudia Maya


    Spirulina platensis has the potential to be developed because of essential chemical compounds in the form of phycocyanin that can be used as an antioxidant. The growth of microalgae and phycocyanin depends on the availability of nutrition contained in culture medium. The cultivation will be carried out at 1 L reactor with continuous aeration, light intensity is 3000-4000 lux, and temperature is 27-30°C. Phycocyanin is obtained by liquid-liquid extraction method using phosphate buffer pH 7. Phycocyanin test performed by using UV-Vis spectrophotometry. The result show that the highest dry biomass is obtained on bean sprouts extract medium 8% (v/v) with the addition of urea fertilizer 120 ppm. The highest content of phycocyanin is obtained on bean sprouts extract medium 8% (v/v) with the addition of urea fertilizer 100 ppm with phycocyanin concentration of 257.12 mg/L.

  6. Evaluation of fuel properties for microalgae Spirulina platensis bio-diesel and its blends with Egyptian petro-diesel

    Directory of Open Access Journals (Sweden)

    Soha S.M. Mostafa


    In this study, the feasibility of biodiesel production from microalga Spirulina platensis has been investigated. The physico–chemical characteristics of the produced biodiesel were studied according to the standards methods of analysis (ASTM and evaluated according to their fuel properties as compared to Egyptian petro-diesel. Blends of microalgae biodiesel and petro-diesel (B2, B5, B10 and B20 were prepared on a volume basis and their physico–chemical characteristics have been also studied. The obtained results showed that; with the increase of biodiesel concentration in the blends; the viscosity, density, total acid number, initial boiling point, calorific value, flash point, cetane number and diesel index increase. While the pour point, cloud point, carbon residue and sulfur, ash and water contents decrease. The observed properties of the blends were within the recommended petro-diesel standard specifications and they are in favor of better engine performance.

  7. Value added by Spirulina platensis in two different diets on growth performance, gut microbiota, and meat quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    Mohamed S. Yusuf


    Full Text Available Aim: The growth promoting effect of the blue-green filamentous alga Spirulina platensis (SP was observed on meat type Japanese quail with antibiotic growth promoter alternative and immune enhancing power. Materials and Methods: This study was conducted on 180 Japanese quail chicks for 4 weeks to find out the effect of diet type (vegetarian protein diet [VPD] and fish meal protein diet [FMPD]- Spirulina dose interaction (1 or 2 g/kg diet on growth perfor-mance, gut microbiota, and sensory meat quality of growing Japanese quails (1-5 weeks old. Results: Data revealed improvement (p<0.05 of weight gain, feed conversion ratio and European efficiency index due to 1, 2 g (SP/kg VPD, and 2 g (SP/kg FMPD, respectively. There was a significant decrease of ileum mean pH value by 1 g (SP/kg VPD. Concerning gut microbiota, there was a trend toward an increase in Lactobacilli count in both 1; 2 g (SP/kg VPD and 2 g (SP/kg FMPD. It was concluded that 1 or 2 g (SP/kg vegetarian diet may enhance parameters of performance without obvious effect on both meat quality and gut microbiota. Moreover, 1 and/or 2 g (SP may not be invited to share fish meal based diet for growing Japanese quails. Conclusion: Using of SP will support the profitable production of Japanese quails fed vegetable protein diet.

  8. Total bakteri asam laktat dan Coliform pada ileum dan sekum ayam broiler yang diberi Spirulina platensis dengan lama pemberian berbeda

    Directory of Open Access Journals (Sweden)

    Muhammad Irfan Sulfani


    Full Text Available This research was conducted to determine the amount of lactic acid bacteria and coliform inside the caecum and ileum of broilers. 240 days old chicks broiler (DOC with 42.015 ± 0.219 g average body weight were used in this research as an experimental objects. The chicks broiler were treated with 0.04% antibiotics and 1% Spirulina plantensis as a prebiotic under different interval ingestion. This experiment was constructed under completely random design (CRD with 4 treatments and 5 repetition. The treatment that was applied were T0 (Poultry feed + 0.04% Zinc bacitracin, T1 (Poultry feed + 1% throughout 7 days, T2 (Poultry feed + 1% throughout 21 days, and T4 (Poultry feed + 1% throughout 35 days. The parameter measurements conducted in the 32nd day with random sampling from each experiments. Total amount of lactic acid and coliform from each samples were observed and the variance was with 5% accuration. The result showed the total amout of Coliform in ileum was significantly different (P<0.05 in the other hand the total amount of Coliform and acid bacteria in caecum were not influenced (P<0.05. It can be inferred that the Spirulina platensis treatment for 3 weeks reduced the total amount of bacteria inside caecum and ileum.

  9. In vitro and in vivo preliminary results on Spirulina platensis for ...

    African Journals Online (AJOL)



    May 1, 2013 ... platensis for treatment of impetigo: Topical cream application .... 7.5 g; liquid paraffin 3.75 ml; and aqueous phase: deionized water,. 35 ml; sodium ..... macroalgae from Gran Canaria (Canary Islands, Spain). Int. Microbiol.

  10. Separation, identification and quantification of carotenoids and chlorophylls in dietary supplements containing Chlorella vulgaris and Spirulina platensis using High Performance Thin Layer Chromatography. (United States)

    Hynstova, Veronika; Sterbova, Dagmar; Klejdus, Borivoj; Hedbavny, Josef; Huska, Dalibor; Adam, Vojtech


    In this study, 14 commercial products (dietary supplements) containing alga Chlorella vulgaris and cyanobacteria Spirulina platensis, originated from China and Japan, were analysed. UV-vis spectrophotometric method was applied for rapid determination of chlorophylls, carotenoids and pheophytins; as degradation products of chlorophylls. High Performance Thin-Layer Chromatography (HPTLC) was used for effective separation of these compounds, and also Atomic Absorption Spectrometry for determination of heavy metals as indicator of environmental pollution. Based on the results obtained from UV-vis spectrophotometric determination of photosynthetic pigments (chlorophylls and carotenoids), it was confirmed that Chlorella vulgaris contains more of all these pigments compared to the cyanobacteria Spirulina platensis. The fastest mobility compound identified in Chlorella vulgaris and Spirulina platensis using HPTLC method was β-carotene. Spectral analysis and standard calibration curve method were used for identification and quantification of separated substances on Thin-Layer Chromatographic plate. Quantification of copper (Cu 2+ , at 324.7 nm) and zinc (Zn 2+ , at 213.9nm) was performed using Flame Atomic Absorption Spectrometry with air-acetylene flame atomization. Quantification of cadmium (Cd 2+ , at 228.8 nm), nickel (Ni 2+ , at 232.0nm) and lead (Pb 2+ , at 283.3nm) by Electrothermal Graphite Furnace Atomic Absorption Spectrometry; and quantification of mercury (Hg 2+ , at 254nm) by Cold Vapour Atomic Absorption Spectrometry. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Development of cassava cake enriched with its own bran and Spirulina platensis - doi: 10.4025/actascitechnol.v34i4.10687

    Directory of Open Access Journals (Sweden)

    Meire Franci Polonio Navacchi


    Full Text Available The cassava cake was developed enriching it with a biomass of Spirulina platensis and a type of bran made out of its own starch. This biomass, a part from being rich in protein, also contains vitamins, essential fatty acids and minerals. Around Umuarama, in the State of Paraná, there is an agricultural/industrial complex annually producing and processing tons of cassava. Baked goods can be elaborated based in cassava as a way to expand the use of this raw material and to produce food free of gluten to celiac people. In this complex a solid byproduct is generated, which is rich in starch and fibres, and because of its low commercial value it is used for animal feed or discarded. The bran was dehydrated and analysed microbiologically as well as physically and chemically so as to be used in applied research. Developed energetic food based on cassava lacks protein, but this can be supplied by adding the biomass of Spirulina platensis. Different formulations of this cassava cake were developed varying the concentration of Spirulina platensis and cassava bran. The formulation that presented the best features received chocolate before being submitted to sensory tests by children in the public education system. The results show an excellent acceptance which made viable the development of this product because of aspects like nutrition, technology and sensorial.

  12. Culture Conditions stimulating high γ-Linolenic Acid accumulation by Spirulina platensis Condições de cultura simulando o levado acúmulo de ácido γ-linolênico por Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Srinivasa Reddy Ronda


    Full Text Available Gamma-linolenic acid (GLA production by Spirulina platensis under different stress-inducing conditions was studied. Submerged culture studies showed that low temperature (25ºC, strong light intensity (6 klux and primrose oil supplement (0.8%w/v induced 13.2 mg/g, 14.6 mg/g and 13.5 mg linolenic acid per gram dry cell weight respectively. A careful observation of fatty acid profile of the cyanobacteria shows that, oleic acid and linoleic acid, in experiments with varying growth temperature and oil supplements respectively, helped in accumulating excess γ-linolenic acid. In addition, cultures grown at increasing light regimes maintained the γ-linolenic acid to the total fatty acid ratio(GLA/TFA constant, despite any change in γ-linolenic acid content of the cyanobacteria.Estudou-se a produção de ácido γ-linolênico por Spirulina platensis em diferentes condições de estresse. Culturas submersas indicaram que temperatura baixa (25ºC, forte intensidade de luz (6 klux e suplementação com óleo de prímula (0,8% p/v induziram a produção de ácido linolênico de 13,2 mg/g, 14,6 mg/g e 13,5 mg/g peso seco, respectivamente. Uma observação cuidadosa do perfil de ácidos graxos da cianobacteria indica que os ácidos oléico e linoléico, em experimentos com diferentes temperaturas de crescimento e suplementos de óleo, auxiliaram no acúmulo de excesso de ácido γ-linolênico. Além disso, as culturas obtidas em intensidades crescentes de luz mantiveram a relação ácido γ-linolênico/ácidos graxos totais constante, independentemente de qualquer mudança no conteúdo de ácido γ-linolênico da cianobactéria.

  13. Spirulina platensis Extract Supplementation Attenuates Diabetic Complication in Gamma Irradiated Rats

    International Nuclear Information System (INIS)

    Ibrahim, R.M.; Sherif, N.H


    Diabetes mellitus, a metabolic disorder, is becoming a major health problem. Although there are a number of drugs available on the market, long time use may cause a number of side effects. Spirulina is a microscopic and filamentous cyanobacterium that contains essential amino acids, essential fatty acids, vitamins, minerals and anti-oxidative components. The objective of this study was to analyze the possible hypo glycemic and hypolipidaemic effects of Spirulina intake against streptozotocin and/or radiation induced diabetes in male albino rats. In the experiment, a total of 60 rats were used and the rats were divided into six groups of ten rats each: group I, normal untreated rats (control) ; group II, animals of this group received only Spirulina (15 mg/kg) for 30 consecutive days; group III, animals were injected intraperitoneally with a freshly prepared solution of streptozotocin(STZ) (45 mg/kg i.p.) in 0.1 M citrate buffer, ph 4.5 for 30 consecutive days ; group IV, as group II then given Spirulina for 30 days , group V, same as group III then exposed to 6 Gy gamma radiation as a single dose shot ; and group VI, Spirulina + diabetic irradiated group, rats were given orally Spirulina (15 mg/kg) then injected in - traperitoneally with (STZ) followed by irradiation at a dose level of 6 Gy as a single dose shot. The results revealed that animal treated with STZ or/and exposed to gamma radiation showed an increase in fasting blood sugar (FBS), glycosylated haemoglobin (HbA1c), total cholesterol (TC), triglyceride (Tg), low density lipoprotein (LDL), plasma insulin and C- peptide in compared to control. Also, a marked increase in the liver tissue of thiobarbituric acid reactive substance (TBARS) and a decrease in glutathione (GSH) and catalase (CAT) was observed. Oral pretreatment of rats with aqueous extract of Spirulina (SPE) counteracted STZ or/and radiation induced lipid peroxidation and encouraging hypoglycemic and hypolipidaemic properties of the treated

  14. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis) Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay


    Eduardo Sommella; Giulio Maria Conte; Emanuela Salviati; Giacomo Pepe; Alessia Bertamino; Carmine Ostacolo; Francesca Sansone; Francesco Del Prete; Rita Patrizia Aquino; Pietro Campiglia


    Arthrospira platensis, better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS) and Ultra High-Performance Liquid Chromatography (UHPLC) for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary sup...

  15. Pressurized liquid extracts from Spirulina platensis microalga. Determination of their antioxidant activity and preliminary analysis by micellar electrokinetic chromatography. (United States)

    Herrero, Miguel; Ibáñez, Elena; Cifuentes, Alejandro; Señoráns, Javier


    In this work, different extracts from the microalga Spirulina platensis are obtained using pressurized liquid extraction (PLE) and four different solvents (hexane, light petroleum, ethanol and water). Different extraction temperatures (115 and 170 degrees C) were tested using extraction times ranging from 9 to 15 min. The antioxidant activity of the different extracts is determined by means of an in vitro assay using a free radical method. Moreover, a new and fast method is developed using micellar electrokinetic chromatography with diode array detection (MEKC-DAD) to provide a preliminary analysis on the composition of the extracts. This combined application (i.e., in vitro assays plus MEKC-DAD) allowed the fast characterization of the extracts based on their antioxidant activity and the UV-vis spectra of the different compounds found in the extracts. To our knowledge, this work shows for the first time the great possibilities of the combined use of PLE-in vitro assay-MEKC-DAD to investigate natural sources of antioxidants.

  16. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis. (United States)

    Yang, Fang; Wong, Ka-Hing; Yang, Yufeng; Li, Xiaoling; Jiang, Jie; Zheng, Wenjie; Wu, Hualian; Chen, Tianfeng


    Tellurium-containing phycocyanin (Te-PC) and allophycocyanin (Te-APC), two organic tellurium (Te) species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 μg g(-1) protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropane)dihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress.

  17. In vitro antioxidant and antiproliferative activities of selenium-containing phycocyanin from selenium-enriched Spirulina platensis. (United States)

    Chen, Tianfeng; Wong, Yum-Shing


    Both selenium and phycocyanin have been reported to show potent cancer chemopreventive activities. In this study, we investigated the in vitro antioxidant and antiproliferative activities of selenium-containing phycocyanin (Se-PC) purified from selenium-enriched Spirulina platensis. The antioxidant activity of Se-PC was evaluated by using four different free radical scavenging assays, namely, the 2,2'-azinobis-3-ethylbenzothiazolin-6-sulfonic acid (ABTS) assay, 1,1-diphenyl-2-picryhydrazyl (DPPH) assay, superoxide anion scavenging assay, and erythrocyte hemolysis assay. The results indicated that Se-PC exhibited stronger antioxidant activity than phycocyanin by scavenging ABTS, DPPH, superoxide anion, and 2,2'-azobis-(2-amidinopropane)dihydrochloride free radicals. Se-PC also showed dose-dependent protective effects on erythrocytes against H 2O 2-induced oxidative DNA damage as evaluated by the Comet assay. Moreover, Se-PC was identified as a potent antiproliferative agent against human melanoma A375 cells and human breast adenocarcinoma MCF-7 cells. Induction of apoptosis in both A375 and MCF-7 cells by Se-PC was evidenced by accumulation of sub-G1 cell populations, DNA fragmentation, and nuclear condensation. Further investigation on intracellular mechanisms indicated that depletion of mitochondrial membrane potential (DeltaPsi m) was involved in Se-PC-induced cell apoptosis. Our findings suggest that Se-PC is a promising organic Se species with potential applications in cancer chemoprevention.

  18. Higher adsorption capacity of Spirulina platensis alga for Cr(VI) ions removal: parameter optimisation, equilibrium, kinetic and thermodynamic predictions. (United States)

    Gunasundari, Elumalai; Senthil Kumar, Ponnusamy


    This study discusses about the biosorption of Cr(VI) ion from aqueous solution using ultrasonic assisted Spirulina platensis (UASP). The prepared UASP biosorbent was characterised by Fourier transform infrared spectroscopy, X-ray diffraction, Brunauer-Emmet-Teller, scanning electron spectroscopy and energy dispersive X-ray and thermogravimetric analyses. The optimum condition for the maximum removal of Cr(VI) ions for an initial concentration of 50 mg/l by UASP was measured as: adsorbent dose of 1 g/l, pH of 3.0, contact time of 30 min and temperature of 303 K. Adsorption isotherm, kinetics and thermodynamic parameters were calculated. Freundlich model provided the best results for the removal of Cr(VI) ions by UASP. The adsorption kinetics of Cr(VI) ions onto UASP showed that the pseudo-first-order model was well in line with the experimental data. In the thermodynamic study, the parameters like Gibb's free energy, enthalpy and entropy changes were evaluated. This result explains that the adsorption of Cr(VI) ions onto the UASP was exothermic and spontaneous in nature. Desorption of the biosorbent was done using different desorbing agents in which NaOH gave the best result. The prepared material showed higher affinity for the removal of Cr(VI) ions and this may be an alternative material to the existing commercial adsorbents.

  19. Selection and protein sds-page identification of a new high-producing polysaccharide strain of Spirulina platensis

    International Nuclear Information System (INIS)

    Wang Zhiping; Liu Yanhui


    The relationship between anti-radiation capacity and polysaccharide contents of ten Spirulina platensis strains were studied. The results showed that the correlation coefficient between 60 Co γ-ray half-lethal dose (LD 50 ) and polysaccharide contents of the 10 strains was 0.9873. After the single cells or spheroplasts of Sp-08 were treated by 0.6%EMS and 2.4 kGy 60 Co γ-ray irradiation, four morphological mutant named Sp-08A, Sp-08B, Sp-08C and Sp-08D, which could endure about 7.0 kGy γ-ray irradiation, were obtained. The polysaccharide contents of Sp-08A, Sp-08B, Sp-08C and Sp-08D, were 32.8%, 17.3%, 3.4% and 42.3% higher than that of their parent Sp-08, respectively. The results of protein SDS-PAGE analysis showed that the heredity of Sp-08A, Sp-08C and Sp-08D were mutated. Therefore, Sp-08A was a perfect high-producing polysaccharide strain with excellent characteristics of morphology and growth. Now, Sp-08A is applied in mass cultivation and industrialization. (authors)

  20. Application of Spirulina platensis for prevention of white spot syndrome virus in post larvae and juvenile black tiger shrimp (Penaeus monodon

    Directory of Open Access Journals (Sweden)

    Hemtanon, P.


    Full Text Available In this study, the extract of Spirulina platensis were examined in vitro to inhibit white spot syndrome virus (WSSV and application of dry S. platensis in diet for prevention of white spot syndrome (WSS in post larvae and juvenile black tiger shrimp (Penaeus monodon. The results showed that the lowest concentration of the extract for inhibiting WSSV was 0.01 mg/ml, while the optimum concentration was found to be 0.1 mg/ ml in which the mortality rate of the shrimp was 4 percents and infection was not detected from survivalshrimp by the immunohistochemistry method.Furthermore, The results showed that the survival rate of the post larvae fed on steamed egg containing dry S. platensis 5 g/kg of diet was higher than that of the control (p<0.05 when challenged with WSSV and no WSSV infected shrimp examine by polymerase chain reaction (PCR assay. In the case of juvenile shrimp, the survival rate of shrimp fed pellets containing dry S. platensis 10 g/kg of diet was higher than that of the control group (p<0.05 after challenging with WSSV. Moreover percent of WSSV infection in the survival shrimp using the immunohistochemistry method was lower than that of the control group.

  1. Equilibrium, thermodynamic and kinetic studies for the biosorption of aqueous lead(II), cadmium(II) and nickel(II) ions on Spirulina platensis

    Energy Technology Data Exchange (ETDEWEB)

    Seker, Ayseguel [Department of Chemistry, Izmir Institute of Technology, Urla 35430, Izmir (Turkey)], E-mail:; Shahwan, Talal [Department of Chemistry, Izmir Institute of Technology, Urla 35430, Izmir (Turkey)], E-mail:; Eroglu, Ahmet E. [Department of Chemistry, Izmir Institute of Technology, Urla 35430, Izmir (Turkey)], E-mail:; Yilmaz, Sinan [Department of Chemistry, Izmir Institute of Technology, Urla 35430, Izmir (Turkey)], E-mail:; Demirel, Zeliha [Department of Biology, Ege University, Bornova 35100, Izmir (Turkey)], E-mail:; Dalay, Meltem Conk [Department of Bioengineering, Ege University, Bornova 35100, Izmir (Turkey)], E-mail:


    The biosorption of lead(II), cadmium(II) and nickel(II) ions from aqueous solution by Spirulina platensis was studied as a function of time, concentration, temperature, repetitive reactivity, and ionic competition. The kinetic results obeyed well the pseudo second-order model. Freundlich, Dubinin Radushkevich and Temkin isotherm models were applied in describing the equilibrium partition of the ions. Freundlich isotherm was applied to describe the design of a single-stage batch sorption system. According to the thermodynamic parameters such as {delta}G{sup o}, {delta}H{sup o}and {delta}S{sup o} calculated, the sorption process was endothermic and largely driven towards the products. Sorption activities in a three metal ion system were studied which indicated that there is a relative selectivity of the biosorbent towards Pb{sup 2+} ions. The measurements of the repetitive reusability of S. platensis indicated a large capacity towards the three metal ions.

  2. Influence of Extractive Solvents on Lipid and Fatty Acids Content of Edible Freshwater Algal and Seaweed Products, the Green Microalga Chlorella kessleri and the Cyanobacterium Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Jarmila Vavra Ambrozova


    Full Text Available Total lipid contents of green (Chlorella pyrenoidosa, C, red (Porphyra tenera, N; Palmaria palmata, D, and brown (Laminaria japonica, K; Eisenia bicyclis, A; Undaria pinnatifida, W, WI; Hizikia fusiformis, H commercial edible algal and cyanobacterial (Spirulina platensis, S products, and autotrophically cultivated samples of the green microalga Chlorella kessleri (CK and the cyanobacterium Spirulina platensis (SP were determined using a solvent mixture of methanol/chloroform/water (1:2:1, v/v/v, solvent I and n-hexane (solvent II. Total lipid contents ranged from 0.64% (II to 18.02% (I by dry weight and the highest total lipid content was observed in the autotrophically cultivated cyanobacterium Spirulina platensis. Solvent mixture I was found to be more effective than solvent II. Fatty acids were determined by gas chromatography of their methyl esters (% of total FAMEs. Generally, the predominant fatty acids (all results for extractions with solvent mixture I were saturated palmitic acid (C16:0; 24.64%–65.49%, monounsaturated oleic acid (C18:1(n-9; 2.79%–26.45%, polyunsaturated linoleic acid (C18:2(n-6; 0.71%–36.38%, α-linolenic acid (C18:3(n-3; 0.00%–21.29%, γ-linolenic acid (C18:3(n-6; 1.94%–17.36%, and arachidonic acid (C20:4(n-6; 0.00%–15.37%. The highest content of ω-3 fatty acids (21.29% was determined in Chlorella pyrenoidosa using solvent I, while conversely, the highest content of ω-6 fatty acids (41.42% was observed in Chlorella kessleri using the same solvent.

  3. Aplicación de estrategias nutricionales y su efecto en el crecimiento en el cultivo continuo de Spirulina (Arthrospira platensis)


    Rojas,Elizabet; Ávila,Marcela; Parada,Gustavo


    Se realizó un cultivo continuo de Spirulina (Arthrospira platensis) durante 78 días en un fotobiorreactor tubular de 300 L de volumen. Durante este periodo se registró el crecimiento en biomasa y la respuesta del cultivo a la estrategia de adición del medio nutritivo. Utilizando como base el medio Zarrouk modificado, se elaboraron tres medios: medio inicial (MI), medio crecimiento (SA1+SA2) y medio mantenimiento (SB1+SB2) para las distintas etapas del cultivo. La entrega de los medios se efec...

  4. Spirulina platensis Improves Mitochondrial Function Impaired by Elevated Oxidative Stress in Adipose-Derived Mesenchymal Stromal Cells (ASCs) and Intestinal Epithelial Cells (IECs), and Enhances Insulin Sensitivity in Equine Metabolic Syndrome (EMS) Horses. (United States)

    Nawrocka, Daria; Kornicka, Katarzyna; Śmieszek, Agnieszka; Marycz, Krzysztof


    Equine Metabolic Syndrome (EMS) is a steadily growing life-threatening endocrine disorder linked to insulin resistance, oxidative stress, and systemic inflammation. Inflammatory microenvironment of adipose tissue constitutes the direct tissue milieu for various cell populations, including adipose-derived mesenchymal stromal cells (ASCs), widely considered as a potential therapeutic cell source in the course of the treatment of metabolic disorders. Moreover, elevated oxidative stress induces inflammation in intestinal epithelial cells (IECs)-the first-line cells exposed to dietary compounds. In the conducted research, we showed that in vitro application of Spirulina platensis contributes to the restoration of ASCs' and IECs' morphology and function through the reduction of cellular oxidative stress and inflammation. Enhanced viability, suppressed senescence, and improved proliferation of ASCs and IECs isolated from metabolic syndrome-affected individuals were evident following exposition to Spirulina. A protective effect of the investigated extract against mitochondrial dysfunction and degeneration was also observed. Moreover, our data demonstrate that Spirulina extract effectively suppressed LPS-induced inflammatory responses in macrophages. In vivo studies showed that horses fed with a diet based on Spirulina platensis supplementation lost weight and their insulin sensitivity improved. Thus, our results indicate the engagement of Spirulina platensis nourishing as an interesting alternative approach for supporting the conventional treatment of equine metabolic syndrome.

  5. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Yang F


    Full Text Available Fang Yang,1 Ka-Hing Wong,2 Yufeng Yang,3 Xiaoling Li,1 Jie Jiang,1 Wenjie Zheng,1 Hualian Wu,1 Tianfeng Chen1 1Department of Chemistry, Jinan University, Guangzhou, People’s Republic of China; 2Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong, People’s Republic of China; 3Institute of Hydrobiology, College of Life Science and Technology, Jinan University, Guangzhou, People’s Republic of China Abstract: Tellurium-containing phycocyanin (Te-PC and allophycocyanin (Te-APC, two organic tellurium (Te species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 µg g-1 protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropanedihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress. Keywords: tellurium, phycocyanin, allophycocyanin, purification, antioxidant activity

  6. Improvement of lipid yield from microalgae Spirulina platensis using ultrasound assisted osmotic shock extraction method (United States)

    Adetya, NP; Hadiyanto, H.


    Microalgae Spirulina sp. has been identified as potential source of natural food supplement and food colorant. The high water content of microalgae (70-90%) causes an obstacle in biomass dehydration which requires large amounts of energy, eventually damaging the lipid in the microalgae. Therefore, the lipid must be extracted by using a suitable method which complies to wet biomass conditions. One of the methods is applying osmotic shock. This study was aimed to investigate the influence of osmotic agent (NaCl) concentration (10-30%) and extraction time (20-50 min) on yield of lipid and also to determine the optimal conditions in the extraction process through response surface methodology. The extraction was conducted at a temperature of 40°C under ultrasound frequency of 40 kHz. The result showed that the optimum yield lipid obtained was 6.39% in 16.98% NaCl concentration for 36 minutes 10 seconds.

  7. Effect of dietary supplementation of spirulina (Arthrospira platensis and thyme (Thymus vulgaris on carcass composition, meat physical traits, and vitamin B12 content on growing rabbits

    Directory of Open Access Journals (Sweden)

    Antonella Dalle Zotte


    Full Text Available The aim of this study was to compare the effect and duration of dietary inclusion of 5% spirulina (Arthrospira platensis and/or 3% thyme (Thymus vulgaris on growing rabbit carcass composition, meat and bone rheological traits, and the vitamin B12 content of Longissimus dorsi (LD meat. The study involved 294 maternal line growing rabbits from the Pannon breeding programme. At weaning (5 wk, animals were randomly divided by dietary treatment into 7 groups of 42 rabbits each. A control group (C-C received a pellet with no supplementation throughout the trial (5-11 wk of age, whereas the other groups were fed diets supplemented with 5% spirulina (S, 3% thyme (T or with both ingredients (ST for either the entire growing period (5-11 wk of age; groups: S-S, T-T, ST-ST, respectively, or its final part only (8-11 wk of age; groups: C-S, C-T, C-ST, respectively. Results showed that regardless of the duration of supplementation, spirulina and thyme provided no effect on the traits examined, except for scapular fat content, whose value was higher in the S-S group than in the C-T group (P<0.05. Spirulina was confirmed as a rich source of vitamin B12 that was successfully transferred into LD meat, thus demonstrating its value as an effective natural supplement in producing food fortified with this vital element. Further studies are necessary to clarify the effect of spirulina on carcass fat deposition, bone development, and mineralisation.

  8. Protective effect of aqueous extract from Spirulina platensis against cell death induced by free radicals


    Radhakrishnan Ammu; Lim Yen-Wei; Chu Wan-Loy; Lim Phaik-Eem


    Abstract Background Spirulina is a commercial alga well known to contain various antioxidants, especially phycocyanin. Apart from being sold as a nutraceutical, Spirulina is incorporated as a functional ingredient in food products and beverages. Most of the previous reports on antioxidant activity of Spirulina were based on chemical rather than cell-based assays. The primary objective of this study was to assess the antioxidant activity of aqueous extract from Spirulina based on its protectiv...

  9. Rapid mutation of Spirulina platensis by a new mutagenesis system of atmospheric and room temperature plasmas (ARTP and generation of a mutant library with diverse phenotypes.

    Directory of Open Access Journals (Sweden)

    Mingyue Fang

    Full Text Available In this paper, we aimed to improve the carbohydrate productivity of Spirulina platensis by generating mutants with increased carbohydrate content and growth rate. ARTP was used as a new mutagenesis tool to generate a mutant library of S. platensis with diverse phenotypes. Protocol for rapid mutation of S. platensis by 60 s treatment with helium driven ARTP and high throughput screening method of the mutants using the 96-well microplate and microplate reader was established. A mutant library of 62 mutants was then constructed and ideal mutants were selected out. The characteristics of the mutants after the mutagenesis inclined to be stable after around 9(th subculture, where the total mutation frequency and positive mutation frequency in terms of specific growth rate reached 45% and 25%, respectively. The mutants in mutant library showed diverse phenotypes in terms of cell growth rate, carbohydrate content and flocculation intensity. The positive mutation frequency in terms of cellular carbohydrate content with the increase by more than 20% percent than the wild strain was 32.3%. Compared with the wild strain, the representative mutants 3-A10 and 3-B2 showed 40.3% and 78.0% increase in carbohydrate content, respectively, while the mutant 4-B3 showed 10.5% increase in specific growth rate. The carbohydrate contents of the representative mutants were stable during different subcultures, indicating high genetic stability. ARTP was demonstrated to be an effective and non-GMO mutagenesis tool to generate the mutant library for multicellular microalgae.

  10. Protein production by Arthrospira (Spirulina platensis in solid state cultivation using sugarcane bagasse as support

    Directory of Open Access Journals (Sweden)

    Lúcia Helena Pelizer


    Full Text Available The genus Arthrospira comprises a group of filamentous multicellular cyanobacteria and can be used for animal feed and human food. Solid state fermentation or cultivation (SSF involves the use of a culture medium composed of solid material with given moisture content. No studies have been published about the cultivation of microalgae or cyanobacteria on solid medium. Furthermore, although sugar-cane bagasse is used as source of energy in alcohol distilleries in Brazil, the excess could be a support to photosynthetic microorganism growth. The experimental design methodology was used to evaluate the protein production by Arthrospira platensis under SSF using sugarcane bagasse as support, taking into account the moisture content of the medium, light intensity and inoculum concentration. Moisture was found to have a strong influence on the performance of the process. The best conditions were: moisture of 98.8%; inoculum concentration of 0.15 g biomass·kg wet culture medium−1 and light intensity of 6.0 klx.

  11. The effects of pH in profile of lipid and ester accumulation of arthrospira platensis (spirulina) as a potential source of biodiesel

    International Nuclear Information System (INIS)

    Reyes, Patrick A.; Ybañez, Manolito G. Jr.; Avilla, Ruel A.


    This study aimed to produce biodiesel (ester-based fuel) using the extracts of microalgae Arthrospira platensis (Spirulina). Specifically, the research focused in determining effect of pH in culturing the Spirulina and its lipid accumulation; determining the constituents present in the lipid extracts; and determining the methyl esters in the transesterified lipids. The best pH condition in culturing the algal sample was found to be at pH 10 to 11. Analysis of the extracted lipid samples revealed that pH condition in culturing medium has a significant effect on the lipid accumulation in Spirulina. Perkin Elmer Claurus 500 GC-MS system elucidated that the constituents present in the experimental samples were esterified lipids. The esters were derived from butanoic, hexadeanoic and octadecanoic acid. About 19 free fatty acids out of 23 determined compounds present were from the controlled sample which suggests that these were main precursors of the esters found in the sample were butyl, allyl nonyl, propyl tetradecyl, methylpropyl, allyl dodecyl, hexyl pentadecyl, dodecyl propyl, heptyl esters with the parent chain of fatty acids enumerated above. These showed that pH manipulations could be used as a direct transesterification of fatty acids in producing biodiesels. (author)

  12. The Effect of Temperature on Protein and Amino Acid Composition of Spirulina platensis.

    Directory of Open Access Journals (Sweden)

    Leyla Hızarcı Uslu


    Full Text Available Sıcaklığın Spirulina platensis’in protein ve amino asit kompozisyonu üzerine etkisi. Bu çalışma, mevsime bağlı iklim değişikliğinin yaz ve kış mevsimlerinde kültüre alınan Spirulina platensis’in protein içeriği ve amino asit kompozisyonuna etkilerini incelemek amacıyla yürütülmüştür. Çalışma boyunca ışık yoğunluğu, pH ve tuzluluk günlük olarak ölçülmüş, sıcaklık ve çözünmüş oksijen gün boyunca ve gece ölçülmüştür. Yaz ve kış mevsiminde ortalama gündüz sıcaklığı sırasıyla 33,9±0,4 ºC ve 18,6±0,5 ºC olarak belirlenirken, gece sıcaklığı 29,9±0,2 °C ve 14.4±0.2°C olarak belirlenmiştir. Ortalama ışık yoğunluğu yaz mevsiminde 848,3 µmol m-2s-1 iken kışın 506,26±48 µmol m-2s-1 olmuştur. Yaz büyüme döneminde protein miktarı (72,9±03 % ve amino asit konsantrasyonu kış dönemine göre daha yüksek bulunmuştur. Amino asitlerden Prolin, Sistin ve Arjinin sadece kış mevsiminde gözlenmiştir

  13. Produção, aspectos nutricionais e fisiológicos de alface sob adubação foliar com Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Débora Samara Oliveira e Silva


    Full Text Available Objetivou-se avaliar a influência de concentrações do fertilizante orgânico a base de Spirulina platensis sobre a produção, crescimento, teores de N, P, K e sódio e sobre as trocas gasosas de alface cv. Elba em condições de campo. Utilizou-se o delineamento de blocos ao acaso, com seis tratamentos, constituídos das concentrações do fertilizante (0; 1,5; 3,0; 4,5; 6,0 e 7,5% com seis repetições. No ponto de colheita da cultura foram avaliadas variáveis de produção e crescimento, os teores de nitrogênio, fósforo, potássio e sódio, bem como, as trocas gasosas das plantas com o medidor de gás infravermelho (IRGA. Os resultados obtidos mostraram que as concentrações do fertilizante, não afetaram a produção, o crescimento, os teores de nutrientes avaliados, assim como não influenciaram as trocas gasosas das plantas.Production, mineral nutrition and physiological aspects of lettuce under foliar fertilization with Spirulina platensis Abstract: The objective of this study was to evaluate the influence of concentrations of organic fertilizer based on Spirulina platensis on yield, growth, in N, P, K and sodium contents and on gaseous changes of lettuce cv. Elba in field conditions. Use the design of randomized blocks, with six treatments consisting of different concentrations of fertilizer (0; 1.5; 3.0; 4.5; 6.0 and 7.5% with six replications. At the harvest point were evaluated the growth and production, nitrogen, phosphorus, potassium and sodium, as well as gas exchange plant with infrared gas meter (IRGA. The results showed that the fertilizer concentrations did not affect production, growth, levels of nutrients evaluated, and did not influence the gas exchange of plants.

  14. Study of polyethyleneimine- and amidoxime-functionalized hybrid biomass of Spirulina (Arthrospira) platensis for adsorption of uranium (VI) ion. (United States)

    Bayramoglu, Gulay; Akbulut, Aydin; Arica, M Yakup


    This study investigates the potential application of the polyethyleneimine- (PEI) and amidoxime-modified Spirulina (Arthrospira) platensis biomasses for the removal of uranium ion in batch mode using the native biomass as a control system. The uranium ion adsorption was also characterized by attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectra, zeta potential analysis, and surface area measurement studies. The effects of pH, biomass amount, contact time, initial uranium ion concentration, and ionic strength were evaluated by using native and modified algal biomass preparations. The uranium ion removal was rapid, with more than 70% of total adsorption taking place in 40 min, and equilibrium was established within 60 min. From the experimental data, it was found that the amount of adsorption uranium ion on the algal preparations decreased in the following series: amidoxime-modified algal biomass > PEI-modified algal biomass > native algal biomass. Maximum adsorption capacities of amidoxime- and PEI-modified, and native algal biomasses were found to be 366.8, 279.5, and 194.6 mg/g, respectively, in batchwise studies. The adsorption rate of U(VI) ion by amidoxime-modified algal biomass was higher than those of the native and PEI-modified counterparts. The adsorption processes on all the algal biomass preparations followed by the Dubinin-Radushkevitch (D-R) and Temkin isotherms and pseudo-second-order kinetic models. The thermodynamic parameters were determined at four different temperatures (i.e., 15, 25, 35, and 45 °C) using the thermodynamics constant of the Temkin isotherm model. The ΔH° and ΔG° values of U(VI) ion adsorption on algal preparations show endothermic heat of adsorption; higher temperatures favor the process. The native and modified algal biomass preparations were regenerated using 10 mM HNO3. These results show that amidoxime-modified algal biomass can be a potential candidate for effective removal of U(VI) ion from

  15. Comparison of Spirulina platensis microalgae and commercial activated carbon as adsorbents for the removal of Reactive Red 120 dye from aqueous effluents

    International Nuclear Information System (INIS)

    Cardoso, Natali F.; Lima, Eder C.; Royer, Betina; Bach, Marta V.; Dotto, Guilherme L.; Pinto, Luiz A.A.; Calvete, Tatiana


    Highlights: ► Spirulina platensis (SP) and activated carbon (AC) were used to remove RR-120 dye. ► The maximum adsorption capacities were found at pH 2 and 298 K. ► The values were 482.2 and 267.2 mg g −1 for SP and AC, respectively. ► Adsorption was exothermic, spontaneous and favorable. ► SP and AC were effective to treat a simulated dye-house effluent. - Abstract: Spirulina platensis microalgae (SP) and commercial activated carbon (AC) were compared as adsorbents to remove Reactive Red 120 (RR-120) textile dye from aqueous effluents. The batch adsorption system was evaluated in relation to the initial pH, contact time, initial dye concentration and temperature. An alternative kinetic model (general order kinetic model) was compared with the traditional pseudo-first order and pseudo-second order kinetic models. The equilibrium data were fitted to the Langmuir, Freundlich and Liu isotherm models, and the thermodynamic parameters were also estimated. Finally, the adsorbents were employed to treat a simulated dye-house effluent. The general order kinetic model was more appropriate to explain RR-120 adsorption by SP and AC. The equilibrium data were best fitted to the Liu isotherm model. The maximum adsorption capacities of RR-120 dye were found at pH 2 and 298 K, and the values were 482.2 and 267.2 mg g −1 for the SP and AC adsorbents, respectively. The thermodynamic study showed that the adsorption was exothermic, spontaneous and favourable. The SP and AC adsorbents presented good performance for the treatment of simulated industrial textile effluents, removing 94.4–99.0% and 93.6–97.7%, respectively, of the dye mixtures containing high saline concentrations.

  16. Comparison of Spirulina platensis microalgae and commercial activated carbon as adsorbents for the removal of Reactive Red 120 dye from aqueous effluents

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Natali F. [Institute of Chemistry, Federal University of Rio Grande do Sul, UFRGS, AV. Bento Goncalves 9500, 91501-970, Porto Alegre, RS (Brazil); Lima, Eder C., E-mail: [Institute of Chemistry, Federal University of Rio Grande do Sul, UFRGS, AV. Bento Goncalves 9500, 91501-970, Porto Alegre, RS (Brazil); Royer, Betina; Bach, Marta V. [Institute of Chemistry, Federal University of Rio Grande do Sul, UFRGS, AV. Bento Goncalves 9500, 91501-970, Porto Alegre, RS (Brazil); Dotto, Guilherme L.; Pinto, Luiz A.A. [Unit Operation Laboratory, School of Chemistry and Food, Federal University of Rio Grande, FURG, R. Engenheiro Alfredo Huch 475, 96201-900, Rio Grande, RS (Brazil); Calvete, Tatiana [Universitary Center La Salle (UNILASALLE), Av. Victor Barreto 2288, 92010-000, Canoas, RS (Brazil)


    Highlights: Black-Right-Pointing-Pointer Spirulina platensis (SP) and activated carbon (AC) were used to remove RR-120 dye. Black-Right-Pointing-Pointer The maximum adsorption capacities were found at pH 2 and 298 K. Black-Right-Pointing-Pointer The values were 482.2 and 267.2 mg g{sup -1} for SP and AC, respectively. Black-Right-Pointing-Pointer Adsorption was exothermic, spontaneous and favorable. Black-Right-Pointing-Pointer SP and AC were effective to treat a simulated dye-house effluent. - Abstract: Spirulina platensis microalgae (SP) and commercial activated carbon (AC) were compared as adsorbents to remove Reactive Red 120 (RR-120) textile dye from aqueous effluents. The batch adsorption system was evaluated in relation to the initial pH, contact time, initial dye concentration and temperature. An alternative kinetic model (general order kinetic model) was compared with the traditional pseudo-first order and pseudo-second order kinetic models. The equilibrium data were fitted to the Langmuir, Freundlich and Liu isotherm models, and the thermodynamic parameters were also estimated. Finally, the adsorbents were employed to treat a simulated dye-house effluent. The general order kinetic model was more appropriate to explain RR-120 adsorption by SP and AC. The equilibrium data were best fitted to the Liu isotherm model. The maximum adsorption capacities of RR-120 dye were found at pH 2 and 298 K, and the values were 482.2 and 267.2 mg g{sup -1} for the SP and AC adsorbents, respectively. The thermodynamic study showed that the adsorption was exothermic, spontaneous and favourable. The SP and AC adsorbents presented good performance for the treatment of simulated industrial textile effluents, removing 94.4-99.0% and 93.6-97.7%, respectively, of the dye mixtures containing high saline concentrations.

  17. Study on the effect of different concentration of Spirulina platensis paste added into dried noodle to its quality characteristics (United States)

    Agustini, T. W.; Ma'ruf, W. F.; Widayat; Wibowo, B. A.; Hadiyanto


    High nutritional content of microalgae S. platensis is very good for human health especially for its protein and β-carotene. These compounds can be used for improving quality of food from nutritional point of view. This study was designed to observe the effect of different concentration of S. platensis paste to dried noodle quality based on physical, chemical and sensory perspectives. Material used in this study was S. platensis powder obtained from CV Neoalgae, Sukoharjo. The best treatment observed from preliminary study was then used for further study and compared to control treatment (without added S. platensis paste). The dried noodle resulted was then analyzed for elasticity, chemical (β-carotene, water, protein, ash, fat and carbohydrate) and sensory (hedonic). Parametric data obtained were analyzed using t-Test while non-parametric data was analyzed using Kruskal-Wallis followed by Multiple Comparison test. The study showed that dried noodle added with 9% S. platensis paste give significant effect (P<0.05) on elasticity; β-carotene, water, protein, ash, fat and carbohydrate and also sensory (hedonic). Dried noodle without added S. platensis paste has lower in β-carotene and protein compared to that of added S. platensis paste with the value of 0.06 mg/100 gr and 17.51 mg/100gr (β-carotene) and 8.88% and 38.6% (protein), respectively. Those, chemical composition of dried noodle added with S. platensis comply with Indonesian National Standard in term of protein, water, and ash content with sensory of 7.26 ≤ μ ≤ 7.63. Addition of S. platensis can significantly increase the nutritional of dried noodle especially protein (by 4 times) and β-carotene.

  18. Optimization of Protein Extraction from Spirulina platensis to Generate a Potential Co-Product and a Biofuel Feedstock with Reduced Nitrogen Content

    Energy Technology Data Exchange (ETDEWEB)

    Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C., E-mail: [College of Engineering, The University of Georgia, Athens, GA (United States); Forsberg, Lennart S.; Azadi, Parastoo [Complex Carbohydrate Research Center, The University of Georgia, Athens, GA (United States)


    The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).

  19. Optimization of Protein Extraction from Spirulina platensis to Generate a Potential Co-Product and a Biofuel Feedstock with Reduced Nitrogen Content

    International Nuclear Information System (INIS)

    Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C.; Forsberg, Lennart S.; Azadi, Parastoo


    The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).


    Directory of Open Access Journals (Sweden)

    Ricardo Lafaiete Moreira


    Full Text Available This study aimed to evaluate the Spirulina platensis influence as a food supplement in Nile tilapia post-larvae grown in saline water. The experiment consisted of two treatments with three replicates. In first one the animals were fed ration containing the androgen 17 α - methyltestosterone and S. platensis, and in the other only diet with the hormone. At the end of the reversal (28 days, tilapia that received S. platensis showed average weights of 1.17 ± 0.16 g, significantly superior to the animals fed only ration, which reached an average weight of 0.62 ± 0.38 g (P < 0.05; however, survival rates showed no significant difference (P < 0.05. At the end of the experiment (78 days, fish gonadal analysis showed indices of 47.5% of males for fish reared without microalgae and 59.09% for fish reared with S. platensis. It was conclude that Nile tilapia showed good growth and survival rate in the presence of S. platensis, compared to the fish fed only diet in saline water. However, it was not possible to obtain acceptable rates of sex reversal after the administration of masculinizing hormone through the diet.

  1. SpirPro: A Spirulina proteome database and web-based tools for the analysis of protein-protein interactions at the metabolic level in Spirulina (Arthrospira) platensis C1. (United States)

    Senachak, Jittisak; Cheevadhanarak, Supapon; Hongsthong, Apiradee


    Spirulina (Arthrospira) platensis is the only cyanobacterium that in addition to being studied at the molecular level and subjected to gene manipulation, can also be mass cultivated in outdoor ponds for commercial use as a food supplement. Thus, encountering environmental changes, including temperature stresses, is common during the mass production of Spirulina. The use of cyanobacteria as an experimental platform, especially for photosynthetic gene manipulation in plants and bacteria, is becoming increasingly important. Understanding the mechanisms and protein-protein interaction networks that underlie low- and high-temperature responses is relevant to Spirulina mass production. To accomplish this goal, high-throughput techniques such as OMICs analyses are used. Thus, large datasets must be collected, managed and subjected to information extraction. Therefore, databases including (i) proteomic analysis and protein-protein interaction (PPI) data and (ii) domain/motif visualization tools are required for potential use in temperature response models for plant chloroplasts and photosynthetic bacteria. A web-based repository was developed including an embedded database, SpirPro, and tools for network visualization. Proteome data were analyzed integrated with protein-protein interactions and/or metabolic pathways from KEGG. The repository provides various information, ranging from raw data (2D-gel images) to associated results, such as data from interaction and/or pathway analyses. This integration allows in silico analyses of protein-protein interactions affected at the metabolic level and, particularly, analyses of interactions between and within the affected metabolic pathways under temperature stresses for comparative proteomic analysis. The developed tool, which is coded in HTML with CSS/JavaScript and depicted in Scalable Vector Graphics (SVG), is designed for interactive analysis and exploration of the constructed network. SpirPro is publicly available on the web

  2. Fed-batch strategy for enhancing cell growth and C-phycocyanin production of Arthrospira (Spirulina) platensis under phototrophic cultivation. (United States)

    Xie, Youping; Jin, Yiwen; Zeng, Xianhai; Chen, Jianfeng; Lu, Yinghua; Jing, Keju


    The C-phycocyanin generated in blue-green algae Arthrospira platensis is gaining commercial interest due to its nutrition and healthcare value. In this study, the light intensity and initial biomass concentration were manipulated to improve cell growth and C-phycocyanin production of A.platensis in batch cultivation. The results show that low light intensity and high initial biomass concentration led to increased C-phycocyanin accumulation. The best C-phycocyanin productivity occurred when light intensity and initial biomass concentration were 300μmol/m(2)/s and 0.24g/L, respectively. The fed-batch cultivation proved to be an effective strategy to further enhance C-phycocyanin production of A.platensis. The results indicate that C-phycocyanin accumulation not only requires nitrogen-sufficient condition, but also needs other nutrients. The highest C-phycocyanin content (16.1%), production (1034mg/L) and productivity (94.8mg/L/d) were obtained when using fed-batch strategy with 5mM medium feeding. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay

    Directory of Open Access Journals (Sweden)

    Eduardo Sommella


    Full Text Available Arthrospira platensis, better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS and Ultra High-Performance Liquid Chromatography (UHPLC for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary supplements. FT-ICR was employed to elucidate the qualitative profile of Spirulina pigments, in both direct infusion mode (DIMS and coupled to UHPLC. DIMS showed to be a very fast (4 min and accurate (mass accuracy ≤ 0.01 ppm tool. 51 pigments were tentatively identified. The profile revealed different classes, such as carotenes, xanthophylls and chlorophylls. Moreover, the antioxidant evaluation of the major compounds was assessed by pre-column reaction with the DPPH radical followed by fast UHPLC-PDA separation, highlighting the contribution of single analytes to the antioxidant potential of the entire pigment fraction. β-carotene, diadinoxanthin and diatoxanthin showed the highest scavenging activity. The method took 40 min per sample, comprising reaction. This strategy could represent a valid tool for the fast and comprehensive characterization of Spirulina pigments in dietary supplements, as well as in other microalgae-based products.

  4. Fast Profiling of Natural Pigments in Different Spirulina (Arthrospira platensis) Dietary Supplements by DI-FT-ICR and Evaluation of their Antioxidant Potential by Pre-Column DPPH-UHPLC Assay. (United States)

    Sommella, Eduardo; Conte, Giulio Maria; Salviati, Emanuela; Pepe, Giacomo; Bertamino, Alessia; Ostacolo, Carmine; Sansone, Francesca; Prete, Francesco Del; Aquino, Rita Patrizia; Campiglia, Pietro


    Arthrospira platensis , better known as Spirulina, is one of the most important microalgae species. This cyanobacterium possesses a rich metabolite pattern, including high amounts of natural pigments. In this study, we applied a combined strategy based on Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (FT-ICR-MS) and Ultra High-Performance Liquid Chromatography (UHPLC) for the qualitative/quantitative characterization of Spirulina pigments in three different commercial dietary supplements. FT-ICR was employed to elucidate the qualitative profile of Spirulina pigments, in both direct infusion mode (DIMS) and coupled to UHPLC. DIMS showed to be a very fast (4 min) and accurate (mass accuracy ≤ 0.01 ppm) tool. 51 pigments were tentatively identified. The profile revealed different classes, such as carotenes, xanthophylls and chlorophylls. Moreover, the antioxidant evaluation of the major compounds was assessed by pre-column reaction with the DPPH radical followed by fast UHPLC-PDA separation, highlighting the contribution of single analytes to the antioxidant potential of the entire pigment fraction. β-carotene, diadinoxanthin and diatoxanthin showed the highest scavenging activity. The method took 40 min per sample, comprising reaction. This strategy could represent a valid tool for the fast and comprehensive characterization of Spirulina pigments in dietary supplements, as well as in other microalgae-based products.

  5. Capacidade antioxidante da microalga Spirulina platensis em células da levedura Saccharomyces cerevisiae submetidas ao estressor paraquat


    Guarienti, Cíntia; Bertolin, Telma Elita; Costa, Jorge Alberto Vieira


    Em virtude de várias publicações terem mostrado a alta associação entre a geração de radicais livres e as doenças crônico-degenerativas, tem havido grande interesse por alimentos funcionais antioxidantes. O excesso de espécies reativas no organismo resulta em estresse oxidativo que provoca danos celulares e teciduais. A microalga Spirulina tem sido pesquisada em função de suas propriedades nutricionais e antioxidantes. O objetivo desse trabalho foi de avaliar a atividade antioxidante da mi...

  6. Antioxidant Potential of Extracts Obtained from Macro- (Ascophyllum nodosum, Fucus vesiculosus and Bifurcaria bifurcata and Micro-Algae (Chlorella vulgaris and Spirulina platensis Assisted by Ultrasound

    Directory of Open Access Journals (Sweden)

    Rubén Agregán


    Full Text Available Background: Natural antioxidants, which can replace synthetic ones due to their potential implications for health problems in children, have gained significant popularity. Therefore, the antioxidant potential of extracts obtained from three brown macroalgae (Ascophyllum nodosum, Fucus vesiculosus and Bifurcaria bifurcata and two microalgae (Chlorella vulgaris and Spirulina platensis using ultrasound-extraction as an innovative and green approach was evaluated. Methods: Algal extracts were obtained by ultrasound-assisted extraction using water/ethanol (50:50, v:v as the extraction solvent. The different extracts were compared based on their antioxidant potential, measuring the extraction yield, the total phenolic content (TPC and the antioxidant activity. Results: Extracts from Ascophyllum nodosum (AN and Bifurcaria bifurcata (BB showed the highest antioxidant potential compared to the rest of the samples. In particular, BB extract presented the highest extraction (35.85 g extract/100 g dry weight (DW and total phenolic compounds (TPC (5.74 g phloroglucinol equivalents (PGE/100 g DW yields. Regarding the antioxidant activity, macroalgae showed again higher values than microalgae. BB extract had the highest antioxidant activity in the ORAC, DPPH and FRAP assays, with 556.20, 144.65 and 66.50 µmol Trolox equivalents (TE/g DW, respectively. In addition, a correlation among the antioxidant activity and the TPC was noted. Conclusions: Within the obtained extracts, macroalgae, and in particular BB, are more suitable to be used as sources of phenolic antioxidants to be included in products for human consumption. The relatively low antioxidant potential, in terms of polyphenols, of the microalgae extracts studied in the present work makes them useless for possible industrial applications compared to macroalgae, although further in vivo studies evaluating the real impact of antioxidants from both macro- and micro-algae at the cellular level should be

  7. Efficacy of Spirulina platensis diet supplements on disease resistance and immune-related gene expression in Cyprinus carpio L. exposed to herbicide atrazine. (United States)

    Khalil, Samah R; Reda, Rasha M; Awad, Ashraf


    The present study evaluated the immunotoxicological effects of the herbicide atrazine (ATZ) at sub-lethal concentrations and the potential ameliorative influence of Spirulina platensis (SP) over a sub-chronic exposure period on Cyprinus carpio L., also known as common carp. Common carp was sampled after a 40-days exposure to ATZ (428 μg/L) and SP (1%), individually or in combination to assess the non-specific immune response, changes in mRNA expression of immune-related genes [lysozyme (LYZ), immunoglobulin M (IgM), and complement component 3 (C3)] in the spleen, and inflammatory cytokines (interleukins IL-1ß and IL-10) in the head kidney using real-time PCR. Additionally, disease resistance to Aeromonas sobria was evaluated. The results revealed that ATZ exposure caused a significant decline in most of the hematological variables, lymphocyte viability, and lysozyme and bactericidal activity. Moreover, ATZ increased the susceptibility to disease, reflected by a significantly lower post-challenge survival rate of the carp. ATZ may induce dysregulated expression of immune-related genes leading to downregulation of mRNA levels of IgM and LYZ in the spleen. However, expression of C3 remained unaffected. Of the cytokine-related genes examined, IL-1B was up-regulated in the head kidney. In contrast, the expression of IL-10 gene was down-regulated in the ATZ-exposed group. The SP supplementation resulted in a significant improvement in most indices; however, these values did not match with that of the controls. These results may conclude that ATZ affects both innate and adaptive immune responses through the negative transcriptional effect on genes involved in immunity and also due to the inflammation of the immune organs. In addition, dietary supplements with SP could be useful for modulation of the immunity in response to ATZ exposure, thereby presenting a promising feed additive for carps in aquaculture. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Cultivation of Arthrospira (spirulina platensis in desalinator wastewater and salinated synthetic medium: protein content and amino-acid profile Cultivo de Arthrospira (Spirulina platensis em rejeito de dessalinizador e meio sintético salinizado: teor protéico e perfil de aminoácidos

    Directory of Open Access Journals (Sweden)

    Harriet Volkmann


    Full Text Available Arthrospira (Spirulina platensis was cultivated in laboratory under controlled conditions (30ºC, photoperiod of 12 hours light/dark provided by fluorescent lamps at a light intensity of 140 µmol photons.m-2.s-1 and constant bubbling air in three different culture media: (1 Paoletti medium (control, (2 Paoletti supplemented with 1 g.L-1 NaCl (salinated water and (3 Paoletti medium prepared with desalinator wastewater. The effects of these treatments on growth, protein content and amino acid profile were measured. Maximum cell concentrations observed in Paoletti medium, Paoletti supplemented with salinated water or with desalinator wastewater were 2.587, 3.545 and 4.954 g.L-1, respectively. Biomass in medium 3 presented the highest protein content (56.17%, while biomass in medium 2 presented 48.59% protein. All essential amino acids, except lysine and tryptophan, were found in concentrations higher than those requiried by FAO.Arthrospira (Spirulina platensis foi cultivada em laboratório sob condições controladas (30ºC, intensidade luminosa de 140 µmol fótons.m-2.s-1, 12 horas claro/escuro e insuflação constante de ar atmosférico, em três meios de cultivo: (1 meio de Paoletti (controle, (2 meio de Paoletti suplementado com 1,0 g.L-1 de NaCl (água salinizada e (3 meio de Paoletti preparado com rejeito de dessalinizador. Foi verificado o efeito destes tratamentos no crescimento, teor de proteínas e aminoácidos. As concentrações celulares máximas obtidas foram de 2,587; 3,545 e 4,954 g.L-1 no meio controle, meio de Paoletti suplementado com água salinizada ou com rejeito de dessalinizador, respectivamente. Com relação às concentrações protéicas, estas foram maiores na biomassa cultivada no meio 3, com 56,17%, enquanto que a biomassa cultivada no meio 2 apresentou 48,59%. A maioria dos aminoácidos essenciais encontrou-se acima dos limites requeridos pela FAO, com exceção apenas de lisina e triptofano.


    Directory of Open Access Journals (Sweden)



    Full Text Available This study aimed to evaluate the influence of S. platensis as a food supplement for Nile tilapia post-larvae. Two trials was running. In the first, was used two treatments, one offered freshwater microalgae (green water and other offered microalga S. platensis. In the second trial, were evaluated the effect of without copepods, administration of copepods alone and copepods enriched with S. platensis. Throughout the study, all animals were fed diets with masculinizing hormone 17-K-methyl-testosterone. It was evaluated the growth in weight and length, the survival rate and the rate of sex reversal of tilapia (mean +,- SD. In the first trial, the fish that received the S. platensis and receiving freshwater microalgae showed as result, 0.21 +,- 0.042 g; 2.50 +,- 0.091 cm; 97.5 ± 1,00% and 0.11 +,- 0.022 g; 1.91 +,- 0.419 cm; 98.33 +,- 0.70%, respectively. In the second trial, when the copepods were utilized, with and without S. platensis, the post-larvae as result, 0.221 ± 0.008 g; 2.70 ± 0.070 cm; 86.67 +,- 1.03% and 0.211 +,- 0.014 g; 2.56 ± 0.121 cm; 77.50 +,- 1.33%, respectively. The animals that received only commercial had as result, 0.190 +,- 0.008 g; 2.22 +,- 0.215 cm and 79.17 +,-0.21%. Using S. platensis resulted in better growth in weight and length, but did not affect survival and rates of sex reversal Nile tilapia post-larvae of exposed to natural food.

  10. Evaluation of the Influence of Nitrogen and Phosphorus Nutrients in the Culture and Production ofbiosurfactants by MicroalgaSpirulina


    Lisiane Fernandes De Carvalho; Mariana Souza De Oliveira


    The aim of this study was to verify the influence of phosphorus and nitrogen nutrients in the culture and production of biosurfactants by Spirulina platensis LEB 52,Spirulina platensisParacas and Spirulina sp. LEB 18. For this, experiments were performed using Full Factorial Design 22 to evaluate the influence of phosphorus and nitrogen nutrients on the maximum biomass concentration and maximum productivity in the cultures, as well as in production biosurfactant by extracts...

  11. Growth and content of Spirulina platensis biomass chlorophyll cultivated at different values of light intensity and temperature using different nitrogen sources

    Directory of Open Access Journals (Sweden)

    Eliane Dalva Godoy Danesi


    Full Text Available The effects of light intensity and temperature in S. platensis cultivation with potassium nitrate or urea as nitrogen source were investigated, as well as the biomass chlorophyll contents of this cyanobacteria, through the Response Surface Methodology. Experiments were performed at temperatures from 25 to 34.5ºC and light intensities from 15 to 69 µmol photons m-2 s-1, in mineral medium. In cultivations with both sources of nitrogen, KNO3 and urea, statistic evaluation through multiple regression, no interactions of such independent variables were detected in the results of the dependent variables maximum cell concentration, chlorophyll biomass contents, cell and chlorophyll productivities, as well as in the nitrogen-cell conversion factor. In cultivation performed with both sources of nitrogen, it was possible to obtain satisfactory adjustments to relate the dependent variables to the independent variables. The best results were achieved at temperature of 30ºC, at light intensity of 60 µmol photons m-2s-1, for cell growth, with cell productivity of approximately 95 mg L-1 d-1 in cultivations with urea. For the chlorophyll biomass content, the most adequate light intensity was 24 µmol photons m-2 s-1.


    Directory of Open Access Journals (Sweden)

    C. Cruz-Martínez


    Full Text Available AbstractNH4NO3 simultaneously provides a readily assimilable nitrogen source (ammonia and a reserve of nitrogen (nitrate, allowing for an increase in Arthrospira platensis biomass production while reducing the cost of the cultivation medium. In this study, a 22plus star central composite experimental design combined with response surface methodology was employed to analyze the influence of light intensity (I and the total amount of added NH4NO3 (Mt on a bench-scale tubular photobioreactor for fed-batch cultures. The maximum cell concentration (Xm, cell productivity (PX and biomass yield on nitrogen (YX/N were evaluated, as were the protein and lipid contents. Under optimized conditions (I = 148 μmol·photons·m-2·s-1 and Mt = 9.7 mM NH4NO3, Xm = 4710 ±34.4 mg·L-1, PX = 478.9 ±3.8 mg·L-1·d-1 and YX/N = 15.87 ±0.13 mg·mg-1 were obtained. The best conditions for protein content in the biomass (63.2% were not the same as those that maximized cell growth (I = 180 μmol·photons·m-2·s-1 and Mt = 22.5 mM NH4NO3. Based on these results, it is possible to conclude that ammonium nitrate is an interesting alternate nitrogen source for the cultivation of A. platensisin a fed-batch process and could be used for other photosynthetic microorganisms.

  13. Protean career: perspectives of study

    Directory of Open Access Journals (Sweden)

    Litvinova Ye.Yu.


    Full Text Available The article analyzes different approaches to study of models of constructing the employment career in current environment. The changes having taken place in interrelationsbetween employees and organizations over recent 15 years led to changes in their mutual expectations including the ones concerning the career development. Boundaryless career based on career mobility and protean career based on subjective understanding of career success are regarded as alternatives to traditional careers. The main attributes of “new careers” are: an increased independence in employee-organization dyads, low level of mutual obligations, freedom of choice, self-actualization, priority of career loyalty and self-management in contrast to organization loyalty. Changes in career conceptualizing inevitably led to revision of career competences. Traditional professional competences give way to career meta-competences like adaptiveness, capacity for education, self-management, taking responsibility. At the same time empirical studies displaya prematurity of statements about the expressed loss of interest to traditional careers.

  14. Análisis microscópico de muestras comerciales de Spirulina (Cyanophyta)


    Arenas, Patricia Marta; Cortella, Alicia Rita


    Se analizó el contenido de muestras comerciales de Spirulina (Cyanophytu), expendidas en el mercado como suplementos dietéticos y adelgazantes. Fueron observadas al microscopio fotónico y al microscopio electrónico de barrido (MEB), previo tratamiento por "freeze drying". Los resultados indican que todas contienen Spirulina platensis. En algunas de ellas esta especie se presenta pura, mientras que en otras se halla mezclada con otras Cyanophyta (Oscillatoria y Phormidium) debido probablemente...

  15. İki Farklı Spirulina platensis Suşunun Büyüme Özelliklerinin Karşılaştırılması

    Directory of Open Access Journals (Sweden)

    Cenker Kılıç


    Full Text Available Mikroalgal biyoteknoloji kapsamında sıklıkla kullanılan türlerden Spirulina platensis’in üretimi son yıllarda ülkemizde de başarıyla gerçekleştirilmektedir. Bu çalışmada, düz ve spiral formda olan iki farklı Spirulina suşunun büyüme karakteristikleri incelendi. Ayrıca, klorofil ve kuru ağırlık ölçümlerinde pratiklik sağlayacak spektrofotometrik ölçümler çalışıldı. Deneme süresince, hücre sayıları haricinde tüm parametrelerin birbirine benzerlik gösterdiği saptandı. Denemenin başında spiral/düz form oranı 2.43 iken bu oran deneme sonunda 5.53’e yükseldi. Spektrofotometrik ölçümler, kültürlerde büyümenin izlenmesinde pratiklik sağlaması bakımından önemlidir. Bu kapsamda, 680 nm’de ölçülen absorbans değeri ile kuru ağırlık ve klorofil a miktarları arasında önemli bir ilişki olduğu saptandı (p

  16. Acoustic, electrochemical and microscopic characterization of interaction of Arthrospira platensis biofilm and heavy metal ions


    Tekaya , Nadèje; Gammoudi , Ibtissèm; Braiek , Mohamed; Tarbague , Hakim; Morote , Fabien; Raimbault , Vincent; Sakly , Nawfel; Rebière , Dominique; Ben Ouada , Hatem; Lagarde , Florence; Ben Ouada , Hafedh; Cohen-Bouhacina , Touria; Déjous , Corinne; Jaffrezic-Renault , Nicole


    International audience; This study examines a biofilm of Arthrospira platensis and its interactions with cadmium and mercury, using electrochemical admittance spectroscopy technique combined with highly sensitive Love wave platform for the real-time detection in liquid medium. Spirulina cells were immobilized via multilayers of polyelectrolyte (PEM) on Si/SiO2 surface of both transducers and characterized using atomic force microscopy (AFM). Scanning electron microscopy (SEM) cell images reve...

  17. Enhancement of natural killer cell activity in healthy subjects by Immulina®, a Spirulina extract enriched for Braun-type lipoproteins

    DEFF Research Database (Denmark)

    Nielsen, Claus Henrik; Balachandran, Premalatha; Christensen, Ole


    Immulina®, a commercial extract of Arthrospira (Spirulina) platensis is a potent activator of THP-1 monocytes and CD4+ T cells IN VITRO and enhances several immunological functions in mice. We further characterized Immulina® by determining that Braun-type lipoproteins are responsible for a major...

  18. Oral administration of a Spirulina extract enriched for Braun-type lipoproteins protects mice against influenza A(H1N1) virus infection (United States)

    Previous studies indicate that Immulina, a commercial extract of Arthrospira (Spirulina) platensis, is a potent activator of innate immune cells and that Braun-type lipoproteins (a principal toll-like receptor (TLR) 2 ligand) are the main active components within this product. In the present study, ...

  19. Evaluation of the cosmetic potential of the Cyanobacterium Spirulina platensis


    Novak, Alessandra Cristine


    Abstract: Toiletry, Perfumery and Cosmetics Sector (TPCS) occupies a prominent place in modern society. The search for beauty and wellness, combined with increased life expectancy of the population, causes the intensive search to products that improve appearance, hygiene and health. Thus, the development of cosmetics is very stimulated. Another important feature is the continuously pressure from consumers and companies to this development of new and innovative products, raising competitivenes...

  20. Production of Spirulina platensis by adding sodium bicarbonate and ...

    African Journals Online (AJOL)



    Apr 2, 2014 ... consumption of carbohydrates for respiration and this resulted in a decrease ... crease of cell took place in the type II nutrition due to the rates of urea and .... the best cellular increase and the best protein ratio. In this case, we ...

  1. Spirulina improves antioxidant status by reducing oxidative stress in rabbits fed a high-cholesterol diet. (United States)

    Kim, Mi Yeon; Cheong, Sun Hee; Lee, Jeung Hee; Kim, Min Ji; Sok, Dai-Eun; Kim, Mee Ree


    The beneficial effect of Spirulina (Spirulina platensis) on tissue lipid peroxidation and oxidative DNA damage was tested in the hypercholesterolemic New Zealand White rabbit model. After hypercholesterolemia was induced by feeding a high cholesterol (0.5%) diet (HCD) for 4 weeks, then HCD supplemented with 1% or 5% Spirulina (SP1 or SP5, respectively) was provided for an additional 8 weeks. Spirulina supplementation significantly reduced the increased lipid peroxidation level in HCD-fed rabbits, and levels recovered to control values. Oxidative stress biomarkers such as glutathione, glutathione peroxidase, glutathione reductase, and glutathione S-transferase were significantly improved in the liver and red blood cells of rabbits fed SP1. Furthermore, SP5 induced antioxidant enzyme activity by 3.1-fold for glutathione, 2.5-fold for glutathione peroxidase, 2.7-fold for glutathione reductase, and 2.3-fold for glutathione S-transferase in liver, compared to the HCD group. DNA damage in lymphocytes was significantly reduced in both the SP1 and SP5 groups, based on the comet assay. Findings from the present study suggest that dietary supplementation with Spirulina may be useful to protect the cells from lipid peroxidation and oxidative DNA damage.

  2. Effect of Spirulina supplementation on plasma metabolites in crossbred and purebred Australian Merino lambs

    Directory of Open Access Journals (Sweden)

    A.E.O. Malau-Aduli


    Full Text Available The effect of supplementing purebred and crossbred Merino lambs with Arthrospira platensis (Spirulina on plasma metabolite concentrations under pasture-based management system and the influences of sire breed and sex were investigated. A completely randomized experimental design balanced by 4 sire breeds (Merino, White Suffolk, Dorset and Black Suffolk, 3 Spirulina supplementation levels (0, 100 and 200 ml representing the control, low and high, respectively and 2 sexes (ewe and wether lambs was utilised. All lambs had ad libitum access to the basal diet of ryegrass pastures and barley. Lambs in the treatment groups were individually drenched daily with Spirulina prior to being released with the control group of lambs for grazing over a 6-week period following a 3-week adjustment phase. At the start and completion of the feeding trial, blood samples were centrifuged and plasma metabolites measured. Data were analysed with Spirulina supplementation level, sire breed, sex and their second-order interactions fitted as fixed effects and metabolite concentrations as dependent variables. Gamma-glutamyl transferase (GGT concentrations decreased (from 79.40 to 69.25 UI and glucose increased (from 3.81 to 4.19 mmol/L as the level of Spirulina supplementation increased from 0 ml in the control to 200 ml in the high treatment groups (P < 0.05. Lambs supplemented at low Spirulina levels had the highest creatinine concentrations (61.75 μmol/L. Interactions between sex and supplementation level significantly affected glucose, aspartate aminotransferase (AST and Mg concentrations (P < 0.05, while sire breed and supplementation level interactions influenced albumin to globulin (A/G ratio, creatinine and GGT concentrations. It was demonstrated that Spirulina supplementation does not negatively impact lamb health and productivity.

  3. Cultivation of Chlorella vulgaris and Arthrospira platensis with Recovered Phosphorus from Wastewater by Means of Zeolite Sorption (United States)

    Markou, Giorgos; Depraetere, Orily; Vandamme, Dries; Muylaert, Koenraad


    In this study, zeolite was employed for the separation and recovery of P from synthetic wastewater and its use as phosphorus (P) source for the cultivation of the green microalga Chlorella vulgaris and the cyanobacterium Arthrospira (Spirulina) platensis. At P-loaded zeolite concentration of 0.15–1 g/L, in which P was limited, the two species displayed quite different behavior regarding their growth and biomass composition. C. vulgaris preferred to increase the intracellular P and did not synthesize biomass, while A. platensis synthesized biomass keeping the intracellular P as low as possible. In addition under P limitation, C. vulgaris did display some little alteration of the biomass composition, while A. platensis did it significantly, accumulating carbohydrates around 70% from about 15%–20% (control). Both species could desorb P from zeolite biologically. A. platensis could recover over 65% and C. vulgaris 25% of the P bounded onto zeolite. When P-loaded zeolite concentration increased to 5 g/L, P was adequate to support growth for both species. Especially in the case of C. vulgaris, growth was stimulated from the presence of P-loaded zeolite and produced more biomass compared to the control. PMID:25690037

  4. Cultivation of Chlorella vulgaris and Arthrospira platensis with Recovered Phosphorus from Wastewater by Means of Zeolite Sorption

    Directory of Open Access Journals (Sweden)

    Giorgos Markou


    Full Text Available In this study, zeolite was employed for the separation and recovery of P from synthetic wastewater and its use as phosphorus (P source for the cultivation of the green microalga Chlorella vulgaris and the cyanobacterium Arthrospira (Spirulina platensis. At P-loaded zeolite concentration of 0.15–1 g/L, in which P was limited, the two species displayed quite different behavior regarding their growth and biomass composition. C. vulgaris preferred to increase the intracellular P and did not synthesize biomass, while A. platensis synthesized biomass keeping the intracellular P as low as possible. In addition under P limitation, C. vulgaris did display some little alteration of the biomass composition, while A. platensis did it significantly, accumulating carbohydrates around 70% from about 15%–20% (control. Both species could desorb P from zeolite biologically. A. platensis could recover over 65% and C. vulgaris 25% of the P bounded onto zeolite. When P-loaded zeolite concentration increased to 5 g/L, P was adequate to support growth for both species. Especially in the case of C. vulgaris, growth was stimulated from the presence of P-loaded zeolite and produced more biomass compared to the control.

  5. Teores de β-caroteno em suplementos e biomassa de Spirulina Contents of β-carotene in supplements and biomass of Spirulina

    Directory of Open Access Journals (Sweden)

    Daniel Barroso de Alencar


    Full Text Available A cianobactéria Spirulina tem sido utilizada há séculos, tendo em vista suas propriedades nutricionais e medicinais. Neste trabalho, objetivou-se analisar os teores de β-caroteno tanto em suplementos alimentares a base de Spirulina comercializados em estabelecimentos de produtos naturais no mercado varejista, quanto em S. platensis cultivada em laboratório. Alguns pigmentos carotenóides possuem atividade de vitamina A e, dentre eles, o β-caroteno é o que apresenta maior atividade biológica. A extração de β-caroteno foi feita com metanol:água (90:10 v/v, seguida de saponificação e partição em n-hexano. As análises cromatográficas foram realizadas em coluna Waters Spherisorb S5 ODS 2 (4,6 x 250 mm, usando metanol:tetrahidrofurano (90:10, v/v bombeado a 2 mL min-1, com registro dos cromatogramas em 450 nm. Os suplementos alimentares a base de Spirulina apresentaram baixos teores de β-caroteno. A maior concentração foi encontrada em S. platensis cultivada a 24º C com fotoperíodo de 16 h claro e 8 h escuro. Considerando sua atividade provitamínica, os teores de retinol equivalente (RE nas microalgas analisadas no presente trabalho foram calculados a partir do β-caroteno para classificá-las como fonte excelente ou fonte útil de vitamina A.Spirulina is a cyanobacterium that has been used for several centuries due to its nutritional and medicinal properties. This work has evaluated the contents of β-carotene both in Spirulina commercialized as food supplement, purchased from natural product shops, and in S. platensis reared under laboratory conditions. Some carotenoids exhibit pro-vitamin A activity, and β-carotene presents the greatest biological activity. β-Carotene of microalgae was extracted in 90% aqueous methanol. These extracts were saponified and partitioned in n-hexane. Chromatographic analyses were carried out in a Spherisorb column S5 ODS 2 (4.6 x 250 mm, with a mobile phase of methanol:tetrahydrofuran (90:10, v

  6. Application of Low cost Spirulina growth medium using Deep sea water (United States)

    Lim, Dae-hack; Kim, Bong-ju; Lee, Sung-jae; Choi, Nag-chul; Park, Cheon-young


    Deep-sea water has a relatively constant temperature, abundant nutrients such as calcium, magnesium, nitrates, and phosphates, etc., and stable water quality, even though there might be some variations of their compositions according to collection places. Thus, deep-sea water would be a good substrate for algal growth and biomass production since it contains various nutrients, including a fluorescent red pigment, and β-carotene, etc. The aim of this study was to investigate the economics of a culture condition through comparative analysis to Spirulina platensis growth characteristic under various medium conditions for cost-effective production of Spirulina sp.. Growth experiments were performed with S. platensis under various culture medium conditions (deep sea water + SP medium). Growth tests for culture medium demonstrated that the deep sea water to SP medium ratio of 50:50(W/W) was effective in S. platensis with the maximum biomass (1.35g/L) and minimum medium making cost per production mass (133.28 KRW/g). Parameter estimation of bio-kinetics (maximum growth rate and yield) for low cost medium results showed that the maximum growth rate and yield of N, P, K were obtained under deep sea water to SP medium ratio of 50:50(W/W) of 0.057 1/day and 0.151, 0.076, 0.123, respectively. Acknowledgment : "This research was a part of the project titled 'Development of microalgae culture technique for cosmetic materials based on ocean deep sea water(20160297)', funded by the Ministry of Oceans and Fisheries, Korea."

  7. Classifications of College Students' Protean and Boundaryless Orientation to Work (United States)

    Rojewski, Jay W.; Pisarik, Christopher; Han, Hyojung


    Increasingly, individuals navigate their own careers in self-directed (protean) and boundaryless contexts. These concepts have been applied to adult employees but have seen limited application with young adults. Therefore, 205 college students were assessed on the "Protean and Boundaryless Career Attitudes" scales (Briscoe, Hall, and…

  8. Protean and Boundaryless Career Attitudes and Organizational Commitment: The Effects of Perceived Supervisor Support (United States)

    Cakmak-Otluoglu, K. Ovgu


    Despite the traditional sentiment that protean and boundaryless career attitudes indicate a decline in organizational commitment, little empirical evidence is available. The present study examined the relation of protean and boundaryless career attitudes to organizational commitment and whether the perceived supervisor support moderated these…

  9. Antioxidant activity of the microalga Spirulina maxima


    Miranda M.S.; Cintra R.G.; Barros S.B.M.; Mancini-Filho J.


    Spirulina maxima, which is used as a food additive, is a microalga rich in protein and other essential nutrients. Spirulina contains phenolic acids, tocopherols and ß-carotene which are known to exhibit antioxidant properties. The aim of the present study was to evaluate the antioxidant capacity of a Spirulina extract. The antioxidant activity of a methanolic extract of Spirulina was determined in vitro and in vivo. The in vitro antioxidant capacity was tested on a brain homogenate incubated ...

  10. Biosorption characteristics of Spirulina and Chlorella cells to accumulate heavy metals

    Directory of Open Access Journals (Sweden)

    Kőnig-Péter Anikó


    Full Text Available The heavy metal biosorption of dried Chlorella vulgaris and Spirulina platensis-Spirulina maxima cells was studied under various experimental conditions. The effect of biosorbent dosage, pH, adsorption time, temperature, initial metal concentration on biosorption was studied. Biosorption process can be divided into two parts: the first part follows zero-order, the second part pseudo second-order kinetics. Characterization of biosorption equilibrium was evaluated with Langmuir and Dubinin-Radushkevich models using non-linear regression. The optimum pH range was found to be 5.0 − 6.0 for Pb(II and 4.0 − 6.0 for Cu(II and Cd(II adsorption. The maximum adsorption capacities for Pb(II, Cd(II and Cu(II were 144, 161 and 138 mg g-1 by Chlorella cells and 370, 201 and 165 by Spirulina cells, based on the experimental data. The same values for activated carbon were 86, 134 and 43 mg g-1, respectively.

  11. Changes of the delayed fluorescence characteristics in Spirulina, Anabaena and Chlorella in response to chromatic adaptation and irradiance

    International Nuclear Information System (INIS)

    Znak, N.Y.; Morgun, V.N.


    Efficiency of the energy transformation for CO2 fixation (E), and kinetics of the initial O-2-mediated electron transport of Spirulina platensis (Gem. ) Geitl, and Chlorella vulgaris Beijerinck cells were measured after adaptation to various growth irradiances (I) by means of the delayed fluorescence (DF) induction curves. Maxima of the membrane potential expenses during induction period were observed at I half saturating oxygen evolution; they were shifted according to growth I remaining higher in Spirulina than in Chlorella. The alterations of absorbance and fluorescence spectra at 25 degrees C after adaptation to I demonstrated changes in composition of pigments of algae, created to compensate for the imbalance in radiation absorption between the two photosystems. For Spirulina cells, the value of E was higher after growing under low I, or under blue radiation absorbed mainly by photosystem (PS) 1 (400-500 nm) with excitation by yellow (570 nm) radiation. For Chlorella cells, it was also higher after growing under low I. Under such conditions the half-rise time for DP-phase of DF induction curve decreased, which reflected an acceleration of kinetics of the initial electron transport between photosystems. An opposite situation was observed with Spirulina cells grown under high I or yellow radiation, and Chlorella cells from high I. Enhancement of effective PS2/PS1 ratio associated with decrease of reaction centre (RC) 2/RC1 stoichiometry may because of the increase of E and high membrane energization under saturating I in algae adapted to low I

  12. Effects of C-phycocyanin and Spirulina on Salicylate-Induced Tinnitus, Expression of NMDA Receptor and Inflammatory Genes (United States)

    Hwang, Juen-Haur; Chen, Jin-Cherng; Chan, Yin-Ching


    Effects of C-phycocyanin (C-PC), the active component of Spirulina platensis water extract on the expressions of N-methyl D-aspartate receptor subunit 2B (NR2B), tumor necrosis factor–α (TNF-α), interleukin-1β (IL-1β), and cyclooxygenase type 2 (COX-2) genes in the cochlea and inferior colliculus (IC) of mice were evaluated after tinnitus was induced by intraperitoneal injection of salicylate. The results showed that 4-day salicylate treatment (unlike 4-day saline treatment) caused a significant increase in NR2B, TNF-α, and IL-1β mRNAs expression in the cochlea and IC. On the other hand, dietary supplementation with C-PC or Spirulina platensis water extract significantly reduced the salicylate-induced tinnitus and down-regulated the mRNAs expression of NR2B, TNF-α, IL-1β mRNAs, and COX-2 genes in the cochlea and IC of mice. The changes of protein expression levels were generally correlated with those of mRNAs expression levels in the IC for above genes. PMID:23533584

  13. Effects of C-phycocyanin and Spirulina on salicylate-induced tinnitus, expression of NMDA receptor and inflammatory genes.

    Directory of Open Access Journals (Sweden)

    Juen-Haur Hwang

    Full Text Available Effects of C-phycocyanin (C-PC, the active component of Spirulina platensis water extract on the expressions of N-methyl D-aspartate receptor subunit 2B (NR2B, tumor necrosis factor-α (TNF-α, interleukin-1β (IL-1β, and cyclooxygenase type 2 (COX-2 genes in the cochlea and inferior colliculus (IC of mice were evaluated after tinnitus was induced by intraperitoneal injection of salicylate. The results showed that 4-day salicylate treatment (unlike 4-day saline treatment caused a significant increase in NR2B, TNF-α, and IL-1β mRNAs expression in the cochlea and IC. On the other hand, dietary supplementation with C-PC or Spirulina platensis water extract significantly reduced the salicylate-induced tinnitus and down-regulated the mRNAs expression of NR2B, TNF-α, IL-1β mRNAs, and COX-2 genes in the cochlea and IC of mice. The changes of protein expression levels were generally correlated with those of mRNAs expression levels in the IC for above genes.

  14. Phycocyanin extraction in Spirulina produced using agricultural waste (United States)

    Taufiqurrahmi, N.; Religia, P.; Mulyani, G.; Suryana, D.; Ichsan; Tanjung, F. A.; Arifin, Y.


    Phycocyanin is a pigment-protein complex synthesized by blue-green microalgae such as Arthrospira (Spirulina) platensis. This pigment is used mainly as natural colouring in food industry. Previous studies have demonstrated the potential health benefits of this natural pigment. The price of phycocyanin is a vital factor that dictates its marketability. The cost of culturing the algae, particularly from the substrate used for growth, is one of the main factors that determine the price of phycocyanin. Another important factor is the growth yield of the algae. In our research, agricultural waste such as charcoal produced from rice husk was utilized for the algae cultivation to replace the synthetic chemicals such as urea and triple superphosphate used the mineral medium. The use of this low cost substrate increases the cell concentration by 60 % during 8 days’ cultivation to reach 0.39 g/l. The phycocyanin extraction was performed using water at the different biomass-to-solvent ratio and shaking rates. The phycocyanin concentration and purity (A615/A280) obtained were 1.2 g/l and 0.3. These values are 40 % and 20 % lower than the value obtained from the algae produced using the synthetic chemicals. Further purification produced the extract purity required for food grade. The biomass-solvent ratio does not significantly affect the extract purity; however, the higher shaking rate during extraction reduces the purity. This finding demonstrates the potential of using rice husk as an alternative substrate to cultivate algae for phycocyanin extraction.

  15. Variation of Spirulina maxima biomass production in different depths of urea-used culture medium. (United States)

    Affan, Md-Abu; Lee, Dae-Won; Al-Harbi, Salim Marzoog; Kim, Han-Jun; Abdulwassi, Najah Ibrahim; Heo, Soo-Jin; Oh, Chulhong; Park, Heung-Sik; Ma, Chae Woo; Lee, Hyeon-Yong; Kang, Do-Hyung


    Fewer studies have assessed the outdoor cultivation of Spirulina maxima compared with S. platensis, although the protein content of S. maxima is higher than S. platensis. Spirulina growth medium requires an increased amount of NaHCO3, Na2CO3, and NaNO3, which increases the production cost. Therefore, the current study used a low-cost but high-efficiency biomass production medium (Medium M-19) after testing 33 different media. The medium depth of 25 cm (group A) was sub-divided into A1 (50% cover with a black curtain (PolyMax, 12 oz ultra-blackout), A2 (25% cover), and A3 (no cover). Similarly the medium depths of 30 and 35 cm were categorized as groups B (B1, B2, and B3) and C (C1, C2, and C3), respectively, and the effects of depth and surface light availability on growth and biomass production were assessed. The highest biomass production was 2.05 g L-1 in group A2, which was significantly higher (p maxima died in B1 and C1 on the fifth day of culture. The biochemical composition of the biomass obtained from A2 cultures, including protein, carbohydrate, lipid, moisture, and ash, was 56.59%, 14.42%, 0.94%, 5.03%, and 23.02%, respectively. Therefore, S. maxima could be grown outdoors with the highest efficiency in urea-enriched medium at a 25-cm medium depth with 25% surface cover or uncovered.

  16. Photosensitizers from Spirulina for Solar Cell

    Directory of Open Access Journals (Sweden)

    Liqiu Wang


    Full Text Available Spirulina is a kind of blue-green algae with good photosynthetic efficiency and might be used for photovoltaic power generation. So this paper used living spirulina as novel photosensitizer to construct spirulina biosolar cell. The results showed that spirulina had the photoelectric conversion effect, and could let the spirulina biosolar cell have 70 μA photocurrent. Meanwhile, adding glucose sucrose or chitosan in the spirulina anode chamber, they could make the maxima current density of the cell greatly increased by 80 μA, 100 μA, and 84 μA, respectively, and the sucrose could improve the maximum power density of the cell to 63 mW/m−2. Phycobiliprotein played an important role in the photosynthesis of spirulina. So in this paper phycobiliprotein was extracted from spirulina to composite with squaraine dye to sensitize nanocrystalline TiO2 photoanode for building dye sensitized solar cell, and the photoelectric properties of the cell also were investigated.

  17. Production of phenolic compounds from Spirulina maxima ...

    African Journals Online (AJOL)

    The purpose of this study was to illustrate the enhancing process of phenolics synthesis in Spirulina maxima grown in Zarrouk's medium supplemented with different concentration of NaNO3 and/or combined with phenylalanine (L-PA). Also, the protective efficacy of Spirulina polyphenolic (SPP) extracts against ...

  18. Construction of a Genome-Scale Metabolic Model of Arthrospira platensis NIES-39 and Metabolic Design for Cyanobacterial Bioproduction.

    Directory of Open Access Journals (Sweden)

    Katsunori Yoshikawa

    Full Text Available Arthrospira (Spirulina platensis is a promising feedstock and host strain for bioproduction because of its high accumulation of glycogen and superior characteristics for industrial production. Metabolic simulation using a genome-scale metabolic model and flux balance analysis is a powerful method that can be used to design metabolic engineering strategies for the improvement of target molecule production. In this study, we constructed a genome-scale metabolic model of A. platensis NIES-39 including 746 metabolic reactions and 673 metabolites, and developed novel strategies to improve the production of valuable metabolites, such as glycogen and ethanol. The simulation results obtained using the metabolic model showed high consistency with experimental results for growth rates under several trophic conditions and growth capabilities on various organic substrates. The metabolic model was further applied to design a metabolic network to improve the autotrophic production of glycogen and ethanol. Decreased flux of reactions related to the TCA cycle and phosphoenolpyruvate reaction were found to improve glycogen production. Furthermore, in silico knockout simulation indicated that deletion of genes related to the respiratory chain, such as NAD(PH dehydrogenase and cytochrome-c oxidase, could enhance ethanol production by using ammonium as a nitrogen source.

  19. In vitro antioxidant activity assessment on alcoholic extract of cyanobacteria cultures from Spirulina platensis


    Senthilkumaran Jagadeesh J, Jaiganesh K, Somasundaram G


    The antioxidant supplementation such as vitamin C, E, A and beta carotene etc, has proven to prevent the process of ageing caused by free radicals. Antioxidants either prevent free radical production or counteract the impeding damage by doing so they are involved in the protection and prevention of cellular damage which is the common pathway for cancer, aging and much disease. The cyanobacteria is a blue green micro algae believed to be a rich antioxidant source, found in abundance in Spiruli...

  20. Photodynamic effect and mechanism study of selenium-enriched phycocyanin from Spirulina platensis against liver tumours. (United States)

    Liu, Zijian; Fu, Xiang; Huang, Wei; Li, Chunxia; Wang, Xinyan; Huang, Bei


    Selenium-containing phycocyanin (Se-PC) has been proved to have many biological effects, including anti-inflammatory and antioxidant. In this study, we investigated the photodynamic therapy (PDT) effects of Se-PC against liver tumour in vitro and in vivo experiment. Our results demonstrated that the half lethal dose of Se-PC PDT on HepG2 cells was 100μg/ml PC containing 20% selenium. Se-PC location migration from lysosomes to mitochondria was time dependent. In in vivo experiments, the tumour inhibition rate was 75.4% in the Se-PC PDT group, compared to 52.6% in PC PDT group. Histological observations revealed that the tumour cells outside the tissue showed cellular necrosis, and those inside the tissue exhibited apoptotic nuclei and digested vacuoles in the cytoplasm after Se-PC PDT treatment. Antioxidant enzyme analysis indicated that GSH-Px activity was linked to the selenium content of Se-PC, and SOD activity was affected by PC PDT. Therefore, Se-PC PDT could induce cell death through free radical production of PDT in tumours and enhance the activity of antioxidant enzymes with selenium in vivo. The mechanism of Se-PC PDT against liver tumour involves hematocyte damage and mitochondria-mediated apoptosis accompanied with autophagy inhibition during early stage of tumour development, which displayed new prospect and offered relatively safe way for cancer therapy. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. Bioethanol Production by Carbohydrate-Enriched Biomass of Arthrospira (Spirulina) platensis

    DEFF Research Database (Denmark)

    Markou, Giorgos; Angelidaki, Irini; Nerantzis, Elias


    at four concentrations, 2.5 N, 1 N, 0.5 N and 0.25 N, and for each acid concentration the saccharification was conducted under four temperatures (40 °C, 60 °C, 80 °C and 100 °C). Higher acid concentrations gave in general higher reducing sugars (RS) yields (%, gRS/gTotal sugars) with higher rates, while...... the increase in temperature lead to higher rates at lower acid concentration. The hydrolysates then were used as substrate for ethanolic fermentation by a salt stress-adapted Saccharomyces cerevisiae strain. The bioethanol yield (%, gEtOH/gBiomass) was significantly affected by the acid concentration used...

  2. First description of a cyanophage infecting the cyanobacterium Arthrospira platensis (Spirulina)

    Digital Repository Service at National Institute of Oceanography (India)

    Jacquet, S.; Zhong, X.; Parvathi, A.; Ram, A.S.P.

    Cyanobacteria constitute a versatile group of photosynthetic bacteria of immense commercial and ecological importance. Some species of this group are cultivated and sold as food because of their high nutritional value. This is typically the case...

  3. Kandungan Minyak Botryococcus Braunii, Nannochloropsis sp., dan Spirulina Platensis pada Umur yang Berbeda

    Directory of Open Access Journals (Sweden)

    Sri Amini


    cell density was reached by S. platensiswith 8.46 log cell/mL on day 13, while the highest growth rate was shown by S. platensiswith growth rate (k = 9.40 on day 3. The highest yield of oil was obtained from B. brauniion day 9 which was 14.90%.

  4. Promoting Protean Career through Employability Culture and Mentoring: Career Strategies as Moderator (United States)

    Wong, Siew Chin; Mohd Rasdi, Roziah; Abu Samah, Bahaman; Abdul Wahat, Nor Wahiza


    Purpose: The purpose of this paper is to examine the effects of organizational-related variables and the moderating role of career strategies on protean career among employees. Design/methodology/approach: Research data are gathered from a sample of 306 employees in 18 electrical and electronics multinational corporations (MNCs) in Malaysia.…

  5. Expanding and Adapting the Protean Career Management Scale for University Students (PCMS-U). (United States)

    Liberato Borges, Ludmila F; De Andrade, Alexsandro L; Ziebell de Oliveira, Manoela; Guerra, Valeschka Martins


    Many changes in the socioeconomic scenario led to the emergence of different models of career guidance, among which the protean career stands out. This model works with the prospect of a career that is self-directed and aligned with personal values, with important propositions for both professionals and students entering the work market. In the Brazilian scenario, however, there is a lack of appropriate measures to evaluate protean aspects among college students without work experience. Thus, the present study aimed at adapting and validating the attitudes towards the Protean Career Scale to this population. The sample consisted of 902 students aging from 18 to 30 years old (M = 22.52; SD = 6.53) attending 34 different undergraduate courses. Exploratory and confirmatory analysis attested the two-dimensional nature of the scale structure. The reliability indexes were satisfactory: over .65. The correlation between the protean models and factors such as personality, values, and locus of control provided adequate evidence of the measure's predictive validity (p < .05).

  6. Personal Values, Social Capital, and Higher Education Student Career Decidedness: A New "Protean"-Informed Model (United States)

    Fearon, Colm; Nachmias, Stefanos; McLaughlin, Heather; Jackson, Stephen


    This study investigates the role of personal values as motivational antecedents for understanding higher education (HE) student career decidedness among university business school (UBS) students. We propose a new "protean"-informed HE student career decidedness model for theorizing how both personal values and social capital mediators…

  7. Antioxidant activity of the microalga Spirulina maxima

    Directory of Open Access Journals (Sweden)

    M.S. Miranda


    Full Text Available Spirulina maxima, which is used as a food additive, is a microalga rich in protein and other essential nutrients. Spirulina contains phenolic acids, tocopherols and ß-carotene which are known to exhibit antioxidant properties. The aim of the present study was to evaluate the antioxidant capacity of a Spirulina extract. The antioxidant activity of a methanolic extract of Spirulina was determined in vitro and in vivo. The in vitro antioxidant capacity was tested on a brain homogenate incubated with and without the extract at 37oC. The IC50 (concentration which causes a 50% reduction of oxidation of the extract in this system was 0.18 mg/ml. The in vivo antioxidant capacity was evaluated in plasma and liver of animals receiving a daily dose of 5 mg for 2 and 7 weeks. Plasma antioxidant capacity was measured in brain homogenate incubated for 1 h at 37oC. The production of oxidized compounds in liver after 2 h of incubation at 37oC was measured in terms of thiobarbituric acid reactant substances (TBARS in control and experimental groups. Upon treatment, the antioxidant capacity of plasma was 71% for the experimental group and 54% for the control group. Data from liver spontaneous peroxidation studies were not significantly different between groups. The amounts of phenolic acids, a-tocopherol and ß-carotene were determined in Spirulina extracts. The results obtained indicate that Spirulina provides some antioxidant protection for both in vitro and in vivo systems.

  8. Protean and boundaryless career attitudes scales: Spanish translation and validation Protean and boundaryless career attitudes scales: Spanish translation and validation Protean and boundaryless career attitudes scales: Spanish translation and validation

    Directory of Open Access Journals (Sweden)

    Oriol Lordan


    Full Text Available Purpose: The aim of this paper is to translate into Spanish and examine the psychometric properties of the resulting Spanish version of Briscoe, Hall and DeMuth (2006’s Protean and Boundayless Career Attitude Scale, encompassing: Self-Direction, Values-driven predispositions, Boundaryless mindset and Organizational Mobility Preference. Design/methodology/approach: Translation of the Protean and Boundayless Career Attitude Scale was carried out using a back-translation procedure and cognitive interviews were conducted to ensure an accurate interpretation of questionnaire items. The validity and reliability of the scale were evaluated using exploratory factor analysis and Cronbach’s alpha coefficients. Finally, confirmatory factor analysis was performed to evaluate the factor structure of the modified version of the scale, which consists in those items with higher factor loadings.Findings: The reliability coefficients of the modified scale are consistent with those reported by Briscoe et al. (2006. Nevertheless, the values-driven attitudes scale seem to measure two latent traits: strong core beliefs regarding one’s definition of career success and individual emphasis of core personal values through work (reliance on personal values when individual and organizational values do not match.Originality/value: This is the first study which provides a Spanish translation of the Protean and Boundaryless Career Attitude Scale.Purpose: The aim of this paper is to translate into Spanish and examine the psychometric properties of the resulting Spanish version of Briscoe, Hall and DeMuth (2006’s Protean and Boundayless Career Attitude Scale, encompassing: Self-Direction, Values-driven predispositions, Boundaryless mindset and Organizational Mobility Preference.Design/methodology/approach: Translation of the Protean and Boundayless Career Attitude Scale was carried out using a back-translation procedure and cognitive interviews were conducted to


    Directory of Open Access Journals (Sweden)

    Christofera Marliana Junaedi


    Full Text Available It was started by The Great Depression in America that so many changes happened on the organization internally and externally, and the change of career development from career job to protean career as well. Some researchers prove it and state that the job esspecially for career nowadays is different from it was few decades ago. The effect of this changes occur on the system and value that employees have and career development management conducted by the company. This article will discuss the change factor of company internally and externally, its effects,the subtitution of the new paradigm from the old one, and also its implications on the individu and the company. Abstract in Bahasa Indonesia : Berawal dari terjadinya depresi yang besar (The Great Depression di Amerika yang menyebabkan perubahan organisasi secara internal dan eksternal, perubahan pengembangan karir pun bergeser dari karir tradisional menjadi karir protean. Banyak peneliti yang membuktikannya dan menyatakan bahwa karir saat ini berbeda dengan beberapa decade sebelumnya. Dampak dari perubahan ini tentu saja menimbulkan sistem dan nilai yang dimiliki karyawan dan juga manajemen pengembangan karir perusahaan. Artikel ini akan membahas tentang perubahan factor internal dan eksternal organisasi, dampaknya pada perubahan paradigma dari paradigma lama menjadi baru, dan juga implikasinya pada individu dan perusahaan. Kata kunci: karir tradisional, karir protean, paradigma lama, paradigma baru, manajemen karir.

  10. Isolation, characterization and localization of extracellular polymeric substances from the cyanobacterium Arthrospira platensis strain MMG-9

    NARCIS (Netherlands)

    Ahmed, M.; Moerdijk-Poortvliet, T.C.W.; Wijnholds, A.; Stal, L.J.; Hasnain, S.


    Arthrospira platensis is a cyanobacterium known for its nutritional value and secondary metabolites. Extracellular polymeric substances (EPS) are an important trait of most cyanobacteria, including A. platensis. Here, we extracted and analysed different fractions of EPS from a locally isolated

  11. Relationship between protean career orientation and work-life balance: A resource perspective


    Direnzo, Marco S.; Greenhaus, Jeffrey H.; Weer, Christy H.


    The article of record as published may be found at Despite the commonly held belief that a protean career orientation (PCO) enables employees to achieve more balance in their lives, little is known about the relationship between PCO and work-life balance. Using two waves of data collection separated by 2.5 years, this study examined the relationship between PCO and work-life balance among a sample of 367 college-educated employees in the Unite...

  12. Drying Spirulina with Foam Mat Drying at Medium Temperature

    Directory of Open Access Journals (Sweden)

    Aji Prasetyaningrum


    Full Text Available Spirulina is a single cell blue green microalgae (Cyanobacteria containing many Phytonutrients (Beta-carotene, Chlorophyl, Xanthophyl, Phyocianin using as anti-carcinogen in food. Producing dry spirulina by quick drying process at medium temperature is very important to retain the Phytonutrient quality. Currently, the work is still challenging due to the gel formation that block the water diffusion from inside to the surface.  This research studies the performance of foam-mat drying on production of dry spirulina. In this method the spirulina was mixed with foaming agent (glair/egg albumen, popular as white egg at 2.5% by weight at air velocity 2.2 m/sec. Here, the effect of spirulina thickness and operational temperature on drying time and quality (Beta-carotene and color were observed. The drying time was estimated based on the measurement of water content in spirulina versus time. Result showed that the thicker spirulina, the longer drying time. Conversely, the higher operational temperature, faster drying time. At thickness ranging 1-3 mm and operational temperature below 70oC, the quality of spirulina can fit the market requirement

  13. Spirulina maxima Protects Liver From Isoniazid and Rifampicin Drug Toxicity. (United States)

    Jatav, Santosh Kumar; Kulshrestha, Archana; Zacharia, Anish; Singh, Nita; Tejovathi, G; Bisen, P S; Prasad, G B K S


    Hepatotoxicity associated with isoniazid and rifampicin is one of the major impediments in antituberculosis therapy. The present study explored the prophylactic and therapeutic efficacies of Spirulina maxima in isoniazid and rifampicin induced hepatic damage in a rat model. Hepatic damage induced in Wistar rats by isoniazid and rifampicin resulted in significant alterations in biomarkers of liver function, namely, bilirubin, aspartate transaminase, alanine transaminase, alkaline phosphatase, and oxidative stress markers such as superoxide dismutase, catalase, glutathione, and thiobarbituric acid reactive substances. Co-administration of Spirulina maxima along with antituberculosis drugs protected liver from hepatotoxicity due to isoniazid and rifampicin. Administration of Spirulina maxima consecutively for 2 weeks to hepatodamaged animals resulted in restoration of hepatic function as evident from normalization of serum markers of liver function. Thus, the present study revealed remarkable prophylactic and therapeutic potential of Spirulina maxima. Co-administration of Spirulina maxima and antituberculosis drugs is advantageous as it provides extra nutritional benefit. © The Author(s) 2014.

  14. Possible role of Arthrospira platensis in reversing oxidative stress-mediated liver damage in rats exposed to lead. (United States)

    Khalil, Samah R; Elhady, Walaa M; Elewa, Yaser H A; Abd El-Hameed, Noura E; Ali, Sozan A


    Environmental pollutants, particularly metallic elements, mobilized and released into the environment, eventually accumulate in the food chain and thus pose a serious threat to human and animal health. In the present study, the role of Arthrospira (Spirulina platensis; SP) as a protector against oxidative stress-mediated liver damage induced by an exposure to lead acetate (LA; as a metallic pollutant) was assessed. To achieve this aim, rats were orally administered with 300 mg/kg bw SP for 15 days, before and concurrently with an intraperitoneal injection of 50 mg/kg bw LA (6 injections throughout 15 days). As a result, co-administration of SP with LA reduced the amount of lead that accumulated in both blood and liver tissue of the exposed rats and minimized the increased levels of lipid peroxidation, protein oxidation, DNA oxidative damage, and liver enzyme endpoints. In addition, because of SP administration, the levels of depleted biomarkers of antioxidant status and total antioxidant capacity in LA-exposed rats improved. Moreover, SP protected the liver tissue against the changes caused by LA exposure and also decreased the reactivity of HSP70 in the cytoplasm of hepatocytes. Collectively, our data suggest that SP has a potential use as a food supplement in the regions highly polluted with heavy metals such as lead. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  15. Quantitative Isotope-Dilution High-Resolution-Mass-Spectrometry Analysis of Multiple Intracellular Metabolites in Clostridium autoethanogenum with Uniformly 13C-Labeled Standards Derived from Spirulina. (United States)

    Schatschneider, Sarah; Abdelrazig, Salah; Safo, Laudina; Henstra, Anne M; Millat, Thomas; Kim, Dong-Hyun; Winzer, Klaus; Minton, Nigel P; Barrett, David A


    We have investigated the applicability of commercially available lyophilized spirulina ( Arthrospira platensis), a microorganism uniformly labeled with 13 C, as a readily accessible source of multiple 13 C-labeled metabolites suitable as internal standards for the quantitative determination of intracellular bacterial metabolites. Metabolites of interest were analyzed by hydrophilic-interaction liquid chromatography coupled with high-resolution mass spectrometry. Multiple internal standards obtained from uniformly (U)- 13 C-labeled extracts from spirulina were used to enable isotope-dilution mass spectrometry (IDMS) in the identification and quantification of intracellular metabolites. Extraction of the intracellular metabolites of Clostridium autoethanogenum using 2:1:1 chloroform/methanol/water was found to be the optimal method in comparison with freeze-thaw, homogenization, and sonication methods. The limits of quantification were ≤1 μM with excellent linearity for all of the calibration curves ( R 2 ≥ 0.99) for 74 metabolites. The precision and accuracy were found to be within relative standard deviations (RSDs) of 15% for 49 of the metabolites and within RSDs of 20% for all of the metabolites. The method was applied to study the effects of feeding different levels of carbon monoxide (as a carbon source) on the central metabolism and Wood-Ljungdahl pathway of C. autoethanogenum grown in continuous culture over 35 days. Using LC-IDMS with U- 13 C spirulina allowed the successful quantification of 52 metabolites in the samples, including amino acids, carboxylic acids, sugar phosphates, purines, and pyrimidines. The method provided absolute quantitative data on intracellular metabolites that was suitable for computational modeling to understand and optimize the C. autoethanogenum metabolic pathways active in gas fermentation.

  16. Spirulina as a livestock supplement and animal feed. (United States)

    Holman, B W B; Malau-Aduli, A E O


    Spirulina (Athrospira sp.) is an edible microalga and a highly nutritious potential feed resource for many agriculturally important animal species. Research findings have associated Spirulina to improvements in animal growth, fertility, aesthetic and nutritional product quality. Spirulina intake has also been linked to an improvement in animal health and welfare. Its influence over animal development stems from its nutritive and protein-rich composition, thus leading to an increased commercial production to meet consumer demand. Consequently, Spirulina is emerging as a cost-effective means of improving animal productivity for a sustainable and viable food security future. However, our present knowledge of animal response to dietary Spirulina supplementation is relatively scanty and largely unknown. Therefore, the primary objective of this paper was to review past and current findings on the utilisation of Spirulina as a feed supplement and its impact on animal productivity and health. Only animals deemed to be of agricultural significance were investigated; hence, only ruminants, poultry, swine and rabbits and their responses to dietary Spirulina supplementation are covered. © 2012 Blackwell Verlag GmbH.

  17. Health aspects of Spirulina (Arthrospira microalga food supplement

    Directory of Open Access Journals (Sweden)

    Sotiroudis Theodore G.


    Full Text Available Spirulina, now named Arthrospira, is a microscopic and filamentous cyanobacterium that has a long history of use as a safe food lacking toxicity. It is commercially produced in large outdoor ponds under controlled conditions. The aim of this review article is to summarize available recent information concerning human clinical potential and applications of Spirulina, as well as clinical data related to the safety and side effects of Spirulina. Potential health benefits of Spirulina are mainly due to its chemical composition, which includes proteins (the highest protein content of any natural food, 55%-70%, carbohydrates, essential amino acids, minerals (especially iron, essential fatty acids, vitamins, and pigments. In this respect, three major bioactive components of Spirulina, the protein phycocyanin (a biliprotein pigment, sulfated polysaccharides and gamma linolenic acid seem to play significant role in imparting improved human body functions. Furthermore, new experimental evidence supports the immunomodulation and antiviral effects of Spirulina supplementation. According to the Dietary Supplements Information Expert Committee of United States Pharmacopeial Convention the available clinical evidence does not indicate a serious risk to health or other public health concerns for Spirulina. However, a few cases of severe side-effects have been reported.

  18. Biofunctionalized Nanofibers Using Arthrospira (Spirulina Biomass and Biopolymer

    Directory of Open Access Journals (Sweden)

    Michele Greque de Morais


    Full Text Available Electrospun nanofibers composed of polymers have been extensively researched because of their scientific and technical applications. Commercially available polyhydroxybutyrate (PHB and polyhydroxybutyrate-co-valerate (PHB-HV copolymers are good choices for such nanofibers. We used a highly integrated method, by adjusting the properties of the spinning solutions, where the cyanophyte Arthrospira (formally Spirulina was the single source for nanofiber biofunctionalization. We investigated nanofibers using PHB extracted from Spirulina and the bacteria Cupriavidus necator and compared the nanofibers to those made from commercially available PHB and PHB-HV. Our study assessed nanofiber formation and their selected thermal, mechanical, and optical properties. We found that nanofibers produced from Spirulina PHB and biofunctionalized with Spirulina biomass exhibited properties which were equal to or better than nanofibers made with commercially available PHB or PHB-HV. Our methodology is highly promising for nanofiber production and biofunctionalization and can be used in many industrial and life science applications.

  19. Acute phase and transport protein synthesis in simulated infection in undernourished men using uniformly labelled Spirulina Platensis

    International Nuclear Information System (INIS)

    Reeds, P.J.; Opekun, A.; Jahoor, F.; Wong, W.W.; Klein, P.D.


    Although it has been known for many years that injury and infection lead to body nitrogen loss, the reason has remained obscure. In this paper, we develop the argument that the processes that are activated during infection demand the provision of specific amino acids which have to be supplied from body protein. In particular, we show that the positive acute phase proteins are very rich in the aromatic amino acids and the exaggerated use of these amino acids (phenylalanine, tryptophan and tyrosine) in acute phase protein synthesis lead to an endogenous ''amino acid imbalance'' which restricts the use of other amino acids for tissue protein synthesis. Minimally invasive protocols, involving the administration of 15 N and 13 C-labelled amino acids for studying whole body nitrogen turnover, amino acid oxidation and plasma protein synthesis are described. (author). 22 refs, 3 tabs

  20. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis


    Chen, Tianfeng; Yang,Fang; Wong,Ka-Hing; Yang,Yufeng; Li,Xiaoling; Jiang,Jie; Wu,Hualian; Zheng,Wenjie


    Fang Yang,1 Ka-Hing Wong,2 Yufeng Yang,3 Xiaoling Li,1 Jie Jiang,1 Wenjie Zheng,1 Hualian Wu,1 Tianfeng Chen1 1Department of Chemistry, Jinan University, Guangzhou, People’s Republic of China; 2Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong, People’s Republic of China; 3Institute of Hydrobiology, College of Life Science and Technology, Jinan University, Guangzhou, People’s Republic of China Abstract: Tellu...

  1. Influenza type A virus: an outstandingly protean pathogen and a potent modular weapon. (United States)

    Shoham, Dany


    A remarkable debate recently arose on a global scale, about bioethics, biohazard, bioweaponry and bioterrorism issues related to scientific research concerning the induced transition of the highly lethal H5N1 avian flu virus from a non-pandemic to a tentatively pandemic strain, which might fall into malevolent hands. Appreciable ecogenetic complexity marks the main attributes of influenza type A viruses, namely infectivity, virulence, antigenicity, transmissibility, host range, endemicity, and epidemicity. They all shape, conjunctively, the outstanding protean nature of this pathogen, hence the modularity of the latter as a potent weapon. The present analysis inquires into those attributes, so as to profile and gauge threat, usability, impact and coping, particularly that the dimension of genetic engineering of this virus largely amplifies its potential. Within that context, various human interventions and misuses, including human experimental infections, undesirable vaccinations, as well as unauthorized and unskillful operations, led to bad corollaries and are also discussed in the present study. Altogether, a variety of interrelated properties underlying the complicatedness of and menaces posed by influenza A virus as a grave medical challenge, a dually explorable pathogen, and a modular biological warfare agent, are thereby illuminated, alongside with their scientific, strategic and practical implications.

  2. Biomass composition of Arthrospira platensis during cultivation on industrial process water and harvesting

    DEFF Research Database (Denmark)

    Ljubic, Anita; Safafar, Hamed; Holdt, Susan Løvstad


    by optical microscopy showed that microfiltration caused cell rupture at the moderate level while centrifugation had more severe effect on A. platensis. Effect of centrifugal forces and shear stress on A. platensis cells was confirmed by detecting lower lipid content in samples after applying both...... microfiltration and centrifugation due to cell content leakage....

  3. Adsorption of procion red and congo red dyes using microalgae Spirulina sp

    Directory of Open Access Journals (Sweden)

    Risfidian Mohadi


    Full Text Available Adsorption of procion red and congo red dyes using microalgae Spirulina sp was conducted. Spirulina sp was obtained by cultivation and production in laboratory scale. Spirulina sp was used as adsorbent for adsorption of dyes. Adsorption process was studied by kinetic and thermodynamic in order to know the adsorption phenomena. The results showed that kinetically congo red is reactive than procion red on Spirulina sp. On the other hand, thermodynamically procion red was stable than congo red on Spirulina sp which was indicated by adsorption capacity, enthalpy, and entropy.

  4. Protocol optimization for enhanced production of pigments in Spirulina. (United States)

    Kumar, Devendra; Kumar, Neeraj; Pabbi, Sunil; Walia, Suresh; Dhar, Dolly Wattal


    Spirulina has attracted special attention due to its importance as human foodstuff and natural colours with specific functional properties. These functional properties have been attributed to phycobilins, carotenoids, phenolics and unsaturated fatty acids. Present study was conducted under controlled phytotron conditions to identify the efficient strains of Spirulina in terms of pigment synthesis and to optimize their enhanced production. Methodology for enhanced production was standardized by varying specific environmental parameters (light intensity, temperature, carbon dioxide concentration, pH and NaCl level). Different strains of Spirulina depicted variability and environmental parameters showed distinct influence on pigments. Growth and pigment production was recorded to be most efficient under optimized conditions of light intensity (70 μmol m -2  s -1 ), temperature (30 °C), CO 2 concentration (550 ppm and 750 ppm), pH (10.5) and NaCl level (2 g L -1 ).

  5. Measuring System for Growth Control of the Spirulina Aquaculture (United States)

    Ponce S., Claudio; Ponce L., Ernesto; Bernardo S., Barraza


    It describes the workings of a data-logging instrument that measures growth levels of the Spirulina aquaculture. The Spirulina is a very delicate algae and its culture may be suddenly lost due to overgrowth. This kind of instrument is not at present available in the market. The transduction is a submergible laser device whose measuring margin of error is near to 0.28%. The advantage of this new instrument is the improvement in the measurement and the low cost. The future application of this work is related to the industrial production of food and fuel from micro algae culture, for the growing world population.

  6. Studying the Effect of Ionization Radiation of 60Co on the Spirulina (United States)

    Ai, Weidang; Guo, Shuang-Sheng; Ai, Weidang; Dong, Wen-Ping; Qin, Li-Feng; Tang, Yong-Kang

    It studied the effect of ionization radiation on the Spirulina plastensis(No.6) by using the γ-rays of 60 Co. In the experiment, Spirulina were irradiated, and the dose of the ionization radiation covered 0, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0kGy. After irradiating, these Spirulina were cultured under the same conditions. During the course of the experiment, the growth rate, photosynthetic efficiency and nutrition quality of the Spirulina, were analyzed. From the results, low dose of γ-rays (less than 1.5kGy) could improve the content of phycobilin and protein of Spirulina. Only small changes in the morphology of algae filament were found at dose less than 1.0kGy. But with the increase of the dose of γ-rays (more than 1.5kGy), the filaments would break up or even disintegrate. Spirulina had stronger ionization radiation proof and self-rehabilitation capacity, but the growth of Spirulina was stagnated. The LD50 (i.e. the dose resulted in 50% death of the Spirulina) of the colony was 2.0kGy. Considering the capacity of being resistant to γ-rays irradiation, Spirulina can be considered as one of the key biological components in the Controlled Ecological Life Support System (CELSS) for future long-term space missions. Keywords: Controlled Ecological Life Support System (CELSS); Spirulina; ionization radiation; biological component

  7. Traditional career versus self-directed or protean career: a comparative study of satisfaction with career, profession and work

    Directory of Open Access Journals (Sweden)

    Guilherme Assunção de Andrade


    Full Text Available DOI: 10.5007/2175-8077.2011v13n31p58 This research has analyzed if the attitudes and values of news professionals are more adherent to the traditional idea of career or self-directed/protean careers. The objectives were to identify the anchors of respondents’ careers, the degree of satisfaction towards their careers, professions and work and the relationship between these variables and their career profiles. The data collection instrument used was a questionnaire and a sample consisted of 113 graduate and undergraduate students in the area of Administration. As a result, we have found the “Lifestyle” career anchor with the highest average, indicating a tendency to pursue a career that allows integrating personal, family and work lives. We have detected a trend of the subjects to track the protean career. And no correlation was found between career anchors and career satisfaction, indicating that there is not a specific anchor that could provide greater work satisfaction than others. The study contributes to the proposition questions about the career profile that has been used, with the identification of the level of professional satisfaction. Besides it has indicated there should be a revision of the scale of Career Anchors, in order to increase its reliability.

  8. Total lipid accumulation and fatty acid profiles of microalga Spirulina ...

    African Journals Online (AJOL)

    Nutrient limitation in terms of nitrogen and phosphorus increased lipid accumulation under depleted growth in Spirulina strains. Nitrogen limitation was found more effective than phosphorus in accumulating lipid. The fatty acid profile was variable: palmitic (48%), linolenic (21%) and linoleic acids (15%) were the most ...

  9. The radioactivity of spirulina and its heavy elements

    International Nuclear Information System (INIS)

    Fantariandraintsoa, A.A.


    Spirulina is one of the three classes of algae that have the ability to accumulate contaminants from the environment in which they live. The main aim of this work is to study the radioactive contamination of Spirulina using gamma spectrometry and to determine its content of heavy elements using the technique of X-ray fluorescence analysis. Use of detector and Gamma Vision software, in the laboratory of nuclear analysis of the I nstitut National des Sciences et Techniques Nucleaires -Madagascar (INSTN-Madagascar), allowed us to find some amount of radioactive elements such as potassium, lead, thallium and bismuth. The elements found in the laboratory of X-ray fluorescence analysis, of the same institute, using the conventional method along with the XRF AXIL software are calcium, iron, magnesium, bromine, rubidium and strontium as well as heavy elements zinc and copper. Spirulina is rich in potassium, its activity is 98±56 Bq.Kg -1 and the average concentration of the radioactive element is 16.2 g.Kg -1 . Analysis results leads us to say that it is best to consume spirulina from well secured against pollution (greenhouse) culture and we can say that we need to improve crops in natural environments. [fr

  10. Characterization of phycocyanin from Spirulina fusiformis and its thermal stability (United States)

    Munawaroh, H. S. H.; Darojatun, K.; Gumilar, G. G.; Aisyah, S.; Wulandari, A. P.


    Microalgae have some pigments which are potential to be used as functional colorant for foods and cosmetics industries. Here, Spirulina fusiformis is one of the major sources of a blue pigment phycocyanin which has commercial and biotechnological value for biomedical research, as well as a natural colorant for food and cosmetic industries. This study aims at investigating the characteristic of isolated C-phycocyanin from Spirulina fusiformis and its stability under different temperature. A food grade phycocyanin with purity of 2.0 (A620/A280) was obtained successfully from Spirulina fusiformis cultured in seawater-based modified medium and purified by ammonium sulfate precipitation. No significant changes were observed in the spectrum absorbance of C-phycocyanin at temperature up to 60°C over 30 minutes of incubation, and was observed to significantly denaturation at 70°C and higher temperature. Incubation of the pigment at relatively high temperature resulted in a decrease in the spectrum intensities of the C-phycocyanin in a temperature-dependent manner. Taken together, our results suggest that the optimal condition for preserving the stability of food grade phycocyanin isolated from Spirulina fusiformis is taking it at low temperature.

  11. Predictors of Protean Career and the Moderating Role of Career Strategies among Professionals in Malaysian Electrical and Electronics (E & E) Industry (United States)

    Wong, Siew Chin; Mohd Rasdi, Roziah


    Purpose: The purpose of this paper is to examine the effects of individually related variables and the moderating role of career strategies on protean career among professionals in Malaysian Electrical & Electronics (E & E) industry. Design/methodology/approach: Research data were gathered from a sample of 306 of professional employees in…

  12. From malnutrition to HIV: spirulina is an effective solution which continues to reveal its secrets


    Birot, Raphaëlle; Jouvencel, Diane de; Raginel, Laetitia; Rouillé, Geneviève


    Spirulina presents major advantages in the fight against chronic malnutrition based on its micronutrient composition, its health potential and the fact that it can be grown locally. International solidarity associations, such as Antenna Technologies and Entrepreneurs du Monde whose goal is to reduce extreme poverty and public health problems in developing countries, have undertakenproduction and distribution programmes of spirulina, especially in West Africa. The quality of spirulina produced...

  13. Antiviral activity of exopolysaccharides from Arthrospira platensis against koi herpesvirus. (United States)

    Reichert, M; Bergmann, S M; Hwang, J; Buchholz, R; Lindenberger, C


    Although koi herpesvirus (KHV) has a history of causing severe economic losses in common carp and koi farms, there are still no treatments available on the market. Thus, the aim of this study was to test exopolysaccharides (EPS) for its antiviral activity against KHV, by monitoring inhibition and cytotoxic effects in common carp brain cells. These substances can be easily extracted from extracellular algae supernatant and were identified as groups of sulphated polysaccharides. In order to reach this aim, Arthrospira platensis, which is well known for its antiviral activity of intra- and extracellular compounds towards mammalian herpesviruses, was investigated as standard organism and compared to commercial antiviral drug, ganciclovir, which inhibits the viral DNA polymerization. The antiviral activity of polysaccharides of A. platensis against KHV was confirmed in vitro using qualitative assessment of KHV life cycle genes, and it was found by RT-PCR that EPS, applied at a concentration of >18 μg mL -1 and a multiplicity of infection (MOI) of 0.45 of KHV, suppressed the viral replication in common carp brain (CCB) cells even after 22 days post-infection, entirely. Further, this study presents first data indicating an enormous potential using polysaccharides as an additive for aquacultures to lower or hinder the spread of the KHV and koi herpesvirus disease (KHVD) in future. © 2017 John Wiley & Sons Ltd.

  14. A lithium-sensitive and sodium-tolerant 3'-phosphoadenosine-5'-phosphatase encoded by halA from the cyanobacterium Arthrospira platensis is closely related to its counterparts from yeasts and plants. (United States)

    Zhang, Ju-Yuan; Zou, Jie; Bao, Qiyu; Chen, Wen-Li; Wang, Li; Yang, Huanming; Zhang, Cheng-Cai


    3'-Phosphoadenosine-5'-phosphatase (PAPase) is required for the removal of toxic 3'-phosphoadenosine-5'-phosphate (PAP) produced during sulfur assimilation in various eukaryotic organisms. This enzyme is a well-known target of lithium and sodium toxicity and has been used for the production of salt-resistant transgenic plants. In addition, PAPase has also been proposed as a target in the treatment of manic-depressive patients. One gene, halA, which could encode a protein closely related to the PAPases of yeasts and plants, was identified from the cyanobacterium Arthrospira (Spirulina) platensis. Phylogenic analysis indicated that proteins related to PAPases from several cyanobacteria were found in different clades, suggesting multiple origins of PAPases in cyanobacteria. The HalA polypeptide from A. platensis was overproduced in Escherichia coli and used for the characterization of its biochemical properties. HalA was dependent on Mg2+ for its activity and could use PAP or 3'-phosphoadenosine-5'-phosphosulfate as a substrate. HalA is sensitive to Li+ (50% inhibitory concentration [IC50] = 3.6 mM) but only slightly sensitive to Na+ (IC50 = 600 mM). The salt sensitivity of HalA was thus different from that of most of its eukaryotic counterparts, which are much more sensitive to both Li+ and Na+, but was comparable to the PAPase AtAHL (Hal2p-like protein) from Arabidopsis thaliana. The properties of HalA could help us to understand the structure-function relationship underlying the salt sensitivity of PAPases. The expression of halA improved the Li+ tolerance of E. coli, suggesting that the sulfur-assimilating pathway is a likely target of salt toxicity in bacteria as well.

  15. Direct catalytic hydrothermal liquefaction of spirulina to biofuels with hydrogen (United States)

    Zeng, Qin; Liao, Hansheng; Zhou, Shiqin; Li, Qiuping; Wang, Lu; Yu, Zhihao; Jing, Li


    We report herein on acquiring biofuels from direct catalytic hydrothermal liquefaction of spirulina. The component of bio-oil from direct catalytic hydrothermal liquefaction was similar to that from two independent processes (including liquefaction and upgrading of biocrude). However, one step process has higher carbon recovery, due to the less loss of carbons. It was demonstrated that the yield and HHV of bio-oil from direct catalytic algae with hydrothermal condition is higher than that from two independent processes.

  16. Propriedades de saúde de Spirulina spp.

    Directory of Open Access Journals (Sweden)

    M. A. Ambrosi


    Full Text Available

    Espécies de Spirulina têm sido utilizadas mundialmente na alimentação humana e animal, assim como na obtenção de aditivos utilizados em formas farmacêuticas e alimentos. Esta bactéria é uma fonte rica em proteínas, vitaminas, aminoácidos essenciais, minerais, ácidos graxos poliinsaturados e outros nutrientes, sendo seu principal uso como suplemento alimentar. As propriedades nutricionais de Spirulina spp. têm sido relacionadas com possíveis atividades terapêuticas, caracterizando o microrganismo no âmbito dos alimentos funcionais e nutracêuticos. A ação de Spirulina spp. é comprovada a nível experimental ‘in vivo’ e ‘in vitro’, verificandose sua efetividade na inibição da replicação de alguns vírus, na ação citostática e citotóxica no tratamento de câncer, na diminuição dos lipídios e da glicose no sangue e da pressão sangüínea, na redução de peso em obesos, no aumento da população de microrganismos da flora intestinal, na melhoria da resposta imunológica, na proteção renal contra metais pesados e fármacos, além de apresentar atividade rádio - protetora e de ser eficiente na desnutrição, aumentando a absorção de minerais. Dados da literatura permitem concluir que biomassa de Spirulina spp., além de ser um excelente suplemento alimentar, é uma fonte potencial no tratamento de diversas enfermidades, constituindo uma alternativa eficiente para o desenvolvimento de produtos nutracêuticos. Palavras-chave: Spirulina spp.; nutracêutico; câncer; hiperlipidemia; diabetes; desnutrição.

  17. JST Thesaurus Headwords and Synonyms: Arthrospira platensis [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Arthrospira platensis 名詞 一般 * * *... * スピルリナ スピルリナ スピルリナ Thesaurus2015 200906003891090957 C LS06 UNKNOWN_2 Arthrospira platensis

  18. Production of the α and β Subunits of Spirulina Allophycocyanin and C-Phycocyanin in Escherichia coli : A Comparative Study of Their Antioxidant Activities. (United States)

    Cherdkiatikul, Thiti; Suwanwong, Yaneenart


    Allophycocyanin and c-phycocyanin have been reported to be potent antioxidants. In this work, the genes encoding the apo-proteins of allophycocyanin α (ApcA), allophycocyanin β (ApcB), c-phycocyanin α (CpcA), and c-phycocyanin β (CpcB) from Spirulina platensis were cloned, and the recombinant proteins were produced in Escherichia coli to study their antioxidant effects. All four recombinant phycocyanins could be produced in the soluble form and purified to more than 97% purity. The results of radical scavenging assays showed that the Trolox equivalent values for peroxyl radical scavenging by the ApcA, ApcB, CpcA, and CpcB proteins were 1.81 ± 0.2 µM, 1.98 ± 0.22 µM, 0.95 ± 0.15 µM, and 1.49 ± 0.15 µM, respectively. The IC50 values for hydroxyl radical scavenging of ApcA, ApcB, CpcA, CpcB, and Trolox were 269 ± 9 µg/mL, 190 ± 5 µg/mL, 129 ± 8 µg/mL, 108 ± 4 µg/mL, and 195 ± 12 µg/mL, respectively. These results indicated that allophycocyanin exhibited higher activity than c-phycocyanin in scavenging peroxyl radicals, whereas c-phycocyanin exhibited higher activity than allophycocyanin in scavenging hydroxyl radicals. All of the apo-phycocyanin subunits possessed strong antioxidant activities and can be further developed and applied to the food and drug industries. However, the selection of the most useful antioxidant should depend on the type of targeted free radical to obtain the highest efficiency. © 2014 Society for Laboratory Automation and Screening.

  19. A chiral microwave absorbing absorbent of Fe–CoNiP coated on spirulina

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Yonggang, E-mail: [Science and Technology on Electromagnetic Scattering Laboratory, Shanghai, 200438 (China); Yuan, Liming [Science and Technology on Electromagnetic Scattering Laboratory, Shanghai, 200438 (China); Zhang, Deyuan [School of Mechanical Engineering and Automation, Beihang University, Beijing, 100191 (China)


    A chiral bio-absorbent of Fe–CoNiP coated on the spirulina was fabricated by the electroless and chemical vapor decomposition. The scanning electron microscopy (SEM) was used to evaluate the spirulina cells particle morphology. X-ray diffraction (XRD) patterns were done to analyze the particle crystal grain structure. The permittivity and permeability was measured by a vector network analyzer in frequency 8–18 GHz, and the reflection loss (RL) was calculated. The results showed the carbonyl iron particles (CIPs) and CoNiP were bonded to the spirulina surface, the permittivity and permeability could be enlarged as Fe films coated on the particles compared with the CoNiP spirulina, it was attributed to the excellent electromagnetic property of CIPs. The chiral Fe–CoNiP composites had a better absorbing property at 8–18 GHz than the CoNiP spirulina composite, the RL was −16.26 dB at 10.48 GHz, the absorbing band was 9.5–11.5 GHz of RL less than −10 dB, which indicated the Fe–CoNiP spirulina could be an effective absorbent used in 8–18 GHz. - Highlights: • Absorbers filled with Fe–CoNiP coating on the spirulina were fabricated. • The permittivity and permeability increased as CIPs coated. • The Fe material enhanced the electromagnetic property. • The spirulina coated Fe–CoNiP was effective in 8–18 GHz.

  20. Proteome-wide analysis and diel proteomic profiling of the cyanobacterium Arthrospira platensis PCC 8005.

    Directory of Open Access Journals (Sweden)

    Sabine Matallana-Surget

    Full Text Available The filamentous cyanobacterium Arthrospira platensis has a long history of use as a food supply and it has been used by the European Space Agency in the MELiSSA project, an artificial microecosystem which supports life during long-term manned space missions. This study assesses progress in the field of cyanobacterial shotgun proteomics and light/dark diurnal cycles by focusing on Arthrospira platensis. Several fractionation workflows including gel-free and gel-based protein/peptide fractionation procedures were used and combined with LC-MS/MS analysis, enabling the overall identification of 1306 proteins, which represents 21% coverage of the theoretical proteome. A total of 30 proteins were found to be significantly differentially regulated under light/dark growth transition. Interestingly, most of the proteins showing differential abundance were related to photosynthesis, the Calvin cycle and translation processes. A novel aspect and major achievement of this work is the successful improvement of the cyanobacterial proteome coverage using a 3D LC-MS/MS approach, based on an immobilized metal affinity chromatography, a suitable tool that enabled us to eliminate the most abundant protein, the allophycocyanin. We also demonstrated that cell growth follows a light/dark cycle in A. platensis. This preliminary proteomic study has highlighted new characteristics of the Arthrospira platensis proteome in terms of diurnal regulation.

  1. Protective effects of Spirulina maxima on hyperlipidemia and oxidative-stress induced by lead acetate in the liver and kidney. (United States)

    Ponce-Canchihuamán, Johny C; Pérez-Méndez, Oscar; Hernández-Muñoz, Rolando; Torres-Durán, Patricia V; Juárez-Oropeza, Marco A


    Oxidative damage has been proposed as a possible mechanism involved in lead toxicity, specially affecting the liver and kidney. Previous studies have shown the antioxidant effect of Spirulina maxima in several experimental models of oxidative stress. The current study was carried out to evaluate the antioxidant activity of Spirulina maxima against lead acetate-induced hyperlipidemia and oxidative damage in the liver and kidney of male rats. Control animals were fed on a standard diet and did not receive lead acetate (Control group). Experimental animals were fed on a standard laboratory diet with or without Spirulina maxima 5% in the standard laboratory diet and treated with three doses of lead acetate (25 mg each/weekly, intraperitoneal injection) (lead acetate with Spirulina, and lead acetate without Spirulina groups). The results showed that Spirulina maxima prevented the lead acetate-induced significant changes on plasma and liver lipid levels and on the antioxidant status of the liver and kidney. On the other hand, Spirulina maxima succeeded to improve the biochemical parameters of the liver and kidney towards the normal values of the Control group. It was concluded that Spirulina maxima has protective effects on lead acetate-induced damage, and that the effects are associated with the antioxidant effect of Spirulina.

  2. Use of rotifers for the maintenance of monoalgal mass cultures of Spirulina

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, S.A.; Richmond, A.


    Zooplankton was successfully used for the biological control of unicellular algal contaminants in Spirulina mass cultures even under conditions adverse to the growth of Spirulina (maximal winter daily temperature of approximately 10 degrees C and very low bicarbonate concentration). Brachionus plicatilis (Rotifera) was the most successful species of zooplankton used. The interrelationships between Spirulina, green unicellular contaminant, and B. plicatilis were studied under various conditions. Two species of unicellular contaminant were used; Monoraphidium minutum was isolated from local cultures and Chlorella vulgaris, obtained from contaminated Spirulina cultures in Israel. The rotifer B. plicatilis successfully controlled the population size of both contaminants whether they were introduced in a single addition or as a daily dose. The biological control of the unicellular contaminants allows Spirulina to be cultured in a medium low in bicarbonate, thereby reducing the cost of the medium and increasing the quantity of CO2 that may be freely absorbed from the atmosphere at the optimal pH for Spirulina cultivation. (Refs. 9).

  3. Optimization of formulation and processing of Moringa oleifera and spirulina complex tablets. (United States)

    Zheng, Yi; Zhu, Fan; Lin, Dan; Wu, Jun; Zhou, Yichao; Mark, Bohn


    Objective: To prepare a more comprehensive nutrition, more balanced proportion of natural nutritional supplement tablets with Moringa oleifera leaves and spirulina the two nutrients which have complementary natural food ingredients. Method: On the basis of research M. oleifera leaves with spirulina nutrient composition was determined on M. oleifera leaves and spirulina ratio of raw materials, and the choice of microcrystalline cellulose, sodium salt of caboxy methyl cellulose(CMC),magnesium stearate excipient, through single factor and orthogonal experiment, selecting the best formula tablets prepared by powder direct compression technology, for preparation of M. oleifera and spirulina complex tablets. Results: The best ratio of raw material for the M. oleifera leaves powder: spirulina powder was 7:3, the best raw materials for the tablet formulation was 88.5%, 8.0% microcrystalline cellulose, CMC 2.0%, stearin magnesium 1.5%, the optimum parameters for the raw material crushing 200-300 mesh particle size, moisture content of 7%, tableting pressure 40 kN. Conclusion: Through formulation and process optimization, we can prepare more comprehensive and balanced nutrition M. oleifera and spirulina complex tablets, its sheet-shaped appearance, piece weight variation, hardness, friability, disintegration and other indicators have reached the appropriate quality requirements.

  4. Isolation and characterization of oxygen-evolving photosystem II particles and photosystem II core complex from the filamentous cyanobacterium Spirulina platensis

    Czech Academy of Sciences Publication Activity Database

    Šetlíková, Eva; Sofrová, D.; Kovář, V.; Budáč, Petr


    Roč. 51, č. 4 (2013), s. 517-530 ISSN 0300-3604 R&D Projects: GA ČR GA206/08/1683; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : antibodies * fluorescence spectra * IMAC chromatography Subject RIV: EE - Microbiology, Virology Impact factor: 1.007, year: 2013

  5. Spirulina chitosan gel induction on healing process of Cavia cobaya post extraction socket

    Directory of Open Access Journals (Sweden)

    Rostiny Rostiny


    Full Text Available Background: Prominent residual ridge is necessary to gain retention and stabilility for succesful prosthodontic treatment such as removable, fixed or implant. Spirulina is a natural substance that can help tissue healing and chitosan also a natural substance that reported to have the ability to help bone remodelling. The combination gel of spirulina and chitosan could be considered as an alternative material to maintain residual ridge height after tooth extraction. Purpose: The aim of study was to examine the effect of combination gel of Spirulina and chitosan on healing process of Cavia cobaya post tooth extraction socket by counting the amount of osteoclast, osteoblast and colagen as an indicator. Methods: Twenty eight cavia cobaya were divided into 4 groups. Insisive mandible extraction was done and the sockets were filled with 3% CMCNa for control groups, 3% spirulina chitosan 200 mg for group 1, 6% spirulina chitosan 200 mg for group 2, 12% spirulina chitosan 200 mg for group 3. After 30 days, histopathology examination was done by using microscope to count the amount of osteoclast, osteoblast and collagen. Results: Data was analyzed by using Anova and Tukey HSD. For osteoclast, there was no significant different between every groups, while for osteoblast and collagen there was significant different between groups. The results showed that induction of combination gel spirulina chitosan was able to accumulate collagen fiber and resulting faster wound healing. Conclusion: Combination 12% gel spirulina chitosan 200 mg could be used as an alternative material for better bone remodeling after tooth extraction.Latar belakang: Residual ridge yang prominen sangat dibutuhkan untuk mendapatkan retensi dan stabilitas untuk menunjang keberhasilan perawatan di bidang prostodonsia seperti pada kasus removable, fixed atau implant. Tindakan pencabutan gigi dapat merusak jaringan periodontal, sementum dan tulang alveolar yang mengakibatkan resorbsi ridge

  6. Extraction of Nutraceuticals from Spirulina (Blue-Green Alga): A Bioorganic Chemistry Practice Using Thin-layer Chromatography (United States)

    Herrera Bravo de Laguna, Irma; Toledo Marante, Francisco J.; Luna-Freire, Kristerson R.; Mioso, Roberto


    Spirulina is a blue-green alga (cyanobacteria) with high nutritive value. This work provides an innovative and original approach to the consideration of a bioorganic chemistry practice, using Spirulina for the separation of phytochemicals with nutraceutical characteristics via thin-layer chromatography (TLC) plates. The aim is to bring together…

  7. Improving oxidative stability of olive oil: Incorporation of Spirulina and evaluation of its synergism with citric acid

    International Nuclear Information System (INIS)

    Alavi, N.; Golmakani, M.T.


    The effects of different Spirulina concentrations used alone and in combination with citric acid on the oxidative stability of olive oil were assessed. The amounts of primary and secondary oxidation products produced in Spirulina samples were lower than that of the control. The improved oxidative stability indices of Spirulina samples with and without citric acid were in the range of 85.20–94.47% and 258.10–260.21%, respectively. In comparison with the control, Spirulina samples manifested significantly higher carotenoid and chlorophyll contents at the beginning and end of the storage period. The presence of these bioactive compounds results from the presence of Spirulina in the medium and can thus retard the oxidation of olive oil. A higher oxidative stability was reached using BHT in comparison with Spirulina samples. Furthermore, no synergistic action was observed in possible connections between citric acid and Spirulina. In conclusion, Spirulina can enhance oxidative stability and improve the shelf life of olive oil. [es

  8. Nutritional comparison of Spirulina sp powder by solid-state fermentation using Aspergillus sp (FNCL 6088) and Lactobacillus plantarum (FNCL 0127) (United States)

    Dewi, E. N.; Amalia, U.


    The Spirulina sp powder contains high levels of protein and Solid-State Fermentation (SSF) improved protein level. The aims of the study was to find the proximate contents in Spirulina sp’s powder fermentation. The experiments were conducted by SSF of Spirulina sp’s powder using fungi Aspergillus sp (FNCL 6088) and lactic acid bacteria Lactobacillus plantarum (FNCL 0127). SSF was carried out for 10 days at 35% moisture level. The protein contents of Spirulina sp’s powder fermented by L. plantarum were consistently lower (p fermentation. The Spirulina sp fermented products contained the highest level of protein after 6 days.

  9. Consumption of an aqueous cyanophyta extract derived from Arthrospira platensis is associated with reduction of chronic pain: results from two human clinical pilot studies

    Directory of Open Access Journals (Sweden)

    Jensen GS


    Full Text Available Gitte S Jensen,1 Victoria L Attridge,1 Steve G Carter,1 Jesse Guthrie,2 Axel Ehmann,2 Kathleen F Benson1 1NIS Labs, 2Cerule LLC, Klamath Falls, OR, USA Objectives: The aim of this study was to evaluate the effects of consumption of an aqueous cyanophyta extract (ACE from Arthrospira platensis on chronic pain in humans, in two clinical pilot studies. Design and interventions: The two pilot studies each involved 12 subjects experiencing chronic pain. The initial study followed an open-label 4-week study design involving consumption of 1 g ACE per day. A subsequent placebo-controlled, single-blind, crossover study involved consumption of 500 mg ACE, 250 mg ACE, or 0 mg ACE (placebo per day for 1-week duration, separated by 1-week washout period. Subjects: Adult subjects of both sexes, with chronic joint-related pain for at least 6 months prior to enrollment, were recruited after obtaining written informed consent. Outcome measures: Visual analog scales were used to score pain at rest and during physical activity for each person's primary and secondary areas of chronic pain. An activities of daily living questionnaire was used to collect data on physical functioning. Results: The data showed rapid reduction of chronic pain in people consuming ACE, where the reduction in pain scores for each person's primary pain area reached a high level of statistical significance after 2 weeks of consumption (P<0.01, both when at rest and when being physically active. Secondary pain areas when physically active showed highly significant improvements within 1 week of consumption of 1 g/d (P<0.001 and borderline significant improvements within 1 week of consuming 500 mg/d (P<0.065 and 250 mg/d (P<0.05. This was accompanied by an increased ability to perform daily activities (P<0.05. A small but significant weight loss was observed during the 4-week study, as the average body mass index dropped from 31.4 to 29.4 (P<0.01. Conclusion: Consumption of ACE was associated

  10. Spirulina exhibits hepatoprotective effects against lead induced oxidative injury in newborn rats. (United States)

    Gargouri, M; Ben Saad, H; Ben Amara, I; Magné, C; El Feki, A


    Lead is a toxic metal that induces a wide range of biochemical and physiological effects. The present investigation was designed at evaluating the toxic effects of a prenatal exposure to lead of mothers on hepatic tissue of newborn rats, and potent protective effects of spirulina. Female rats were randomly divided into 4 groups which were given a normal diet (control),a diet enriched with spirulina (S), lead acetate administered through drinking water (Pb), or a diet enriched with spirulina and lead contaminated water (S Pb), respectively. The duration of treatments was from the 5th day of gestation to 14 days postpartum. Lead toxicity was assessed by measuring body and liver weights, blood and stomach lead levels, hepatic DNA, RNA and protein amounts, blood enzyme activities (AST and ALT), as well as lipid peroxidation level and activities of antioxidant enzymes in hepatic tissues of neonates. Lead intoxication of mothers caused reduction of liver weight as well as of hepatic DNA, mRNA and protein levels in newborns. Moreover, oxidative stress and changes in antioxidant enzyme activities were recorded. Conversely, supplementation of mothers with spirulina mitigated these effects induced by lead. These results substantiated the potential hepatoprotective and antioxidant activity of spirulina.

  11. Development of a Spirulina Extract/Alginate-Imbedded PCL Nanofibrous Cosmetic Patch. (United States)

    Byeon, Seon Yeong; Cho, Myung Kwon; Shim, Kyou Hee; Kim, Hye Jin; Song, Hyeon Gi; Shin, Hwa Sung


    Cosmetic patches have recently been developed as skin products for personal care owing to rapid advances in the technology of delivery of active ingredients, moisture, and adhesiveness to skin. Alginate and Spirulina are typical marine resources used in cosmetic products. This research involved the development of a Spirulina extract-impregnated alginate nanofiber cosmetic patch supported by a polycaprolactone (PCL) nanofiber cover ( Spi /Alg-PCL NF patch). In addition to the ability of alginate to affect moisture and adhesiveness to skin, the impregnation of Spirulina extract strengthened those abilities as well as its own bioactive effectiveness. All fabrication processing steps were undertaken in aqueous solution. The three components (alginate, Spirulina extract, and PCL) had no detected cytotoxicity in human keratinocyte cell-based examination. In addition, wetting the pre-dried patch on the skin resulted in the Spirulina extract being released within 30 min. The results indicate the excellence of the Spi /Alg-PCL NF patch as a skin-care cosmetic device.

  12. Effect of Spirulina addition on the physicochemical and structural properties of extruded snacks

    Directory of Open Access Journals (Sweden)

    Bárbara Franco LUCAS

    Full Text Available Abstract Nowadays the demand for practical food like snacks increases worldwide, however the nutritional value in most these formulations is reduced. Due to its chemical composition with high protein concentration, the microalga Spirulina has been used on the production of enriched foods. The present study aimed to evaluate the effects of Spirulina sp. LEB 18 addition on snacks formulations and extrusion conditions on the physicochemical and structural properties of snacks. Protein concentration and physical properties such as expansion index, bulk density, hardness, water absorption index, water solubility index and color were determined. The results showed that the addition of Spirulina sp. LEB 18, temperature in the last zone of the extruder and feed moisture influenced the product responses. The increase in feed moisture increased the hardness, bulk density and water absorption index of the snacks. Higher concentrations of microalga produced snacks with higher protein content, total color difference (ΔE and compact structure. The addition of 2.6% Spirulina produced snacks with up to 11.3% protein and with adequate physical and structural properties for consumption. Thus, snacks containing Spirulina are an alternative to the demand for healthy food of practical consumption.

  13. Effect of humic acids on the growth and the biochemical composition of Arthrospira platensis

    Directory of Open Access Journals (Sweden)

    Massiel Vanessa Rivera Gonzalez


    Full Text Available The purpose of this research was to evaluate the effect of three concentrations of humic acids (HA 1, 10, 100 mg/L against a concentration of indole acetic acid (IAA on production of biomass, pigments, proteins, carbohydrates and lipids of A. platensis.  Cultures discontinuous in Zarrouk 25% medium supplemented with HA and IAA under conditions of aeration constant and photoperiod from 12:12 hours, during 30 days were made. It was found that the maximum biomass production was higher in the culture supplemented with 10 mg / L of AH, compared to the control and cultures supplemented with AIA. In the same way the highest production of pigments, proteins and carbohydrates were observed in this treatment. Therefore, the growth and production of metabolites of A. platensis was increased, which makes it possible to observe the potential use of these substances as organic biological stimulants.

  14. Managing Protean Diversity

    DEFF Research Database (Denmark)

    Marfelt, Mikkel Mouritz; Muhr, Sara Louise


    Recently, global workforce diversity and its management have received criticism for not paying attention to the contextual influence stemming from socially constructed dialectics of power and politics. These contextual dynamics, however, tend to be viewed as external to the organization....... In this article, we follow the call for critically investigating the contexts influencing diversity management by analyzing the development of a global human resource management project initiated to promote a culturally diverse workforce. We find that despite good intentions, as well as support from the top...... management, the project dissolves through micropolitics and power dynamics. We contribute to the critical literature on workforce diversity by identifying how organizational contextual dynamics influence the way the concept of workforce diversity is constructed and understood at work. Based on these findings...

  15. Nutritional control of antibiotic production by Streptomyces platensis MA7327: importance of L-aspartic acid


    Falzone, Maria; Crespo, Emmanuel; Jones, Klarissa; Khan, Gulaba; Korn, Victoria L; Patel, Amreen; Patel, Mira; Patel, Krishnaben; Perkins, Carrie; Siddiqui, Sana; Stenger, Drew; Yu, Eileen; Gelber, Michael; Scheffler, Robert; Nayda, Vasyl


    Streptomyces platensis MA7327 is a bacterium producing interesting antibiotics, which act by the novel mechanism of inhibiting fatty acid biosynthesis. The antibiotics produced by this actinomycete are platensimycin and platencin plus some minor related antibiotics. Platensimycin and platencin have activity against antibiotic-resistant bacteria such as methicillin-resistant Staphylococcus aureus and vancomycin-resistant Enterococcus; they also lack toxicity in animal models. Platensimycin als...

  16. Deodorization of Arthrospira platensis biomass for further scale-up food applications. (United States)

    Cuellar-Bermúdez, Sara P; Barba-Davila, Bertha; Serna-Saldivar, Sergio O; Parra-Saldivar, Roberto; Rodriguez-Rodriguez, José; Morales-Davila, Sandra; Goiris, Koen; Muylaert, Koenraad; Chuck-Hernández, Cristina


    Given the importance of A. platensis as a potential food protein source, we describe an affordable deodorization process that does not significantly affect the nutritional value of algae biomass. Ethanol, acetone or hexane were used to deodorize algae biomass and then to identify the profile of volatile compounds associated with its distinctive odor. Sensorial characteristics were improved in the biomass cake after the proposed solvent extraction. Panelists identified the ethanolic extract with the most pronounced algae-related odor. Gas chromatography-mass spectrometry analysis showed that a mixture of 20 different compounds derived from fatty acids and amino acids contributed to the characteristic smell of A. platensis biomass. The results of the present study show that the ethanol solvent-free A. platensis biomass contained > 600 g kg -1 protein,  65% in vitro protein digestibility, similar to the original biomass. The Fourier transform infrared spectroscopy secondary protein structure was comparable among samples, indicating that the only change after ethanol extraction was a reduction of the algae smell. The various extraction procedures investigated in the present study were effective in deodorizing the algae biomass. The most effective protocol was the removal of odoriferous compounds with ethanol. This particular procedure yielded an algae biomass with an improved sensorial traits. The results of the present study should help with the identification of odoriferous compounds derived from fatty acids, pigments and proteins associated with A. platensis. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  17. Performance of the mixed LED light quality on the growth and energy efficiency of Arthrospira platensis. (United States)

    Mao, Ruixin; Guo, Shuangsheng


    The effect of mixed light quality with red, blue, and green LED lamps on the growth of Arthrospira platensis was studied, so as to lay the theoretical and technical basis for establishing a photo-bioreactor lighting system for application in space. Meanwhile, indexes, like morphology, growth rate, photosynthetic pigment compositions, energy efficiency, and main nutritional components, were measured respectively. The results showed that the blue light combined with red light could decrease the tightness of filament, and the effect of green light was opposite. The combination of blue light or green light with red light induced the filaments to get shorter in length. The 8R2B treatment could promote the growth of Arthrospira platensis significantly, and its dry weight reached 1.36 g L -1 , which was 25.93% higher than the control. What's more, 8R2B treatment had the highest contents of carbohydrate and lipid, while 8R2G was rich in protein. 8R0.5G1.5B had the highest efficiency of biomass production, which was 161.53 mg L -1  kW -1  h -1 . Therefore, the combination of red and blue light is more conducive to the growth of Arthrospira platensis, and a higher biomass production and energy utilization efficiency can be achieved simultaneously under the mixed light quality with the ratio of 8R0.5G1.5B.

  18. Use of extracts from oyster shell and soil for cultivation of Spirulina maxima. (United States)

    Jung, Joo-Young; Kim, Sunmin; Lee, Hansol; Kim, Kyochan; Kim, Woong; Park, Min S; Kwon, Jong-Hee; Yang, Ji-Won


    Calcium ion and trace metals play important roles in various metabolisms of photosynthetic organisms. In this study, simple methods were developed to extract calcium ion and micronutrients from oyster shell and common soil, and the prepared extracts were tested as a replacement of the corresponding chemicals that are essential for growth of microalgae. The oyster shell and soil were treated with 0.1 M sodium hydroxide or with 10 % hydrogen peroxide, respectively. The potential application of these natural sources to cultivation was investigated with Spirulina maxima. When compared to standard Zarrouk medium, the Spirulina maxima cultivated in a modified Zarrouk media with elements from oyster shell and soil extract exhibited increases in biomass, chlorophyll, and phycocyanin by 17, 16, and 64 %, respectively. These results indicate that the extracts of oyster shell and soil provide sufficient amounts of calcium and trace metals for successful cultivation of Spirulina maxima.

  19. Antioxidant effects of Spirulina supplement against lead acetate-induced hepatic injury in rats

    Directory of Open Access Journals (Sweden)

    Walid Hamdy El-Tantawy


    Full Text Available Lead is a toxic metal that induces a wide range of behavioral, biochemical and physiological effects in humans. Oxidative damage has been proposed as a possible mechanism involved in lead toxicity. The current study was carried out to evaluate the antioxidant activities of Spirulina supplement against lead acetate -induced hepatic injury in rats. Five groups of rats were used in this study, Control, Lead acetate (100 mg/kg, Lead acetate (100 mg/kg + 0.5 g/kg Spirulina, Lead acetate (100 mg/kg + 1 g/kg Spirulina and Lead acetate + 25 mg/100 g Vitamin C (reference drug. All experimental groups received the oral treatment by stomach tube once daily for 4 weeks. Lead intoxication resulted in a significant increase in serum alanine transaminae (ALT, aspartate transaminae (AST activities, liver homogenate tumor necrosis factor-α (TNF-α, caspase-3, malondialdehyde (MDA, nitric oxide (NO levels and a significant decline of total serum protein, liver homogenate reduced glutathione (GSH level and superoxide dismutase (SOD activity. Both doses of Spirulina supplement as well as Vitamin C succeeded to improve the biochemical parameters of serum and liver and prevented the lead acetate-induced significant changes on plasma and antioxidant status of the liver. Both doses of Spirulina supplement had the same anti-apoptotic activity and high dose exhibited more antioxidant activity than that of low dose. In conclusion, the results of the present work revealed that Spirulina supplement had protective, antioxidant and anti-apoptotic effects on lead acetate-induced hepatic damage.

  20. Cultivation of Spirulina maxima in medium supplemented with sugarcane vinasse. (United States)

    Dos Santos, Raquel Rezende; Araújo, Ofélia de Queiroz Fernandes; de Medeiros, José Luiz; Chaloub, Ricardo Moreira


    The feasibility of sugarcane vinasse as supplement in growth medium of Spirulina maxima was investigated. The cell was cultivated under autotrophic (no vinasse, 70 μmol photons m(-2) s(-1)), heterotrophic (no light, culture medium supplemented with vinasse at 0.1% v/v and 1.0% v/v) and mixotrophic conditions (70 μmol photons m(-2) s(-1), vinasse at 0.1% v/v and 1.0% v/v). These preliminary results suggested a cyclic two-stage cultivation - CTSC, with autotrophic condition during light phase of the photoperiod (12 h, 70-200 μmol photons m(-2) s(-1)) and heterotrophic condition during dark phase (12h, 3.0% v/v vinasse). The adopted CTSC strategy consisted in three cycles with 75% withdrawal of suspension and reposition of medium containing 3.0% v/v vinasse, separated by autotrophic rest periods of few days between cycles. Results show an increase of biomass concentration between 0.495 g L(-1) and 0.609 g L(-1) at the 7th day of each cycle and high protein content (between 74.3% and 77.3% w/w). Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Can Spirulina maxima reduce the mutagenic potential of sibutramine? (United States)

    Araldi, R P; Santos, N P; Mendes, T B; Carvalho, L B; Ito, E T; de-Sá-Júnior, P L; Souza, E B


    The worldwide obesity pandemic requires the use of anti-obesity drugs. Sibutramine is an anti-obesity drug that has been used worldwide but is indiscriminately consumed in Brazil. Several studies have demonstrated that sibutramine promotes weight loss and weight maintenance, but several side effects have been associated with its systematic consumption. For this reason, sibutramine was withdrawn from the European and American markets, but still remains legal for use in Brazil. Studies have shown that a 5-10% reduction in body weight results in outstanding health benefits for obese patients. However, in order to promote significant weight loss, it is necessary to use sibutramine for at least 2 years. This long-term exposure has carcinogenic potential, as sibutramine causes DNA damage. Thus, this study evaluated the in vivo mutagenic potential of sibutramine alone (5, 7, 10, 15, and 20 mg/kg) and in association with Spirulina maxima (150 and 300 mg/kg), a cyanobacterium with antioxidant potential, using the polychromatic erythrocyte micronucleus test. Our results reinforced the mutagenic potential of sibutramine alone, which showed a time-dependent action. Combinatory treatments with S. maxima were not able to reduce the genotoxicity of sibutramine. These results were confirmed in vitro with the cytokinesis-blocked micronucleus test. In conclusion, our data showed that new alternative anti-obesity treatments are needed since the consumption of sibutramine can increase the risk of cancer in overweight patients.

  2. Spirulina Protects against Hepatic Inflammation in Aging: An Effect Related to the Modulation of the Gut Microbiota?

    Directory of Open Access Journals (Sweden)

    Audrey M. Neyrinck


    Full Text Available Aging predisposes to hepatic dysfunction and inflammation that can contribute to the development of non-alcoholic fatty liver disease. Spirulina, a cyanobacterium used as a food additive or food supplement, has been shown to impact immune function. We have tested the potential hepatoprotective effect of a Spirulina in aged mice and to determine whether these effects can be related to a modulation of the gut microbiota. Old mice have been fed a standard diet supplemented with or without 5% Spirulina for six weeks. Among several changes of gut microbiota composition, an increase in Roseburia and Lactobacillus proportions occurs upon Spirulina treatment. Interestingly, parameters related to the innate immunity are upregulated in the small intestine of Spirulina-treated mice. Furthermore, the supplementation with Spirulina reduces several hepatic inflammatory and oxidative stress markers that are upregulated in old mice versus young mice. We conclude that the oral administration of a Spirulina is able to modulate the gut microbiota and to activate the immune system in the gut, a mechanism that may be involved in the improvement of the hepatic inflammation in aged mice. Those data open the way to new therapeutic tools in the management of immune alterations in aging, based on gut microbe-host interactions.

  3. Prebiotic competence of spirulina on the production performance of broiler chickens

    Directory of Open Access Journals (Sweden)

    A.B.M. Rawshon Jamil


    Full Text Available The study was conducted to evaluate the prebiotic effects of Spirulina as a growth and immunity promoter for broiler chickens. Birds (n=100 were randomly and equally distributed into four groups (T0, T1, T2 and T3 and fed on a diet containing 0, 2, 4 and 8 g Spirulina/kg feed respectively for 4 weeks. The body weight was significantly (P<0.05 increased in the treatment groups fed with Spirulina diet from 7th days to 28th days old. FCR was also significantly (P<0.05 decreased among the treatment groups. Hematological parameters were significantly (P<0.05 increased except ESR which was decreased significantly (P<0.05 in the treatment group. Aspartate aminotransferase (ALT and alanine aminotransferase (AST level were significantly (P<0.05 decreased in all the treatment groups. The study suggests that, Spirulina is a good natural feed additive which has a tremendous effect to improve the broiler production and thereby may reduce the production cost. [J Adv Vet Anim Res 2015; 2(3.000: 304-309

  4. Biological Effects of Spirulina (Arthrospira Biopolymers and Biomass in the Development of Nanostructured Scaffolds

    Directory of Open Access Journals (Sweden)

    Michele Greque de Morais


    Full Text Available Spirulina is produced from pure cultures of the photosynthetic prokaryotic cyanobacteria Arthrospira. For many years research centers throughout the world have studied its application in various scientific fields, especially in foods and medicine. The biomass produced from Spirulina cultivation contains a variety of biocompounds, including biopeptides, biopolymers, carbohydrates, essential fatty acids, minerals, oligoelements, and sterols. Some of these compounds are bioactive and have anti-inflammatory, antibacterial, antioxidant, and antifungal properties. These compounds can be used in tissue engineering, the interdisciplinary field that combines techniques from cell science, engineering, and materials science and which has grown in importance over the past few decades. Spirulina biomass can be used to produce polyhydroxyalkanoates (PHAs, biopolymers that can substitute synthetic polymers in the construction of engineered extracellular matrices (scaffolds for use in tissue cultures or bioactive molecule construction. This review describes the development of nanostructured scaffolds based on biopolymers extracted from microalgae and biomass from Spirulina production. These scaffolds have the potential to encourage cell growth while reducing the risk of organ or tissue rejection.

  5. Dynamics of gonadal development of Aegla platensis Schmitt (Decapoda, Anomura, Aeglidae Dinâmica do desenvolvimento gonadal de Aegla platensis Schmitt (Decapoda, Anomura, Aeglidae

    Directory of Open Access Journals (Sweden)

    Carolina C. Sokolowicz


    Full Text Available One way to estimate gonadal development through the reproductive cycle is to observe the growth of the gonads related to the organs used to store energy. The aim of this study was to follow the gonadosomatic and hepatosomatic indexes during annual cycle of Aegla platensis Schmitt, 1942. Adult animals were collected in Taquara, Rio Grande do Sul, Brazil (29°46'S, 50°53'W. Males and females were initially weighed and dissected and had their gonads and hepatopancreas (HP removed and weighed in order to estimate the Gonadosomatic (GI and hepatosomatic (HI indexes. In females, the indexes were also compared to the degree of development of the ovaries. In males the GI showed a peak of gonadal development in the autumn (p Uma maneira de estimar o desenvolvimento gonadal ao longo do ciclo reprodutivo é observar o crescimento das gônadas em relação aos órgãos utilizados para o estoque de energia. O objetivo desse estudo foi acompanhar os índices gonadossomático e hepatossomático durante o ciclo reprodutivo de Aegla platensis Schmitt, 1942. Animais adultos foram coletados em Taquara, Rio Grande do Sul, Brasil (29°46'S, 50°53'W. Machos e fêmeas foram pesados e dissecados, gônadas e hepatopâncreas (HP foram retirados e pesados para obtenção dos índices gonadossomático (IG e hepatossomático (IH. Nas fêmeas, os índices também foram comparados com o grau de desenvolvimento dos ovários. Nos machos o IG mostrou um pico de desenvolvimento gonadal no outono (p < 0,05, quando os valores do IH diminuíram (p < 0,05. Fêmeas mostraram um aumento do IG no final do verão e início do outono (p < 0,05 e os valores do IG aumentaram à medida que o ovário tornava-se maduro. Em A. platensis, tanto nos machos como nas fêmeas, os valores do IH nunca mostraram valores mais baixos que o IG, o que pode indicar que esses aeglídeos apresentam um padrão de utilização de energia diferente dos outros decápodos, onde à medida que o desenvolvimento

  6. C-phycocyanin extraction assisted by pulsed electric field from Artrosphira platensis. (United States)

    Martínez, Juan Manuel; Luengo, Elisa; Saldaña, Guillermo; Álvarez, Ignacio; Raso, Javier


    This paper assesses the application of pulsed electric fields (PEF) to the fresh biomass of Artrhospira platensis in order to enhance the extraction of C-phycocyanin into aqueous media. Electroporation of A. platensis depended on both electric field strength and treatment duration. The minimum electric field intensity for detecting C-phycocyanin in the extraction medium was 15kV/cm after the application of a treatment time 150μs (50 pulses of 3μs). However higher electric field strength were required when shorter treatment times were applied. Response surface methodology was used in order to investigate the influence of electric field strength (15-25kV/cm), treatment time (60-150μs), and temperature of application of PEF (10-40°C) on C-phycocyanin extraction yield (PEY). The increment of the temperature PEF treatment reduced the electric field strength and the treatment time required to obtain a given PEY and, consequently decreased the total specific energy delivered by the treatment. For example, the increment of temperature from 10°C to 40°C permitted to reduce the electric field strength required to extract 100mg/g d w of C-phycocyanin from 25 to 18kV/cm, and the specific energy input from 106.7 to 67.5kJ/Kg. Results obtained in this investigation demonstrated PEF's potential for selectively extraction C-phycocyanin from fresh A. platensis biomass. The purity of the C-phycocyanin extract obtained from the electroporated cells was higher than that obtained using other techniques based on the cell complete destruction. Copyright © 2016 Elsevier Ltd. All rights reserved.



    Md. Anzar Alam*, Nafis Haider , Shamim Ahmed , Md. Tanwir Alam and Abdul Azeez


    : Antioxidants are substances that may protect cells from the damage caused by unstable molecules known as free radicals; free radicals damage may lead to cancer and other diseases. Some of the example of antioxidants are like β-carotene, lycopene, Vit. C, E & A and other substances which are found in variety of fruits, vegetables, algae (spirulina) & other medicinal plants. Spirulina (Blue green algae) is a microscopic single cell alga which grows in fresh water and has a simple structure bu...

  8. Antioxidative effect of Arthrospira platensis biomass on the lipid oxidation| Efeito antioxidante da biomassa de Arthrospira platensis sobre a oxidação lipídica

    Directory of Open Access Journals (Sweden)

    Dayane Meireles de Souza


    Full Text Available Introduction: Cyanobacteria are promising natural sources of antioxidants. Environmental conditions that influence synthesis of substances in cultures of cyanobacteria have been studied. Objective: This investigation aimed to evaluate the antioxidative effect of Arthrospira platensis biomass on the process of lipid oxidation in bulk oil and oil/water emulsion. Method: Arthrospira platensis growth potential for antioxidant production under different cultivation conditions using an experimental design. The antioxidative effect of the methanolic extracts and the biomass on preventing lipid oxidation was measured by peroxide value (PV. Results: The results showed that the growing conditions to obtain the biomass promoted change in the protective ability of different biomass extracts. Extracts obtained from the cultivated biomass grown under 150 μmol photons/m2s-1, 1.875 g.L-1 NaNO3; 13.5 g.L-1 NaHCO3 (assay14 and 50 μmol photons/m2s-1, 2.5 g.L-1 NaNO3; 18.0 g.L-1 NaHCO3 (standard showed the most antioxidative effect on preventing lipid oxidation, therefore used in the formulation of mayonnaise. The mayonnaise made with soybean oil and 0.5% biomass was preserved against lipid photodegradation during seven days of storage, but the peroxide value related to control varied from 2.9 to 3.1 mEqO2.Kg-1, with no significant difference in the preservation afforded by tert-butilhydroquinone, in the same period of storage. In mayonnaise made with sunflower oil, biomass, independent of concentration, was unable to protect the product against photooxidation. Conclusions: The results demonstrate the protective ability on preventing lipid oxidation of Arthrospira platensis biomass and its potential for use in food lipid-based of soybean oil. ============================================== Introdução: Cianobactérias são promissoras fontes naturais de antioxidantes. Condições ambientais que influenciam síntese de substâncias em cultivos de cianobact

  9. New evidences on the presence of Stegomastodon platensis Ameghino, 1888, Proboscidea: Gomphotheriidae, in the Late Pleistocene of Central Chile

    Energy Technology Data Exchange (ETDEWEB)

    Labarca, R.; Alberdi, M.T.; Prado, J.L.; Mansilla, P.; Mourgues, F.A.


    This paper contextualizes, describes and taxonomically assigned cranial and dental Gomphotheriidae materials from the El Trebal 1, late Pleistocene form central Chile. Starting from metric and morphological variables fossils are included in Stegomastodon platensis. Taxonomic implications of this finding as well as some regional paleoenvironmental history are discussed. (Author)

  10. Bacterias halotolerantes/alcalofilas productoras de acido indol acético (AIA asociadas a Arthrospira platensis (Cyanophyceae

    Directory of Open Access Journals (Sweden)

    Liliana Cecilia Gómez Gómez


    Full Text Available Título en ingles: Halotolerant alkalophilic and indolacetic acid producing acid producing bacteria associated with Arthrospira platensis (Cyanophyceae Resumen: Este trabajo tuvo como propósito contribuir al conocimiento de la interacción entre la cianobacteria alcalófila Arthrospira platensis y las bacterias que crecen asociadas a su mucilago. Se desarrolló un  medio de cultivo heterotrófico en el cual se aislaron cinco cepas bacterianas asociadas a un monocultivo de A. platensis. Se determinó la capacidad de estas cinco cepas para producir ácido 3- indol acético (AIA. La tipificación molecular de los aislamientos bacterianos permitió identificarlos como Exiguobacterium aurantiacum str. DSM 20416, Xanthomonas sp. ML-122, Halomonas sp. Ap-5, Bacillus okhensis str.  Kh10-101, Indibacter alkaliphilus, type str. LW1T; todas las cepas bacterianas obtenidas  son halotolerantes, alcalófilas y productoras de AIA. Los resultados aportan evidencia para sugerir una interacción benéfica entre A. platensis y sus bacterias asociadas,  quizá como estrategia evolutiva  de cooperación para desarrollarse en  un ambiente hipersalino.    Palabras claves: Bacillus okhensis, Exiguobacterium aurantiacum, Halomonas sp., Indibacter alkaliphilus. Xanthomonas sp. Abstract: The aim of this study was contribute to knowledge over alkalophilic cianobacteryum  Arthrospira platensis  and their  interaction with some associated bacteria growing in their mucilage. Heterotrophic culture medium was designed, in this medium were isolated five bacterial strains associated to single culture of A. platensis. It was measured the 3-indol acetic acid (IAA production by these bacterial strains. Molecular typing allowed identify these bacterial strains like Exiguobacterium aurantiacum str. DSM 20416, Xanthomonas sp. ML-122, Halomonas sp. Ap-5, Bacillus okhensis str. Kh10-101, Indibacter alkaliphilus, type str. LW1T; all these bacteria are halotolerant

  11. Isolation and antibacterial activity of anabaena phycocyanin

    African Journals Online (AJOL)



    Apr 10, 2013 ... (Yoshida et al., 1996) due to their antioxidant and anti- inflammatory ... studies indicated that phycocyanin from spirulina have obvious curative effect on .... phycocyanin from spirulina platensis using expanded bed adsorption.

  12. Biomass of Spirulina maxima enriched by biosorption process as a new feed supplement for swine. (United States)

    Saeid, A; Chojnacka, K; Korczyński, M; Korniewicz, D; Dobrzański, Z


    This paper deals with the new mineral feed additives with Cu produced in a biosorption process from a semi-technical scale. The natural biomass of edible microalga Spirulina sp. was enriched with Cu(II) and then used as a mineral supplement in feeding experiments on swine to assess its nutrition properties. A total of 24 piglets divided into two groups (control and experimental) were used to determine the bioavailability of a new generation of mineral feed additives based on Spirulina maxima . The control group was feed using traditional inorganic supplements of microelements, while the experimental group was fed with the feed containing the biomass of S. maxima enriched with Cu by biosorption. The apparent absorption was 30 % ( P  maxima -is a promising alternative to currently used inorganic salts as the source of nutritionally important microelements.

  13. Production of Generation-2 Mekong giant catfish (Pangasinodon gigas cultured with Spirulina sp.

    Directory of Open Access Journals (Sweden)

    Kriangsak Meng-umphan


    Full Text Available The purpose of this study is to evaluate the treatment of Spirulina-supplemented pellet feed to 5-year-old F1 groups of Mekong giant catfish (Pangasinodon gigas from the brood stock and intended for use as breeders. The effects on their growth and maturation when cultured in an earthen pond were observed. Results revealed that, compared to control, there was more gain in weight while the feed conversion ratio was lower. The number of red blood cells was also higher while that of white blood cells was lower, compared to control. Out of 18 treated fish (9 males and 9 females, 6 males and 2 females gave sperms and eggs while none from control group did. It was concluded that Spirulina supplemented in pellet feed can improve growth and maturation performance to the brood stock of Mekong giant catfish.

  14. Growth performance and nutrition value of Spirulina sp. under different photoperiod

    Directory of Open Access Journals (Sweden)

    Tatag Budiardi


    Full Text Available This study was conducted to analyze the production of freshwater Spirulina sp. cultured with photoperiod manipulation treatment. In this study, photoperiod manipulation treatment performed on cultured spirulina using fiber tanks (100 L. Spirulina was grown with different photoperiod (bright/T and dark/G that are six hours per day (6T-18G, 12 hours per day (12T-12G, 18 hours per day (18T-6G, and 24 hours per day (24L-0G. The parameters were observed include dry biomass, population density (N, specific growth rate (SGR, doubling time (G, proximate analysis, and water quality. The results of this study showed that the optimum population density was achieved on day-3 days of cultured, and manipulation photoperiod showed no significant effect to the dry biomass harvest and population density, but significantly affect the specific growth rate and doubling time. Treatment of lighting 12, 18 and 24 hours per day to produce the maximum specific growth rate (0,345 to 0,366 per day and a maximum doubling time (1,89 to 2,01 days were not significantly different, whereas the old treatment six hours per day lighting showed the lowest maximum growth rate (0,323 per day and highest doubling time (2,15 days. At treatment of lighting 12 hours per day, relatively higher protein content (39,73% than others. In conclusion, the lighting 12 hours per day resulted in optimum production efficiency than other treatments.Keywords: Spirulina sp., photoperiod, density, biomass, growth, nutrition value. ABSTRAKPenelitian ini dilakukan untuk menganalisis produksi spirulina Spirulina sp. air tawar yang dikultur dengan manipulasi fotoperiode.  Dalam penelitian ini, spirulina dikultur dalam wadah fiber 100 L dengan perlakuan fotoperiode (terang/T dan gelap/G berbeda, yaitu enam jam per hari (6T-18G, 12 jam per hari (12T-12G, 18 jam per hari (18T-6G, dan 24 jam per hari (24T-0G. Parameter yang diamati meliputi biomassa kering, kepadatan populasi (N, laju pertumbuhan spesifik

  15. Spirulina sp. LEB-18 culture using effluent from the anaerobic digestion

    Directory of Open Access Journals (Sweden)

    J. A. Borges


    Full Text Available The carbon source is the most expensive nutrient for Spirulina production; effluents from anaerobic digestion contain this nutrient in the form of HCO3-. The aim of this study was to assess the growth kinetics, composition and fatty acid profile of Spirulina sp. LEB-18 grown in standard Zarrouk medium (NaHCO3 16.8 g L-1 and in Zarrouk medium replaced with 20% (v/v effluent with reduced concentrations of NaHCO3 (5.3 and 2.8 g L-1. The use of effluent and lower concentrations of HCO3 was found to be an alternative to reduce the costs of Spirulina production, because there were no significant differences in growth parameters (µmax 0.324 - 0.354 d-1; Pmax 0.280 - 0.297 g L-1 d-1, in the different culture medium used. Lipids ranged between 4.9 and 5.0%; the media with effluent had higher levels of linoleic acid compared to the standard medium.

  16. Biological CO2 mitigation from coal power plant by Chlorella fusca and Spirulina sp. (United States)

    Duarte, Jessica Hartwig; de Morais, Etiele Greque; Radmann, Elisângela Martha; Costa, Jorge Alberto Vieira


    CO 2 biofixation by microalgae and cyanobacteria is an environmentally sustainable way to mitigate coal burn gas emissions. In this work the microalga Chlorella fusca LEB 111 and the cyanobacteria Spirulina sp. LEB 18 were cultivated using CO 2 from coal flue gas as a carbon source. The intermittent flue gas injection in the cultures enable the cells growth and CO 2 biofixation by these microorganisms. The Chlorella fusca isolated from a coal power plant could fix 2.6 times more CO 2 than Spirulina sp. The maximum daily CO 2 from coal flue gas biofixation was obtained with Chlorella fusca (360.12±0.27mgL -1 d -1 ), showing a specific growth rate of 0.17±<0.01d -1 . The results demonstrated the Chlorella fusca LEB 111 and Spirulina sp. LEB 18 potential to fix CO 2 from coal flue gas, and sequential biomass production with different biotechnological destinations. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Protective Role of Spirulina on Gamma Rays Induced Haematological and Biochemical Disorders in Mice

    International Nuclear Information System (INIS)

    Ibrahim, R.M.; Kamal El-Dein, E.M.


    The present study reports the haematological and biochemical protective effect of Salipriina on Swiss albino mice exposed to gamma radiation. Swiss albino mice (8 weeks old) were administered intraperitoneally Sanepil (800 mg/kg b.wt.) prior to whole body gamma-irradiation (7.5 Gy). Radiation exposure resulted in a significant decline in different bone marrow cells (pro-and normoblasts) and blood constituents (erythrocytes, leukocytes, differential leukocyte count, haematocrit,haemoglobin and erythrocyte sedimentation rate). Pro- and normoblasts, erythrocytes, leukocytes, haematocrit and haemoglobin values showed a significant (p<0.05) decline during the first 3 days, followed by a gradual recovery starting from day 7, but normal values were not recorded until 14 days post-exposure. Treatment of mice with Spirulina also caused a significant decrease in malondialdehyde (MDA) formation in the liver, suggesting its role in protection against radiation induced membrane and cellular damage. Similarly, pretreatment of mice with Spirulina caused a significant increase in serum glutathione (GSH) level in comparison with that of irradiated animals. Results suggest that Spirulina modulate the radiation induced hematological and biochemical alterations in Swiss albino mice

  18. Biosorption of Microelements by Spirulina: Towards Technology of Mineral Feed Supplements (United States)

    Chojnacka, Katarzyna


    Surface characterization and metal ion adsorption properties of Spirulina sp. and Spirulina maxima were verified by various instrumental techniques. FTIR spectroscopy and potentiometric titration were used for qualitative and quantitative determination of metal ion-binding groups. Comparative FTIR spectra of natural and Cu(II)-treated biomass proved involvement of both phosphoryl and sulfone groups in metal ions sorption. The potentiometric titration data analysis provided the best fit with the model assuming the presence of three types of surface functional groups and the carboxyl group as the major binding site. The mechanism of metal ions biosorption was investigated by comparing the results from multielemental analyses by ICP-OES and SEM-EDX. Biosorption of Cu(II), Mn(II), Zn(II), and Co(II) ions by lyophilized Spirulina sp. was performed to determine the metal affinity relationships for single- and multicomponent systems. Obtained results showed the replacement of naturally bound ions: Na(I), K(I), or Ca(II) with sorbed metal ions in a descending order of Mn(II) > Cu(II) > Zn(II) > Co(II) for single- and Cu(II) > Mn(II) > Co(II) > Zn(II) for multicomponent systems, respectively. Surface elemental composition of natural and metal-loaded material was determined both by ICP-OES and SEM-EDX analysis, showing relatively high value of correlation coefficient between the concentration of Na(I) ions in algal biomass. PMID:25386594

  19. Hallazgo de Triatoma platensis Neiva, 1913 (Hemiptera, Triatominae en el estado brasileño de "Rio Grande do Sul" Finding of Triatoma platensis Neiva, 1913 (Hemiptera, Triatominae in the Brazilian State of "Rio Grande do Sul"

    Directory of Open Access Journals (Sweden)

    Roberto Salvatella


    Full Text Available Triatoma platensis Neiva 1913 (Hemiptera, Triatominae, especie ornitófila, con área de dispersión conocida en Argentina, Bolivia, Paraguay y Uruguay es notificada en un primer registro para Brasil. Hallada en el municipio de Uruguaiana (Río Grande do Sul en nidos de Anumbius annumbi (Vieillot, 1817 (Passeriformes, Furnariidae donde cohabitaba con cricétidos de la especie Orizomys flavescens. Ningún ejemplar de los siete colectados se presentó infectado por Trypanosoma cruzi.Triatoma platensis, an ornitophilic species, found in Argentina, Bolivia, Paraguay and Uruguay is reported for the first time in Brazil. It was found in the county of Uruguaiana (Rio Grande do Sul in nests of Anumbius annumbi (Vieillot, 1817 (Passeriformes, Furnariidae where it cohabited with cricetids belonging to the species Orizomys flavescens. None of the seven individuals collected were infected by Trypanosoma cruzi.

  20. Experimental and modelling of Arthrospira platensis cultivation in open raceway ponds. (United States)

    Ranganathan, Panneerselvam; Amal, J C; Savithri, S; Haridas, Ajith


    In this study, the growth of Arthrospira platensis was studied in an open raceway pond. Furthermore, dynamic model for algae growth and CFD modelling of hydrodynamics in open raceway pond were developed. The dynamic behaviour of the algal system was developed by solving mass balance equations of various components, considering light intensity and gas-liquid mass transfer. A CFD modelling of the hydrodynamics of open raceway pond was developed by solving mass and momentum balance equations of the liquid medium. The prediction of algae concentration from the dynamic model was compared with the experimental data. The hydrodynamic behaviour of the open raceway pond was compared with the literature data for model validation. The model predictions match the experimental findings. Furthermore, the hydrodynamic behaviour and residence time distribution in our small raceway pond were predicted. These models can serve as a tool to assess the pond performance criteria. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Supercritical Carbon Dioxide and Microwave-Assisted Extraction of Functional Lipophilic Compounds from Arthrospira platensis

    Directory of Open Access Journals (Sweden)

    Diego A. Esquivel-Hernández


    Full Text Available Arthrospira platensis biomass was used in order to obtain functional lipophilic compounds through green extraction technologies such as supercritical carbon dioxide fluid extraction (SFE and microwave-assisted extraction (MAE. The temperature (T factor was evaluated for MAE, while for SFE, pressure (P, temperature (T, and co-solvent (ethanol (CS were evaluated. The maximum extraction yield of the obtained oleoresin was (4.07% ± 0.14% and (4.27% ± 0.10% for SFE and MAE, respectively. Extracts were characterized by gas chromatography mass spectrometry (GC-MS and gas chromatography flame ionization detector (GC-FID. The maximum contents of functional lipophilic compounds in the SFE and MAE extracts were: for carotenoids 283 ± 0.10 μg/g and 629 ± 0.13 μg/g, respectively; for tocopherols 5.01 ± 0.05 μg/g and 2.46 ± 0.09 μg/g, respectively; and for fatty acids 34.76 ± 0.08 mg/g and 15.88 ± 0.06 mg/g, respectively. In conclusion, the SFE process at P 450 bar, T 60 °C and CS 53.33% of CO2 produced the highest yield of tocopherols, carotenoids and fatty acids. The MAE process at 400 W and 50 °C gives the best extracts in terms of tocopherols and carotenoids. For yield and fatty acids, the MAE process at 400 W and 70 °C produced the highest values. Both SFE and MAE showed to be suitable green extraction technologies for obtaining functional lipophilic compounds from Arthrospira platensis.

  2. Effect of spirulina food supplement on blood morphological parameters, biochemical composition and on the immune function of sportsmen

    Directory of Open Access Journals (Sweden)

    K Milasius


    Full Text Available Of highest biological value are natural concentrates of optimally combined substances produced by nature. One of food supplements of this kind is dietary Spirulina produced by the Tianshi firm (China. It is a most rationally balanced food supplement of a high biological value; it satisfies the needs of the whole body, including its immune system. The aim of the current work was to assess the effect of the multicomponent natural food supplement Spirulina on the physical development, blood morphological, biochemical picture and immune function of sportsmen. Materials and Methods: The study cohort comprised 12 high performance sportsmen (age 20-22 years. They were using tablets of Spirulina, a dietary product for 14 days. Physical development was determined with the aid of standard methods. The general blood picture was analyzed with the aid of a Micros-60 hematological analyzer (company ABX DIAGNOSTICS, France. Lymphocytes and their subsets were analysed by flow cytometery (FACSCalibur, Becton Dickinson Immunocytometry Systems (BDIS, USA and the absolute and percentage values were calculated. To evaluate immune function lymphocyte blasttransformation response to mitogens was studied. Results: Investigations carried out on endurance-training sportsmen showed that a 14-d administration of Spirulina exerted a positive effect on blood morphological composition indices and its biochemical changes. The results of our study confirm the positive effect of Spirulina food supplement on the quantitative parameters of immune system. Part of the study cohort after weeks showed a tendency of normalizing CD3 , CD3 CD4 lympocite count: positive changes were still present two weeks following the interruption of Spirulina intake

  3. Spirulina does not decrease muscle damage nor oxdidative stress in cycling athletes with adequate nutritional status

    Directory of Open Access Journals (Sweden)

    G.A.M. Franca


    Full Text Available The objective of this study was to assess the effect of Spirulina maxima on oxidative stress and muscle damage in cycling athletes subjected to high volume and intensity of training. Eighteen male athletes were randomly divided into an experimental group (n=11 with age 27.8±3.5 and placebo (n=7 with age 34.3±2.3 in a double-blind fashion. They carried out a protocol of Spirulina dietary supplementation (7.5 g/day of placebo for four weeks and maintained their trainings during this period. A nutritional anamnesis was performed and blood tests were done to determine pre and post levels of creatine kinase (CK, lactic dehydrogenase (LHD, superoxide dismutase (SOD and malondialdehyde (MDA. The supplemented and placebo groups performed the same volume training, has adequate macronutrients and antioxidant vitamins ingestion before study, as well as initial CK, LDH, SOD and MDA levels. Supplementation did not promote a significant alteration in CK levels on supplemented group (158.4±16.3 for 140.0±16.6 U/l, p>0.05, LDH (420±13.2 for 394.9±27.9 UI/l, p>0.05, MDA (2.8±0.2 for 2.9±0.4 nmol/ml, p>0.05, nor an increase in the SOD (7.3±0.6 for 7.0±0.6 U/mg Hb, p>0.05. We conclude that administration of Spirulina does not interfere in the magnitude of muscle damage nor in antioxidant status of cycling athletes that practice intense training.

  4. Inspiration fuels space research in Congo. Combating malnutrition with Spirulina, the green protein source

    International Nuclear Information System (INIS)


    In Congo, around 43% of all children under the age of five suffer from chronic malnutrition. The result is a high infant mortality rate./ Researchers from the Belgian Nuclear research Center SCK•CEN started working on the cultivation of spirulina, a type of algae rich in vitamins and minerals that are essential for combating chronic malnutrition in children. This Inspiration project is the first in a series and signals the ambition of SCK•CEN to contribute towards a balanced and sustainable world.

  5. The effects of nitrogen deficiencies on the lipid and protein contents ...

    African Journals Online (AJOL)

    Nitrogen deficiencies were studied in Spirulina platensis (Cyanophyceae) with the aim of determining the effects of the 50 and 100% deficient nitrogen on the lipid and protein contents of the cell under laboratory conditions. S. platensis cultures were grown in Spirulina medium and kept at the constant room temperature of ...

  6. Studies on the water quality and biota of a tidal eutrophic creek ...

    African Journals Online (AJOL)

    ... E.monodon, Navicula gracilis, N. mutica, Ulnariaulna, Nitzschia palea, Pinnularia braunii, P. gibba, Microcystis aeruginosa and Spirulina platensis. Of the 15 mudflat algae Nitzschia palea, Pinnularia braunii, P. gibba and Spirulina platensis were environmentally important species. The population of the benthic fauna was ...

  7. Influence of desalinator wastewater for the cultivation of Arthrospira platensis. Fatty acids profile

    Directory of Open Access Journals (Sweden)

    Volkmann, Harriet


    Full Text Available The need for a desalination processes in northeastern Brazil is due to the salinity of its water sources. However, these processes produce residues with high saline concentrations and a significant environmental impact. These wastewaters can be used for Arthrospira platensis cultivation. This work aimed to cultivate Arthrospira platensis in three different media: Paoletti Synthetic Medium (PSM, Salinated Water Medium (SWM and Desalinator Wastewater Médium (DWWM. Microalgae were cultivated under controlled conditions, in 4 L photobioreactors, 30±1°C, 12 hours of light/dark photoperiod provided by fluorescent lamps at a light intensity of 140 μmol• m–2•s–1 and constant bubbling of air (0.5 L•L–1 •min–1. The effect of different media on cell concentration, productivity, total content of lipids and fatty acids profile was verified. Higher cell concentration, as well as higher productivity was observed in DWWM: 4.954 (±0.554 g•L–1 and 0.225 (±0.042 g•L–1 •day–1, respectively. Concerning total lipids, the contents of 4.54% and 4.69% were observed in DWWM and SWM, respectively. High levels of saturated fatty acids were observed in both treatments. Concerning γ-linolenic acid, the contents of 13.09% (DWWM and 11.95% (SWM were found.En la región nordeste de Brasil, debido a la elevada salinidad de los acuíferos, existe la necesidad de utilizar procesos de desalación. Sin embargo, estos procesos generan residuos con alta concentración salina, con significativo impacto ambiental. El objetivo de este trabajo fue el cultivo de Arthrospira platensis en tres medios de cultivo diferentes: medio de Paoletti, medio de agua salinizada y medio de agua de desecho obtenida en el proceso de desalación de acuíferos. Las microalgas fueron cultivadas en laboratorio, con condiciones controladas, en fotobiorreactores de 4 L, a 30±1°C y periodos de 12 horas de claridad/oscuridad con iluminación de 140 μmol•m–2•s–1 e

  8. SOILS, FERTILIZATION AND MANAGEMENT OF WATER Halotolerant/alkalophilic bacteria associated with the cyanobacterium Arthrospira platensis (Nordstedt Gomont that promote early growth in Sorghum bicolor (L. Moench

    Directory of Open Access Journals (Sweden)

    Liliana Gómez G


    Full Text Available Arthrospira platensis associated bacteria (APAB identified through molecuar biology like Bacillus okhensis, Indibacter alkaliphilus and Halomonas sp., are also producing 3-indol acetic acid (IAA, these bacteria was used in early plant growth promotion tests over Sorghum bicolor, these bioassay was considered indirect evidence to suggest that APAB also may have stimulatory effects over A. platensis growth naturally. I. alkaliphilus and B. okhensis enhanced early germination of S. bicolor seads, with better results than that achieved by Azospirillum brasilense, bacterium used like reference as a common plant growth promoting rizobacteria. The three APAB enhanced significative differences (P≤0.05 over morphoagronomic parameters, I. alkaliphilus and B. okhensis exhibith better resoults in elongation stimulation and root and foliage dry weight. Above evidence suggest this bacteria like plant growth promoting and it recomended testing with A. platensis axenic cultures and its associated bactteri for understanding true interaction between them.

  9. Induction of ovarian growth in Aegla platensis (Crustacea, Aeglidae by means of neuroregulators incorporated to food

    Directory of Open Access Journals (Sweden)

    Alejandra V Cahansky


    Full Text Available The freshwater crab Aegla platensis was used as a model to induce ovarian growth by adding different neuroregulators to a pellet food formulation. Added compounds were the dopaminergic inhibitor spiperone or the enkephalinergic inhibitor naloxone, both of them at a dose of 10-8 mol/animal. Animals were fed on the enriched pellets twice a week. After 7 wk, the gonadosomatic index (GI was calculated as (gonad fresh weight / body fresh weight x 100. GI significantly increased only for those females fed on spiperone pellets, compared to a control group receiving pellets with no compound added. During the assayed period, spiperone would be reverting the arrest exerted by dopamine on the neuroendocrine stimulation of ovarian growth. On the other hand, for both spiperone and naloxone a higher GI was correlated to a higher lipid content of both gonads and/or hepatopancreas, suggesting an increased energetic demand in accordance with an active investment in reproduction. Rev. Biol. Trop. 56 (3: 1201-1207. Epub 2008 September 30.Se utilizó al anomuro de agua dulce Aegla platensis como modelo para inducir el crecimiento ovárico mediante el agregado de diferentes neuroreguladores a una formulación de alimento pelleteado. Los compuestos agregados fueron el inhibidor dopaminergico spiperona ó el inhibidor encefalinérgico naloxone, ambos a una dosis de 10-8 moles/animal. Los animales fueron alimentados dos veces a la semana con pellets enriquecidos con alguno de los neuroreguladores. Luego de 7 semanas, se calculó el índice gonadomático (IG como (peso gonadal fresco/ peso corporal fresco x 100. El IG mostró un incremento significativamente sólo en aquellas hembras alimentadas con pellets enriquecidos con spiperona, en comparación con un grupo control que recibió pellets sin agregado alguno. Durante el período ensayado, la spiperona estaría revirtiendo el arresto ejercido por la dopamina sobre la estimulación neuroendocrina del crecimiento ov

  10. Anaerobic digestion of the microalga Spirulina at extreme alkaline conditions: biogas production, metagenome, and metatranscriptome (United States)

    Nolla-Ardèvol, Vímac; Strous, Marc; Tegetmeyer, Halina E.


    A haloalkaline anaerobic microbial community obtained from soda lake sediments was used to inoculate anaerobic reactors for the production of methane rich biogas. The microalga Spirulina was successfully digested by the haloalkaline microbial consortium at alkaline conditions (pH 10, 2.0 M Na+). Continuous biogas production was observed and the obtained biogas was rich in methane, up to 96%. Alkaline medium acted as a CO2 scrubber which resulted in low amounts of CO2 and no traces of H2S in the produced biogas. A hydraulic retention time (HRT) of 15 days and 0.25 g Spirulina L−1 day−1 organic loading rate (OLR) were identified as the optimal operational parameters. Metagenomic and metatranscriptomic analysis showed that the hydrolysis of the supplied substrate was mainly carried out by Bacteroidetes of the “ML635J-40 aquatic group” while the hydrogenotrophic pathway was the main producer of methane in a methanogenic community dominated by Methanocalculus. PMID:26157422

  11. Antioxidant Effect of Spirulina (Arthrospira) maxima on Chronic Inflammation Induced by Freund's Complete Adjuvant in Rats. (United States)

    Gutiérrez-Rebolledo, Gabriel Alfonso; Galar-Martínez, Marcela; García-Rodríguez, Rosa Virginia; Chamorro-Cevallos, Germán A; Hernández-Reyes, Ana Gabriela; Martínez-Galero, Elizdath


    One of the major mechanisms in the pathogenesis of chronic inflammation is the excessive production of reactive oxygen and reactive nitrogen species, and therefore, oxidative stress. Spirulina (Arthrospira) maxima has marked antioxidant activity in vivo and in vitro, as well as anti-inflammatory activity in certain experimental models, the latter activity being mediated probably by the antioxidant activity of this cyanobacterium. In the present study, chronic inflammation was induced through injection of Freund's complete adjuvant (CFA) in rats treated daily with Spirulina (Arthrospira) maxima for 2 weeks beginning on day 14. Joint diameter, body temperature, and motor capacity were assessed each week. On days 0 and 28, total and differential leukocyte counts and serum oxidative damage were determined, the latter by assessing lipid peroxidation and protein carbonyl content. At the end of the study, oxidative damage to joints was likewise evaluated. Results show that S. maxima favors increased mobility, as well as body temperature regulation, and a number of circulating leukocytes, lymphocytes, and monocytes in specimens with CFA-induced chronic inflammation and also protects against oxidative damage in joint tissue as well as serum. In conclusion, the protection afforded by S. maxima against development of chronic inflammation is due to its antioxidant activity.

  12. Biodiesel production from microalgae Spirulina maxima by two step process: Optimization of process variable

    Directory of Open Access Journals (Sweden)

    M.A. Rahman


    Full Text Available Biodiesel from green energy source is gaining tremendous attention for ecofriendly and economically aspect. In this investigation, a two-step process was developed for the production of biodiesel from microalgae Spirulina maxima and determined best operating conditions for the steps. In the first stage, acid esterification was conducted to lessen acid value (AV from 10.66 to 0.51 mgKOH/g of the feedstock and optimal conditions for maximum esterified oil yielding were found at molar ratio 12:1, temperature 60°C, 1% (wt% H2SO4, and mixing intensity 400 rpm for a reaction time of 90 min. The second stage alkali transesterification was carried out for maximum biodiesel yielding (86.1% and optimal conditions were found at molar ratio 9:1, temperature 65°C, mixing intensity 600 rpm, catalyst concentration 0.75% (wt% KOH for a reaction time of 20 min. Biodiesel were analyzed according to ASTM standards and results were within standards limit. Results will helpful to produce third generation algal biodiesel from microalgae Spirulina maxima in an efficient manner.

  13. Development of a chemically defined medium for the production of the antibiotic platensimycin by Streptomyces platensis. (United States)

    Falzone, Maria; Martens, Evan; Tynan, Heather; Maggio, Christian; Golden, Samantha; Nayda, Vasyl; Crespo, Emmanuel; Inamine, Gregory; Gelber, Michael; Lemence, Ryan; Chiappini, Nicholas; Friedman, Emily; Shen, Ben; Gullo, Vincent; Demain, Arnold L


    The actinomycete Streptomyces platensis produces two compounds that display antibacterial activity: platensimycin and platencin. These compounds were discovered by the Merck Research Laboratories, and a complex insoluble production medium was reported. We have used this medium as our starting point in our studies. In a previous study, we developed a semi-defined production medium, i.e., PM5. In the present studies, by varying the concentration of the components of PM5, we were able to develop a superior semi-defined medium, i.e., PM6, which contains a higher concentration of lactose. Versions of PM6, containing lower concentrations of all components, were also found to be superior to PM5. The new semi-defined production media contain dextrin, lactose, MOPS buffer, and ammonium sulfate in different concentrations. We determined antibiotic production capabilities using agar diffusion assays and chemical assays via thin-layer silica chromatography and high-performance liquid chromatography. We reduced crude nutrient carryover from the seed medium by washing the cells with distilled water. Using these semi-defined media, we determined that addition of the semi-defined component soluble starch stimulated antibiotic production and that it and dextrin could both be replaced with glucose, resulting in the chemically defined medium, PM7.

  14. Theoretical investigation of biomass productivities achievable in solar rectangular photobioreactors for the cyanobacterium Arthrospira platensis. (United States)

    Pruvost, Jeremy; Cornet, J F; Goetz, Vincent; Legrand, Jack


    Modeling was done to simulate whole-year running of solar rectangular photobioreactors (PBRs). Introducing the concept of ideal reactor, the maximal biomass productivity that could be achieved on Earth on nitrate as N-source was calculated. Two additional factors were also analyzed with respect to dynamic calculations over the whole year: the effect of PBR location and the effects of given operating conditions on the resulting decrease in productivity compared with the ideal one. Simulations were conducted for the cyanobacterium Arthospira platensis, giving an ideal productivity (upper limit) in the range 55-60 tX ha(-1) year(-1) for a sun tracking system (and around 35-40 tX ha(-1) year(-1) for a fixed horizontal PBR). For an implantation in France (Nantes, west coast), the modification in irradiation conditions resulted in a decrease in biomass productivity of 40%. Various parameters were investigated, with special emphasis on the influence of the incident angle of solar illumination on resulting productivities, affecting both light capture and light transfer inside the bulk culture. It was also found that with appropriate optimization of the residence time as permitted by the model, productivities close to maximal could be achieved for a given location. Copyright © 2012 American Institute of Chemical Engineers (AIChE).

  15. Nutritional control of antibiotic production by Streptomyces platensis MA7327: importance of l-aspartic acid. (United States)

    Falzone, Maria; Crespo, Emmanuel; Jones, Klarissa; Khan, Gulaba; Korn, Victoria L; Patel, Amreen; Patel, Mira; Patel, Krishnaben; Perkins, Carrie; Siddiqui, Sana; Stenger, Drew; Yu, Eileen; Gelber, Michael; Scheffler, Robert; Nayda, Vasyl; Ravin, Ariela; Komal, Ronica; Rudolf, Jeffrey D; Shen, Ben; Gullo, Vincent; Demain, Arnold L


    Streptomyces platensis MA7327 is a bacterium producing interesting antibiotics, which act by the novel mechanism of inhibiting fatty acid biosynthesis. The antibiotics produced by this actinomycete are platensimycin and platencin plus some minor related antibiotics. Platensimycin and platencin have activity against antibiotic-resistant bacteria such as methicillin-resistant Staphylococcus aureus and vancomycin-resistant Enterococcus; they also lack toxicity in animal models. Platensimycin also has activity against diabetes in a mouse model. We have been interested in studying the effects of primary metabolites on production of these antibiotics in our chemically defined production medium. In the present work, we tested 32 primary metabolites for their effect. They included 20 amino acids, 7 vitamins and 5 nucleic acid derivatives. Of these, only l-aspartic acid showed stimulation of antibiotic production. We conclude that the stimulatory effect of aspartic acid is due to its role as a precursor involved in the biosynthesis of aspartate-4-semialdehyde, which is the starting point for the biosynthesis of the 3-amino-2,4-dihydroxy benzoic acid portion of the platensimycin molecule.

  16. Diurnal changes of photosynthesis and growth of Arthrospira platensis cultured in a thin-layer cascade and an open pond

    Czech Academy of Sciences Publication Activity Database

    Benavides, A.M.S.; Ranglová, Karolína; Malapascua, José R.; Masojídek, Jiří; Torzillo, G.


    Roč. 28, DEC (2017), s. 48-56 ISSN 2211-9264 R&D Projects: GA MŠk(CZ) LO1416; GA MŠk EE2.3.30.0059 Grant - others:AV ČR(CZ) CNR-16-29 Program:Bilaterální spolupráce Institutional support: RVO:61388971 Keywords : Arthrospira platensis * Pond * Thin-layer cascade Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.994, year: 2016

  17. Enhancement of human adaptive immune responses by administration of a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis

    DEFF Research Database (Denmark)

    Pedersen, Morten Løbner; Walsted, Anette; Larsen, Rune


    The effect of consumption of Immulina, a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis, on adaptive immune responses was investigated by evaluation of changes in leukocyte responsiveness to two foreign recall antigens, Candida albicans (CA) and tetanus...


    Directory of Open Access Journals (Sweden)

    Muhammad Firdaus


    yang bersumber dari LED dengan cahaya monokromatis merah (M, biru (B, dan biru-merah (BM, serta cahaya dari lampu fluoresens sebagai kontrol (K. Puncak kepadatan sel terjadi pada hari ke-18 dengan kepadatan masing-masing sebanyak 5,56 x 104 sel/mL (M; 1,65 x 104 sel/mL (B; 4,15 x 104 sel/mL (BM; dan 4,56 x 104 sel/mL (K. Perlakuan pencahayaan LED dengan cahaya monokromatis merah mencapai biomassa panen tertinggi sebesar 3,91 mg/mL dengan kandungan protein 49,77%; lemak 19,61%; karbohidrat 6,15%; serat kasar 0,00%; dan abu 24,48%. Pencahayaan dengan LED merah berpotensi diaplikasikan sebagai sumber cahaya dalam produksi Spirulina.

  19. Characteristic of resistant ionization-radiation and its relationship with polysaccharide contents in spirulina

    International Nuclear Information System (INIS)

    Wang Zhiping; Xu Bujin


    The anti-radiation capacities of intact filaments, no-sheath filaments and cells of 4 kinds of Spiralina strains (Ss-V, Sp-F, Sp-Z and Sp-D) treated by "6"0Co γ-rays were studied. The relationship between polysaccharide contents and anti-radiation capacity of 4 strains were also detected. The results showed that Spirulina is highly resistant toγ-radiation, however there were significant differences with various strains. The order of anti-radiation capacity is Ss-V > Sp-F > Sp-Z > Sp-D. Moreover, the anti-radiation capacity were remarkably related with polysaccharide contents in the 4 strains. This showed that polysaccharide is very important for raising and maintain-ing super anti-radiation capacity in Spiralina. (authors)

  20. Biodiesel Production from Wet Spirulina sp. by One-Step Extraction-Transesterification

    Directory of Open Access Journals (Sweden)

    Surya Pradana Yano


    Full Text Available Microalgae has gained immense interests as the raw material for biofuel production. The lipid content in microalgae can be converted into biodiesel through conventional method which involves separated process of extraction and transesterification. In this study, the production of biodiesel from Spirulina sp. was performed through one-step extraction-transesterification using KOH as base catalyst to simplify the production of biodiesel. The mixture of methanol-hexane was employed as both solvent and reactant in the process. The resulting biodiesel was found to be mainly composed of methyl oleate and methyl palmitate. On the other hand, increasing the reaction temperature and reducing the quantity of methanol in solvent mixture would also increase the yield of biodiesel. The optimum methanol-hexane volumetric ratio and temperature which gave the highest biodiesel yield were 3:7 and 50°C, respectively.

  1. Evaluation of the integrated hydrothermal carbonization-algal cultivation process for enhanced nitrogen utilization in Arthrospira platensis production. (United States)

    Yao, Changhong; Wu, Peichun; Pan, Yanfei; Lu, Hongbin; Chi, Lei; Meng, Yingying; Cao, Xupeng; Xue, Song; Yang, Xiaoyi


    Sustainable microalgal cultivation at commercial scale requires nitrogen recycling. This study applied hydrothermal carbonization to recover N of hot-water extracted Arthrospira platensis biomass residue into aqueous phase (AP) under different operation conditions and evaluated the N utilization, biomass yield and quality of A. platensis cultures using AP as the sole N source. With the increase of temperature at 190-210°C or reaction time of 2-3h, the N recovery rate decreased under nitrogen-repletion (+N) cultivation, while contrarily increased under nitrogen-limitation (-N) cultivation. Under +N biomass accumulation in the cultures with AP under 190°C was enhanced by 41-67% compared with that in NaNO3, and the highest protein content of 51.5%DW achieved under 200°C-2h was also 22% higher. Carbohydrate content of 71.4%DW under -N cultivation achieved under 210°C-3h was 14% higher than that in NaNO3. HTC-algal cultivation strategy under -N mode could save 60% of conventional N. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Production of Spirulina sp by utilization of wastewater from the powder type energy drinks (United States)

    Sumantri, Indro; Priyambada, Ika Bagus


    Wastewater of energy drink type of powder produced when the the production equipment required cleaning treatment to produce one taste to others. These equipments washed by water, so that, it produced wastewater. It contains high organic substances and classified as high degradable due to food product. The content of wastewater is high carbon and nitrogen substances. Microalgae is an autotrophic microorganism, live without carbon presence, utilized to digest the substances in wastewater especially for nitrogen substances. Spirulina sp is the type of microalgae selected to utilize the wastewater of energy drink, the selection criteria is the size of Spirulina sp is relatively large and easy to separated from its solution. The experiment conducted by cultivate the seeding microalgae with certain nutrients until the certain volume. The synthetic wastewater obtained from one of energy drink type of powder with commercial brand as Kuku Bima Ener-G, the wastewater concentration selected under the close to the real condition of wastewater as basis of COD measurement (6 sachet/L or COD of 12.480mg/L) and aqueous concentration (1 sachet/L or COD of 2080mg/L). The batch experiments with 1L volume conducted and with variable of percent volume of wastewater added in order to observe the growth of microlagae. The response of the microalgae growth obtained by increasing the optical density of the microalgae solution and continued by calculation for the growth rate of microalgae. The result of the experiments indicated that for the aqueous concentration (1 sachet/L or COD of 2080mg/L) the optimum added of wastewater is 40 % with growrate of 0.55/day while for the concentrated wastewater (6 sachet/L or COD of 12.480mg/L), the optimum condition is 25 % wastewater added with growth rate of 0.43/day.


    Directory of Open Access Journals (Sweden)

    Widya Paramita Lokapirnasari


    Full Text Available High Pathogenecity Avian Influenza (HPAI viruses have high virulence and can frequently causesudden death on birds. The aims of this research was to know the role of Spirulina to a number ofmonocytes and lymphocytes in the blood of chickens which infected with the H5N1 virus. This researchconsisted of three levels of treatment in which each level given Spirulina 0%, 10%, 20% in the fresh wateralgae as drinking water. Each treatment consisted of seven replicates, and the treatment was done sincethe chickens at age 19 until 44 days ( for 25 days. Artificial infection of the chickens with the virus waschallenged by using AI (H5N1 104 EID 50 (A/Ck/Indonesia/BL/03 with route to the respiratory tract (nosedrops 0,1 mL starting on day 19. The results showed that there were a significant difference (p<0.05 ontreatment that given Spirulina at doses of 0%, 10% and 20% for the number ofn monocytes, eosinophils,whereas no significant difference (p > 0.05 was observed in basophils.

  4. Influência do consumo de diferentes níveis de Spirulina no desenvolvimento e perfil lipídico de ratos

    Directory of Open Access Journals (Sweden)

    Lidiane Moreira Chiattoni


    Full Text Available Spirulina é uma cianobactéria que vem sendo produzida e estudada por suas propriedades nutricionais e por seus benefícios à saúde. Neste estudo, avaliou-se a influência de dietas acrescidas de diferentes concentrações de Spirulina sobre o desenvolvimento corporal e o perfil lipídico de ratos. Foram utilizados 24 ratos Wistar, alimentados, durante 40 dias, com quatro dietas isoproteicas (10% distintas, sendo seis animais por grupo: 1 Dieta controle (AIN93G adaptada; 2 Dieta S1 (8,8% de Spirulina; 3 Dieta S2 (17,6% de Spirulina; 4 Dieta S3 (26,4% de Spirulina. Foram avaliados parâmetros nutricionais e o perfil lipídico dos animais, cujos dados foram analisados estatisticamente por Análise de Variância, seguida do teste de Tukey, a 5% de significância (p ≤ 0,05. O tratamento com 8,8% de Spirulina mostrou-se equivalente ao controle, apresentando respostas mais adequadas de CEA, medidas de crescimento e lipídios séricos. Já o S2 não foi capaz de promover um bom desenvolvimento corporal, comparado com o do controle, além de elevar os níveis de colesterol total e LDL-c. O tratamento S3 apresentou somente valores estatisticamente diferentes de HDL-c, quando comparado com os do controle (p ≤ 0,05. Conclui-se que, no tempo e condições do estudo, o tratamento S3, único com Spirulina como fonte exclusiva de proteína, foi capaz de substituir a fonte proteica padrão (caseína na dieta para roedores, promovendo o adequado desenvolvimento corporal e lipídico dos animais.

  5. The Effect of Active Principles of Cilantro and Spirulina Powder on Lead Antagonism to Copper and Chromium in Carassius gibelio

    Directory of Open Access Journals (Sweden)

    Mărioara Nicula


    Full Text Available The goal of our work was to highlight the detoxifying potential of the active principles from lyophilized cilantro and spirulina in experimental contamination with lead, to Carassius gibelio, and their effect on lead antagonism to copper and chromium. 120 Prussian carps, weighing 22-25 g each were divided according to the following treatments for 21 days: C group (without treatment, E1 group (75 ppm Pb into water as Pb(NO32x ½H2O, E2 group (75 ppm Pb into water+2% lyophilized cilantro in feed, E3 group (75 ppm Pb into water+2% lyophilized spirulina in feed. At the end of the experimental period, tissue samples (gills, muscles myotome– epaxial, heart, skin and scales, intestine, liver, brain, gonads, kidney were collected after a starving for 12 hours, and fish euthanasia with clove oil. Determination of Cu and Cr concentration in biological samples was performed using atomic absorption spectrophotometer AAS-VARIAN. Pb addition into water in dose of 75 ppm, has resulted in Cu and Cr mobilization from fish tissues. Decreasing of Cu tissue level occurred less intensive in tissues sampled from groups receiving cilantro and spiriulina powder in feed, maximum efficiency in the counteracting the antagonism against Pb showing spirulina on the heart, liver, and kidney. Cr was maintained at relatively low values, although, cilantro powder has induced in some wise the Pb complexing. In contrast, the freeze-dried spirulina brought the tissue level of Cr close to that of the control group or even has determined its more efficient takeover from the feed.

  6. Determination of antioxidant and chelating activity of protein hydrolysates from spirulina (Arthrospira maxima) obtained by simulated gastrointestinal digestion


    Martínez-Palma, N.; Martínez-Ayala, A.; Dávila-Ortíz, G.


    Spirulina is a cyanobacteria that has been used as food since ancient times, for example in Mexico it was consumed by the Aztecs. Its high protein content, distribution and amino acid composition suggests the presence of important peptides encrypted within the sequences of parent proteins, that after been released by digestive process they could show an antioxidant effect. Our present study examined the above hypothesis through the determination of the antioxidant and chelating activity of tw...

  7. Effect of Spirulina Intervention on Oxidative Stress, Antioxidant Status, and Lipid Profile in Chronic Obstructive Pulmonary Disease Patients

    Directory of Open Access Journals (Sweden)

    Md. Ismail


    Full Text Available Background and Objective. Oxidative stress is intimately associated with many diseases, including chronic obstructive pulmonary disease (COPD. Study objectives include a comparison of the oxidative stress, antioxidant status, and lipid profile between COPD patients and controls and evaluation of the effect of spirulina intervention on oxidative stress, antioxidant status, and lipid profile of COPD patients. Methods. 30 patients with COPD and 20 controls with no respiratory problems were selected. Global Initiative for Chronic Obstructive Lung Disease criteria were served as the basis of COPD diagnosis. The serum content of malondialdehyde (MDA, lipid hydroperoxide, glutathione (GSH, vitamin C, cholesterol, triglyceride (TG, and high density lipoprotein (HDL was measured. The activity of superoxide dismutase (SOD, catalase (CAT, and glutathione-s-transferase (GST was also measured. Two different doses, (500 × 2 mg and (500 × 4 mg spirulina, were given to two groups, each of which comprises 15 COPD patients. Results. All targeted blood parameters have significant difference (P=0.000 between COPD patients and controls except triglyceride (TG. Spirulina intake for 30 and 60 days at (500 × 2 mg dose has significantly reduced serum content of MDA, lipid hydroperoxide, and cholesterol (P=0.000 while increasing GSH, Vit C level (P=0.000, and the activity of SOD (P=0.000 and GST (P=0.038. At the same time, spirulina intake for 30 and 60 days at (500 × 4 mg dose has favorable significant effect (P=0.000 on all targeted blood parameters except for HDL (P=0.163.

  8. Magnetic field action on outdoor and indoor cultures of Spirulina: Evaluation of growth, medium consumption and protein profile. (United States)

    Deamici, Kricelle Mosquera; Santos, Lucielen Oliveira; Costa, Jorge Alberto Vieira


    This study aimed at evaluating whether a magnetic field (MF) affects the growth of Spirulina sp. when applied to it at different exposure times in indoor and outdoor culture systems. The effects of MF on chlorophyll content, medium consumption and protein profile were also investigated. In raceway tanks, a 25 mT MF was applied for 24 h or for 1 h d -1 . MF for 24 h to outdoor assays increased biomass concentration and chlorophyll-a content besides altering the protein profile. Outdoor Spirulina growth was higher (∼3.65 g L -1 ) than the growth found in indoor assays (∼1.80 g L -1 ), while nitrogen and phosphorus consumption was not enhanced by the application of MF. This is the first study that investigated the influence of MF on outdoor microalga assays, and the results showed that MF affected the metabolism of Spirulina cultured in raceways, especially when it was grown outdoors in uncontrolled environmental conditions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Enhancement of antioxidant activity of C-phycocyanin of Spirulina powder treated with supercritical fluid carbon dioxide

    Directory of Open Access Journals (Sweden)

    Monchai Dejsungkranont


    Full Text Available The functionality and activity of proteins can be modified by supercritical fluid CO2 (SCFCO2. The objectives of this study were to investigate the possibility of enhanced antioxidant activity of C-phycocyanin (C-PC proteins from light-harvested Spirulina maxima powder using the SCFCO2 pretreatment and to optimize the SCFCO2 pretreatment conditions enhancing the antioxidant activity of C-PC. The Taguchi method was used to determine the optimum conditions for the SCFCO2 pretreatment. The experimental factors were the pretreatment temperature, pressure, pretreatment mode (static, dynamic and conjugated and duration. The optimal conditions of SCFCO2 pretreatment were: 60 °C, 24.13 MPa and 60 min in static batch mode. Using these pretreatment conditions, the maximum antioxidant activity of C-PC from the treated residual biomass was 410.1 μmole trolox/mg, which was 1.7-fold higher than the untreated biomass (control. The factor that most affected the antioxidant activity of C-PC was temperature (59%. A high pretreatment temperature could damage C-PC, but promoted antioxidant activity. Of note is that this work was the first to explore SCFCO2 treatment enhancing the antioxidant activity of C-PC in Spirulina sp. powder. Keywords: Antioxidant activity, C-phycocyanin, Spirulina sp., Supercritical fluid carbon dioxide pretreatment, Taguchi method

  10. Morfoanatomia e ontogênese do fruto e semente de Vernonia platensis (Spreng. Less. (Asteraceae Morphology, anatomy and ontogeny of the fruit and seed of Vernonia platensis (Spreng. Less. (Asteraceae

    Directory of Open Access Journals (Sweden)

    Natália Arias Galastri


    Full Text Available Asteraceae possui cerca de 23.000 espécies e Vernonieae tem sua maior representatividade no Brasil, sendo Vernonia o maior gênero da tribo. Devido à ampla ocorrência nos Cerrados, V. platensis foi selecionada para a realização deste trabalho, que objetiva descrever a morfoanatomia e o desenvolvimento do pericarpo e da semente desta espécie, comparando os resultados com a literatura. O material coletado foi processado segundo técnicas usuais. O ovário é ínfero, bicarpelar, sincárpico, unilocular, com um óvulo anátropo, unitegumentado, tenuinucelado, formado em placentação basal. A parede ovariana é homogênea, com células mais densas perifericamente. O tegumento possui três regiões, destacando-se evidente endotélio. Na maturidade, a maioria das camadas colapsa, mantendo-se as fibras mesocárpicas externas; o pápus duplo persiste formado por células lignificadas. A semente madura apresenta testa restrita a uma faixa de células colapsadas; o endosperma é celular, persistindo residualmente na maturidade, e o embrião exibe eixo hipocótilo-radícula axial, espesso e curto. Em apenas 40% das cipselas maduras analisadas, há sementes completamente desenvolvidas. As observações deste trabalho corroboram pesquisas anteriores com Asteraceae, mas destaca-se o papel nutritivo do tegumento no desenvolvimento seminal e a baixa produção de sementes em V. platensis.The Asteraceae comprises approximately 23,000 species and Vernonieae is best represented in Brazil; Vernonia is the largest genus in this tribe. Due to occurrence in extensive areas of Cerrado, Vernonia platensis was selected for this work that aims to describe the morphology, anatomy and development of the pericarp and seed of this species, comparing the results with the literature. The collected material was processed by conventional techniques. The ovary is inferior, bicarpellate, syncarpous, unilocular with a single anatropous ovule, unitegmic, tenuinucelate

  11. Determination of uranium in Toxodon Platensis' teeth from Alto Ribeira region in Sao Paulo State for isotope dating

    International Nuclear Information System (INIS)

    Figueiredo, Ana M.G.; Saiki, Mitiko; Sarkis, Jorge E.S.; Kakazu, Mauricio H.; Karmann, Ivo


    In the present work, the concentration of uranium in dentine and dental enamel of a pre-molar of Toxodon platensis (kind of herbivorous) from South America Quaternary, present in the region of Alto Ribeira, Sao Paulo, was determined, in order to date this fossil by using the ESR method (Electron Spin Resonance). The analytical techniques Epithermal Neutron Activation Analysis and High Resolution Inductively Coupled Plasma Mass Spectrometry were employed. The results obtained by using the two cited analytical techniques were in good agreement. These results, together with the data of total dose of deposed ionizing radiation and of the rate dose, allowed to find a ESR age of (6,7 +/- 1,3) Ka for the dentine, and of (5,0 +/- 1,6 Ka) for the dental enamel. Considering an average age of 6 Ka, this date corresponds to the Low to Medium Holocene, which is an unprecedented datum for this species in the southeastern region of Brazil. (author)

  12. Summer feeding ecology of Great Pampa-finches, Embernagra platensis at Laguna de Guaminí, Buenos Aires, Argentina

    Directory of Open Access Journals (Sweden)

    Laura M. Ferman


    Full Text Available The aim of this study was to assemble data on the summer feeding ecology of the Great Pampa-finch, Embernagra platensis at the Laguna de Guaminí, Buenos Aires, Argentina, and to explore the differences related to the dietary patterns for each sex between winter and summer when possible. The stomach contents of 43 birds were analyzed. The animal fraction was composed of Hymenoptera (45.1%, Coleoptera (32.4%, Lepidoptera (6.0%, Araneae (5% and Orthoptera (3.2%. The application of the index of relative importance (IRI resulted in 1490.4 for Coleoptera, 428.5 for Hymenoptera and 162.5 for Lepidoptera caterpillars. The vegetal fraction consisted of Triticum aestivum (26.9%, Cyperaceous (25%, Poaceae (Gramineae (19.3% and Panicum sp. (11.2%. The IRI values were 893.8 for Triticum aestivum, 174.5 for Gramineae, 126.5 for Panicum sp. and 112.8 for Scirpus sp. The food niche width was 0.33 for both sexes; the diversity index resulted in 1.06 for females and 1.33 for males and specific diversity ranged from 1.87 to 2.84. A canonical component analysis (CCA was performed on environmental and morphometric variables, and a Monte Carlo test confirmed the canonical correlations. A t-test showed that some birds harmonized with a logarithmic model and some with a geometric curve. During the summer, Embernagra platensis ingests Hymenoptera and Coleoptera more often than seeds, suggesting that two biological mechanisms could be taking place in this bird.O objetivo deste estudo foi reunir dados referentes à ecologia alimentar do Sabiá-do-banhado, Embernagra platensis, na laguna de Guaminí, Buenos Aires, Argentina, e explorar as diferenças relacionadas aos padrões dietéticos para cada sexo entre inverno e verão, quando possível. O conteúdo estomacal de 43 pássaros foi analisado. A fração animal foi composta por Hymenoptera (45,1%, Coleoptera (32,4%, Lepidoptera(6,0%, Araneae (5% e Orthoptera (3,2%. A aplicação do índice de importância relativa (IRI

  13. Outdoor pilot-scale cultivation of Spirulina sp. LEB-18 in different geographic locations for evaluating its growth and chemical composition. (United States)

    de Jesus, Cristiane Santos; da Silva Uebel, Lívia; Costa, Samantha Serra; Miranda, Andréa Lobo; de Morais, Etiele Greque; de Morais, Michele Greque; Costa, Jorge Alberto Vieira; Nunes, Itaciara Larroza; de Souza Ferreira, Ederlan; Druzian, Janice Izabel


    This study evaluated whether outdoor cultivation of Spirulina sp. in different geographical locations affected its growth and biomass quality, with respect to the chemical composition, volatile compound and heavy metal content, and thermal stability. The positive effect of solar radiation and temperature on biomass productivity in Spirulina sp. cultivated in the northeast was directly related to its improved nutritional characteristics, which occurred with an increase in protein, phycocyanin, and polyunsaturated fatty acid (mainly γ-linolenic) content. The biomass produced in Northeast and South Brazil showed high thermal stability and had volatile compounds that could be used as biomarkers of Spirulina, and their parameters were within the limits of internationally recognized standards for food additives; hence, they have been considered safe foods. However, the growth of crops in south Brazil occurred at lower rates due to low temperatures and luminous intensities, indicative of the robustness of microalgae in relation to these parameters. Copyright © 2018 Elsevier Ltd. All rights reserved.

  14. Dampak Intervensi Sumber Iodium Alami Spirulina sp terhadap Kadar T4 Bebas (FT4 dan Tiroglobulin (TG pada Wanita Usia Subur di Daerah Kalibawang Kulon Progo

    Directory of Open Access Journals (Sweden)

    R. Agus Wibowo


    Full Text Available ABSRACT Iodine Deficiency Disorder (IDD is still a public health problem in Indonesia. Salt iodization was one of IDD prevention programme to prevent IDD, however the national coverage for iodized salt is still less than 90%. Alternative solution to solve IDD elimination is needed to find a better iodine sources. One of nutrient rich source from the sea that was developed to improve the nutritional status is Spirulina sp. Spirulina has high bioavailability due to the simple structure of the cell wall, so that the nutrients contained iodine will be more easily absorbed by the body. The aim of this research was to describe the effect of Spirulina sp to free T4 and thyroglobulin level in women of child bearing age in Kalibawang Kulon Progo regency. This is an experimental study using double blind randomized control trial (RCT. Subjects are euthyroid child bearing woman (18-40 years old, with TSH levels of 3 to 6.2 μIU/L. They were divided into 2 groups with subjects in control group were given placebo while the treatment group were given Spirulina sp (1 gr/day for 3 months. Serum for free T4 and thyroglobulin was analysed using ELISA. The results showed that there were significant changes in free T4 level in both groups after intervention (P <0.05, but there were no significant differences between the two groups at the beginning and end of treatment (P> 0.05 in thyroglobulin. The intervention using Spirulina sp has potential effect to increase free T4 level, however it did not effect thyroglobulin level. Keywords: FreeT4, RCT, Spirulina sp, Thyroglobulin   ABSTRAK   Masalah kekurangan asupan iodium dan gangguan akibat kekurangan iodium (GAKI masih menjadi masalah di Indonesia. Program iodisasi garam merupakan salah satu program yang dijalankan oleh pemerintah Indonesia untuk menanggulangi GAKI, namun sampai saat ini cakupan angka nasional untuk garam beriodium belum mencapai 90%. Dibutuhkan metode baru yang efektif dalam membantu program

  15. Effect of Supercritical Carbon Dioxide Extraction Parameters on the Biological Activities and Metabolites Present in Extracts from Arthrospira platensis. (United States)

    Esquivel-Hernández, Diego A; Rodríguez-Rodríguez, José; Cuéllar-Bermúdez, Sara P; García-Pérez, J Saúl; Mancera-Andrade, Elena I; Núñez-Echevarría, Jade E; Ontiveros-Valencia, Aura; Rostro-Alanis, Magdalena; García-García, Rebeca M; Torres, J Antonio; Chen, Wei Ning; Parra-Saldívar, Roberto


    Arthrospira platensis was used to obtain functional extracts through supercritical carbon dioxide extraction (SFE-CO₂). Pressure (P), temperature (T), co-solvent (CX), static extraction (SX), dispersant (Di) and dynamic extraction (DX) were evaluated as process parameters through a Plackett-Burman design. The maximum extract yield obtained was 7.48 ± 0.15% w/w. The maximum contents of bioactive metabolites in extracts were 0.69 ± 0.09 µg/g of riboflavin, 5.49 ± 0.10 µg/g of α-tocopherol, 524.46 ± 0.10 µg/g of β-carotene, 1.44 ± 0.10 µg/g of lutein and 32.11 ± 0.12 mg/g of fatty acids with 39.38% of palmitic acid, 20.63% of linoleic acid and 30.27% of γ-linolenic acid. A. platensis extracts had an antioxidant activity of 76.47 ± 0.71 µg GAE/g by Folin-Ciocalteu assay, 0.52 ± 0.02, 0.40 ± 0.01 and 1.47 ± 0.02 µmol TE/g by DPPH, FRAP and TEAC assays, respectively. These extracts showed antimicrobial activity against Staphylococcus aureus ATCC 25923, Pseudomonas aeruginosa ATCC 27853, Escherichia coli ATCC 25922 and Candida albicans ATCC 10231. Overall, co-solvent was the most significant factor for all measured effects ( p extraction parameters P: 450 bar, CX: 11 g/min, SX: 15 min, DX: 25 min, T: 60 °C and Di: 35 g.

  16. Fatty acid composition of Spirulina sp., Chlorella sp. and Chaetoceros sp. microalgae and introduction as potential new sources to extinct omega 3 and omega 6

    Directory of Open Access Journals (Sweden)

    Homan Gorjzdadeh


    Full Text Available Background: This study was carried out to determine the oil fatty acids from two special species of microalgae; Spirulina sp.,Chlorella sp. and also Chaetoceros sp. collected from Bahmanshir River. Materials and Methods: Sampling of microalgae Chaetoceros sp. from Bahmanshir River was under taken using bottle samplers during spring season of 2013. Microalgae Spirulina sp. and Chlorella sp. were supplied from Shrimp Research Institute of Iran in Bushehr Province. Samples then were cultured under controlled laboratory conditions and mass culture for 100 liters was undertaken. Isolation of microalgae species from water of cultured media was carried out using filtration and centrifugation methods. The fatty acid compositions were determined by Gas – FID chromatography. Results: Results showed that regarding Saturated Fatty Acids (SFA obtained from purified culture of Chaetoceros sp., Spirulina sp. and Chlorella sp. the maximum amount of total fatty acids were belonged to palmitic acids (C16:0 with 15.21%, 30.1% and 25.17% of total fatty acids  respectively. Analysis of Mono Unsaturated Fatty Acids (MUFA showed that in the Oleic acid was maximum amount of 34% in Spirulina sp. In addition the amount of MUFA in Chlorella sp. was 16.37% of total fatty acids. On the other hand the amount of palmeotic acid in purified culture of Chaetoceros sp. was 30.33% from total content of fatty acids. Analysis of Poly Unsaturated Fatty Acids (PUFA, Linoleic acid (C18:2 (Omega 6, revealed maximum percentage in Spirulina sp. with 18.8%. Results of Alpha linoleic acid (C18:3 (Omega3 analysis showed maximum amount of 9.66% in Chlorella sp. compared to other microalgae with lower omega 3 contents. Spirulina sp. contained maximum amount of Linoleic acid (C18:2 with 18.8% of total fatty acids. Therefore, Spirulina sp. can be considered as a rich source of omega 6 for the purpose of fatty acid extractions. The presence of PUFA in Chlorella sp. and Spirulina sp. was

  17. Anaerobic digestion of wastewater generated from the hydrothermal liquefaction of Spirulina: Toxicity assessment and minimization

    International Nuclear Information System (INIS)

    Zheng, Mingxia; Schideman, Lance C.; Tommaso, Giovana; Chen, Wan-Ting; Zhou, Yan; Nair, Ken; Qian, Wanyi; Zhang, Yuanhui; Wang, Kaijun


    Highlights: • Nutrient reuse and energy recovery of HTL-WW are realized. • Anaerobic digestion of HTL-WW is vital to the sustainability of algal biocrude. • An anaerobic toxicity assay was conducted to evaluate HTL-WW toxicity. • The presence of adsorbents and biofilms effectively minimized inhibition. • A portion of the toxic compounds could be removed after anaerobic digestion. - Abstract: Previous studies demonstrate anaerobic digestion of hydrothermal liquefaction wastewater (HTL-WW) is significant to the sustainability of algal biofuel development for nutrient reuse and residual energy recovery. HTL-WW contains substantial amounts of residual energy but is toxic to anaerobes. With 6% HTL-WW converted from cyanobacteria (e.g. Spirulina), anaerobes were 50% inhibited. In this study, zeolite, granular activated carbon (GAC), and polyurethane matrices (PM) were used during a two-round anaerobic batch test with HTL-WW, and in the presence of each material, the total methane yields were 136 mL/g COD, 169 mL/g COD, and 168 mL/g COD, respectively, being 11%, 37% and 36% higher than the control. GAC was considered promising due to its highest methane yield of 124 mL/g COD at the second feeding, indicating a good recovery of adsorption capacity. The observed low methane production rates indicated the necessity for anaerobic process optimization. The physicochemical analysis of the digestates demonstrated that most of the compounds identified in the HTL-WW were degraded.

  18. Phosphonate degradation by Spirulina strains: cyanobacterial biofilters for the removal of anticorrosive polyphosphonates from wastewater. (United States)

    Forlani, Giuseppe; Prearo, Valentina; Wieczorek, Dorota; Kafarski, Paweł; Lipok, Jacek


    The ability of Spirulina spp. to metabolize the recalcitrant xenobiotic Dequest 2054(®) [hexamethylenediamine-N,N,N',N'-tetrakis(methylphosphonic acid)], a CaSO(4) inhibitor used for boiler treatment and reverse osmosis desalination, was investigated. The compound served as sole source of phosphorus, but not of nitrogen, for cyanobacterial growth. In vivo utilization was followed by (31)P NMR analysis. The disappearance of the polyphosphonate proceeded only with actively dividing cells, and no release of inorganic phosphate was evident. However, no difference was found between P-starved and P-fed cultures. Maximal utilization reached 1.0 ± 0.2 mmoll(-1), corresponding to 0.56 ± 0.11 mmol g(-1) dry biomass, thus residual amounts were still present in the exhausted medium when the compound was supplied at higher initial concentrations. At low substrate levels metabolism rates were lower, suggesting that a concentration-driven uptake may represent a limiting step during the biodegradation process. The compound was not retained by biocolumns made with immobilized cyanobacterial cells, either alive or dead. A lab-scale pilot plant, consisting of a series of sequentially connected vessels containing an actively proliferating algal culture, was built and tested for wastewater treatment. Results showed 50% removal of the polyphosphonate added to an initial concentration of 2.5mM. Although further optimization will be required, data strengthen the possibility of using cyanobacterial strains for bioremediation purposes. Copyright © 2010 Elsevier Inc. All rights reserved.

  19. Incorporation of Chlorella vulgaris and Spirulina maxima biomass in pasta products. Part 1: Preparation and evaluation. (United States)

    Fradique, Mónica; Batista, Ana Paula; Nunes, M Cristiana; Gouveia, Luísa; Bandarra, Narcisa M; Raymundo, Anabela


    Microalgae are able to enhance the nutritional content of conventional foods and hence to positively affect human health, due to their original chemical composition. The aim of the present study was to prepare fresh spaghetti enriched with different amounts of microalgae biomass (Chlorella vulgaris and Spirulina maxima) and to compare the quality parameters (optimal cooking time, cooking losses, swelling index and water absorption), chemical composition, instrumental texture and colour of the raw and cooked pasta enriched with microalgae biomass with standard semolina spaghetti. The incorporation of microalgae results in an increase of quality parameters when compared to the control sample. The colour of microalgae pastas remained relatively stable after cooking. The addition of microalgae resulted in an increase in the raw pasta firmness when compared to the control sample. Of all the microalgae studied, an increase in the biomass concentration (0.5-2.0%) resulted in a general tendency of an increase in the pasta firmness. Sensory analysis revealed that microalgae pastas had higher acceptance scores by the panellists than the control pasta. Microalgae pastas presented very appellative colours, such as orange and green, similar to pastas produced with vegetables, with nutritional advantages, showing energetic values similar to commercial pastas. The use of microalgae biomass can enhance the nutritional and sensorial quality of pasta, without affecting its cooking and textural properties. Copyright (c) 2010 Society of Chemical Industry.

  20. Enhancement of Immune Activation Activities of Spirulina maxima Grown in Deep-Sea Water (United States)

    Choi, Woon Yong; Kang, Do Hyung; Lee, Hyeon Yong


    In this study, the immuno-modulatory and anticancer activities of marine algae, Spirulina maxima grown in deep-sea water (DSW), were investigated. It was found that the extract of S. maxima, cultured in DSW, effectively suppressed the expression of Bcl2 in A549 cells as well as inhibiting various human cancer cells with concentration dependency, which possibly implies that the extracts may play more important roles in controlling cancer cell growth. The secretion of cytokines IL-6 and TNF-α from human B cells was also greatly increased, compared to those of the extract grown in conventional sea-water. The growth of Human Natural Killer (NK) cells in the presence of the extracts from DSW was significantly higher (12.2 × 104 viable cells/mL) when compared to the control (1.1 × 104 viable cells/mL). Based on HPLC analysis, the increase in the biological activities of the extracts from DSW was caused by considerably high amounts of β-carotene and ascorbic acid because the DSW contained high concentrations and good ratios of several key minerals for biosynthesizing β-carotene and ascorbic acid, as well as maintaining high cell growth. PMID:23743830

  1. Alleviation of metabolic abnormalities induced by excessive fructose administration in Wistar rats by Spirulina maxima. (United States)

    Jarouliya, Urmila; Zacharia, J Anish; Kumar, Pravin; Bisen, P S; Prasad, G B K S


    Diabetes mellitus is a metabolic disorder characterized by hyperglycaemia. Several natural products have been isolated and identified to restore the complications of diabetes. Spirulina maxima is naturally occurring fresh water cyanobacterium, enriched with proteins and essential nutrients. The aim of the study was to determine whether S. maxima could serve as a therapeutic agent to correct metabolic abnormalities induced by excessive fructose administration in Wistar rats. Oral administration of 10 per cent fructose solution to Wistar rats (n = 5 in each group) for 30 days resulted in hyperglycaemia and hyperlipidaemia. Aqueous suspension of S. maxima (5 or 10%) was also administered orally once daily for 30 days. The therapeutic potential of the preparation with reference to metformin (500 mg/kg) was assessed by monitoring various biochemical parameters at 10 day intervals during the course of therapy and at the end of 30 days S. maxima administration. Significant (Pmaxima aquous extract. Co-administration of S. maxima extract (5 or 10% aqueous) with 10 per cent fructose solution offered a significant protection against fructose induced metabolic abnormalities in Wistar rats. The present findings showed that S. maxima exhibited anti-hyperglycaemic, anti-hyperlipidaemic and hepatoprotective activity in rats fed with fructose. Further studies are needed to understand the mechanisms.

  2. The effects of temperature and frequencies in ultrasound assisted extraction of phycocyanin from microalgae Spirulina sp

    Energy Technology Data Exchange (ETDEWEB)

    Hadiyanto,, E-mail:; Suttrisnorhadi,; Soetrisnanto, Danny; Azizah, Nur [Department of Chemical Engineering, Diponegoro University, Jl. Prof. Soedarto, SH-Tembalang, Semarang 50239 INDONESIA (Indonesia); Sutanto, Heri [Physic Department, Faculty of Science and Mathematics, Diponegoro University (Indonesia); Suzery, Meiny [Chemistry Department, Faculty of Science and Mathematics, Diponegoro University (Indonesia)


    Microalgae Spirulina sp has been identified as source of protein and other high added value compounds. One of the compounds is phycocyanin as also known for antioxidant use. The extraction of this compound by using conventional method (soxhlet extraction) resulted low yield and longer processing time. This research was aimed to extract phycocyanin by using an extraction assisted by ultrasound irradiation. The extraction was performed by using variable of ultrasound frequency and extraction temperature and ethanol was used as a solvent. The result showed that yield of phycocyanin extracted by conventional method was 11.13% while the ultrasound irradiation could increase the yield up to 15.61% at constant frequency of 42 kHz, while the optimum temperature was obtained at 45°C. The analysis of variable interactions showed that both temperature and time has an interaction and temperature was the highest variable in increasing the yield. The conclusion of this research was the ultrasound could improve significantly the efficiency of extraction as well as activity of phycocyanin extracted from microalgae.

  3. The effects of temperature and frequencies in ultrasound assisted extraction of phycocyanin from microalgae Spirulina sp (United States)

    Hadiyanto, Suttrisnorhadi, Sutanto, Heri; Suzery, Meiny; Soetrisnanto, Danny; Azizah, Nur


    Microalgae Spirulina sp has been identified as source of protein and other high added value compounds. One of the compounds is phycocyanin as also known for antioxidant use. The extraction of this compound by using conventional method (soxhlet extraction) resulted low yield and longer processing time. This research was aimed to extract phycocyanin by using an extraction assisted by ultrasound irradiation. The extraction was performed by using variable of ultrasound frequency and extraction temperature and ethanol was used as a solvent. The result showed that yield of phycocyanin extracted by conventional method was 11.13% while the ultrasound irradiation could increase the yield up to 15.61% at constant frequency of 42 kHz, while the optimum temperature was obtained at 45°C. The analysis of variable interactions showed that both temperature and time has an interaction and temperature was the highest variable in increasing the yield. The conclusion of this research was the ultrasound could improve significantly the efficiency of extraction as well as activity of phycocyanin extracted from microalgae.

  4. The effects of temperature and frequencies in ultrasound assisted extraction of phycocyanin from microalgae Spirulina sp

    International Nuclear Information System (INIS)

    Hadiyanto,; Suttrisnorhadi,; Soetrisnanto, Danny; Azizah, Nur; Sutanto, Heri; Suzery, Meiny


    Microalgae Spirulina sp has been identified as source of protein and other high added value compounds. One of the compounds is phycocyanin as also known for antioxidant use. The extraction of this compound by using conventional method (soxhlet extraction) resulted low yield and longer processing time. This research was aimed to extract phycocyanin by using an extraction assisted by ultrasound irradiation. The extraction was performed by using variable of ultrasound frequency and extraction temperature and ethanol was used as a solvent. The result showed that yield of phycocyanin extracted by conventional method was 11.13% while the ultrasound irradiation could increase the yield up to 15.61% at constant frequency of 42 kHz, while the optimum temperature was obtained at 45°C. The analysis of variable interactions showed that both temperature and time has an interaction and temperature was the highest variable in increasing the yield. The conclusion of this research was the ultrasound could improve significantly the efficiency of extraction as well as activity of phycocyanin extracted from microalgae

  5. Polyhydroxybutyrate (PHB) Synthesis by Spirulina sp. LEB 18 Using Biopolymer Extraction Waste. (United States)

    da Silva, Cleber Klasener; Costa, Jorge Alberto Vieira; de Morais, Michele Greque


    The reuse of waste as well as the production of biodegradable compounds has for years been the object of studies and of global interest as a way to reduce the environmental impact generated by unsustainable exploratory processes. The conversion of linear processes into cyclical processes has environmental and economic advantages, reducing waste deposition and reducing costs. The objective of this work was to use biopolymer extraction waste in the cultivation of Spirulina sp. LEB 18, for the cyclic process of polyhydroxybutyrate (PHB) synthesis. Concentrations of 10, 15, 20, 25, and 30% (v/v) of biopolymer extraction waste were tested. For comparison, two assays were used without addition of waste, Zarrouk (SZ) and modified Zarrouk (ZM), with reduction of nitrogen. The assays were carried out in triplicate and evaluated for the production of microalgal biomass and PHB. The tests with addition of waste presented a biomass production statistically equal to ZM (0.79 g L -1 ) (p PHB in the assay containing 25% of waste was higher when compared to the other cultivations, obtaining 10.6% (w/w) of biopolymer. From the results obtained, it is affirmed that the use of PHB extraction waste in the microalgal cultivation, aiming at the synthesis of biopolymers, can occur in a cyclic process, reducing process costs and the deposition of waste, thus favoring the preservation of the environment.

  6. Effect of operating conditions on hydrothermal liquefaction of Spirulina over Ni/TiO2 catalyst. (United States)

    Tian, Wenying; Liu, Renlong; Wang, Wenjia; Yin, Zhaosen; Yi, Xuewen


    In this study, the effects of reaction temperature, holding time, algae/water ratio and catalyst dosage on the yield and quality of bio-oil produced via the HTL of Spirulina were investigated. The maximum bio-oil yield (43.05 wt%) and energy recovery (ER) value (64.62%) were obtained at 260 °C for 30 min, with an algae/water ratio of 1/4 and a catalyst dosage of 5 wt%. The bio-oil samples were characterized by elemental analysis, Gas Chromatography-Mass Spectrometry (GC-MS), Fourier Transform Infrared (FI-IR), and Thermo-gravimetric analysis (TGA). Results indicated that higher heating values (HHVs) of bio-oils were in the range of 27.28-36.01 MJ/kg, and main compounds of bio-oil were amides, esters, nitriles, hydroperoxide and alkanes. Adding of the Ni/TiO 2 catalyst can decrease the contents of oxygenated and nitrogenous compounds and promote the formation of desirable components such as esters and alkanes. Copyright © 2018 Elsevier Ltd. All rights reserved.

  7. Bioprocess Engineering Aspects of Biopolymer Production by the Cyanobacterium Spirulina Strain LEB 18

    Directory of Open Access Journals (Sweden)

    Roberta Guimarães Martins


    Full Text Available Microbial biopolymers can replace environmentally damaging plastics derived from petrochemicals. We investigated biopolymer synthesis by the cyanobacterium Spirulina strain LEB 18. Autotrophic culture used unmodified Zarrouk medium or modified Zarrouk medium in which the NaNO3 content was reduced to 0.25 g L−1 and the NaHCO3 content reduced to 8.4 g L−1 or increased to 25.2 g L−1. Heterotrophic culture used modified Zarrouk medium containing 0.25 g L−1 NaNO3 with the NaHCO3 replaced by 0.2 g L−1, 0.4 g L−1, or 0.6 g L−1 of glucose (C6H12O6 or sodium acetate (CH3COONa. Mixotrophic culture used modified Zarrouk medium containing 0.25 g L−1 NaNO3 plus 16.8 g L−1 NaHCO3 with the addition of 0.2 g L−1, 0.4 g L−1, or 0.6 g L−1 of glucose or sodium acetate. The highest biopolymer yield was 44% when LEB 18 was growing autotrophically in media containing 0.25 g L−1 NaNO3 and 8.4 g L−1 NaHCO3.

  8. Halotolerant/alkalophilic bacteria associated with the cyanobacterium Arthrospira platensis (Nordstedt Gomont that promote early growth in Sorghum bicolor (L. Moench

    Directory of Open Access Journals (Sweden)

    Gómez G. Liliana Cecilia


    Full Text Available

    Arthrospira platensis associated bacteria (APAB identified through molecuar biology like Bacillus okhensis, Indibacter alkaliphilus and Halomonas sp., are also producing 3-indol acetic acid (IAA, these bacteria was used in early plant growth promotion tests over Sorghum bicolor, these bioassay was considered indirect evidence to suggest that APAB also may have stimulatory effects over A. platensis growth naturally. I. alkaliphilus and B. okhensis enhanced early germination of S. bicolor seads, with better results than that achieved by Azospirillum brasilense, bacterium used like reference as a common plant growth promoting rizobacteria. The three APAB enhanced significative differences (P≤0.05 over morphoagronomic parameters, I. alkaliphilus and B. okhensis exhibit better resoults in elongation stimulation and root and foliage dry weight. Above evidence suggest this bacteria like plant growth promoting and it recomended testing with A. platensis axenic cultures and its associated bactteri for understanding true interaction between them.

  9. Protective Effect of Water Extracted Spirulina maxima on Glutamate-induced Neuronal Cell Death in Mouse Hippocampal HT22 Cell. (United States)

    Lee, Hyeon Yong; Ryu, Ga Hee; Choi, Woon Yong; Yang, Woo Seung; Lee, Hyeon Woo; Ma, Choong Je


    Spirulina maxima was used as important nutritional source in the Aztec civilization because it is rich in proteins and vitamins. It contains various antioxidants such as phycocyanin and flavonoids. Based on abundant antioxidants, S. maxima is known to possess anti-inflammatory effect, especially on neuronal cells. S. maxima was extracted in water and contain of phycocyanin was identified by high-performance liquid chromatography. Cell viability test was performed with treatment of S. maxima extract. After, oxidative stress-related mechanisms were evaluated by detecting the accumulation of reactive oxygen species (ROS) and Ca 2+ influx, and decrease of mitochondrial membrane potential (MMP) level. Then, the glutathione (GSH) related assays were conducted. The water extracted S. maxima exerted the neuroprotective activity by attenuating the ROS and Ca 2+ formation, maintaining the MMP level, and protecting the activity of the antioxidant enzymes by increasing reduced GSH against oxidative stress compared to control. The results suggested that water extracted S. maxima showed powerful neuroprotective effect through the mechanism related to antioxidant activity, able to preventing the radical-mediated cell death. Water extracted Spirulina maxima contains C-phycocyaninWater extracted Spirulina maxima exerts neuroprotective effect on HT22 cellTo investigate the protective mechanisms, reactive oxygen species, Ca 2+ , mitochondrial membrane potential, Glutathione-related assays were performed. Abbreviations used: ROS: Reactive oxygen species; MMP: Mitochondrial membrane potential; GSH: Glutathione; GSSG: Glutathione disulfide, oxidized glutathione; GPx: Glutathione peroxidase; GR: Glutathione reductase; DMEM: Dulbecco's modified Eagle's medium; FBS: Fetal bovine serum; DCF-DA: 2',7'-dichlorofluorescein diacetate; PBS: Phosphate buffered serum; Rho 123: Rhodamine 123; NADPH: Nicotinamide adenine dinucleotide phosphate; DTNB: 5,5'-dithiobis-2-nitrobenzoic acid, Ellman

  10. Large red cyanobacterial mats (Spirulina subsalsa Oersted ex Gomont in the shallow sublittoral of the southern Baltic

    Directory of Open Access Journals (Sweden)

    Piotr Balazy


    Full Text Available We report the first observation of large red cyanobacterial mats in the southern Baltic Sea. The mats (up to 2.5 m in diameter were observed by SCUBA divers at 7.7 m depth on loamy sediments in the Gulf of Gdańsk in mid-November 2013. The main structure of the mat was formed by cyanobacteria Spirulina subsalsa Oersted ex Gomont; a number of other cyanobacteria, diatoms and nematode species were also present. After a few days in the laboratory, the red trichomes of S. subsalsa started to turn blue-green in colour, suggesting the strong chromatic acclimation abilities of this species.

  11. Nitrogen limitation in natural populations of cyanobacteria (Spirulina and Oscillatoria spp.) and its effect on macromolecular synthesis

    International Nuclear Information System (INIS)

    van Rijn, J.; Shilo, M.


    Natural populations of the cyanobacteria Spirulina species and Oscillatoria species obtained from Israeli fish ponds were limited in growth by nitrogen availability in summer. Physiological indicators for nitrogen limitation, such as phycocyanin, chlorophyll a, and carbohydrate content, did not show clear evidence for nitrogen limited growth, since these organisms are capable of vertical migration from and to the nitrogen-rich bottom. By means of 14 C labeling of the cells under simulated pond conditions followed by cell fractionation into macromolecular compounds, it was found that carbohydrates synthesized at the lighted surface were partially utilized for dark protein synthesis at the bottom of these ponds

  12. Effect of spirulina on the levels of zinc, vitamin E and linoleic acid in the palm skin extracts of people with prolonged exposure to arsenic

    Directory of Open Access Journals (Sweden)

    Mir Misbahuddin


    Full Text Available Spirulina, a dietary supplement, improves the symptoms of arsenical palmer keratosis. To understand its mechanism of action, palm skin extracts of moderate palmer arsenical keratosis (n=10, arsenic exposed controls (n=10 and healthy volunteers (n=10 were collected before and after treatment with spirulina powder 10 g/day orally for 12 weeks. The mean (±SD amount of zinc in the palm skin of healthy volunteers was 13.1 ± 5.7 ng/cm2, which was not changed significantly in patients (11.3 ± 5.3 ng/cm2. The amount of vitamin E in healthy volunteers was 6.0 ± 0.3 ng/cm2 which was severely reduced in patients (3.5 ± 0.6 ng/cm2. The amount of linoleic acid was lowered in patient (26.7 ± 17.1 ng/cm2 which was statistically significant in comparison to healthy volunteers (p=0.029. After supplementation of spirulina, zinc level in the palm skin of arsenic exposed controls was increased but it was not statistically significant (p=0.068. The vitamin E and linoleic acid levels were not changed significantly in the skin of palm. In conclusion, arsenical keratosis showed significantly low levels of vitamin E and linoleic acid without any significant change in zinc level. After supplementation of spirulina, low levels of these three compounds were not returned towards the normal levels.

  13. Molecular Cloning of cpcU and Heterodimeric Bilin Lyase Activity Analysis of CpcU and CpcS for Attachment of Phycocyanobilin to Cys-82 on the β-Subunit of Phycocyanin in Arthrospira platensis FACHB314

    Directory of Open Access Journals (Sweden)

    Fei Wu


    Full Text Available A new bilin lyase gene cpcU was cloned from Arthrospira platensis FACHB314 to study the assembly of the phycocyanin β-Subunit. Two recombinant plasmids, one contained the phycocyanobilin (PCB producing genes (hoxI and pcyA, while the other contained the gene of the β-Subunit of phycobiliprotein (cpcB and the lyase gene (cpcU, cpcS, or cpcU/S were constructed and separately transferred into Escherichia coli in order to test the activities of relevant lyases for catalyzing PCB addition to CpcB during synthesizing fluorescent β-PC of A. platensis FACHB314. The fluorescence intensity examination showed that Cys-82 maybe the active site for the β-Subunit binding to PCBs and the attachment could be carried out by CpcU, CpcS, or co-expressed cpcU/S in A. platensis FACHB314.

  14. Optimization of Growth Conditions for Purification and Production of L-Asparaginase by Spirulina maxima (United States)

    El Baroty, Gamal S.


    L-asparaginase (L-AsnA) is widely distributed among microorganisms and has important applications in medicine and in food technology sectors. Therefore, the ability of the production, purification, and characterization of AsnA from Spirulina maxima (SM) were tested. SM cultures grown in Zarrouk medium containing different N2 (in NaNO3 form) concentrations (1.25, 2.50, and 5.0 g/L) for 18 days contained a significant various quantity of dry biomass yields and AsnA enzyme levels. MS L-AsnA activity was found to be directly proportional to the N2 concentration. The cultures of SM at large scales (300 L medium, 5 g/L N2) showed a high AsnA enzyme activity (898 IU), total protein (405 mg/g), specific enzyme activity (2.21 IU/mg protein), and enzyme yield (51.28 IU/L) compared with those in low N2 cultures. The partial purification of crude MS AsnA enzyme achieved by 80% ammonium sulfate AS precipitated and CM-Sephadex C-200 gel filtration led to increases in the purification of enzyme with 5.28 and 10.91 times as great as that in SM crude enzymes. Optimum pH and temperature of purified AsnA for the hydrolyzate were 8.5 and 37 ± 0.2°C, respectively. To the best of our knowledge, this is the first report on L-asparaginase production in S. maxima. PMID:27525017

  15. Optimization of Growth Conditions for Purification and Production of L-Asparaginase by Spirulina maxima

    Directory of Open Access Journals (Sweden)

    Hanaa H. Abd El Baky


    Full Text Available L-asparaginase (L-AsnA is widely distributed among microorganisms and has important applications in medicine and in food technology sectors. Therefore, the ability of the production, purification, and characterization of AsnA from Spirulina maxima (SM were tested. SM cultures grown in Zarrouk medium containing different N2 (in NaNO3 form concentrations (1.25, 2.50, and 5.0 g/L for 18 days contained a significant various quantity of dry biomass yields and AsnA enzyme levels. MS L-AsnA activity was found to be directly proportional to the N2 concentration. The cultures of SM at large scales (300 L medium, 5 g/L N2 showed a high AsnA enzyme activity (898 IU, total protein (405 mg/g, specific enzyme activity (2.21 IU/mg protein, and enzyme yield (51.28 IU/L compared with those in low N2 cultures. The partial purification of crude MS AsnA enzyme achieved by 80% ammonium sulfate AS precipitated and CM-Sephadex C-200 gel filtration led to increases in the purification of enzyme with 5.28 and 10.91 times as great as that in SM crude enzymes. Optimum pH and temperature of purified AsnA for the hydrolyzate were 8.5 and 37 ± 0.2°C, respectively. To the best of our knowledge, this is the first report on L-asparaginase production in S. maxima.

  16. Chemical and biological characterization of wastewater generated from hydrothermal liquefaction of Spirulina. (United States)

    Pham, Mai; Schideman, Lance; Scott, John; Rajagopalan, Nandakishore; Plewa, Michael J


    Hydrothermal liquefaction (HTL) is an attractive method for converting wet biomass into petroleum-like biocrude oil that can be refined to make petroleum products. This approach is advantageous for conversion of low-lipid algae, which are promising feedstocks for sustainable large-scale biofuel production. As with natural petroleum formation, the water in contact with the produced oil contains toxic compounds. The objectives of this research were to: (1) identify nitrogenous organic compounds (NOCs) in wastewater from HTL conversion of Spirulina; (2) characterize mammalian cell cytotoxicity of specific NOCs, NOC mixture, and the complete HTL wastewater (HTL-WW) matrix; and (3) investigate mitigation measures to reduce toxicity in HTL-WW. Liquid-liquid extraction and nitrogen-phosphorus detection was used in conjunction with gas chromatography-mass spectrometry (GC-MS), which detected hundreds of NOCs in HTL-WW. Reference materials for nine of the most prevalent NOCs were used to identify and quantify their concentrations in HTL-WW. Mammalian cell cytotoxicity of the nine NOCs was quantified using a Chinese hamster ovary (CHO) cell assay, and the descending rank order for cytotoxicity was 3-dimethylamino-phenol > 2,2,6,6-tetramethyl-4-piperidone > 2,6-dimethyl-3-pyridinol > 2-picoline > pyridine > 1-methyl-2-pyrrolidinone > σ-valerolactam > 2-pyrrolidinone > ε-caprolactam. The organic mixture extracted from HTL-WW expressed potent CHO cell cytotoxic activity, with a LC(50) at 7.5% of HTL-WW. Although the toxicity of HTL-WW was substantial, 30% of the toxicity was removed biologically by recycling HTL-WW back into algal cultivation. The remaining toxicity of HTL-WW was mostly eliminated by subsequent treatment with granular activated carbon.

  17. Functional Lycopene Cyclase (CruA) in Cyanobacterium, Arthrospira platensis NIES-39, and its Role in Carotenoid Synthesis. (United States)

    Sugiyama, Kenjiro; Ebisawa, Masashi; Yamada, Masaharu; Nagashima, Yoshiki; Suzuki, Hideyuki; Maoka, Takashi; Takaichi, Shinichi


    The genus Arthrospira is filamentous, non-nitrogen-fixing cyanobacteria that is commercially important. We identified the molecular structures of carotenoids in Arthrospira platensis NIES-39. The major carotenoid identified was β-carotene. In addition, the hydroxyl derivatives of β-cryptoxanthin and (3R,3'R)-zeaxanthin were also found to be present. The carotenoid glycosides were identified as (3R,2'S)-myxol 2'-methylpentoside and oscillol 2,2'-dimethylpentoside. The methylpentoside moiety was a mixture of fucoside and chinovoside in an approximate ratio of 1 : 4. Trace amounts of the ketocarotenoid 3'-hydroxyechinenone were also found. Three types of lycopene cyclases have been functionally confirmed in carotenogenesis organisms. In cyanobacteria, the functional lycopene cyclases (CrtL, CruA and CruP) have only been found in four species. In this study, we found that CruA exhibited lycopene cyclase activity in transformed Escherichia coli, which contains lycopene, but CruP exhibited no lycopene cyclase activity and crtL was absent. This is the third cyanobacterial species in which CruA activity has been confirmed. Neurosporene was not a substrate of CruA in E. coli, whereas lycopene cyclases of CrtY (bacteria), CrtL (plants) and CrtYB (fungi) have been reported to convert neurosporene to 7,8-dihydro-β-carotene. β-Carotene hydroxylase (CrtR) was found to convert β-carotene to zeaxanthin in transformed E. coli, which contains β-carotene. Among the β-carotene hydroxylases, bacterial CrtZ and eukaryotic CrtR and BCH have similarities, whereas cyanobacterial CrtR appears to belong to another clade. Based on the identification of the carotenoids and the completion of the entire nucleotide sequence of the A. platensis NIES-39 genome, we propose a biosynthetic pathway for the carotenoids as well as the corresponding genes and enzymes. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved

  18. Chemical absorption and CO2 biofixation via the cultivation of Spirulina in semicontinuous mode with nutrient recycle. (United States)

    da Rosa, Gabriel Martins; Moraes, Luiza; Cardias, Bruna Barcelos; de Souza, Michele da Rosa Andrade Zimmermann; Costa, Jorge Alberto Vieira


    The chemical absorption of carbon dioxide (CO2) is a technique used for the mitigation of the greenhouse effect. However, this process consumes high amounts of energy to regenerate the absorbent and to separate the CO2. CO2 removal by microalgae can be obtained via the photosynthesis process. The objective of this study was to investigate the cultivation and the macromolecules production by Spirulina sp. LEB 18 with the addition of monoethanolamine (MEA) and CO2. In the cultivation with MEA, were obtained higher results of specific growth rate, biomass productivity, CO2 biofixation, CO2 use efficiency, and lower generation time. Besides this, the carbohydrate concentration obtained at the end of this assay was approximately 96.0% higher than the control assay. Therefore, Spirulina can be produced using medium recycle and the addition of MEA, thereby promoting the reduction of CO2 emissions and showing potential for areas that require higher concentrations of carbohydrates, such as in bioethanol production. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Spirulina maxima Extract Prevents Neurotoxicity via Promoting Activation of BDNF/CREB Signaling Pathways in Neuronal Cells and Mice. (United States)

    Koh, Eun-Jeong; Seo, Young-Jin; Choi, Jia; Lee, Hyeon Yong; Kang, Do-Hyung; Kim, Kui-Jin; Lee, Boo-Yong


    Spirulina maxima is a microalgae which contains flavonoids and other polyphenols. Although Spirulina maxima 70% ethanol extract (SM70EE) has diverse beneficial effects, its effects on neurotoxicity have not been fully understood. In this study, we investigated the neuroprotective effects of SM70EE against trimethyltin (TMT)-induced neurotoxicity in HT-22 cells. SM70EE inhibited the cleavage of poly-ADP ribose polymerase (PARP). Besides, ROS production was decreased by down-regulating oxidative stress-associated enzymes. SM70EE increased the factors of brain-derived neurotrophic factor (BDNF)/cyclic AMPresponsive elementbinding protein (CREB) signalling pathways. Additionally, acetylcholinesterase (AChE) was suppressed by SM70EE. Furthermore, we investigated whether SM70EE prevents cognitive deficits against scopolamine-induced neurotoxicity in mice by applying behavioral tests. SM70EE increased step-through latency time and decreased the escape latency time. Therefore, our data suggest that SM70EE may prevent TMT neurotoxicity through promoting activation of BDNF/CREB neuroprotective signaling pathways in neuronal cells. In vivo study, SM70EE would prevent cognitive deficits against scopolamine-induced neurotoxicity in mice.

  20. The role of peptides derived from Spirulina maxima in downregulation of FcεRI-mediated allergic responses. (United States)

    Vo, Thanh-Sang; Ngo, Dai-Hung; Kang, Kyong-Hwa; Park, Sun-Joo; Kim, Se-Kwon


    Spirulina has been found suitable for use as a bioactive additive. It is an excellent source of protein that can be hydrolyzed into bioactive peptides. Two peptides LDAVNR (P1) and MMLDF (P2) purified from enzymatic hydrolysate of Spirulina maxima have been reported to be effective against early atherosclerotic responses. In this study, the intracellular mechanism involved in the downregulation of these peptides on high-affinity IgE receptor-mediated allergic reaction was further investigated. RBL-2H3 mast cells were pretreated with P1 or P2 and sensitized with dinitrophenyl-specific IgE antibody before stimulation of antigen dinitrophenyl-BSA. It was revealed that P1 and P2 exhibited significant inhibition on mast-cell degranulation via decreasing histamine release and intracellular Ca(2+) elevation. The inhibitory activity of P1 was found due to blockade of calcium- and microtubule-dependent signaling pathways. Meanwhile, the inhibition of P2 was involved in suppression of phospholipase Cγ activation and reactive oxygen species production. Moreover, the suppressive effects of P1 and P2 on generation of IL-4 were evidenced via depression of nuclear factor-κB translocation. These findings indicate that peptides P1 and P2 from S. maxima may be promising candidates of antiallergic therapeutics, contributing to development of bioactive food ingredients for amelioration of allergic diseases. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Role of Spirulina in mitigating hemato-toxicity in Swiss albino mice exposed to aluminum and aluminum fluoride. (United States)

    Sharma, Shweta; Sharma, K P; Sharma, Subhasini


    Aluminum is ingested through foods, water, air, and even drugs. Its intake is potentiated further through foods and tea prepared in aluminum utensils and Al salt added in the drinking water for removal of suspended impurities and also fluoride in the affected areas. The ameliorating role of a blue green alga Spirulina is well documented to various pollutants in the animal models. We, therefore, examined its protective role (230 mg/kg body weight) on the hematology of male Swiss albino mice treated with aluminum (sub-acute = 78.4 mg/kg body weight for 7 days, sub-chronic = 7.8 mg/kg body weight for 90 days) and aluminum fluoride (sub-acute = 103 mg/kg body weight, sub-chronic = 21 mg/kg body weight), along with their recovery after 90 days of sub-chronic exposure. This study revealed significant reduction in the values of RBC (5-18 %), Hb (15-17 %), PCV (8-14 %), and platelets (26-36 %), and increase in WBC (54-124 %) in the treated mice, particularly after sub-acute exposure. Aluminum fluoride was comparatively more toxic than aluminum. Further, Spirulina supplement not only alleviated toxicity of test chemicals in Swiss albino mice but also led to their better recovery after withdrawal.

  2. Low-parachor solvents extraction and thermostated micro-thin-layer chromatography separation for fast screening and classification of spirulina from pharmaceutical formulations and food samples. (United States)

    Zarzycki, Paweł K; Zarzycka, Magdalena B; Clifton, Vicki L; Adamski, Jerzy; Głód, Bronisław K


    The goal of this paper is to demonstrate the separation and detection capability of eco-friendly micro-TLC technique for the classification of spirulina and selected herbs from pharmaceutical and food products. Target compounds were extracted using relatively low-parachor liquids. A number of the spirulina samples which originated from pharmaceutical formulations and food products, were isolated using a simple one step extraction with small volume of methanol, acetone or tetrahydrofuran. Herb samples rich in chlorophyll dyes were analyzed as reference materials. Quantitative data derived from micro-plates under visible light conditions and after iodine staining were explored using chemometrics tools including cluster analysis and principal components analysis. Using this method we could easily distinguish genuine spirulina and non-spirulina samples as well as fresh from expired commercial products and furthermore, we could identify some biodegradation peaks appearing on micro-TLC profiles. This methodology can be applied as a fast screening or fingerprinting tool for the classification of genuine spirulina and herb samples and in particular may be used commercially for the rapid quality control screening of products. Furthermore, this approach allows low-cost fractionation of target substances including cyanobacteria pigments in raw biological or environmental samples for preliminary chemotaxonomic investigations. Due to the low consumption of the mobile phase (usually less than 1 mL per run), this method can be considered as environmentally friendly analytical tool, which may be an alternative for fingerprinting protocols based on HPLC machines and simple separation systems involving planar micro-fluidic or micro-chip devices. Copyright © 2011 Elsevier B.V. All rights reserved.

  3. Analysis of β-N-methylamino-L-alanine (BMAA) in spirulina-containing supplements by liquid chromatography-tandem mass spectrometry. (United States)

    McCarron, Pearse; Logan, Alan C; Giddings, Sabrina D; Quilliam, Michael A


    Over the last decade the amino acid beta-N-methylamino-L-alanine (BMAA) has come under intense scrutiny. International laboratory and epidemiological research continues to support the hypothesis that environmental exposure to BMAA (e.g., through dietary practices, water supply) can promote the risk of various neurodegenerative diseases. A wide variety of cyanobacteria spp. have previously been reported to produce BMAA, with production levels dependent upon species, strain and environmental conditions. Since spirulina (Arthrospira spp.) is a member of the cyanobacteria phylum frequently consumed via dietary supplements, the presence of BMAA in such products may have public health implications. In the current work, we have analyzed ten spirulina-containing samples for the presence of BMAA; six pure spirulina samples from two separate raw materials suppliers, and four commercially-available multi-ingredient products containing 1.45 g of spirulina per 8.5 g serving. Because of controversy surrounding the measurement of BMAA, we have used two complementary liquid chromatography-tandem mass spectrometry (LC-MS/MS) methods: one based on reversed phase LC (RPLC) with derivatization and the other based on hydrophilic interaction LC (HILIC). Potential matrix effects were corrected for by internal standardization using a stable isotope labeled BMAA standard. BMAA was not detected at low limits of detection (80 ng/g dry weight) in any of these product samples. Although these results are reassuring, BMAA analyses should be conducted on a wider sample selection and, perhaps, as part of ongoing spirulina production quality control testing and specifications.

  4. From malnutrition to HIV: spirulina is an effective solution which continues to reveal its secrets De la malnutrition au VIH : la spiruline arme efficace qui n’en finit pas de livrer ses secrets De la malnutrición al VIH: la espirulina como arma eficaz que no cesa de revelar secretos


    Raphaëlle Birot; Diane de Jouvencel; Laetitia Raginel; Geneviève Rouillé


    Spirulina presents major advantages in the fight against chronic malnutrition based on its micronutrient composition, its health potential and the fact that it can be grown locally. International solidarity associations, such as Antenna Technologies and Entrepreneurs du Monde whose goal is to reduce extreme poverty and public health problems in developing countries, have undertakenproduction and distribution programmes of spirulina, especially in West Africa. The quality of spirulina produced...

  5. Acute toxicity of excess mercury on the photosynthetic performance of cyanobacterium, S. platensis--assessment by chlorophyll fluorescence analysis. (United States)

    Lu, C M; Chau, C W; Zhang, J H


    Measurement of chlorophyll fluorescence has been shown to be a rapid, non-invasive, and reliable method to assess photosynthetic performance in a changing environment. In this study, acute toxicity of excess Hg on the photosynthetic performance of the cyanobacterium S. platensis, was investigated by use of chlorophyll fluorescence analysis after cells were exposed to excess Hg (up to 20 microM) for 2 h. The results determined from the fast fluorescence kinetics showed that Hg induced a significant increase in the proportion of the Q(B)-non-reducing PSII reaction centers. The fluorescence parameters measured under the steady state of photosynthesis demonstrated that the increase of Hg concentration led to a decrease in the maximal efficiency of PSII photochemistry, the efficiency of excitation energy capture by the open PSII reaction centers, and the quantum yield of PSII electron transport. Mercury also resulted in a decrease in the coefficients of photochemical and non-photochemical quenching. Mercury may have an acute toxicity on cyanobacteria by inhibiting the quantum yield of photosynthesis sensitively and rapidly. Such changes occurred before any other visible damages that may be evaluated by other conventional measurements. Our results also demonstrated that chlorophyll fluorescence analysis can be used as a useful physiological tool to assess early stages of change in photosynthetic performance of algae in response to heavy metal pollution.

  6. Chlorophyll concentration assays

    African Journals Online (AJOL)



    May 10, 2012 ... compounds, seven algal species belonging to cyanobacteria such as Spirulina platensis, ... Key words: Algae isolation, scanning electron microscope, ..... Antibacterial properties of extracts from selected planktonic fresh.

  7. 1750-IJBCS-Article-Henri Gautier

    African Journals Online (AJOL)



    Jan 2, 2012 ... Effects of spirulina supplementation on selected anthropometric, biochemical, and ... up periods will be necessary to test these assumptions. ... platensis), an edible microalgae, is naturally ..... biliprotein with antioxidant, anti- ...

  8. [Pb(NO3)2 and Pb(CH3COO)2] on growth, biomass and proline in ...

    African Journals Online (AJOL)



    Dec 14, 2011 ... Spirulina platensis growth parameters [chlorophyll a (chl a) and dry-wet weight] effects on proline ... between lead accumulation in the test algae and low pH which ... vitamins, antioxidants and immunositimulants for both.

  9. Research Article Special Issue

    African Journals Online (AJOL)


    Jun 15, 2016 ... rats were accidentally divided into the control, sham and test group ... cadmium chloride due to abundant antioxidant property. ..... Karadeniz A, Cemek M, Simsek N. The effects of Panax ginseng and Spirulina platensis on.

  10. Impact of physico-chemical parameters on the physiological growth ...

    African Journals Online (AJOL)

    Impact of physico-chemical parameters on the physiological growth of Arthrospira (Spirulina platensis) exogenous strain UTEXLB2340. Yahia Mustafa A Fagiri, Aisha Salleh, Saifeldin Ahmed F El-Nagerabi ...

  11. African Journal of Biotechnology - Vol 13, No 14 (2014)

    African Journals Online (AJOL)

    Production of Spirulina platensis by adding sodium bicarbonate and urea into chicken manure medium · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Hilal Kargin Yilmaz, Ozlem Sezgin ...

  12. Species-specific differences of the spectroscopic properties of P700 - Analysis of the influence of non-conserved amino acid residues by site-directed mutagenesis of photosystem I from Chlamydomonas reinhardtii

    NARCIS (Netherlands)

    Witt, H.; Bordignon, E.; Carbonera, D.; Dekker, J.P.; Karapetyan, N.; Teutloff, C.; Webber, A.; Lubitz, W.; Schlodder, E.


    We applied optical spectroscopy, magnetic resonance techniques, and redox titrations to investigate the properties of the primary electron donor P700 in photosystem I (PS I) core complexes from cyanobacteria (Thermosynechococcus elongatus, Spirulina platensis, and Synechocystis sp. PCC 6803), algae

  13. Influência da ingestão de espirulina sobre o metabolismo de ratos exercitados Influencia de ingestión de Spirulina sobre el metabolismo de ratones exercitados Influence of spirulina intake on metabolism of exercised rats

    Directory of Open Access Journals (Sweden)

    Gustavo Puggina Rogatto


    Full Text Available No presente estudo foram comparadas as respostas metabólicas agudas ao exercício em ratos alimentados com dieta padrão e à base de espirulina. Ratos Wistar jovens foram divididos em dois grupos de acordo com a dieta: controle (C (dieta padrão e espirulina (S (dieta à base de espirulina. Ao final do período experimental (cinco semanas os animais foram submetidos a uma sessão aguda de exercício de natação (20 minutos, suportando sobrecarga equivalente a 5% do peso corporal para avaliação do lactato sanguíneo, glicose, insulina, proteínas, albumina e ácidos graxos livres (AGL séricos. Amostras do músculo gastrocnêmio e fígado foram utilizadas para determinação dos teores de glicogênio e lipídeos. Ambos os grupos C e S apresentaram aumento da glicemia e dos AGL, queda da insulinemia e redução dos teores de glicogênio muscular e hepático pós-exercício. A lactacidemia durante o exercício foi superior no grupo S em relação ao C. Conclui-se que o padrão de respostas ao exercício agudo dos grupos C e S foi semelhante. Contudo, a proteína da dieta pareceu influenciar aspectos do metabolismo glicídico.En el presente estudio fueron comparadas las respuestas metabólicas agudas al ejercicio en ratones alimentados con dieta padrón y a base de Spirulina. Ratones Wistar jovenes fueron divididos en dos grupos de acuerdo con la dieta: control (C (dieta padrón y Spirulina (S (dieta a base de Spirulina. Al final del período experimental (5 semanas los animales fueron sometidos a una sesión aguda de ejercício de natación (20 minutos, soportando sobrecarga equivalente a 5% de su peso corporal para evaluación del lactato sanguíneo, glucosa, insulina, proteínas, albumina y ácidos grasos libres (AGL séricos. Las muestras del músculo gastrocnemio y fígado fueron utilizadas para la determinación de los tenores de glicogeno y de lípidos. Ambos grupos C e S presentaron un aumento de la glicemia y de los AGL, mantenimiento

  14. The feasibility of using complex wastewater from a monosodium glutamate factory to cultivate Spirulina subsalsa and accumulate biochemical composition. (United States)

    Jiang, Liqun; Pei, Haiyan; Hu, Wenrong; Ji, Yan; Han, Lin; Ma, Guixia


    This paper is mainly observations on the growth and biomass accumulation of Spirulina subsalsa in modified Zarrouk medium supplemented with complex wastewater (CW, from a monosodium glutamate factory) in different concentrations. High ammonia in 75% and 100% CW inhibits algae growth, but maximum biomass production (2.86mgL(-1)) was obtained in 25% CW (concentration of CW in medium was 25%). Different CW concentration promoted biomass composition accumulation at different degrees, 41% of protein content in 25% CW and 18% of carbohydrate in 50% CW. In terms of economy, a concentration of 25% CW was suitable for protein production and 50% for lipid and carbohydrate production. These results suggested that CW is a feasible replacement in part for cultivation of S. subsalsa to economize input of water and nutrients. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Antioxidant effect of Spirulina (Arthrospira) maxima in a neurotoxic model caused by 6-OHDA in the rat striatum. (United States)

    Tobón-Velasco, J C; Palafox-Sánchez, Victoria; Mendieta, Liliana; García, E; Santamaría, A; Chamorro-Cevallos, G; Limón, I Daniel


    There is evidence to support that an impaired energy metabolism and the excessive generation of reactive oxygen species (ROS) contribute to brain injury in neurodegenerative disorders such as Parkinson's disease (PD), whereas diets enriched in foods with an antioxidant action may modulate its progression. Several studies have proved that the antioxidant components produced by Spirulina, a microscopic blue-green alga, might prevent cell death by decreasing free radicals, inhibiting lipoperoxidation and upregulating the antioxidant enzyme systems. In our study, we investigated the protective effect of the Spirulina maxima (S. maxima) against the 6-OHDA-caused toxicity in the rat striatum. The S. maxima (700 mg/kg/day, vo) was administered for 40 days before and 20 days after a single injection of 6-OHDA (16 μg/2 μL) into the dorsal striatum. At 20-day postsurgery, the brain was removed and the striatum was obtained to evaluate the indicators of toxicity, such as nitric oxide levels, ROS formation, lipoperoxidation, and mitochondrial activity. These variables were found significantly stimulated in 6-OHDA-treated rats and were accompanied by declines in dopamine levels and motor activity. In contrast, the animals that received the chronic treatment with S. maxima had a restored locomotor activity, which is associated with the decreased levels of nitric oxide, ROS, and lipoperoxidation in the striatum, although mitochondrial functions and dopamine levels remained preserved. These findings suggest that supplementation with antioxidant phytochemicals (such as contained in S. maxima) represents an effective neuroprotective strategy against 6-OHDA-caused neurotoxicity vía free radical production to preserve striatal dopaminergic neurotransmission in vivo.

  16. h5-HT1B receptor-mediated constitutive Gαi3-protein activation in stably transfected Chinese hamster ovary cells: an antibody capture assay reveals protean efficacy of 5-HT (United States)

    Newman-Tancredi, Adrian; Cussac, Didier; Marini, Laetitia; Touzard, Manuelle; Millan, Mark J


    Serotonin 5-HT1B receptors couple to G-proteins of the Gi/o family. However, their activation of specific G-protein subtypes is poorly characterised. Using an innovative antibody capture/guanosine-5′-0-(3-[35S]thio)-triphosphate ([35S]GTPγS) binding strategy, we characterised Gαi3 subunit activation by h5-HT1B receptors stably expressed in Chinese hamster ovary (CHO) cells. The agonists, 5-HT, alniditan and BMS181,101, stimulated Gαi3, whereas methiothepin and SB224,289 behaved as inverse agonists. The selective 5-HT1B receptor ligand, S18127, modestly stimulated Gαi3 and reversed the actions of both 5-HT and methiothepin. S18127 (1 μM) also produced parallel, dextral shifts of the 5-HT and methiothepin isotherms. Isotopic dilution experiments ([35S]GTPγS versus GTPγS) revealed high-affinity [35S]GTPγS binding to Gαi3 subunits in the absence of receptor ligands indicating constitutive activity. High-affinity [35S]GTPγS binding was increased 2.8-fold by 5-HT with an increase in the affinity of GTPγS for Gαi3 subunits. In contrast, methiothepin halved the number of high-affinity binding sites and decreased their affinity. h5-HT1B receptor-mediated Gαi3 subunit activation was dependent on the concentration of NaCl. At 300 mM, 5-HT stimulated [35S]GTPγS binding, basal Gαi3 activation was low and methiothepin was inactive. In contrast, at 10 mM NaCl, basal activity was enhanced and the inverse agonist activity of methiothepin was accentuated. Under these conditions, 5-HT decreased Gαi3 activation. In conclusion, at h5-HT1B receptors expressed in CHO cells: (i) inverse agonist induced inhibition of Gαi3, and its reversal by S18127, reveals constitutive activation of this Gα subunit; (ii) constitutive Gαi3 activation can be quantified by isotopic dilution [35S]GTPγS binding and (iii) decreasing NaCl concentrations enhances Gαi3 activation and leads to protean agonist properties of 5-HT: that is a switch to inhibition of Gαi3. PMID:12684263

  17. h5-HT(1B) receptor-mediated constitutive Galphai3-protein activation in stably transfected Chinese hamster ovary cells: an antibody capture assay reveals protean efficacy of 5-HT. (United States)

    Newman-Tancredi, Adrian; Cussac, Didier; Marini, Laetitia; Touzard, Manuelle; Millan, Mark J


    ) activation and leads to protean agonist properties of 5-HT: that is a switch to inhibition of Galpha(i3).

  18. Genotypic diversity of oscillatoriacean strains belonging to the genera Geitlerinema and Spirulina determined by 16S rDNA restriction analysis. (United States)

    Margheri, Maria C; Piccardi, Raffaella; Ventura, Stefano; Viti, Carlo; Giovannetti, Luciana


    Genotypic diversity of several cyanobacterial strains mostly isolated from marine or brackish waters, belonging to the genera Geitlerinema and Spirulina, was investigated by amplified 16S ribosomal DNA restriction analysis and compared with morphological features and response to salinity. Cluster analysis was performed on amplified 16S rDNA restriction profiles of these strains along with profiles obtained from sequence data of five Spirulina-like strains, including three representatives of the new genus Halospirulina. Our strains with tightly coiled trichomes from hypersaline waters could be assigned to the Halospirulina genus. Among the uncoiled strains, the two strains of hypersaline origin clustered together and were found to be distant from their counterparts of marine and freshwater habitat. Moreover, another cluster, formed by alkali-tolerant strains with tightly coiled trichomes, was well delineated.

  19. Characterization and pyrolysis of Chlorella vulgaris and Arthrospira platensis: potential of bio-oil and chemical production by Py-GC/MS analysis. (United States)

    Almeida, Hanna N; Calixto, Guilherme Q; Chagas, Bruna M E; Melo, Dulce M A; Resende, Fabio M; Melo, Marcus A F; Braga, Renata Martins


    Biofuels have been seen as potential sources to meet future energy demand as a renewable and sustainable energy source. Despite the fact that the production technology of first-generation biofuels is consolidated, these biofuels are produced from foods crops such as grains, sugar cane, and vegetable oils competing with food for crop use and agricultural land. In recent years, it was found that microalgae have the potential to provide a viable alternative to fossil fuels as source of biofuels without compromising food supplies or arable land. On this scenario, this paper aims to demonstrate the energetic potential to produce bio-oil and chemicals from microalgae Chlorella vulgaris and Arthrospira platensis. The potential of these biomasses was evaluated in terms of physical-chemical characterization, thermogravimetric analysis, and analytical pyrolysis interfaced with gas chromatograph (Py-GC/MS). The results show that C. vulgaris and A. platensis are biomasses with a high heating value (24.60 and 22.43 MJ/kg) and low ash content, showing a high percentage of volatile matter (72.49 and 79.42%). These characteristics confirm their energetic potential for conversion process through pyrolysis, whereby some important aromatic compounds such as toluene, styrene, and phenol were identified as pyrolysis products, which could turn these microalgae a potential for biofuels and bioproduct production through the pyrolysis.

  20. Oxidative Stability and Physico-chemical Properties of Meat from Broilers Fed with Dietary Neem Leaf Powder, Spirulina and their Combination

    Directory of Open Access Journals (Sweden)

    Ravi KILLI


    Full Text Available This 6 week study was conducted to evaluate the antioxidant potential, maintaining quality and sensory properties of broiler meat from birds fed on dietary neem leaf powder (NLP. A total of 90 Vencobb broiler chicks were randomly allotted to 6 groups of 15 birds in each. Dietary treatments consisted of normal diet (control Group I, feed containing terramycin-200 (TM-200* at the concentration of 0.05% (Group II, feed containing NLP of 0.2% (Group III, feed containing NLP of 0.2% and spirulina of 1% (Group IV, feed containing TM-200 at 0.05% and spirulina of 1% (Group V and feed containing spirulina of 1% (Group VI. At the end of the experiment liver, kidney and muscle samples were collected to evaluate the tissue peroxidation (TBARS and protein carbonyls and antioxidant markers (SOD. Physico-chemical quality determinants of both fresh and preserved meat viz. extract release volume (ERV, water holding capacity (WHC and pH were also studied. TBARS protein carbonyls indicated a significant (P < 0.05 decrease in all the treated groups when compared to control. Superoxide dismutase levels were found to be significantly increased in all the treated groups, in all the tissues collected. Compared to control group, favorable physico-chemical quality determinants were recorded in all the treated groups. The sensory attributes did not show significant (P < 0.05 differences for color, flavor, juiciness, tenderness and overall acceptability. This study indicates enhanced stress tolerance levels, improved meat quality with unaffected consumer acceptance levels of the meat observed in the study, from broilers fed with neem and spirulina either alone or in combinationsș this points out that neem at 0.2% level can be used in poultry diets instead of antibiotic growth promoters (AGP.

  1. The Effect of a combination of 12% spirulina and 20% chitosan on macrophage, PMN, and lymphocyte cell expressions in post extraction wound

    Directory of Open Access Journals (Sweden)

    Nike Hendrijantini


    Full Text Available Background: Tooth extraction is the ultimate treatment option for defective teeth followed by the need for dentures. Inflammation is one phase of the healing process that should be minimized in order to preserve alveolar bone for denture support. Macrophage, PMN and lymphocyte cells are indicators of acute inflammation. Spirulina and chitosan are natural compounds with the potential to be anti-inflammatory agents. Purpose: This research aimed to determine macrophage, PMN and lymphocyte cells of animal models treated with a combination of 12% spirulina and 20% chitosan on the 1st, 2nd and 3rd post-extraction day. Methods: Animal models were randomly divided into control (K and treatment (P groups. Each group was further divided into three subgroups (KI, KII, KIII and PI, PII, PIII. The post-extraction sockets of the control group animals were then filled with CMC Na 3%. Meanwhile, the post-extraction sockets of the treatment group members were filled with a combination of 12% spirulina and 20% chitosan. Subsequently, the number of PMN, macrophage and lymphocyte cells was analyzed by means of HE analysis on the 1st., 2nd. and 3rd. days. Statistical analysis was then performed using a T-test. Results: There was a decrease in PMN cells and an increase in macrophage and lymphocyte cells on Days 1, 2, and 3. Conclusion: It can be concluded that a combination of 12% spirulina and 20% chitosan can not only decrease PMN cells, but can also increase macrophage and lymphocyte cells on Days 1, 2 and 3 after tooth extraction.

  2. Spirulina Supplements Improved the Nutritional Status of Undernourished Children Quickly and Significantly: Experience from Kisantu, the Democratic Republic of the Congo

    Directory of Open Access Journals (Sweden)

    Féfé Khuabi Matondo


    Full Text Available Aim. Despite high levels of malnutrition, there is still very little information on the nutritional benefits of Spirulina, a natural alga that provides essential amino acids, rare essential lipids, and numerous minerals and vitamins, to undernourished children in the world. Methods. We carried out a prospective study of 50 children aged between six and 60 months. The intervention group consisted of 16 children who received 10 g of Spirulina daily, as well as the local diet administered by the nutritional centre, and the control group of 34 children who just received the local diet. Both groups of children were assessed on day zero, day 15, and day 30. Results. After treatment, the weight-for-age Z scores and weight-for-height Z scores increased significantly in the intervention group. At day 15, there was a statistically significant difference between the mean corpuscular volume, total proteins, and albumin (p<0.05 in both groups, in favour of the intervention group, and at day 30, this difference extended to all of the studied parameters (p<0.05. Conclusion. This study found that the nutritional status of undernourished children who received Spirulina supplements as well as the local diet administered by the nutritional centre improved quickly and significantly.

  3. 2716-IJBCS-Article-Laurencia Toulsoumde SONGRE-OUATTARA

    African Journals Online (AJOL)


    Use of the moringa, spirulina, orange-fleshed sweet potato and a multivitamin complex in the manufacture ... spiruline (Spirulina platensis) et la patate douce à chair .... utilisant le test d'acceptabilité avec l'épreuve ...... Antioxidant properties of ...

  4. Protean appearance of craniopharyngioma on computed tomography

    International Nuclear Information System (INIS)

    Danziger, A.; Price, H.I.


    Craniopharyngiomas present a diverse appearance on computed tomography. Histological diagnosis is not always possible, but computed tomography is of great assistance in the delineation of the tumour as well as of the degree of associated hydrocephalus. Computed tomography also enables rapid non-invasive follow-up after surgery or radiotherapy, or both

  5. Fusarium graminearum growth inhibition mechanism using phenolic compounds from Spirulina sp Mecanismo de inibição de Fusarium graminearum por compostos fenólicos extraídos de Spirulina sp

    Directory of Open Access Journals (Sweden)

    Fernanda Arnhold Pagnussatt


    Full Text Available The application of natural antifungal substances is motivated by the need for alternatives to existing methods that are not always applicable, efficient, or that do not pose risk to consumers or the environment. Furthermore, studies on the behaviour of toxigenic species in the presence of natural fungicides have enabled their safe application in the food chain In this study, Spirulina LEB-18 phenolic extract was assessed for its antifungal activity on 12 toxigenic strains of Fusarium graminearum isolated from barley and wheat. The susceptible metabolic pathways were assessed through the determination of structural compounds (glucosamine and ergosterol and enzyme activity of the microorganisms' primary metabolism. The results indicate that phenolic extracts reduced the growth rate of the toxigenic species investigated. The IC50 was obtained by applying 3 to 8% (p/p of phenolic compounds in relation to the culture medium. The use of this natural fungicide proved promising for the inhibition of fungal multiplication, especially in terms of the inactivation of enzymatic systems (amylase and protease of Fusarium graminearum.A aplicação de substâncias naturais com efeito antifúngico é motivada pela necessidade de alternativas aos métodos existentes que nem sempre são aplicáveis, eficientes ou sem risco de danos ao consumidor ou meio ambiente. Além disso, estudos para elucidar o comportamento de espécies toxigênicas mediante fungicidas naturais tornam-se necessárias, contribuindo dessa forma com a segurança alimentar. Neste trabalho, extrato fenólico de Spirulina foi utilizado para avaliar a atividade antifúngica sobre 12 cepas toxigênicas de Fusarium graminearum, isoladas de cevada e trigo. As rotas metabólicas que poderiam ser afetadas foram avaliadas através da determinação de compostos estruturais (glicosamina e ergosterol e da atividade de enzimas do metabolismo primário dos micro-organismos. Os resultados indicaram que os

  6. Perfil metabólico de Aegla platensis Schmitt, (Crustacea, Aeglidae, Anomura submetida a dietas ricas em carboidratos ou proteínas Metabolic profile of Aegla platensis Schmitt, (Crustacea, Anomura submitted to carbohydrate-rich or high-protein diets

    Directory of Open Access Journals (Sweden)

    Bibiana Della P. Ferreira


    Full Text Available O objetivo desse estudo foi avaliar o efeito de uma dieta rica em carboidratos e uma dieta rica em proteínas sobre o metabolismo de Aegla platensis, um caranguejo anomuro de água doce. Os animais foram coletados no Arroio do Mineiro, município de Taquara, Rio Grande do Sul, em agosto/2002 e janeiro/2003, e foram alimentados durante 15 dias com carne bovina crua e arroz branco, em aquários aerados. O fotoperíodo foi controlado: 12 horas claro - 12 horas escuro. Glicose, proteínas, lipídios e triglicerídios foram dosados na hemolinfa; glicogênio e lipídios foram dosados no hepatopâncreas, brânquias e músculo. Em Aegla platensis, mantida em condições de laboratório, em todos os tecidos estudados pode ser observado que o aporte regular de alimento, bem como o tipo de dieta administrada determinaram um perfil diferenciado de resposta metabólica entre os sexos e o período de realização dos experimentos (inverno e verão.The objective of this study was to assess the effect of a carbohydrate-rich and a high-protein diets on metabolism of Aegla platensis, a freshwater anomuram crab. The animals were collected in Mineiro Creek, Taquara city, Rio Grande do Sul, at august/2002 and january/2003, and were feed during 15 days with crude bovine meat and white rice, in an aerated aquarium. The photoperiod was controlled: 12 hours day - 12 hours night. Glucose, proteins, lipids and triglycerides were dosed in haemolymph; glycogen and lipids were dosed in hepatopancreas, gills and muscle tissues. In Aegla platensis, maintained in laboratory conditions, in all studied tissues can be seen that the regular food intake, as well as the kind of administered diet determinated a differential profile of metabolic response between sexes and the period of the experiments performance (winter and summer.

  7. Exploring the relationship between protean and boundaryless career attitudes and affective commitment through the lens of a fuzzy set QCA methodology Explorando la relación entre las actitudes de carreras protéicas y nómadas y el compromiso afectivo desde la óptica de una metodología basada en lógica difusa

    Directory of Open Access Journals (Sweden)

    Mihaela Enache


    Full Text Available Sweeping changes in employment relationships and organizational structures have challenged traditional career models and gave way to two emerging paradigms to examine professional careers: the protean and the boundaryless career. During the last decades, researchers and practitioners conducted conceptual and empirical research on new career patterns to explore the impact of boundaryless and protean careers upon individual outcomes, such as subjective and objective career success, adaptability and employability. Nevertheless, we have a limited understanding on how new career orientations affect organizational outcomes (such as, for instance, organizational commitment. Therefore, the objective of this research is twofold: (a first, to determine whether the protean and the boundaryless career attitudes analysed have any kind of impact on employees’ affective commitment; and (b second, to offer a guideline to use the fuzzy set methodology to enable conducting research about professional careersLos cambios sustanciales que se han producido en el marco de las relaciones laborales y en las estructuras organizativas han puesto en tela de juicio el modelo tradicional de carreras profesionales, dando lugar a dos nuevos paradigmas emergentes en el estudio de las carreras profesionales: las carreras proteicas y las carreras nómadas. En las últimas décadas, las investigaciones sobre los nuevos modelos de carreras profesionales han examinado el impacto de las actitudes nómadas y proteicas sobre varios resultados a nivel individual como el éxito subjetivo y objetivo, la adaptabilidad y la empleabilidad. Sin embargo, todavía tenemos una visión restringida sobre la influencia de estas actitudes sobre resultados organizativos como, por ejemplo, el compromiso organizativo. Con el objetivo de profundizar en este tipo de influencias, la investigación se propone: (1 determinar si las actitudes proteicas y nómadas tienen algún impacto sobre el compromiso

  8. Chemopreventive and Antioxidant Effect of Polyphenol Free Spirulina maxima and Its Hydrolyzed Protein Content: Investigation on Azoxymethane Treated Mice. (United States)

    Martínez-Palma, Nikte Y; Dávila-Ortiz, Gloria; Jiménez-Martínez, Cristian; Madrigal-Bujaidar, Eduardo; Álvarez-González, Isela


    Spirulina maxima (Sm) is known to have nutritive value as well as a number of potentially useful biomedical properties. The initial purpose of this report was to evaluate the inhibitory effect of the alga (without its polyphenol content), on the induction of azoxymethane (AOM)-induced colon aberrant crypts (AC) in mouse. Besides, we hydrolyzed the protein content of such mixture. Our second aim was to determine the inhibitory potential of this last plant mixture on the AOM-induced colon AC in mouse. Moreover, we also determined the effect of the two indicated Sm samples on the oxidative damage caused by AOM in the colon and liver of treated mice. The experiment lasted 5 weeks. At the end, we registered the level of AC, nitric oxide, and the lipid and protein oxidation. Our results showed the following: (1) the carcinogen increased more than 18 times the amount of the AC found in the control group. (2) On the contrary, the two tested mixtures of Sm produced a significant reduction over this damage (about 45%). (3) The two tested Sm mixtures were generally able to reduce the oxidative stress markers although with variable effects which go from 59% to 100% with respect to the control mice. Therefore, the present report established that the tested Sm fractions have mouse colon anticarcinogenic potential, partially related with their antioxidant capacity. Our report also suggested the need to further evaluate specific Sm chemicals as chemopreventive agents.

  9. Spirulina vesicolor Improves Insulin Sensitivity and Attenuates Hyperglycemia-Mediated Oxidative Stress in Fructose-Fed Rats

    Directory of Open Access Journals (Sweden)

    Walaa Hozayen


    Full Text Available Aim: The current study aimed to investigate the anti-hyperglycemic, anti-hyperlipidemic and insulin sensitizing effects of the cyanobacterium Spirulina vesicolor extract in fructose-fed rats. Materials and Methods: Rats were fed 30% fructose solution in drinking water for 4 weeks. Animals exhibited hyperglycemia and hyperinsulinemia were selected for further investigations. Diabetic and control rats were orally supplemented with 50 mg/kg body weight S. vesicolor extract for 4 weeks. Results: At the end of 8 weeks, fructose-fed rats showed significant increase in serum glucose, insulin, cholesterol, triglycerides, cardiovascular risk indices and insulin resistance. Treatment of the fructose-fed rats with S. vesicolor extract improved this metabolic profile. Fructose feeding produced a significant increase in serum tumor necrosis factor alpha (TNF-α and a decrease in adiponectin levels. In addition, fructose-fed rats exhibited a significant increase in liver, kidney and heart lipid peroxidation levels, and declined antioxidant defenses. Supplementation of the fructose-fed rats with S. vesicolor extract reversed these alterations. Conclusion: S. vesicolor attenuates hyperglycemia-mediated oxidative stress and inflammation, and is thus effective in improving insulin sensitivity in fructose-fed rats. [J Complement Med Res 2016; 5(1.000: 57-64

  10. Extraction fatty acid as a source to produce biofuel in microalgae Chlorella sp. and Spirulina sp. using supercritical carbon dioxide (United States)

    Tai, Do Chiem; Hai, Dam Thi Thanh; Vinh, Nguyen Hanh; Phung, Le Thi Kim


    In this research, the fatty acids of isolated microalgae were extracted by some technologies such as maceration, Soxhlet, ultrasonic-assisted extraction and supercritical fluid extraction; and analyzed for biodiesel production using GC-MS. This work deals with the extraction of microalgae oil from dry biomass by using supercritical fluid extraction method. A complete study at laboratory of the influence of some parameters on the extraction kinetics and yields and on the composition of the oil in terms of lipid classes and profiles is proposed. Two types of microalgae were studied: Chlorella sp. and Spirulina sp. For the extraction of oil from microalgae, supercritical CO2 (SC-CO2) is regarded with interest, being safer than n-hexane and offering a negligible environmental impact, a short extraction time and a high-quality final product. Whilst some experimental papers are available on the supercritical fluid extraction (SFE) of oil from microalgae, only limited information exists on the kinetics of the process. These results demonstrate that supercritical CO2 extraction is an efficient method for the complete recovery of the neutral lipid phase.

  11. Development and characterization of bioactive edible films from spider crab (Maja crispata) chitosan incorporated with Spirulina extract. (United States)

    Balti, Rafik; Mansour, Mohamed Ben; Sayari, Nadhem; Yacoubi, Lamia; Rabaoui, Lotfi; Brodu, Nicolas; Massé, Anthony


    Active food packaging films based on crab chitosan and Spirulina extract (SE) were developed. The effects of the SE incorporation at different levels on physical (color, opacity water vapor and oxygen permeability) and mechanical (tensile strength and elongation at break) properties of chitosan films were investigated. FTIR was carried out to observe the potential modifications of the chitosan films when incorporated with SE. The obtained results suggested that incorporation of SE into chitosan films improved mechanical and barrier properties. The antioxidant activity of the chitosan/SE films was characterized by means of three different analytical assays (DPPH, FRAP and FIC). Crab chitosan edible films containing SE showed higher antioxidant activity, regardless concentrations and methods assayed. Furthermore, the antioxidant activity occurred in a concentration-dependent manner. The agar disc diffusion method was used to determine the antibacterial activities of chitosan edible films against Escherichia coli, Staphylococcus aureus, Pseudomonas aeruginosa, Listeria monocytogenes, Salmonella typhimurium, Bacillus subtilis and Bacillus cereus. The chitosan/SE films were more effective (pchitosan edible films incorporated with SE showed great potential to be used for active food packaging due to its excellent antioxidant and antibacterial activities. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Spirulina maxima Extract Ameliorates Learning and Memory Impairments via Inhibiting GSK-3β Phosphorylation Induced by Intracerebroventricular Injection of Amyloid-β 1-42 in Mice. (United States)

    Koh, Eun-Jeong; Kim, Kui-Jin; Song, Ji-Hyeon; Choi, Jia; Lee, Hyeon Yong; Kang, Do-Hyung; Heo, Ho Jin; Lee, Boo-Yong


    Spirulina maxima , a microalga containing high levels of protein and many polyphenols, including chlorophyll a and C-phycocyanin, has antioxidant and anti-inflammatory therapeutic effects. However, the mechanisms where by Spirulina maxima ameliorates cognitive disorders induced by amyloid-β 1-42 (Aβ 1-42 ) are not fully understood. In this study, we investigated whether a 70% ethanol extract of Spirulina maxima (SM70EE) ameliorated cognitive impairments induced by an intracerebroventricular injection of Aβ 1-42 in mice. SM70EE increased the step-through latency time in the passive avoidance test and decreased the escape latency time in the Morris water maze test in Aβ 1-42 -injected mice. SM70EE reduced hippocampal Aβ 1-42 levels and inhibited amyloid precursor protein processing-associated factors in Aβ 1-42 -injected mice. Additionally, acetylcholinesterase activity was suppressed by SM70EE in Aβ 1-42 -injected mice. Hippocampal glutathione levels were examined to determine the effects of SM70EE on oxidative stress in Aβ 1-42 -injected mice. SM70EE increased the levels of glutathione and its associated factors that were reduced in Aβ 1-42 -injected mice. SM70EE also promoted activation of the brain-derived neurotrophic factor/phosphatidylinositol-3 kinase/serine/threonine protein kinase signaling pathway and inhibited glycogen synthase kinase-3β phosphorylation. These findings suggested that SM70EE ameliorated Aβ 1-42 -induced cognitive impairments by inhibiting the increased phosphorylation of glycogen synthase kinase-3β caused by intracerebroventricular injection of Aβ 1-42 in mice.

  13. Influência da ingestão de biomassas de spirulina (Arthrospira sp. sobre o peso corporal e consumo de ração em ratos

    Directory of Open Access Journals (Sweden)

    Araújo Kátia Gomes de Lima


    Full Text Available Neste trabalho verificou-se a influência do consumo de biomassas provenientes de três diferentes origens sobre o peso corporal e consumo de ração em ratos Wistar, machos e adultos. Grupos que consumiram 5% ou 10% (p/p da biomassa foram comparados com um controle. A biomassa I não promoveu diferença significativa no consumo de ração ou peso corporal dos três grupos. A biomassa II não causou diferença significativa no peso corporal, mas sim no consumo de ração. A biomassa III não causou diferença significativa no consumo de ração, nem no peso corporal, mas houve tendência de maior ganho de peso para o grupo que consumiu a ração contendo 10% de spirulina. Os resultados obtidos indicam que diferentes biomassas podem apresentar diferentes propriedades, mas não confirmam a alegação de que a spirulina pode levar a diminuição de peso ou de consumo de alimento.

  14. Neutron activation analysis for development of mercury sorbent based on blue-green alga salipriina palatinates

    International Nuclear Information System (INIS)

    Frontasyeva, M.V.; Kirkesali, E.I.; Aksenova, N.G.; Mosulishvili, L.M.; Belokobylsky, A.I.; Khizanishvili, A.I.


    Epithermal neutron activation analysis was used to study interaction of blue-green alga Spirulina platensis with toxic metal mercury. Various concentrations of Hg(II) were added to cell cultures in a nutrient medium. The dynamic of accumulation of Hg was investigated over days in relation to Spirulina biomass growth. The process of Hg adsorption by Spirulina biomass was studied in short-time experiments. The isotherm of adsorption was / out in Freindlich coordinates. Natural Spirulina biomass has potential to be used in the remediation of sewage waters at Hg concentrations ∼ 100 μg/1

  15. Insects found in birds' nests from Argentina. Pseudoseisura lophotes Reichenbach, 1853 and Anumbius annumbi (Vieillot, 1817) (Aves: Furnariidae), hosts of Triatoma platensis Neiva, 1913 (Hemiptera: Reduviidae: Triatominae). (United States)

    Paola, Turienzo


    The insect fauna of the nests of Pseudoseisura lophotes (Reichenbach, 1853) (Aves: Furnariidae) from Argentina was investigated. A total of 110 species (68 identified to species, 22 identified to genus, 20 identified to family) in 40 families of 10 orders of insects was found in these nests. Triatoma platensis Neiva, 1913 (Hemiptera: Reduviidae) was found again in nests of P. lophotes, corroborating after 73 years the first observations made by Mazza in 1936. The occurrence of the insects in nests of P. lophotes is compared with the previously known insect fauna in nests of A. annumbi, Furnarius rufus (Furnariidae), and Myiopsitta monachus (Psittacidae). The insect fauna in additional nests of Anumbius annumbi from the same and/or different localities is given, and used in comparisons. The first occurrence of Cuterebridae (Diptera) in birds' nests, their pupae as the overwintering stage, and the second simultaneous infestation by two species of Philornis (Diptera: Muscidae) on the same nestlings are presented. Other simultaneous infestations of different hematophagous arthropods (Hemiptera: Cimidae; Reduviidae: Triatominae, and Acari: Argasidae) are remarked and discussed.

  16. Efecto de la intensidad de diodos electroluminosos y fotoperiodo en la optimización de la producción de biomasa de Spirulina ( Arthrospira

    Directory of Open Access Journals (Sweden)

    V. Vásquez - Villalobos


    Full Text Available Se optimizó la producción de biomasa ( ф de cultivos batch d e Spirulina sp. en fotobiorreactores a escala de laboratorio (FBL de 0,2 L, por efecto de X 1 : intensidad de diodos electroluminosos (LED’s entre 1,25 a 41,7 klux y X 2 : fotoperiodo de12/12 a 24/0, h de luz/h de oscuridad (L/O utilizando un diseño compuesto central rotacional (DCCR y metodología de superficie de respuesta (MSR. Asimismo, se eval uaron las características hidráulicas y el valor ф de un cultivo batch de Spirulina en un fotobiorreactor de canal bucle cerrado abierto a la atmósfera (FB - BCAA por efecto de la iluminación LED de 8,3±1,9 klux y fotoperiodos de 12/12 y 24/0 h L/O. En los FBL se encontró dos zonas óptimas de ф , ambas con una intensidad LED de 21,5 klux y fotoperiodos 12/12 y 24/0 h L/O, siendo los valores ф de 1,65 y 1,62 respectivamente. El modelo matemático que indicó estas zonas fue de segundo orden (p = 0,000396 < 0,05 con una consistencia de predicción de R² = 0,92. En el FB - BCAA, el cultivo de Spirulina sp. con fotoperiodo de 12/12 h L/O, mostr ó un valor ф de 0,72, una adaptación más rápida de λ = 4,62 h, una mayor velocidad específica de crecimiento de μ max = 0,033 h - 1 y menor tiempo de consumo de energía de 74,05 h ; comparado con el cultivo desarrollado con fotoperiodo 24/0 h L/O. Los parámetros hidráulicos del FB - BCAA fueron: volumen de operación 2,5 L, velocidad de flujo 0,26 m/s, números de Reynolds ( Re 15488, Froude ( Fr 0,60 y Vedernikov ( V ed 0,90.

  17. Spirulina maxima extract prevents cell death through BDNF activation against amyloid beta 1-42 (Aβ1-42) induced neurotoxicity in PC12 cells. (United States)

    Koh, Eun-Jeong; Kim, Kui-Jin; Choi, Jia; Kang, Do-Hyung; Lee, Boo-Yong


    Spirulina maxima is a blue-green micro alga that contains abundant amounts of proteins (60-70%), vitamins, chlorophyll a, and C-phycocyanin (C-PC). It has been shown to reduce oxidative stress, and prevent diabetes and non-alcoholic fatty liver disease. However, it is unclear whether Spirulina maxima 70% ethanol extract (SM70EE), chlorophyll a, and C-PC prevent Aβ 1-42 -induced neurotoxicity in PC12 cells. The aim of this study was to investigate whether SM70EE, chlorophyll a, and C-PC prevent Aβ 1-42 -induced cell death. SM70EE, chlorophyll a, and C-PC suppressed the Aβ 1-42 -induced increase in poly-ADP ribose polymerase-1 (PARP-1) cleavage and reduced Aβ 1-42 -induced decreases in glutathione and its associated factors. The level of brain-derived neurotrophic factor (BDNF), which plays a critical role in neuronal survival and neuroprotection, was increased by SM70EE, chlorophyll a, and C-PC in Aβ 1-42 -treated cells. SM70EE treatment decreased oxidative stress and cell death in response to Aβ 1-42 treatment, while simultaneously suppressing PARP cleavage and increasing the levels of glutathione (GSH) and its associated factors. Moreover, SM70EE lowered the levels of APP and BACE1, two major factors involved in APP processing, and increased BDNF expression during Aβ 1-42 -induced neurotoxicity in PC12 cells. We suggest that SM70EE prevents cell death caused by Aβ 1-42 -induced neurotoxicity via the activation of BDNF signaling. Copyright © 2018 Elsevier B.V. All rights reserved.

  18. Modelamiento matemático y por redes neuronales artificiales del crecimiento de Spirulina sp. en fotobiorreactor con fuente de luz fluorescente e iluminación en estado sólido

    Directory of Open Access Journals (Sweden)

    Víctor Vásquez-Villalobos


    Full Text Available Se evaluaron los modelos matemáticos de Gompertz y logístico en la cinética de crecimiento de Spirulina sp., los cuales fueron comparados con un modelamiento por Redes Neuronales Artificiales Backpropagation (RNA-BP. La Spirulina fue cultivada en un fotobiorreactor de laboratorio aireado (3 L/min de 500 mL, con iluminación fluorescente de 40W y en Estado Sólido (LED-Light Emitting Diode de 1W; obteniendo con ambos sistemas 11,0 klx. La iluminación LED, permitió obtener un valor elevado de biomasa (ɑ de 0,90 , en comparación con la obtenida con iluminación fluorescente de 0,82; así como una mayor velocidad de crecimiento μ=0,63 h-1, precedida de un menor tiempo de latencia λ=0,34 h. La RNA-BP mostró buena precisión con respecto al modelo corregido de Gompertz I, tanto para el caso del cultivo de Spirulina sp. con iluminación fluorescente y con LED, mostrando coeficientes de correlación (R del orden de 0,993 y 0,994 respectivamente, con respecto a los datos experimentales. Resulta ventajoso el modelamiento a través del modelo corregido de Gompertz I, porque además de valores de R de 0,987 y 0,990 en los cultivos de Spirulina sp. Con iluminación fluorescente y con LED respectivamente, permite obtener los parámetros de la cinética de crecimiento de manera directa.

  19. Evaluation of glass leaching as nutrient source for microalgae growth; Evaluacion del comportamiento de vidrios lixiviados como nutrientes de algas

    Energy Technology Data Exchange (ETDEWEB)

    Grabska, N.; Tamayo, A.; Mazo, M. A.; Pascual, L.; Rubio, J.


    Three glasses with an elemental composition similar to the nutrient ratio required for Spirulina platensis growth and with different SiO{sub 2} content have been prepared. The glasses were crushed and sieved into 2 different fractions and the effect of the particle size has been studied in terms of the leaching kinetics of each element. The chemical analysis of the leaching water was used for obtaining the dissolution rate curves for each element taking part of the glass composition. From the calculation of the leaching rate constant and the exponential constant of the lixiviation reaction, it has been evaluated the Spirulina platensis growth in ambient normal conditions of light, temperature and pH of the growing media. It has been concluded that, either from the modification of the chemical composition of the glass or its particle size, it is possible to tune the delivery of the nutrients to match the growth rate of Spirulina platensis. (Author)

  20. Evaluation of glass leaching as nutrient source for microalgae growth

    International Nuclear Information System (INIS)

    Grabska, N.; Tamayo, A.; Mazo, M. A.; Pascual, L.; Rubio, J.


    Three glasses with an elemental composition similar to the nutrient ratio required for Spirulina platensis growth and with different SiO 2 content have been prepared. The glasses were crushed and sieved into 2 different fractions and the effect of the particle size has been studied in terms of the leaching kinetics of each element. The chemical analysis of the leaching water was used for obtaining the dissolution rate curves for each element taking part of the glass composition. From the calculation of the leaching rate constant and the exponential constant of the lixiviation reaction, it has been evaluated the Spirulina platensis growth in ambient normal conditions of light, temperature and pH of the growing media. It has been concluded that, either from the modification of the chemical composition of the glass or its particle size, it is possible to tune the delivery of the nutrients to match the growth rate of Spirulina platensis. (Author)

  1. Promoting helix pitch and trichome length to improve biomass harvesting efficiency and carbon dioxide fixation rate by Spirulina sp. in 660 m2 raceway ponds under purified carbon dioxide from a coal chemical flue gas. (United States)

    Cheng, Jun; Guo, Wangbiao; Ameer Ali, Kubar; Ye, Qing; Jin, Guiyong; Qiao, Zhanshan


    The helix pitch and trichome length of Spirulina sp. were promoted to improve the biomass harvesting efficiency and CO 2 fixation rate in 660 m 2 raceway ponds aerated with food-grade CO 2 purified from a coal chemical flue gas. The CO 2 fixation rate was improved with increased trichome length of the Spirulina sp. in a raceway pond with double paddlewheels, baffles, and CO 2 aerators (DBA raceway pond). The trichome length has increased by 33.3 μm, and CO 2 fixation rate has increased by 42.3% and peaked to 51.3 g/m 2 /d in a DBA raceway pond. Biomass harvesting efficiency was increased with increased helix pitch. When the day-average greenhouse temperature was 33 °C and day-average sunlight intensity was 72,100 lu×, the helix pitch of Spirulina sp. was increased to 56.2 μm. Hence the biomass harvesting efficiency was maximized to 75.6% and biomass actual yield was increased to 35.9 kg in a DBA raceway pond. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. Structure of the ent-Copalyl Diphosphate Synthase PtmT2 from Streptomyces platensis CB00739, a Bacterial Type II Diterpene Synthase. (United States)

    Rudolf, Jeffrey D; Dong, Liao-Bin; Cao, Hongnan; Hatzos-Skintges, Catherine; Osipiuk, Jerzy; Endres, Michael; Chang, Chin-Yuan; Ma, Ming; Babnigg, Gyorgy; Joachimiak, Andrzej; Phillips, George N; Shen, Ben


    Terpenoids are the largest and most structurally diverse family of natural products found in nature, yet their presence in bacteria is underappreciated. The carbon skeletons of terpenoids are generated through carbocation-dependent cyclization cascades catalyzed by terpene synthases (TSs). Type I and type II TSs initiate cyclization via diphosphate ionization and protonation, respectively, and protein structures of both types are known. Most plant diterpene synthases (DTSs) possess three α-helical domains (αβγ), which are thought to have arisen from the fusion of discrete, ancestral bacterial type I TSs (α) and type II TSs (βγ). Type II DTSs of bacterial origin, of which there are no structurally characterized members, are a missing piece in the structural evolution of TSs. Here, we report the first crystal structure of a type II DTS from bacteria. PtmT2 from Streptomyces platensis CB00739 was verified as an ent-copalyl diphosphate synthase involved in the biosynthesis of platensimycin and platencin. The crystal structure of PtmT2 was solved at a resolution of 1.80 Å, and docking studies suggest the catalytically active conformation of geranylgeranyl diphosphate (GGPP). Site-directed mutagenesis confirmed residues involved in binding the diphosphate moiety of GGPP and identified DxxxxE as a potential Mg(2+)-binding motif for type II DTSs of bacterial origin. Finally, both the shape and physicochemical properties of the active sites are responsible for determining specific catalytic outcomes of TSs. The structure of PtmT2 fundamentally advances the knowledge of bacterial TSs, their mechanisms, and their role in the evolution of TSs.

  3. The biomechanical role of overall-shape transformation in a primitive multicellular organism: A case study of dimorphism in the filamentous cyanobacterium Arthrospira platensis. (United States)

    Chaiyasitdhi, Atitheb; Miphonpanyatawichok, Wirat; Riehle, Mathis Oliver; Phatthanakun, Rungrueang; Surareungchai, Werasak; Kundhikanjana, Worasom; Kuntanawat, Panwong


    Morphological transformations in primitive organisms have long been observed; however, its biomechanical roles are largely unexplored. In this study, we investigate the structural advantages of dimorphism in Arthrospira platensis, a filamentous multicellular cyanobacterium. We report that helical trichomes, the default shape, have a higher persistence length (Lp), indicating a higher resistance to bending or a large value of flexural rigidity (kf), the product of the local cell stiffness (E) and the moment of inertia of the trichomes' cross-section (I). Through Atomic Force Microscopy (AFM), we determined that the E of straight and helical trichomes were the same. In contrast, our computational model shows that I is greatly dependent on helical radii, implying that trichome morphology is the major contributor to kf variation. According to our estimation, increasing the helical radii alone can increase kf by 2 orders of magnitude. We also observe that straight trichomes have improved gliding ability, due to its structure and lower kf. Our study shows that dimorphism provides mechanical adjustability to the organism and may allow it to thrive in different environmental conditions. The higher kf provides helical trichomes a better nutrient uptake through advection in aquatic environments. On the other hand, the lower kf improves the gliding ability of straight trichomes in aquatic environments, enabling it to chemotactically relocate to more favorable territories when it encounters certain environmental stresses. When more optimal conditions are encountered, straight trichomes can revert to their original helical form. Our study is one of the first to highlight the biomechanical role of an overall-shape transformation in cyanobacteria.

  4. Process for sewage biological treatment from uranium

    International Nuclear Information System (INIS)

    Popa, K.; Cecal, A.; Craciun, I.


    The invention relates to the sewage treatment, in particular to the sewage biological treatmen from radioactive waste, namely from uranium. The process dor sewage biological treatment from uranium includes cultivation in the sewage of the aquatic plants Lemna minor and Spirulina platensis. The plants cultivation is carried out in two stages. In the first stage for cultivation is used Lemna minor in the second stage - Spirulina platensis . After finishing the plant cultivation it is carried out separation of their biomass. The result of the invention consists in increasing the uranyl ions by the biomass of plants cultivated in the sewage

  5. Process for sewage biological treatment from uranium

    International Nuclear Information System (INIS)

    Popa, Karin; Cecal, Alexandru; Craciun, Iftimie Ionel; Rudic, Valeriu; Gulea, Aurelian; Cepoi, Liliana


    The invention relates to the sewage treatment, in particular to the sewage biological treatment from radioactive waste, namely from uranium. The process for sewage biological treatment from uranium includes cultivation in the sewage of the aquatic plants Lemna minor and Spirulina platensis. The plant cultivation is carried out in two stages. In the first stage for cultivation is used Lemna minor and in the second stage - Spirulina platensis. After finishing the plant cultivation it is carried out separation of their biomass. The result of the invention consists in increasing the uranyl ions accumulation by the biomass of plants cultivated in the sewage.

  6. Extração e purificação de clorofila a, da alga Spirulina maxima: um experimento para os cursos de química Extraction and purification of chlorophyll a isolated from Spirulina maxima: an experiment for the chemistry courses

    Directory of Open Access Journals (Sweden)

    Ana Paula Jecks Maestrin


    Full Text Available This work describes a simple and economical experiment for the extraction and purification of chlorophyll a from Spirulina maxima. Extraction and purification of natural compounds can be considered one of the most illustrative experiments that can be performed in Organic Chemistry courses. Particularly, the chromatography of dyes and pigments allows students to have a better comprehension of the chromatography separations. These compounds represent an important class of organic pigments applied in pharmaceutical, cosmetic, detergent compositions, and various other fields and can be extracted from plants and algae. To extract, separate and purify chlorophyll a from associated pigments such as xanthophylls, carotenes, and pheophytins, very costly processes are reported. The present approach is perfectly adequate for use in Chemistry experiments for undergraduate students.

  7. Improving oxidative stability of olive oil: Incorporation of Spirulina and evaluation of its synergism with citric acid; Mejora de la estabilidad oxidativa del aceite de oliva: Incorporación de Espirulina y evaluación de su sinergismo con ácido cítrico.

    Energy Technology Data Exchange (ETDEWEB)

    Alavi, N.; Golmakani, M.T.


    The effects of different Spirulina concentrations used alone and in combination with citric acid on the oxidative stability of olive oil were assessed. The amounts of primary and secondary oxidation products produced in Spirulina samples were lower than that of the control. The improved oxidative stability indices of Spirulina samples with and without citric acid were in the range of 85.20–94.47% and 258.10–260.21%, respectively. In comparison with the control, Spirulina samples manifested significantly higher carotenoid and chlorophyll contents at the beginning and end of the storage period. The presence of these bioactive compounds results from the presence of Spirulina in the medium and can thus retard the oxidation of olive oil. A higher oxidative stability was reached using BHT in comparison with Spirulina samples. Furthermore, no synergistic action was observed in possible connections between citric acid and Spirulina. In conclusion, Spirulina can enhance oxidative stability and improve the shelf life of olive oil. [Spanish] Se evaluaron los efectos de diferentes concentraciones de Espirulina usadas solas y en combinación con ácido cítrico sobre la estabilidad oxidativa del aceite de oliva. Las cantidades de productos de oxidación primarios y secundarios producidos en muestras de Espirulina fueron menores que las del control. Además, la estabilidad oxidativa de muestras de Espirulina con y sin ácido cítrico estaban en el intervalo de 85,20–94,47% y 258,10–260,21%, respectivamente. En comparación con el control, las muestras de Espirulina mostraron un contenido significativamente mayor de carotenoides y clorofila al inicio y al final del período de almacenamiento. La presencia de estos compuestos bioactivos y la presencia de Espirulina en el medio pueden retardar la oxidación del aceite de oliva. Se obtuvo una mayor estabilidad oxidativa usando BHT en comparación con muestras de Espirulina. Además, no se observó ninguna acción sin

  8. A study of acute phase and transport protein synthesis in undernourished men using simulated infection and uniformly 15N-labelled Spirulina Platenses

    International Nuclear Information System (INIS)

    Kurpad, A.V.; Soares, M.J.; Sekhar, R.V.; Reeds, P.J.; Fjeld, C.R.


    This study was conducted to test the hypothesis that acute phase protein synthesis is accelerated and transport protein synthesis is decelerated in adult men in whom the stress of infection is superimposed upon undernutrition. As a pilot study, four chronically undernourished men and two well-nourished controls were studied on two occasions separated by four days; the second session was conducted 24 hours after the administration of typhoid vaccine. Basal urine and blood samples were collected and then subjects were given priming oral doses of 15 N-Spirulina (13.5mg/kg body weight) and oral doses (3.5mg/kg body weight) every 30 min for the next six hours. Meals were aliquoted during the dosing period. Blood samples were collected at four, five and six hours. 15 N enrichment in different fractions of plasma i.e., albumin, non-albumin and amino acids, was measured by combustion GC-IRMS. Total urinary nitrogen was measured by Kjeldahl. 5 refs, 2 figs, 3 tabs

  9. Down-regulation of histamine-induced endothelial cell activation as potential anti-atherosclerotic activity of peptides from Spirulina maxima. (United States)

    Vo, Thanh-Sang; Kim, Se-Kwon


    Histamine, a potent inflammatory mediator, has been known to cause the pathogenesis of atherosclerosis. In this sense, two bioactive peptides P1 (LDAVNR; 686Da) and P2 (MMLDF; 655Da) purified from gastric enzymatic hydrolysate of Spirulina maxima were examined for their protective effects against early atherosclerotic responses induced by histamine in EA.hy926 endothelial cells. Interestingly, both P1 and P2 exhibited inhibitory activities on the production and expression of IL-6 and MCP-1. Furthermore, P1 and P2 inhibited the production of adhesion molecules including P-selectin and E-selectin, and thus reducing in vitro cell adhesion of monocyte onto endothelial cells. In addition, the production of intracellular reactive oxygen species was observed to reduce in the presence of P1 or P2. Notably, the inhibitory activities of P1 and P2 were found due to down-regulating Egr-1 expression via histamine receptor and PKCδ-dependent MAPKs activation pathway. These results suggest that peptides P1 and P2 from S. maxima are effective to suppress histamine-induced endothelial cell activation that may contribute to the prevention of early atherosclerosis. Copyright © 2013 Elsevier B.V. All rights reserved.

  10. Mutagenic potential of Cordia ecalyculata alone and in association with Spirulina maxima for their evaluation as candidate anti-obesity drugs. (United States)

    Araldi, R P; Rechiutti, B M; Mendes, T B; Ito, E T; Souza, E B


    Obesity is one of the most important nutritional disorders, and can be currently considered as an epidemic. Although there are few weight reduction drugs available on the market, some new drug candidates have been proposed, including Cordia ecalyculata, a Brazilian plant with anorectic properties, and Spirulina maxima, a cyanobacterium with antioxidant and anti-genotoxic activity. In this study, we evaluated the mutagenic potential of C. ecalyculata at doses of 150, 300, and 500 mg/kg alone and in association with S. maxima at doses of 75, 150, and 250 mg/kg, respectively, through an in vivo micronucleus test, using mice of both sexes, and an in vitro micronucleus test and comet assay, using human peripheral blood. For all tests, cyclophosphamide was used as a positive control. The results showed that treatment of 300 mg/kg C. ecalyculata and the combination treatment of 500 mg/kg C. ecalyculata with 250 mg/kg S. maxima resulted in anorectic effects. The mutagenic tests did not reveal any clastogenic or genotoxic activity for any treatment, indicating that these candidates could be marketed as weight-reduction drugs. Moreover, the drugs contain chemo-preventive substances that can protect against tumorigenesis, which has been associated with obesity.

  11. Optimization of a process for high fibre and high protein biscuit. (United States)

    Singh, Parul; Singh, Rakhi; Jha, Alok; Rasane, Prasad; Gautam, Anuj Kumar


    Biscuits are popular and convenient food products due to their ready to eat nature. Biscuits were prepared from sorghum and whole wheat flour with the addition of spirulina (Spirulina platensis) powder to produce high fibre and high protein biscuit. Levels of ingredients in biscuits such as spirulina powder, sorghum flour and guar gum were optimized using response surface methodology (RSM) for its sensory, textural and antioxidant attributes. Sensory attributes as colour intensity (R2 = 0.89, P powder and sorghum flour was found to have significant effect on the responses.

  12. L'algue alimentaire Spirulina sp. Découverte de lacs naturels à Wadi el Natroun en République Arabe d'Egypte Spirulina Sp. Food Alga. Discovery of Natural Lakes At Wadi El Natrun in the Arab Republic of Egypt

    Directory of Open Access Journals (Sweden)

    Abdin El Sherif S. A.


    Full Text Available Bien que connue depuis les temps les plus anciens, la dépression de Wadi el Natroun n'avait jamais été prospectée autrement que pour sa richesse en sels minéraux. C'est en 1977 que les auteurs, cherchant à savoir s'il existait des lacs naturels à Spirulines en République Arabe d'Égypte, découvrirent dans la dépression de Wadi el Natroun certains lacs comme Abou Gobara et El Khadra où croissaient spontanément les algues spirulines. Le climat du site, l'origine et la composition des eaux, ainsi que la concentration en algues, ont été étudiés afin d'estimer la productivité du site en vue d'une éventuelle exploitation industrielle. L'exploitation de ces lacs permettrait de mettre en valeur le site de Wadi el Natroun par la production d'une substance très riche en protéine pour l'alimentation humaine dont à tant besoin la République Arabe d'Égypte. Even though it has been known from olden days, the depression of Wadi el Natrun had never been prospected other than for its wealth of mineral salts. It was in 1977 that the authors began searching for natural lakes with Spirulina algae in the Arab Republic of Egypt and, in the depression of Wadi el Natrun, discovered varions lakes such as Abu Gobara and El Khadra where Spirulina algae grew in a natural state. The climate of the site, the original and composition of the water as well as the algae concentration were analyzed to evaluate the productivity of the site for eventual industrial exploitation. The exploitation of these lakes would give value to the Wadi el Natrun site by producing a very protein-rich substance for human nourishment which the Arab Republic of Egypt needs so badly.

  13. Spirulina maxima Extract Reduces Obesity through Suppression of Adipogenesis and Activation of Browning in 3T3-L1 Cells and High-Fat Diet-Induced Obese Mice. (United States)

    Seo, Young-Jin; Kim, Kui-Jin; Choi, Jia; Koh, Eun-Jeong; Lee, Boo-Yong


    Obesity predisposes animals towards the metabolic syndrome and diseases such as type 2 diabetes, atherosclerosis, and cardiovascular disease. Spirulina maxima is a microalga with anti-oxidant, anti-cancer, and neuroprotective activities, but the anti-obesity effect of Spirulina maxima 70% ethanol extract (SM70EE) has not yet been fully established. We investigated the effect of SM70EE on adipogenesis, lipogenesis, and browning using in vitro and in vivo obesity models. SM70EE treatment reduced lipid droplet accumulation by the oil red O staining method and downregulated the adipogenic proteins C/EBPα, PPARγ, and aP2, and the lipogenic proteins SREBP1, ACC, FAS, LPAATβ, Lipin1, and DGAT1 by western blot analysis. In addition, the index components of SM70EE, chlorophyll a, and C-phycocyanin, reduced adipogenesis and lipogenesis protein levels in 3T3-L1 and C3H10T1/2 cells. High-fat diet (HFD)-fed mice administered with SM70EE demonstrated smaller adipose depots and lower blood lipid concentrations than control HFD-fed mice. The lower body mass gain in treated SM70EE-administrated mice was associated with lower protein expression of adipogenesis factors and higher expression of AMPKα-induced adipose browning proteins PRDM16, PGC1α, and UCP1. SM70EE administration ameliorates obesity, likely by reducing adipogenesis and activating the thermogenic program, in 3T3-L1 cells and HFD-induced obese mice.

  14. Dietary vitamin E (α-tocopheryl acetate) and organic selenium ...

    African Journals Online (AJOL)


    performance and antioxidant status of broilers fed n-3 PUFA-enriched feeds ..... plastic bags in dry ice and stored at -80 oC for assay of SOD. At the end of the trial ...... Biomass nutrient profiles of three microalgae: Spirulina Platensis, Chlorella.

  15. Antibacterial activities of the extracts of cyanobacteria and green ...

    African Journals Online (AJOL)

    In compliance to the recent surveys on algal species and their potentials to produce biologically active compounds, seven algal species belonging to cyanobacteria such as Spirulina platensis, Nostoc linckia, Phormidium autumnale, Tolypothrix distorta and Microcystis aeruginosa and green algae such as Chlorella vulgaris, ...

  16. Author Details

    African Journals Online (AJOL)

    Antihyperglycemic activity of Phyllanthus amarus (Schum & Thonn) in rats. Abstract · Vol 16, No 3 (2014) - Articles Effet anti-ulcereux de l'extrait hydroalcoolique D'ecorce de tronc et de racine de Ficus polita vahl. (Moraceae) Abstract · Vol 17, No 2 (2015) - Articles Effect of Spirulina platensis powder on metabolic syndrome ...

  17. Author Details

    African Journals Online (AJOL)

    Sugiharto, S. Vol 48, No 1 (2018) - Articles Effect of feeding duration of Spirulina platensis on growth performance, haematological parameters, intestinal microbial population and carcass traits of broiler chicks. Abstract PDF. ISSN: 2221-4062. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  18. The effect of ultrasound at 256 KHz on Microcystis aeruginosa, with ...

    African Journals Online (AJOL)


    Oct 31, 2012 ... for 5 min inhibits the growth of the cyanobacterium Spirulina platensis for 3 d, while a sonication with 20 kHz showed no constant effect (Hao et al., 2004). Several mechanisms were discovered by which ultrasonic treatment affects the cells, of which the collapsing of gas vacu- oles during cavitation was ...

  19. One-Week Antihypertensive Effect of Ile-Gln-Pro in Spontaneously Hypertensive Rats

    NARCIS (Netherlands)

    Lu, Jun; Sawano, Yoriko; Miyakawa, Takuya; Xue, You-Lin; Cai, Mu-Yi; Egashira, Yukari; Ren, Di-Feng; Tanokura, Masaru


    The antihypertensive effect of an angiotensin I-converting enzyme (ACE) inhibitory peptide lie-Gin-Pro (IQP), whose sequence was derived from Spirulina platensis, was investigated in spontaneously hypertensive rats (SHRs) for 1 week. The weighted systolic blood pressure (SBP) and diastolic blood


    African Journals Online (AJOL)

    Philippe Stéfanini and. Samuel Ravatua-Smith attempt to shed light on the phenomenon of social conversion that occurs when farmers change from traditional agricultural practices towards a less well-known form of aquaculture; in this case, the production of the Spirulina superfood. (Arthrospira platensis). Though the focus ...

  1. Electric field effects on red chlorophylls, b-carotenes and P700 in cyanobacterial photosystem I complexes.

    NARCIS (Netherlands)

    Frese, R.N.; Palacios, M.A.; Azzizi, A.; van Stokkum, I.H.M.; Kruip, J.; Rögner, M.; Karapetyan, N.V.; Schlodder, E.; van Grondelle, R.; Dekker, J.P.


    We have probed the absorption changes due to an externally applied electric field (Stark effect) of Photosystem I (PSI) core complexes from the cyanobacteria Synechocystis sp. PCC 6803, Synechococcus elongatus and Spirulina platensis. The results reveal that the so-called C719 chlorophylls in S.

  2. The Protean Challenge of Game Collections at Academic Libraries (United States)

    Cross, Emma; Mould, David; Smith, Robert


    The rise of game development and game studies on university campuses prompts academic libraries to consider how to support teaching and research in this area. This article examines current issues and challenges in the development of game collections at academic libraries. The gaming ecosystem has become more complex and libraries may need to move…

  3. Diseño de una crema para masajes con extracto de spirulina cubana Design of Cuban spirulin extract-derived massage cream

    Directory of Open Access Journals (Sweden)

    Ivone Almirall Díaz


    Full Text Available La spirulina constituye la microalga de mayor uso en Cuba y una de las más importantes en el ámbito mundial por su alto contenido proteico y poseer una excelente mezcla de vitaminas, minerales y agentes antioxidantes que protegen al organismo contra la acción nociva de los radicales libres. Por estas razones se ha incursionado en la elaboración de productos cosméticos destinados al cuidado de la piel con la utilización del principio bioactivo del extracto hidroalcohólico de esta microalga. Se realizó el diseño de una crema para masajes y se evaluaron 3 lotes del producto hasta los 18 meses desde un punto de vista tecnológico, microbiológico y toxicológico. La formulación resultó ser estable durante el tiempo de ensayo y el estudio toxicológico desarrollado demostró la no irritabilidad dérmica ni oftálmica del cosmético. Se analizó la aceptación del producto por parte de 130 consumidores mediante la aplicación de una prueba sensorial afectiva y se encontró que este es aceptado con agrado.Spirulin constitutes the most used microalga in Cuba and one of the most important worldwide because of its high protein content and excellent combination of vitamins, minerals and anti-oxidative agents that protect the body against harmful action of free radicals. For these reasons, the manufacture of cosmetic products for the skin care using the bioactive principle of the hydroalcoholic extract of this microalga has been undertaken. The design of a massage cream was technologically, microbiologically and toxicologically evaluated in three different product batches for 18 months. The formulation was stable during the testing period and the toxicological study showed that the cosmetic did not cause skin or eye irritation. The acceptance of the product by 130 consumers was analyzed on the basis of a sensorial test where it was found that the cream was satisfactorily accepted.


    Directory of Open Access Journals (Sweden)

    Ricardo Verthein Tavares de MACEDO


    Full Text Available A microalga Spirulina maxima foi cultivada em meios com 2,5g/L KNO3 (2,5N, proposto por PAOLETTI et al [10] e considerado meio padrão, em meios com 0,2g/L KNO3 (0,2N e em ausência de nitrogênio (0,0N nas temperaturas de 25°C e 35°C. A composição da biomassa celular seca apresentou a 35°C um aumento médio dos lipídios totais, de 2,8 vezes do meio com ausência de nitrogênio (0,0N e 2,9 vezes do meio 0,2N em relação ao meio padrão. A 25°C apresentou um aumento médio de 3,1 vezes do meio com ausência de nitrogênio (0,0N e 3,2 vezes do meio 0,2N em relação ao meio padrão. A biomassa em forma de gel de cada tratamento foi recolhida e feita a extração dos lipídios totais, os quais foram pesados em base seca. As análises estatísticas dos resultados, em estimativa não linear com superfície de resposta e regressão múltipla com análise de resíduos, mostraram para o aumento dos lipídios totais uma função linear com a temperatura (T e não linear com o nitrogênio (N, ajustando-se a um modelo onde o coeficiente de regressão R=0,99459 e a equação LIPT = A+B²T+CN ².The micraolgae Spirulina maxima was cultivated in medium with 2,5g/L KNO3 (2,5N, proposed by Paoletti et al [10] and considered standard medium, in media with 0,2g/L KNO3 (0,2N and in absence of nitrogen (0,0N in temperatures of 25°C and 35°C. The composition of the dry cellular biomass presented to 35°C a medium increase of the total lipids, of 2,8 times of the middle with absence of nitrogen (0,0N and 2,9 times of the half 0,2N in relation to the standard medium. To 25°C it presented a medium increase of 3,1 times of the medium with absence of nitrogen (0,0N and 3,2 times of the half 0,2N in relation to the standard medium. The biomass in form of gel of each treatment was picked up and made the extraction of the total lipids, which were heavy in base evaporate. The statistical analyses of the results, in estimate non lineal with answer surface and

  5. Structure of the ent -Copalyl Diphosphate Synthase PtmT2 from Streptomyces platensis CB00739, a Bacterial Type II Diterpene Synthase

    Energy Technology Data Exchange (ETDEWEB)

    Rudolf, Jeffrey D.; Dong, Liao-Bin; Cao, Hongnan; Hatzos-Skintges, Catherine; Osipiuk, Jerzy; Endres, Michael; Chang, Chin-Yuan; Ma, Ming; Babnigg, Gyorgy; Joachimiak, Andrzej; Phillips, George N.; Shen, Ben


    Terpenoids are the largest and most structurally diverse family of natural products found in nature, yet their presence in bacteria is underappreciated. The carbon skeletons of terpenoids are generated through carbocation-dependent cyclization cascades catalyzed by terpene synthases (TSs). Type I and type II TSs initiate cyclization via diphosphate ionization and protonation, respectively, and protein structures of both types are known. Most plant diterpene synthases (DTSs) possess three alpha-helical domains (alpha beta gamma), which are thought to have arisen from the fusion of discrete, ancestral bacterial type I TSs (alpha) and type II TSs (beta gamma). Type II DTSs of bacterial origin, of which there are no structurally characterized members, are a missing piece in the structural evolution of TSs. Here, we report the first crystal structure of a type II DTS from bacteria. PtnaT2 from Streptomyces platensis CB00739 was verified as an ent-copalyl diphosphate synthase involved in the biosynthesis of platensimycin and platencin. The crystal structure of PtmT2 was solved at a resolution of 1.80 angstrom, and docking studies suggest the catalytically active conformation of geranylgeranyl diphosphate (GGPP). Site-directed mutagenesis confirmed residues involved in binding the diphosphate moiety of GGPP and identified DxxxxE as a potential Mg2+-binding motif for type II DTSs of bacterial origin. Finally, both the shape and physicochemical properties of the active sites are responsible for determining specific catalytic outcomes of TSs. The structure of PtmT2 fundamentally advances the knowledge of bacterial TSs, their mechanisms, and their role in the evolution of TSs.

  6. Arthrospira (Spirulina) in tannery wastewaters

    African Journals Online (AJOL)


    May 29, 2012 ... oxidation of sulphide and ammonia, and the trapping of other odour-causing compounds was observed. An attempt was made to achieve ... manipulation of the biological processes may offer a conceptual basis for the more ... oxidation, blending and aeration followed by flocculant-assisted settling of a por-.

  7. Algal autolysate medium to label proteins for NMR in mammalian cells. (United States)

    Fuccio, Carmelo; Luchinat, Enrico; Barbieri, Letizia; Neri, Sara; Fragai, Marco


    In-cell NMR provides structural and functional information on proteins directly inside living cells. At present, the high costs of the labeled media for mammalian cells represent a limiting factor for the development of this methodology. Here we report a protocol to prepare a homemade growth medium from Spirulina platensis autolysate, suitable to express uniformly labeled proteins inside mammalian cells at a reduced cost-per-sample. The human proteins SOD1 and Mia40 were overexpressed in human cells grown in (15)N-enriched S. platensis algal-derived medium, and high quality in-cell NMR spectra were obtained.

  8. Algal autolysate medium to label proteins for NMR in mammalian cells

    Energy Technology Data Exchange (ETDEWEB)

    Fuccio, Carmelo; Luchinat, Enrico; Barbieri, Letizia [University of Florence, Magnetic Resonance Center (CERM) (Italy); Neri, Sara [Giotto Biotech S.R.L. (Italy); Fragai, Marco, E-mail: [University of Florence, Magnetic Resonance Center (CERM) (Italy)


    In-cell NMR provides structural and functional information on proteins directly inside living cells. At present, the high costs of the labeled media for mammalian cells represent a limiting factor for the development of this methodology. Here we report a protocol to prepare a homemade growth medium from Spirulina platensis autolysate, suitable to express uniformly labeled proteins inside mammalian cells at a reduced cost-per-sample. The human proteins SOD1 and Mia40 were overexpressed in human cells grown in {sup 15}N-enriched S. platensis algal-derived medium, and high quality in-cell NMR spectra were obtained.

  9. Variación temporal de la población de la almeja Darina solenoides y del mejillón Mytilus Edulis Platensis, y su relación con la alimentación del ostrero austral

    Directory of Open Access Journals (Sweden)

    Lorenzo Javier Gallardo


    Full Text Available Resumen. El presente trabajo de investigación se ha planteado en el marco de una beca para alumnos avanzados de la UNPA, Unidad Académica Río Gallegos. Tiene como objetivo analizar las variaciones temporales de la población del mejillón Mytilus edulis platensis y de la almeja Darina solenoides y se inserta en un Proyecto de Investigación (29A/227 dirigido por Dra. Z. Lizarralde que tiene como objeto estudiar la ecología trófica del Ostrero Austral (Haematopus leucopodus en el estuario del río Gallegos (Santa Cruz. Durante el 2010 se efectuaron muestreos mensuales (abril a diciembre en un banco de mejillones y otro de almejas, con el objeto de analizar la variación temporal de la densidad y biomasa, y la estructura de tallas poblacional. Se analizó la granulometría y porcentaje de materia orgánica de los sedimentos. El sedimento del banco de mejillones se encuentra constituido en su mayoría por la fracción correspondiente a los gránulos; en el banco de almejas por arenas muy finas (43% y finas (39%. En ambos casos la materia orgánica no supera el 3 %. La densidad de mejillones alcanzó un valor máximo de 2255 individuos/m2 en abril y un mínimo de 497 en noviembre. La biomasa máxima se encontró en abril (110 g/m 2. La densidad de Darina solenoides alcanzó un valor máximo de 565 en junio y un mínimo de 282 individuos/m2 en el mes de octubre. La biomasa máxima ocurrió en diciembre (132 g/m2. No se detectó el período de reclutamiento de nuevos individuos en los bancos de las especies estudiadas.

  10. Bioconversion of poultry droppings for biogas and algal production

    Energy Technology Data Exchange (ETDEWEB)

    Mahadevaswamy, M.; Venkataraman, L.V.


    An integrated system for the bioconversion of poultry droppings for biogas production and utilization of the effluent for the production of the blue-green alga Spirulina platensis was studied. Poultry droppings produced 0.54 cubic m of biogas per kilogran of Total Solids (TS). The 2% TS biogas plant effluent as sole nutrient medium for Spirulina yielded 7-8 g dry algae a day. The biomass was harvested by filtration. The sundried algal biomass has been used as a poultry feed component. In economic terms the system appears promising. 18 references.

  11. From malnutrition to HIV: spirulina is an effective solution which continues to reveal its secrets De la malnutrition au VIH : la spiruline arme efficace qui n’en finit pas de livrer ses secrets De la malnutrición al VIH: la espirulina como arma eficaz que no cesa de revelar secretos

    Directory of Open Access Journals (Sweden)

    Raphaëlle Birot


    Full Text Available Spirulina presents major advantages in the fight against chronic malnutrition based on its micronutrient composition, its health potential and the fact that it can be grown locally. International solidarity associations, such as Antenna Technologies and Entrepreneurs du Monde whose goal is to reduce extreme poverty and public health problems in developing countries, have undertakenproduction and distribution programmes of spirulina, especially in West Africa. The quality of spirulina produced in these developing countries continues to increase to the extent that it can now be exported. Thus, associations such as Spirulidaire market a traditional, fair and supportive spirulina in France and Europe and thus promote local producers.The perception of spirulina continues to evolve with the multiplication of field initiatives and the accumulation of scientific data. New studies demonstrate that spirulina also presents clinically significant anti-viral and immuno-stimulating effects in people infected by HIV.Sur la base de sa composition en micronutriments, de son potentiel pour la santé et du fait qu’elle soit cultivable localement, la spiruline présente des avantages majeurs dans la lutte contre la malnutrition chronique. Des associations de solidarité internationale, comme Antenna Technologies et Entrepreneurs du Monde qui ont comme vocation de réduire l’extrême pauvreté et les problèmes de santé publique dans les pays en développement, ont entrepris des programmes de culture et de distribution de spiruline notamment en Afrique de l’Ouest. La qualité de la spiruline produite dans ces pays en développement ne cesse d’augmenter et est telle qu’elle permet son exportation. C’est ainsi que des associations comme Spirulidaire commercialisent une spiruline artisanale, équitable et solidaire en France et en Europe et permettent ainsi de soutenir les producteurs locaux.La perception de la spiruline ne cesse d’évoluer avec la

  12. Epithermal neutron activation analysis in applied microbiology

    International Nuclear Information System (INIS)

    Marina Frontasyeva


    Some results from applying epithermal neutron activation analysis at FLNP JINR, Dubna, Russia, in medical biotechnology, environmental biotechnology and industrial biotechnology are reviewed. In the biomedical experiments biomass from the blue-green alga Spirulina platensis (S. platensis) has been used as a matrix for the development of pharmaceutical substances containing such essential trace elements as selenium, chromium and iodine. The feasibility of target-oriented introduction of these elements into S. platensis biocomplexes retaining its protein composition and natural beneficial properties was shown. The absorption of mercury on growth dynamics of S. platensis and other bacterial strains was observed. Detoxification of Cr and Hg by Arthrobacter globiformis 151B was demonstrated. Microbial synthesis of technologically important silver nanoparticles by the novel actinomycete strain Streptomyces glaucus 71 MD and blue-green alga S. platensis were characterized by a combined use of transmission electron microscopy, scanning electron microscopy and energy-dispersive analysis of X-rays. It was established that the tested actinomycete S. glaucus 71 MD produces silver nanoparticles extracellularly when acted upon by the silver nitrate solution, which offers a great advantage over an intracellular process of synthesis from the point of view of applications. The synthesis of silver nanoparticles by S. platensis proceeded differently under the short-term and long-term silver action. (author)

  13. A Review of Cyanobacterial Odorous and Bioactive Metabolites: Impacts and Management Alternatives in Aquaculture (United States)


    Ben-Amotz, A., 1985. Lipid and lipopoly- saccharide constituents of cyanobacterium Spirulina platensis (Cyanophyceae, Nostocales). Mar. Ecol. Prog...only been confirmed in liver and brain cells (Fischer et al., 2005; Meier- Abt et al., 2007). Once inside cells, microcystins and nodularins inhibit... assay ) or PPIA (protein phosphatase inhibition assay ) but the actual toxin responsible was not confirmed (i.e., confirmation by LC-MS, MALDI, or HPLC is

  14. 1829-IJBCS-Article-Barry Mamoudou

    African Journals Online (AJOL)


    Le Spirulina platensis est une algue utilisée pour ses effets nutritionnel et thérapeutique. De nombreuses études ont montré son intérêt ..... Mesure des cytokines (interleukine-4 (IL-4), l'interféron-γ (IFN-γ) et l'interleukine-2). - Réduction ... avec les métaux et les médicaments pouvant générer des radicaux libres toxiques ...

  15. KAROTENOID DARI MAKROALGAE DAN MIKROALGAE: POTENSI KESEHATAN APLIKASI DAN BIOTEKNOLOGI [Carotenoids from Macroalgae and Microalgae: Health Potential, Application and Biotechnology


    Leenawaty Limantara3); Budhi Prasetyo1); AB. Susanto2); Helly de Fretes1)*


    Algae, both micro and macroalgae, is one of the largest producers of carotenoids. The major composition of carotenoid on algae are β-carotene, astaxanthin, luthein, zeaxanthin, cryptoxanthin, and fucoxanthin which have important roles for human health. Carotenoids were produced by several microalgae species such as Dunaliella sallina, Haemotococcus pluvialis, Chlorella pyrenoidosa, Spirulina platensis, Nannnochloropsis oculata, and also from some macroalgae species such as Kappaphycus alvarez...

  16. Characterization of Various Biomass Feedstocks for Energy Production

    DEFF Research Database (Denmark)

    Toor, Saqib; Rosendahl, Lasse; Hoffmann, Jessica


    Biomass represents the renewable energy source and their use reduces the consumption of fossil fuels and limits the emission of CO2. In this work, various biomass feedstocks were assessed for assessing their suitability as energy production sources using thermochemical conversion routes especially...... hydrothermal liquefaction (HTL) process. The methods used to analyze involved performing proximate, ultimate and thermogravimetry analysis. On the basis of proximate, ultimate, and thermogravimetry analysis, the dried distiller grains with solubles (DDGS), corn silage, chlorella vulgaris, spirulina platensis...

  17. A espirulina: um novo modismo brasileiro




    A autora apresenta uma série de dados referentes a morfologia, cultura, processamemto, composicao química e usos da espirulina (Spirutina maxima, Spirulina platensis), microalga verde-azulada cujo consumo está muito em evidência em diversos países da Eutopa, Ásia e América do Norte e que começa também a ser miuto utilizada por brasileiros.

  18. A espirulina: um novo modismo brasileiro

    Directory of Open Access Journals (Sweden)

    Elizabeth Terãn

    Full Text Available A autora apresenta uma série de dados referentes a morfologia, cultura, processamemto, composicao química e usos da espirulina (Spirutina maxima, Spirulina platensis, microalga verde-azulada cujo consumo está muito em evidência em diversos países da Eutopa, Ásia e América do Norte e que começa também a ser miuto utilizada por brasileiros.

  19. Competitive biosorption of different forms of lead [Pb(NO 3 ) 2 and ...

    African Journals Online (AJOL)

    Spirulina platensis growth parameters [chlorophyll a (chl a) and dry-wet weight] effects on proline content, lead accumulation and the combined effect of the different forms of lead [Pb (NO3)2, Pb (CH3COO)2] and pH (6 to 8) were investigated for 192 h. The accumulation and form of lead were determined to be effective on ...

  20. Double-blind randomised controlled trial of the independent and synergistic effect of Spirulina maxima with exercise (ISESE) on general fitness, lipid profile and redox status in overweight and obese subjects: study protocol. (United States)

    Hernández-Lepe, Marco Antonio; López-Díaz, José Alberto; Rosa, Laura Alejandra de la; Hernández-Torres, Rosa Patricia; Wall-Medrano, Abraham; Juarez-Oropeza, Marco Antonio; Pedraza-Chaverri, José; Urquidez-Romero, Rene; Ramos-Jiménez, Arnulfo


    In order to reduce cardiovascular disease risk factors, a healthy diet must include dietary antioxidants from different sources (eg, Spirulina maxima ) and regular practice of exercise should be promoted. There is some evidence from animal studies that S. maxima and exercise decrease cardiovascular disease risks factors. However, very few studies have proved the independent or synergistic effect of S. maxima plus exercise in humans. This study attempts to address the independent and synergistic effects in overweight and obese subjects participating in a systematic physical exercise programme at moderate intensity on general fitness, plasma lipid profile and antioxidant capacity. Using a randomised, double-blind, placebo-controlled, counterbalanced crossover study design, 80 healthy overweight and obese subjects will be evaluated during a 12-week isoenergetic diet accompanied by 4.5 g/day S. maxima intake and/or a physical systematic exercise programme at moderate intensity. Body composition, oxygen uptake, heart rate, capillary blood lactate, plasma concentrations of triacylglycerols, total, low-density and high-density lipoprotein cholesterol, antioxidant status, lipid oxidation, protein carbonyls, superoxide dismutase, catalase, glutathione, glutathione peroxidase, glutathione reductase and paraoxonase will be assessed. This study and all the procedures have been approved by the Universidad Autonoma de Ciudad Juarez Bioethics Committee. Findings will be disseminated through peer-reviewed journals, national and international conferences. NCT02837666. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  1. Biotechnology in Georgia for Various Applications

    International Nuclear Information System (INIS)

    Mosulishvili, L.; Tsibakhashvili, N.; Kirkesali, E.; Tsertsvadze, L.; Frontasyeva, M.; Pavlov, S.


    The results of collaborative work carried out in the field of biotechnology at the Frank Laboratory of Neutron Physics (FLNP) of the Joint Institute for Nuclear Research (JINR) (Dubna, Russia) jointly with scientists from Georgia are presented. Using instrumental neutron activation analysis (NAA), significant results were ontained in the following directions - medical biotechnology, environmental biotechnology and industrial biotechnology. In the biomedical experiments a blue-green alga Spirulina platensis biomass has been used as a matrix for the development of pharmaceutical substances containing such vitally important trace elements as selenium, chromium and iodine. The feasibility of target-oriented introduction of these elements into Spirulina platensis biocomplexes retaining its protain composition and natural beneficial properties has been proved. The adsorption of such toxic metal as mercury by Spirulina platensis biomass in dynamics of growth has been studied also. NAA has been successfully applied to investigate the biotechnology of toxic Cr(VI) transformation into less toxic Cr(III) complexes by Cr(VI)-reducer bacteria isolated from polluted basalts in Georgia. This method was used to track accumulation of chromium in the bacterial cells. To monitor and identify Cr(III) complexes in these bacteria, electron spin resonance (ESR) spectrometry was employed. For the first time, the elemental composition of Cr(VI)-reducer bacteria has been studied using epithermal NAA. The natural organic mass of vegetal origin - peat - was applied as a source of microorganisms to study the bacterial leaching of some metals from lean ores, rocks and industrial wastes. (author)

  2. Evaluación del comportamiento de vidrios lixiviados como nutrientes de algas

    Directory of Open Access Journals (Sweden)

    Natalia Grabska


    Full Text Available Se han preparado 3 vidrios con distinto contenido en SiO2 y de composición similar a los nutrientes necesarios para el crecimiento del alga Spirulina platensis. Se han escogido 2 fracciones con distinto tamaño de partícula para cada uno de los vidrios preparados y la cinética de lixiviación de dichos vidrios ha sido estudiada a través del análisis químico de las aguas de lixiviado, permitiendo obtener las curvas de velocidad para cada uno de los componentes del vidrio. A partir del cálculo de la constante de velocidad y del exponente de la reacción de lixiviado, se ha realizado una aproximación al crecimiento del alga Spirulina platensis en condiciones ambientales normales de luz, pH y temperatura y se ha obtenido que, a través de la modificación de la composición del vidrio de partida o de su tamaño de partícula, es posible ajustar el aporte de nutrientes al medio a la velocidad de crecimiento del alga Spirulina platensis.

  3. Decontamination of radioactive liquid wastes by hydrophytic vegetal organisms

    International Nuclear Information System (INIS)

    Cecal, Al; Popa, K.; Potoroaca, V.; Melniciuc-Puica, N.


    Bioaccumulation of some radioactive ions from contaminated waste solutions, on hydrophytic vegetal organisms is discussed. In order to follow the distribution of radioactive ions 137 Cs + , 60 Co 2+ and 51 Cr 3+ in various cell components extracted from Spirulina platensis, Porphiridium cruentum, Scenedesmus quadricauda, Lemna minor, Elodea canadensis, Pistia stratiotes and Riccia fluitans, the plants were cultivated in radioactive solutions. The resulting complexes were extracted with acetone or acetic acid and separated chromatographically. The results show an intense activity of the polysaccharide and lipoid fractions in the bioaccumulation process. The bioaccumulation varies in the series: Spirulina > Scenedesmus > Porphiridium > Riccia > Pistia > Lemna ≥ Elodea for 137 Cs + and 60 Co 2+ ; Spirulina > Porphiridium > Scenedesmus > Riccia > Pistia > Lemna > Elodea for 51 Cr 3+ . (author)

  4. Effects of dietary on antioxidant status, lipid profile, immune response and performance characteristics of broiler chickens reared under high ambient temperature

    Directory of Open Access Journals (Sweden)

    Sara Mirzaie


    Full Text Available Objective Spirulina has been recognized formerly as a filamentous spiral-shaped blue-green algae but more recently as a genus of photosynthetic bacteria (Arthrospira. This microorganism is considered as a rich source of essential nutrients for human and animals. The present study was conducted to determine potential application of Spirulina for heat-exposed broilers. Methods Two hundred and fifty Cobb 500 chicks with male to female in equal ratio with average initial weight of 615.6 g at 17 days of age were divided into 5 treatments with 5 replicates of 10 chicks. Treatment groups were as follows: positive and negative controls with 0% Spirulina supplement and three Spirulina receiving groups with 5 g/kg (0.5%, 10 g/kg (1%, and 20 g/kg (2% supplementation. Spirulina receiving groups as well as positive control were exposed to high ambient temperature at 36°C for 6 h/d from 38 to 44 days of age. Biochemical variables were measured in serum samples at 35, 38, 42, and 45 days of broiler chickens age. Results The results showed that supplementation of the diet with Spirulina decreased concentration of stress hormone and some serum lipid parameters while enhanced humoral immunity response and elevated antioxidant status whereas it didn’t meaningfully affect performance characteristics. Nevertheless, feed conversion ratio was improved numerically but not statistically in broilers fed with 1% Spirulina under high ambient temperature. Conclusion Overall, the present study suggests that alleviation of adverse impacts due to high ambient temperature at biochemical level including impaired enzymatic antioxidant system, elevated stress hormone and lipid profile can be approached in broiler chickens through supplementation of the diet with Spirulina platensis.

  5. Agronomic Biofortification of Amaranthus dubius with Macro Nutrients and Vitamin A (United States)

    Mala, R.; Celsia, A. S. Ruby; Mahalakshmi, R.; Rajeswari, S.


    Agronomic biofortification of Amaranthus dubius with carbohydrates, proteins and Vitamin A using Spirulina platensis is reported in the present preliminary study. S. platensis was applied basally to field and its influence on germination, concentration of proteins, carbohydrates, chlorophyll, carotenoids and antioxidant activity of leaves were assessed in CO1 variety of A. dubius. Biofortification of the nutrients were evaluated on 5th and 20th day. Germination was optimum at 0.005 % of S. platensis as a fertilizer and the agronomic fortifying agent. Germination in control was 82 % and 95 % in 0.005 % of S. platensis fortification. The concentration of total chlorophyll in control and biofortified leaf on 20th day were 85.6 mg/g and 325 mg/g of dried leaf. The concentration of proteins was 71.93 mg/g and 450 mg/g on 20th day in control and fortified leaves. S. platensis applied field produced leaves fortified with 1.27 % of vitamin A aldehyde. Antioxidant activity of control leaf was 34.85 % and it was significantly increased in fortified leaves to 87 %. Thus the study confirms the fortification of leaf with proteins, carbohydrates and vitamin A.

  6. Respons Imunoglobulin-G dan Imunoglobulin-M Mencit yang Diberi Ekstrak Methanol Alga Biru Hijau dan Diinfeksi Dengan Takizoit

    Directory of Open Access Journals (Sweden)

    Sorta Basar Ida Simanjuntak


    Full Text Available Toxoplasmosis is an infectious disease caused by Toxoplasma gondii. This disease could severelyaffect humans and animals. Up to now there has been no simple treatment to fight toxoplasmosis. Aprospective alternative treatment to overcome this problem is by increasing immunity of the body using animmunostimulant such as Spirulina platensis. The aims of this research were to observe the potency of S.platensis as an immunostimulant and to find the most potential fraction of S. Platensis that can increasethe responses of IgG and IgM antibodies againts toxoplasma. The responses of these antibodies weremeasured using ELISA method. The isolation of compounds from S. platensis using Preparative ThinLayer Chromatography (PTLC found three fractions which were a top fraction (I, a middle fraction (II,and a lower fraction (III. Forty-eight mice used in this research were divided into four different groupswith 12 mice in each group and treated differently. The top, middle, and lower fractions of S. platensis wereadministered orally to three groups of mice respectively at dose of 3mg/ml for each mouse while the micein the fourth group were kept as untreated controls. The treatment was conducted for 14 days consecutivelyand on the next day, all mice, including the controls, were challenged with tachizoit. The effect of S.platensisfractions on the responses of IgG and IgM antibodies were then measured at various time intervals, i.e. day0 (before infection and day 1, 2, and 3 after infection. The results showed that IgG response increased inthe day 0 (2.504 OD and the day 3 after infection (2.608 OD while IgM response increased in day 1 afterinfection (2.898 OD. In conclusion, S. platensis was an immunostimulant and the middle fraction (II of S.Platensis was the most potential fraction to increase immunity againts toxoplasma .

  7. The Fantastic Voyage of the Trypanosome: A Protean Micromachine Perfected during 500 Million Years of Engineering

    Directory of Open Access Journals (Sweden)

    Timothy Krüger


    Full Text Available The human body is constantly attacked by pathogens. Various lines of defence have evolved, among which the immune system is principal. In contrast to most pathogens, the African trypanosomes thrive freely in the blood circulation, where they escape immune destruction by antigenic variation and incessant motility. These unicellular parasites are flagellate microswimmers that also withstand the harsh mechanical forces prevailing in the bloodstream. They undergo complex developmental cycles in the bloodstream and organs of the mammalian host, as well as the disease-transmitting tsetse fly. Each life cycle stage has been shaped by evolution for manoeuvring in distinct microenvironments. Here, we introduce trypanosomes as blueprints for nature-inspired design of trypanobots, micromachines that, in the future, could explore the human body without affecting its physiology. We review cell biological and biophysical aspects of trypanosome motion. While this could provide a basis for the engineering of microbots, their actuation and control still appear more like fiction than science. Here, we discuss potentials and challenges of trypanosome-inspired microswimmer robots.

  8. Antro-duodenal tuberculosis causing gastric outlet obstruction--a rare presentation of a protean disease. (United States)

    Gheorghe, Liana; Băncilă, Ion; Gheorghe, Cristian; Herlea, Vlad; Vasilescu, Cătălin; Aposteanu, Gabriela


    Gastroduodenal tuberculosis is a rare location of abdominal tuberculosis. It usually occurs secondary to pulmonary tuberculosis. We report a case of a 63-year-old woman admitted to the referral center for symptoms of upper gastrointestinal obstruction caused by ulcerohypertrophic antroduodenal tuberculosis. The lesion was misdiagnosed as malignancy at endoscopy. Even at surgery, the lesion was considered gastric cancer and imposed an oncologic resection. The diagnosis was established in the presence of giant-cell granulomas with caseating necrosis in the surgical resected specimens. In our case, the rare gastroduodenal location of abdominal tuberculosis occurred as primary tuberculosis, in the absence of other identifiable locations.

  9. The mysterious trace amines: protean neuromodulators of synaptic transmission in mammalian brain. (United States)

    Burchett, Scott A; Hicks, T Philip


    The trace amines are a structurally related group of amines and their isomers synthesized in mammalian brain and peripheral nervous tissues. They are closely associated metabolically with the dopamine, noradrenaline and serotonin neurotransmitter systems in mammalian brain. Like dopamine, noradrenaline and serotonin the trace amines have been implicated in a vast array of human disorders of affect and cognition. The trace amines are unique as they are present in trace concentrations, exhibit high rates of metabolism and are distributed heterogeneously in mammalian brain. While some are synthesized in their parent amine neurotransmitter systems, there is also evidence to suggest other trace amines may comprise their own independent neurotransmitter systems. A substantial body of evidence suggests that the trace amines may play very significant roles in the coordination of biogenic amine-based synaptic physiology. At high concentrations, they have well-characterized presynaptic "amphetamine-like" effects on catecholamine and indolamine release, reuptake and biosynthesis; at lower concentrations, they possess postsynaptic modulatory effects that potentiate the activity of other neurotransmitters, particularly dopamine and serotonin. The trace amines also possess electrophysiological effects that are in opposition to these neurotransmitters, indicating to some researchers the existence of receptors specific for the trace amines. While binding sites or receptors for a few of the trace amines have been advanced, the absence of cloned receptor protein has impeded significant development of their detailed mechanistic roles in the coordination of catecholamine and indolamine synaptic physiology. The recent discovery and characterization of a family of mammalian G protein-coupled receptors responsive to trace amines such as beta-phenylethylamine, tyramine, and octopamine, including socially ingested psychotropic drugs such as amphetamine, 3,4-methylenedioxymethamphetamine, N,N-dimethyltryptamine, and lysergic acid diethylamide, have revitalized the field of scientific studies investigating trace amine synaptic physiology, and its association with major human disorders of affect and cognition.

  10. The Protean Toxicities of Lead: New Chapters in a Familiar Story

    Directory of Open Access Journals (Sweden)

    David C. Bellinger


    Full Text Available Many times in the history of lead toxicology the view that “the problem” has been solved and is no longer a major health concern has prevailed, only to have further research demonstrate the prematurity of this judgment. In the last decade, an extraordinary amount of new research on lead has illustrated, all too clearly, that “the problem” has not disappeared, and that, in fact, it has dimensions never before considered. Recent risk assessments have concluded that research has yet to identify a threshold level below which lead can be considered “safe.” Although children’s intelligence has traditionally been considered to be the most sensitive endpoint, and used as the basis for risk assessment and standard setting, increased lead exposure has been associated with a wide variety of other morbidities both in children and adults, in some cases at biomarker levels comparable to those associated with IQ deficits in children. In adults, these endpoints include all-cause mortality and dysfunctions in the renal, cardiovascular, reproductive, central nervous systems. In children, IQ deficits are observed at blood lead levels well below 10 μg/dL, and the dose-effect relationship appears to be supra-linear. Other health endpoints associated with greater early-life lead exposure in children include ADHD, conduct disorder, aggression and delinquency, impaired dental health, and delayed sexual maturation. Studies employing neuroimaging modalities such as volumetric, diffusion tensor, and functional MRI are providing insights into the neural bases of the cognitive impairments associated with greater lead exposure.

  11. The Impact of Cultural Individualism & Collectivism on Protean & Boundaryless Career Attitudes and Job Satisfaction (United States)

    Hong, Re-an Ren


    Over the past several decades, new career theories have been developed in an attempt to explain the changing nature of work. No longer is one's career generally considered to be a lifelong commitment to one organization or even one career field, but the trajectory of a career is now considered to be self-driven and contingent on factors such…

  12. Inhibitory activities of microalgal extracts against Epstein-Barr Virus (EBV antigen expression in lymphoblastoid cells

    Directory of Open Access Journals (Sweden)

    Koh Yih Yih


    Full Text Available The inhibitory activities of microalgal extracts against the expression of three EBV antigens, latent membrane protein (LMP1, Epstein-Barr nuclear antigen (EBNA1 and Z Epstein-Barr reactivation activator (ZEBRA were assessed by immunocytochemistry. The observation that the methanol extracts and their fractions from Ankistrodesmus convolutus, Synechococcus elongatus and Spirulina platensis exhibited inhibitory activity against EBV proteins in three Burkitt’s lymphoma cell lines at concentrations as low as 20 μg/ml suggests that microalgae could be a potential source of antiviral compounds against EBV.

  13. Microelement composition of the herbs with hypoglycemic and tonic actions

    International Nuclear Information System (INIS)

    Babaev, T.A.; Ibragimova, E.A.; Nazirova, E.R.; Samarkhodjaeva, N.R.; Nalbandyan, A.A.


    Full text: Diabetes mellitus is a heavy disease with complex neuroendocrinal pathogenesis, which disturbs all stages of metabolism, including exchange of microelements. A significant role in pathogenesis of diabetes mellitus is given to copper, zinc, chromium, manganese - microelements directly participating in carbohydrate exchange. Usage of microelements in medicine as inorganic salts has not found a wide application. It is known, that the majority of vitaminous-mineral complexes represent a mechanical mix of artificial vitamins and microelements. The available facts testify that such inorganic forms of minerals are poorly assimilated by an organism, and moreover can block the assimilation of organic forms, what results in a gradual increase of deficiency in these microelements in organism. Scientists know around 300 plants possessing hypoglycemising effect to a greater or lesser extent. Using the method of neutron-activation analysis we have investigated the microelement composition of some of herbs possessing hypoglycemising and tonic action. On the basis of these data our group has developed the structure of a phytocompound, which includes 15 components, Spirulina platensis and mumiyo containing the balanced amount of easily assimilated organically connected minerals. The analysis of received data shows, that the developed phytocompound contains significant amount of Mn, Cu, Zn and in smaller amounts Co. Calculations show, that the daily need of an organism for copper, manganese, zinc and iodine is completely satisfied by the phytocompound. The data on analysis of element structure of Spirulina platensis and mumiyo evidence the presence of a wide spectrum of the majority of microelements in these preparations, and the content of copper and manganese in Spirulina platensis exceeds their content in mumiyo 1,5-2 times, and the presence of chromium is almost 20 times higher. The complex of the developed phytocompound, Spirulina platensis and mumiyo is suggested

  14. Application of some microorganisms for synthesis of gold and silver nanoparticles

    International Nuclear Information System (INIS)

    Frontas'eva, M.V.; Pavlov, S.S.; Zinicovscaia, I.I.; Kirkesali, E.I.; Kalabegishvili, T.; Murusidze, I.; Faanhof, A.


    In recent years, much attention has been paid to microbial technologies of nanoparticle production. Novel strains of actinomycetes Streptomyces glaucus 71 MD, Streptomyces spp. 211A, arthrobacter genera - Arthrobacter globiformis 151B and Arthrobacter oxydans 61B and blue-green microalga Spirulina platensis were used for synthesis of silver and gold nanoparticles. The studies were carried out using scanning electron microscopy (SEM), energy dispersive X-ray analysis (EDAX), transmission electron microscopy (TEM), X-ray diffraction (XRD), atomic absorption spectrometry (AAS), and neutron activation analysis (NAA)

  15. Bioleaching of UO22+ ions from poor uranium ores by means of cyanobacteria

    International Nuclear Information System (INIS)

    Cecal, A.; Humelnicu, D.; Popa, K.; Palamaru, I.; Nemtoi, G.; Rudic, V.; Gulea, A.


    Uranium (VI) leaching, as uranyl ions, from ores with a poor content in util minerals, using some algae as: Porphyridium cruentum (Smith and Soerly) Naegeli, Spirulina platensis CNM-CB-02 and Nostoc linkia (Roth) Born and Flah was studied. The basic composition of these ores allowed the self-maintenance and self-development of these microorganisms, which have facilitated then the leaching of the uranium (VI) as UO 2 2+ ions. The microbial leaching degree was comprised between 40-90%, depending on the used alga and experimental conditions. (author)

  16. Determination of the elemental composition of cyanobacteria cells and cell fractions by atomic emission and atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Sedykh, Eh.M.; Lyabusheva, O.A.; Bannykh, L.N.; Tambiev, A.Kh.


    An approach to studying the elemental composition of cyanobacteria Spirulina platensis and Nostoc commune using a set of complementary analytical methods (ICP-AES, PAAS, and ETAAS) was proposed . The procedures were adapted for the determination of macro- and microelements (Na, K, Mg, Ca, Fe, Mn, Cu, Mo, Zn, B, and Se) in the biomass of cyanobacteria and separated cell fractions (chloroform and water-methanol extracts and precipitates). The conditions for the mineralization of biological materials were optimized for autoclave and microwave sample preparation procedures. The evaporation and atomization of Se and Mo in a graphite furnace in the presence of chloroform and methanol were studied [ru

  17. Microelement composition of the herbs with hypoglycemic and tonic actions

    Energy Technology Data Exchange (ETDEWEB)

    Babaev, T A; Ibragimova, E A; Nazirova, E R; Samarkhodjaeva, N R; Nalbandyan, A A [Institute of Biochemistry, Tashkent (Uzbekistan)


    Full text: Diabetes mellitus is a heavy disease with complex neuroendocrinal pathogenesis, which disturbs all stages of metabolism, including exchange of microelements. A significant role in pathogenesis of diabetes mellitus is given to copper, zinc, chromium, manganese - microelements directly participating in carbohydrate exchange. Usage of microelements in medicine as inorganic salts has not found a wide application. It is known, that the majority of vitaminous-mineral complexes represent a mechanical mix of artificial vitamins and microelements. The available facts testify that such inorganic forms of minerals are poorly assimilated by an organism, and moreover can block the assimilation of organic forms, what results in a gradual increase of deficiency in these microelements in organism. Scientists know around 300 plants possessing hypoglycemising effect to a greater or lesser extent. Using the method of neutron-activation analysis we have investigated the microelement composition of some of herbs possessing hypoglycemising and tonic action. On the basis of these data our group has developed the structure of a phytocompound, which includes 15 components, Spirulina platensis and mumiyo containing the balanced amount of easily assimilated organically connected minerals. The analysis of received data shows, that the developed phytocompound contains significant amount of Mn, Cu, Zn and in smaller amounts Co. Calculations show, that the daily need of an organism for copper, manganese, zinc and iodine is completely satisfied by the phytocompound. The data on analysis of element structure of Spirulina platensis and mumiyo evidence the presence of a wide spectrum of the majority of microelements in these preparations, and the content of copper and manganese in Spirulina platensis exceeds their content in mumiyo 1,5-2 times, and the presence of chromium is almost 20 times higher. The complex of the developed phytocompound, Spirulina platensis and mumiyo is suggested

  18. A espirulina: um novo modismo brasileiro


    Terãn, Elizabeth


    A autora apresenta uma série de dados referentes a morfologia, cultura, processamemto, composicao química e usos da espirulina (Spirutina maxima, Spirulina platensis), microalga verde-azulada cujo consumo está muito em evidência em diversos países da Eutopa, Ásia e América do Norte e que começa também a ser miuto utilizada por brasileiros. The author presents a series of figures referents to morphology, culture, process of manufacture, chemical composition and uses of spiruline, a blue-gre...

  19. Hydrothermal liquefaction of microalgae's for bio oil production

    DEFF Research Database (Denmark)

    Toor, Saqib; Reddy, Harvind; Deng, Shuguang

    process water for algae cultivation. GC-MS, elemental analyzer, calorimeter and nutrient analysis were used to analyze bio-crude, lipid-extracted algae and water samples produced in the hydrothermal liquefaction process. The highest bio-oil yield of 46% was obtained on Nannochloropsis salina at 310 °C...... and 107 bar. For Spirulina platensis algae sample, the highest bio-oil yield is 38% at 350 °C and 195 bar. Preliminary data also indicate that a lipid-extracted algae solid residue sample obtained in the hydrothermal liquefaction process contains a high level of proteins...

  20. Polyurethane and alginate immobilized algal biomass for the removal of aqueous toxic metals

    International Nuclear Information System (INIS)

    Fry, I.V.; Mehlhorn, R.J.


    We describe the development of immobilized, processed algal biomass for use as an adsorptive filter in the removal of toxic metals from waste water. To fabricate an adsorptive filter from precessed biomass several crucial criteria must be met, including: (1) high metal binding capacity, (2) long term stability (both mechanical and chemical), (3) selectivity for metals of concern (with regard to ionic competition), (4) acceptable flow capacity (to handle large volumes in short time frames), (5) stripping/regeneration (to recycle the adsorptive filter and concentrate the toxic metals to manageable volumes). This report documents experiments with processed algal biomass (Spirulina platensis and Spirulina maxima) immobilized in either alginate gel or preformed polyurethane foam. The adsorptive characteristics of these filters were assessed with regard to the criteria listed above


    Directory of Open Access Journals (Sweden)

    Martba Sáncbez


    Full Text Available Spirulina is a photosynthetic, filamentous, helical-shaped, multicellular and green-blue microalga. The two most important species of which are Spirulina maxima and Spirulina platensis. For these microórgarusms cell division occurs by binary fission. Since this material contains chlorophyll a, Jike higher plants, botanists classify it as a microalgae belonging to Cyanophyceae class; but according to bacteriologists it is a bacteria dueto its prokaryotic structure. Before Columbus, Mexicans (Aztecs exploited this microorganism as human food; presently, African tribes (Kanembu use it for the same purpose. Its chemical composition includes proteins (55%-70%, carbohydrates (15%-25%, essential fatty acids (18%, vitamins, minerals and pigments like carotenes, chlorophyll a and phycocyanin. The last one is used in food and cosmetic industries. Spirulina is considered as an excellent food, lacking toxicity and having corrective properties against viral attacks, anemia, tumor growth and malnUtrition. It has been reported in literature that the use of these microalgae as animal food supplement implies enhancement of the yellow coloration of skin and eggs yo !k in poultry and flaDlÍOgos, growth acceleration, sexual maturation and increase of fertility in cattle.

  2. Cytological and Biochemical Effects of St. John’s Wort Supplement (A Complex Mixture of St. John’s Wort, Rosemary and Spirulina on Somatic and Germ Cells of Swiss Albino Mice

    Directory of Open Access Journals (Sweden)

    A. M. Aleisa


    Full Text Available Commercially available St. John’s wort supplement (SJWS composed of an herbal mixture of St. John’s Wort (SJW, Rosemary (RM and Spirulina (SP is used as a dietary supplement for the treatment of psychiatric disorders. Although the minor ingredients, (RM and SP are proven antioxidants, their quantity is quite insignificant as compared to the SJW, which is the major ingredient. Most of the toxic effects of SJWS are attributed to the main constituents of SJW which differ due to the influence of light (hypericin and variations in temperature above freezing point (hyperforin. However, there are no reports on toxicity of SJWS maintained at room temperature in pharmacies and supermarkets. In view of the folkloric importance, immense (prescribed or unprescribed use and a paucity of literature on SJWS, it was found worthwhile to (1 determine the genotoxic effects of SJWS in somatic and germ cells of mice and (2 investigate the role of biochemical changes, as a possible mechanism. The protocol included the oral treatment of mice with different doses (380, 760 and 1520 mg/kg/day of SJWS for 7 days. The following experiments were conducted: (i cytological studies on micronucleus test, (ii cytogenetic analysis for meiotic chromosomes, (iii cytological analysis of spermatozoa abnormalities, (iv quantification of proteins and nucleic acids in hepatic and testicular cells and (v estimation of malondialdehyde (MDA and nonprotein sulfhydryl (NP-SH in hepatic and testicular cells. The treatment increased the frequency of micronuclei in polychromatic erythrocytes (PCE in the femora. It caused aberrations in chromosomes of testes and induced spermatozoa abnormalities. These changes might be attributed to the epigenetic mechanisms as revealed by an increase in concentrations of MDA and depletion of nucleic acids and NP-SH levels in both hepatic and testicular cells observed in the present study. Since, the samples of SJWS used were not drawn

  3. Blue green alga mediated synthesis of gold nanoparticles and its antibacterial efficacy against Gram positive organisms

    Energy Technology Data Exchange (ETDEWEB)

    Uma Suganya, K.S. [Centre for Ocean Research, Sathyabama University, Chennai 600 119 (India); Govindaraju, K., E-mail: [Centre for Ocean Research, Sathyabama University, Chennai 600 119 (India); Ganesh Kumar, V.; Stalin Dhas, T.; Karthick, V. [Centre for Ocean Research, Sathyabama University, Chennai 600 119 (India); Singaravelu, G. [Nanoscience Division, Department of Zoology, Thiruvalluvar University, Vellore 632115 (India); Elanchezhiyan, M. [Department of Microbiology, Dr ALM Post Graduate Institute of Basic Medical Sciences, University of Madras, Chennai 600113 (India)


    Biofunctionalized gold nanoparticles (AuNPs) play an important role in design and development of nanomedicine. Synthesis of AuNPs from biogenic materials is environmentally benign and possesses high bacterial inhibition and bactericidal properties. In the present study, blue green alga Spirulina platensis protein mediated synthesis of AuNPs and its antibacterial activity against Gram positive bacteria is discussed. AuNPs were characterized using Ultraviolet–visible (UV–vis) spectroscopy, Fluorescence spectroscopy, Fourier Transform-Infrared (FTIR) spectroscopy, Raman spectroscopy, High Resolution-Transmission Electron Microscopy (HR-TEM) and Energy Dispersive X-ray analysis (EDAX). Stable, well defined AuNPs of smaller and uniform shape with an average size of ∼ 5 nm were obtained. The antibacterial efficacy of protein functionalized AuNPs were tested against Gram positive organisms Bacillus subtilis and Staphylococcus aureus. - Highlights: • Size controlled synthesis of gold nanoparticles from blue green alga Spirulina platensis • Stability of gold nanoparticles at different temperatures • Potent antibacterial efficacy against Gram positive organisms.

  4. Caracterização ácido-base da superfície de espécies mistas da alga Spirulina através de titulação potenciométrica e modelo de distribuição de sítios discretos Acid base characterization of the surface of mixed species of algae Spirulin by potentiometric titration and discrete site distribution model

    Directory of Open Access Journals (Sweden)

    Elizabete C. de Lima


    Full Text Available Acid base properties of mixed species of the microalgae Spirulina were studied by potentiometric titration in medium of 0.01 and 0.10 mols L-1 NaNO3 at 25.0±0.10 C using modified Gran functions or nonlinear regression techniques for data fitting. The discrete site distribution model was used, permitting the characterization of five classes of ionizable sites in both ionic media. This fact suggests that the chemical heterogeneity of the ionizable sites on the cell surface plays a major role on the acid-base properties of the suspension in comparison to electrostatic effects due to charge-charge interactions. The total of ionizable sites were 1.75±0.10 and 1.86±0.20 mmolsg-1 in ionic media of 0.01 and 0.10 mols L-1 NaNO3, respectively. A major contribution of carboxylic groups was observed with an average 34 and 22% of ionizable sites being titrated with conditional pcKa of 4.0 and 5.4, respectively. The remaining 44% of ionizable sites were divided in three classes with averaged conditional pcKa of 6.9, 8.7 and 10.12, which may be assigned respectively to imidazolic, aminic, and phenolic functionalities.

  5. Casp8p41: The Protean Mediator of Death in CD4 T-cells that Replicate HIV

    Directory of Open Access Journals (Sweden)

    Rahul Sampath


    Full Text Available HIV cure is now the focus of intense research after Timothy Ray Brown (the Berlin patient set the precedent of being the first and only person cured. A major barrier to achieving this goal on a meaningful scale is an elimination of the latent reservoir, which is thought to comprise CD4-positive cells that harbor integrated, replication-competent HIV provirus. These cells do not express viral proteins, are indistinguishable from uninfected CD4 cells, and are thought to be responsible for HIV viral rebound–-that occurs within weeks of combination anti retroviral therapy (cART interruption. Modalities to engineer transcriptional stimulation (reactivation of this dormant integrated HIV provirus, leading to expression of cytotoxic viral proteins, are thought to be a specific way to eradicate the latently infected CD4 pool and are becoming increasingly relevant in the era of HIV cure. HIV protease is one such protein produced after HIV reactivation that cleaves procaspase-8 to generate a novel protein Casp8p41. Casp8p41 then binds to the BH3 domain of BAK, leading to BAK oligomerization, mitochondrial depolarization, and apoptosis. In central memory T cells (TCMs from HIV-infected patients, an elevated Bcl-2/procaspase-8 ratio was observed, and Casp8p41 binding to Bcl-2 was associated with a lack of reactivation-induced cell death. This was reversed by priming cells with a specific Bcl-2 antagonist prior to reactivation, resulting in increased cell death and decreased HIV DNA in a Casp8p41-dependent pathway. This review describes the biology, clinical relevance, and implications of Casp8p41 for a potential cure.

  6. Novel Concept for LSS Based on Advanced Microalgal Biotechnologies (United States)

    Brown, I.; Jones, J. A.; Bayless, D.; Karakis, S.; Karpov, L.; McKay, D. S.


    One of the key issues for successful human space exploration is biomedical life support in hostile space and planetary environments that otherwise cannot sustain life. Bioregenerative life support systems (LSS) are one of the options for atmospheric regeneration. To date, no bioregenerative LSS has shown capability for 100% air regeneration. Nor have these LSS been robust enough to simultaneously provide a regenerable complete food source. In contrast to microalgae, traditional plant approaches, e.g. wheat and lettuce, are lacking essential amino acids, vitamins, and micronutrients. Moreover, the rate of photosynthesis by microalgae significantly exceeds that of high plants. Nevertheless, the employment of microalgae in LSS technology was restricted, until recently, due to high water demands. Also the per person requirement of a 40L volume of microalgae in a photobioreactor, to provide daily O2 production, made an algae-based approach less attractive. By employing a vertically stacked membrane bioreactor, coupled with a solar tracker and photon-delivery system, a lightweight air revitalization system for space based applications, with minimal water requirements, can be developed. Our preliminary estimations suggest that a membrane bioreactor, 8m3 in volume, comprised of 80m2 (twenty 2m x 2m membranes, each spaced 10 cm apart), and a total of 70L of water could produce 2.7 kg of dried microalgal biomass that would supply the energy and essential amino acid requirements, as well as producing sufficient O2 for the daily needs of a 15 member crew. Research on the biochemical content of edible blue-green alga Spirulina (Arthrospira) platensis shows a wide spectrum of stable Spirulina mutants with an enhanced content of amino acids, -carotene, and phycobilliprotein c-phycocyanin. Feeding animals suffering from radiation-induced lesions, c-phycocyanin, extracted from strain 27G, led to a correction in the decrement of dehydrogenase activity and energy-rich phosphate

  7. Influence of spirulina intake on metabolism of exercised rats


    Rogatto, Gustavo Puggina; Oliveira, Camila Aparecida Machado de; Santos, Júlio Wilson dos; Manchado, Fúlvia de Barros; Nakamura, Fábio Yuzo; Moraes, Camila de; Zagatto, Alessandro de Moura; Faria, Marcel Cardoso; Afonso, Márcia; Mello, Maria Alice Rostom de


    No presente estudo foram comparadas as respostas metabólicas agudas ao exercício em ratos alimentados com dieta padrão e à base de espirulina. Ratos Wistar jovens foram divididos em dois grupos de acordo com a dieta: controle (C) (dieta padrão) e espirulina (S) (dieta à base de espirulina). Ao final do período experimental (cinco semanas) os animais foram submetidos a uma sessão aguda de exercício de natação (20 minutos, suportando sobrecarga equivalente a 5% do peso corporal) para avaliação ...

  8. Arthrospira (Spirulina) in tannery wastewaters. Part 2: Evaluation of ...

    African Journals Online (AJOL)

    Part 2: Evaluation of tannery wastewater as production media for the mass culture of ... as a critical driver in the profitability of the algal biotechnology enterprise. ... and possibly marginal economics of, biofuels production from the microalgae ...

  9. Cultivo de Spirulina maxima ao ar livre - I. Inverno

    Directory of Open Access Journals (Sweden)

    Rogério Lacaz Ruiz


    e noturno indicaram que o melhor período de produção de biomassa durante o dia foi das 8 - 13 h e a produtividade atingiu valor máximo de 8,08 g/metro quadrado/dia. Durante todo o experimento foi necessário adicionar água ao sistema, devido à ausência de chuvas; e o total acrescentado equivaleu a 72,14 mm de chuva.

  10. Effect of Nickel on the growth of Spirulina maxima (Arthrospira)

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez-Bocanegra, A. R.; Torres-Munoz, J. A.; Neria-Gonzalez, M. I.; Rios-Leal, E.; Aguilar-Lopez, R.


    Nickel is not produced in Mexico, but is a component widely used in the paper industry, fertilizers, iron foundry, and jewels fabrication among others. therefore it is founded in residual waters coming form domestic and industrial. It is known that such a heavy metal is essential to the life of some microorganisms including microalgae, however at relatively high concentrations it turns to be toxic inside some physiological processes (Jin et al., 1996). (Author)

  11. Effect of Cadmium on the growth of Spirulina maxima (Arthrospira)

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Munoz, J. A.; Aguilar-Lopez, R.; Hernandez-Villagran, D.; Neria-Gonzalez, M. I.; Rios-Leal, E.; Dominguez-Bocanegra, A. R.


    The removal of heavy metal by microorganisms can occur through several mechanisms, such as simple adsorption, absorption, enzymatic synthesis or through the production of extracellular polymers. Cadmium (CD), a metal released in most mining and metallurgical processes, is one of the main agents responsible for water pollution. In spite of the increasing amount of research published on the interaction of microorganisms with heavy metals, few work describe this interaction with cyanobacteria. (Author)

  12. Effect of lead on the growth of Spirulina maxima (Arthrospira)

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez- Villagran, D.; Torres-Munoz, J. A.; Rios-Leal, E.; Aguilar-Lopez, R.; Dominguez-Bocanegra, A. R.


    The pollution of aquatic ecosystems caused by heavy metals from industrial and domestic sources leads to the bioaccumulation of these toxicants in cyanobacteria and microalgae with damage or inhibition of specific enzymes and transfer of metals through the food web (He et al., 1998). Moreover, even through ions of some metals, such as zinc, are involved in the metabolism of algae. (Author)

  13. Protective effects of C-phycocyanin on alcohol-induced acute liver injury in mice (United States)

    Xia, Dong; Liu, Bing; Luan, Xiying; Sun, Junyan; Liu, Nana; Qin, Song; Du, Zhenning


    Excessive alcohol consumption leads to liver disease. Extensive evidence suggests that C-phycocyanin (C-PC), a chromophore phycocyanobilin derived from Spirulina platensis, exerts protective effects against chemical-induced organ damage. In this study, we investigated whether C-PC could protect against ethanol-induced acute liver injury. Serum alanine aminotransferase (ALT), aspartate aminotransferase (AST), triglyceride (TG), total cholesterol (CHOL), low-density lipoprotein (LDL), liver homogenate malondialdehyde (MDA), superoxide dismutase (SOD) content were measured, and pathological examination of liver sections were examined. C-PC showed obvious inhibitory effects on serum ALT, AST, TG, CHOL, LDL and MDA, and SOD content significantly increased in the liver. The structure of hepatic lobules was clear, liver sinus returned to normal, and liver cell cords were arranged in neat rows. Cloudiness, swelling, inflammatory cell infiltration and spotty necrosis of liver cells were significantly reduced. Therefore, C-PC can significantly protect against ethanol-induced acute liver injury.

  14. Radioimmunoassay for the determination of free and conjugated abscisic acid

    International Nuclear Information System (INIS)

    Weiler, E.W.


    The characterization and application of a radioimmunoassay specific for free and conjugated abscisic acid (ABA) is reported, The antibodies produced against a bovine serum albumin-(+-)-ABA conjugate have a high affinity for ABA (Ka= 1.3 x 10 9 l mol -1 ). Trans, trans-ABA and related compounds, such as xanthoxin, phaseic acid, dihydrophaseic acid, vomifoliol or violaxanthin do not interfere with the assay. The detection limit of this method is 0.25 x 10 -12 mol ABA, the measuring range extends to 20 x 10 -12 mol, and average recoveries are 103%. Because of the high specificity of this immunoassay, no extract purification steps are required prior to analysis. Several hundred plants can be analyzed per day in a semi-automatic assay performance. ABA has been detected in all higher plant families examined, but was absent in the blue-green alga, Spirulina platensis, the liverwort Marchantia polymorpha, and two species of fungi. (orig.) [de

  15. KAROTENOID DARI MAKROALGAE DAN MIKROALGAE: POTENSI KESEHATAN APLIKASI DAN BIOTEKNOLOGI [Carotenoids from Macroalgae and Microalgae: Health Potential, Application and Biotechnology

    Directory of Open Access Journals (Sweden)

    Leenawaty Limantara3


    Full Text Available Algae, both micro and macroalgae, is one of the largest producers of carotenoids. The major composition of carotenoid on algae are β-carotene, astaxanthin, luthein, zeaxanthin, cryptoxanthin, and fucoxanthin which have important roles for human health. Carotenoids were produced by several microalgae species such as Dunaliella sallina, Haemotococcus pluvialis, Chlorella pyrenoidosa, Spirulina platensis, Nannnochloropsis oculata, and also from some macroalgae species such as Kappaphycus alvarezii, Sargassum sp, and Caulerpa sp. Carotenoids from algae has been proven as a powerful antioxidant and may prevent some degenerative diseases, cardiovascular, and cancer. Carotenoid also has been applied as a natural dye and dietary supplements. Biotechnology has been developed to increase the production of carotenoids from micro- and macroalgae. The large-scale cultivation of microalgae, either in open or closed system are shown to increase carotenoid production. During cultivation, some stress conditions can be specifically manipulated to optimize carotenoid production from microalgae.

  16. Hydrothermal Disintegration and Extraction of Different Microalgae Species

    Directory of Open Access Journals (Sweden)

    Michael Kröger


    Full Text Available For the disintegration and extraction of microalgae to produce lipids and biofuels, a novel processing technology was investigated. The utilization of a hydrothermal treatment was tested on four different microalgae species (Scenedesmus rubescens, Chlorella vulgaris, Nannochloropsis oculata and Arthorspira platensis (Spirulina to determine whether it has an advantage in comparison to other disintegration methods for lipid extraction. It was shown, that hydrothermal treatment is a reasonable opportunity to utilize microalgae without drying and increase the lipid yield of an algae extraction process. For three of the four microalgae species, the extraction yield with a prior hydrothermal treatment elevated the lipid yield up to six times in comparison to direct extraction. Only Scenedesmus rubescens showed a different behaviour. Reason can be found in the different cell wall of the species. The investigation of the differences in cell wall composition of the used species indicate that the existence of algaenan as a cell wall compound plays a major role in stability.

  17. Nutritional and environmental properties of algal products used in healthy diet by INAA and ICP-AES

    International Nuclear Information System (INIS)

    Avino, P.; Lepore, L.; Carconi, P.L.; Moauro, A.


    Spirulina platensis alga sampled in the Caribbean Sea and seven other commercial algal products available on the Italian market of different origin and aspect, have been analyzed by instrumental neutron activation analysis (INAA) and inductively coupled plasma-atomic emission spectrometry (ICP-AES). By neutron irradiation and γ-ray spectrometry (INAA), as many as 20 elements could be measured instrumentally without any chemical treatment. Cu, Mg, Mn and Pb were determined after dissolution of the sample by ICP-AES. The cross-checking of the data, specifically by comparing those of Ca, Cr, Fe and Zn, obtained by the two techniques was found to be in good agreement. Special attention from analytical and nutritional point of view has been devoted to the toxic metals. The measurements have been carried out employing the reference algal material prepared by International Atomic Energy Agency (IAEA). (author)

  18. The role of rabbit meat as functional food. (United States)

    Dalle Zotte, Antonella; Szendro, Zsolt


    Increasing consumer knowledge of the link between diet and health has raised the awareness and demand for functional food ingredients. Meat and its derivatives may be considered functional foods to the extent that they contain numerous compounds thought to be functional. This review will attempt to outline the excellent nutritional and dietetic properties of rabbit meat and offer an overview of the studies performed on the strategies adopted to improve the functional value of rabbit meat. Dietary manipulation has been seen to be very effective in increasing the levels of essential FA, EPA, DHA, CLA, branched chain FA, vitamin E, and selenium in rabbit meat. Dietary fortification with vitamin E or natural products such as oregano essential oil, chia seed oil, and Spirulina platensis microalga seem promising in improving the oxidative stability of rabbit meat while also adding functional ingredients. Copyright © 2011 Elsevier Ltd. All rights reserved.

  19. Heavy metal sorption by microalgae

    International Nuclear Information System (INIS)

    Sandau, E.; Sandau, P.; Pulz, O.


    Viable microalgae are known to be able to accumulate heavy metals (bioaccumulation). Against a background of the increasing environmental risks caused by heavy metals, the microalgae Chlorella vulgaris and Spirulina platensis and their potential for the biological removal of heavy metals from aqueous solutions were taken as an example for investigation. Small-scale cultivation tests (50 l) with Cd-resistant cells of Chlorella vulgaris have shown that approx. 40% of the added 10 mg Cd/l was removed from the solution within seven days. At this heavy metal concentration sensitive cells died. Non-viable microalgae are able to eliminate heavy metal ions in a short time by biosorption in uncomplicated systems, without any toxicity problems. Compared with original biomasses, the sorption capacity of microalgal by-products changes only insignificantly. Their low price makes them economical. (orig.)

  20. The design and optimization for light-algae bioreactor controller based on Artificial Neural Network-Model Predictive Control (United States)

    Hu, Dawei; Liu, Hong; Yang, Chenliang; Hu, Enzhu

    As a subsystem of the bioregenerative life support system (BLSS), light-algae bioreactor (LABR) has properties of high reaction rate, efficiently synthesizing microalgal biomass, absorbing CO2 and releasing O2, so it is significant for BLSS to provide food and maintain gas balance. In order to manipulate the LABR properly, it has been designed as a closed-loop control system, and technology of Artificial Neural Network-Model Predictive Control (ANN-MPC) is applied to design the controller for LABR in which green microalgae, Spirulina platensis is cultivated continuously. The conclusion is drawn by computer simulation that ANN-MPC controller can intelligently learn the complicated dynamic performances of LABR, and automatically, robustly and self-adaptively regulate the light intensity illuminating on the LABR, hence make the growth of microalgae in the LABR be changed in line with the references, meanwhile provide appropriate damping to improve markedly the transient response performance of LABR.

  1. Phenolic Content and Antioxidant Capacity in Algal Food Products

    Directory of Open Access Journals (Sweden)

    Ludmila Machu


    Full Text Available The study objective was to investigate total phenolic content using Folin-Ciocalteu’s method, to assess nine phenols by HPLC, to determine antioxidant capacity of the water soluble compounds (ACW by a photochemiluminescence method, and to calculate the correlation coefficients in commercial algal food products from brown (Laminaria japonica, Eisenia bicyclis, Hizikia fusiformis, Undaria pinnatifida and red (Porphyra tenera, Palmaria palmata seaweed, green freshwater algae (Chlorella pyrenoidosa, and cyanobacteria (Spirulina platensis. HPLC analysis showed that the most abundant phenolic compound was epicatechin. From spectrophotometry and ACW determination it was evident that brown seaweed Eisenia bicyclis was the sample with the highest phenolic and ACW values (193 mg·g−1 GAE; 7.53 µmol AA·g−1, respectively. A linear relationship existed between ACW and phenolic contents (r = 0.99. Some algal products seem to be promising functional foods rich in polyphenols.

  2. The structure of allophycocyanin from Thermosynechococcus elongatus at 3.5 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Murray, James William; Maghlaoui, Karim; Barber, James, E-mail: [Division of Molecular Biosciences, Imperial College, Exhibition Road, London SW7 2AZ (United Kingdom)


    The crystal structure of a light-harvesting protein that interacts with photosystem II is reported. Cyanobacteria and red algae use light-harvesting pigments bound by proteins to capture solar radiation and to channel excitation energy into their reaction centres. In most cyanobacteria, a multi-megadalton soluble structure known as the phycobilisome is a major light-harvesting system. Allophycocyanin is the main component of the phycobilisome core, forming a link between the rest of the phycobilisome and the reaction-centre core. The crystal structure of allophycocyanin from Thermosynechococcus elongatus (TeAPC) has been determined and refined at 3.5 Å resolution to a crystallographic R value of 26.0% (R{sub free} = 28.5%). The structure was solved by molecular replacement using the allophycocyanin structure from Spirulina platensis as the search model. The asymmetric unit contains an (αβ) monomer which is expanded by symmetry to a crystallographic trimer.

  3. Nutritional Evaluation of Raw Materials Entering the Structure to Mixed Fodder for the Specie Poecilia reticulata (Guppy

    Directory of Open Access Journals (Sweden)

    Adrian Gruber


    Full Text Available In the ornamental pisciculture is a especial emphasis on the exterior shape and color to the fishes, issues that are dependent directly to the structure of compound feeds in relation to the nutritional characteristics of the raw materials.Own research or focused on analyzing the crude chemical composition with Weende scheme (water content and dry matter, crude ash, crude protein, crude fat, crude fiber, SEN of raw materials can be used in the structure of a compound feeds for the Poecilia reticulata (guppy species, for most of these materials there are no current data in the literature.These materials were analyzed: gelatin, wheat flour, sunflower meal, soybean meal, meal Spirulina platensis, carrot (Daucus carota, Pangasius fillet, Daphnia pulex, grount dandelion (Taraxacum officinale, grount nettle (Urtica dioica and yeast.

  4. Evaluation of algal biofilms on indium tin oxide (ITO for use in biophotovoltaic platforms based on photosynthetic performance.

    Directory of Open Access Journals (Sweden)

    Fong-Lee Ng

    Full Text Available In photosynthesis, a very small amount of the solar energy absorbed is transformed into chemical energy, while the rest is wasted as heat and fluorescence. This excess energy can be harvested through biophotovoltaic platforms to generate electrical energy. In this study, algal biofilms formed on ITO anodes were investigated for use in the algal biophotovoltaic platforms. Sixteen algal strains, comprising local isolates and two diatoms obtained from the Culture Collection of Marine Phytoplankton (CCMP, USA, were screened and eight were selected based on the growth rate, biochemical composition and photosynthesis performance using suspension cultures. Differences in biofilm formation between the eight algal strains as well as their rapid light curve (RLC generated using a pulse amplitude modulation (PAM fluorometer, were examined. The RLC provides detailed information on the saturation characteristics of electron transport and overall photosynthetic performance of the algae. Four algal strains, belonging to the Cyanophyta (Cyanobacteria Synechococcus elongatus (UMACC 105, Spirulina platensis. (UMACC 159 and the Chlorophyta Chlorella vulgaris (UMACC 051, and Chlorella sp. (UMACC 313 were finally selected for investigation using biophotovoltaic platforms. Based on power output per Chl-a content, the algae can be ranked as follows: Synechococcus elongatus (UMACC 105 (6.38×10(-5 Wm(-2/µgChl-a>Chlorella vulgaris UMACC 051 (2.24×10(-5 Wm(-2/µgChl-a>Chlorella sp.(UMACC 313 (1.43×10(-5 Wm(-2/µgChl-a>Spirulina platensis (UMACC 159 (4.90×10(-6 Wm(-2/µgChl-a. Our study showed that local algal strains have potential for use in biophotovoltaic platforms due to their high photosynthetic performance, ability to produce biofilm and generation of electrical power.

  5. Potential of as a Nutritional Supplement in Malnourished HIV-Infected Adults in Sub-Saharan Africa: A Randomised, Single-Blind Study

    Directory of Open Access Journals (Sweden)

    M. Azabji-Kenfack


    Full Text Available Background Malnutrition is a major global public health issue and its impact on communities and individuals is more dramatic in Sub-Saharan Africa, where it is compounded by widespread poverty and generalized high prevalence of human immunodeficiency virus (HIV. Therefore, malnutrition should be addressed through a multisectorial approach, and malnourished individuals should have access to nutritional rehabilitation molecules that are affordable, accessible, rich in nutrient and efficient. We thus assessed the efficacy of two affordable and accessible nutritional supplements, spirulina platensis versus soya beans among malnourished HIV-infected adults. Methods Undernourished patients, naïve of, but eligible to antiretroviral treatment (ART, aged 18 to 35 years were enrolled and randomly assigned to two groups. The first group received spirulina (Group A as food supplement and the second received soya beans (Group B. Patients were initiated ART simultaneously with supplements. Food supplements were auto-administered daily, the quantity being calculated according to weight to provide 1.5 g/kg body weight of proteins with 25% from supplements (spirulina and soya beans. Patients were monitored at baseline and followed-up during twelve weeks for anthropometric parameters, body composition, haemoglobin and serum albumin, CD4 count and viral load. Results Fifty-two patients were enrolled (Group A: 26 and Group B: 26. The mean age was 26.4 ± 4.9 years (Group A and 28.7 ± 4.8 (Group B with no significant difference between groups ( P = 0.10. After 12 weeks, weight and BMI significantly improved in both groups ( P < 0.001 within each group. The mean gain in weight and BMI in Group A and B were 4.8 vs. 6.5 kg, ( P = 0.68 and 1.3 vs. 1.90 Kg/m 2 , ( P = 0.82 respectively. In terms of body composition, fat free mass (FFM did not significantly increase within each group (40.5 vs. 42.2 Kg, P = 0.56 for Group A; 39.2 vs. 39.0 Kg, P = 0.22 for Group B. But

  6. Replacement

    Directory of Open Access Journals (Sweden)

    S. Radhakrishnan


    Full Text Available The fishmeal replaced with Spirulina platensis, Chlorella vulgaris and Azolla pinnata and the formulated diet fed to Macrobrachium rosenbergii postlarvae to assess the enhancement ability of non-enzymatic antioxidants (vitamin C and E, enzymatic antioxidants (superoxide dismutase (SOD and catalase (CAT and lipid peroxidation (LPx were analysed. In the present study, the S. platensis, C. vulgaris and A. pinnata inclusion diet fed groups had significant (P < 0.05 improvement in the levels of vitamins C and E in the hepatopancreas and muscle tissue. Among all the diets, the replacement materials in 50% incorporated feed fed groups showed better performance when compared with the control group in non-enzymatic antioxidant activity. The 50% fishmeal replacement (best performance diet fed groups taken for enzymatic antioxidant study, in SOD, CAT and LPx showed no significant increases when compared with the control group. Hence, the present results revealed that the formulated feed enhanced the vitamins C and E, the result of decreased level of enzymatic antioxidants (SOD, CAT and LPx revealed that these feeds are non-toxic and do not produce any stress to postlarvae. These ingredients can be used as an alternative protein source for sustainable Macrobrachium culture.

  7. Immunomodulatory and Inhibitory Effect of Immulina®, and Immunloges® in the Ig-E Mediated Activation of RBL-2H3 Cells. A New Role in Allergic Inflammatory Responses

    Directory of Open Access Journals (Sweden)

    Kurt Appel


    Full Text Available Immulina®, a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis (Spirulina is a potent activator of innate immune cells. On the other hand, it is well documented that Spirulina exerts anti-inflammatory effects and showed promising effects with respect to the relief of allergic rhinitis symptoms. Taking into account these findings, we decided to elucidate whether Immulina®, and immunLoges® (a commercial available multicomponent nutraceutical with Immulina® as a main ingredient beyond immune-enhancing effects, might also exert inhibitory effects in the induced allergic inflammatory response and on histamine release from RBL-2H3 mast cells. Our findings show that Immulina® and immunLoges® inhibited the IgE-antigen complex-induced production of TNF-α, IL-4, leukotrienes and histamine. The compound 48/80 stimulated histamine release in RBL-2H3 cells was also inhibited. Taken together, our results showed that Immulina® and immunLoges® exhibit anti-inflammatory properties and inhibited the release of histamine from mast cells.

  8. Protean manifestations of vitamin D deficiency, part 3: association with cardiovascular disease and disorders of the central and peripheral nervous systems. (United States)

    Bell, David S H


    Vitamin D deficiency is associated with the risk factors of inflammation, insulin resistance and endothelial dysfunction, and left ventricular hypertrophy. As a result there is an increase in cardiovascular events (CVEs) associated with vitamin D deficiency. Vitamin D deficiency itself or secondary hyperparathyroidism or both may be responsible for the increase in CVEs. Correction of vitamin D deficiency may decrease the incidence of CVEs. Vitamin D deficiency is also associated with Alzheimer disease, schizophrenia, depression, and chronic pain and muscle weakness. Vitamin D deficiency is early treated with oral vitamin D supplements which may improve the manifestations of the diseases associated with vitamin D deficiency.

  9. Physiological justification for using an unconventional method for processing raw material in aquaculture

    Directory of Open Access Journals (Sweden)

    O. Honcharova


    Full Text Available Purpose. To study the influence of Spirulina рlatensis, which was previously treated by a non-traditional method, on physiological and biochemical processes in the organism of hydrobionts. To analyze the growth rate of Ukrainian scaly carp and tilapia under the influence of the feeding factor. Methodology. Experimental studies were carried out in the laboratory of biological resources and aquaculture. Following was performed during the experiments: clinical examination of hydrobionts, control of growth rates, survival rate by recording the results in a working journal, physiological studies, analysis of morphological and functional blood indices, which were performed according to generally accepted methods. Findings. It was found that the proposed method of non-traditional processing of feed resource for hydrobionts promoted the activation of metabolic processes, contributed to the improvement of fish development indices. During the process of cultivation of Spirulina рlatensis, the use of plasma-chemically activated water had a positive effect on the dynamics of development. Originality. This article presents for the first time the results of a positive effect of the pretreatment of Spirulina Platensis culture with plasma-chemically activated water for its feeding to hydrobionts. A positive effect of this method of feeding on the functional status of fish organism and the process of adaptation-compensatory mechanisms in ontogenesis has been found. Practical value. The proposed method will provide an opportunity to improve the rate of the development of hydrobionts, physiological and biochemical processes with the maximum utilization of the potential of fish organism at the stages of active growth, and also to reduce the cost of artificial feeds.

  10. Hydrothermal liquefaction of Spirulina and Nannochloropsis Salina under subcritical and supercritical water conditions

    DEFF Research Database (Denmark)

    Toor, Saqib; Reddy, H.; Deng, S.


    residue, and recycling process water for algae cultivation. GC-MS, elemental analyzer, FT-IR, calorimeter and nutrient analysis were used to analyze bio-crude, lipid-extracted algae and water samples produced in the hydrothermal liquefaction process. The highest bio-crude yield of 46% was obtained...

  11. 78 FR 49117 - Listing of Color Additives Exempt From Certification; Spirulina Extract (United States)


    .... We compare an individual's estimated daily intake (EDI) of the additive from all food sources to an acceptable intake level established by toxicological data. The EDI is determined by projections based on the... from all food sources of the additive. We commonly use the EDI for the 90th percentile consumer of a...

  12. Biodiesel production from Spirulina microalgae feedstock using direct transesterification near supercritical methanol condition. (United States)

    Mohamadzadeh Shirazi, Hamed; Karimi-Sabet, Javad; Ghotbi, Cyrus


    Microalgae as a candidate for production of biodiesel, possesses a hard cell wall that prevents intracellular lipids leaving out from the cells. Direct or in situ supercritical transesterification has the potential for destruction of microalgae hard cell wall and conversion of extracted lipids to biodiesel that consequently reduces the total energy consumption. Response surface methodology combined with central composite design was applied to investigate process parameters including: Temperature, Time, Methanol-to-dry algae, Hexane-to-dry algae, and Moisture content. Thirty-two experiments were designed and performed in a batch reactor, and biodiesel efficiency between 0.44% and 99.32% was obtained. According to fatty acid methyl ester yields, a quadratic experimental model was adjusted and the significance of parameters was evaluated using analysis of variance (ANOVA). Effects of single and interaction parameters were also interpreted. In addition, the effect of supercritical process on the ultrastructure of microalgae cell wall using scanning electron spectrometry (SEM) was surveyed. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Protein (Cyanobacteria): 161200 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  14. Protein (Cyanobacteria): 479132100 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  15. Protein (Cyanobacteria): 479132040 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  16. Protein (Cyanobacteria): 479132036 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  17. Protein (Cyanobacteria): 454073 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  18. The effects of mixed algal diets on population growth, egg productivity and nutritional profiles in cyclopoid copepods (Thermocyclops hyalinus and Mesocyclops aspericornis

    Directory of Open Access Journals (Sweden)

    Kumar Vidhya


    Full Text Available This experiment was carried out to evaluate the effect of mixed algal diet on dietary profiles of copepods. The microalgae like Spirulina platensis, Chlorella vulgaris and Azolla pinnata were mass cultured in artificial medium for a period of 20 days, cells are harvested, dried, powdered and used as feed. The small freshwater cyclopoids Thermocyclops hyalinus were compared to Mesocyclops aspericornis a species of copepod genera commonly preferred by most of the fish larvae. Both species are easily maintained in culture, when fed with mixed algal diets of equal ratios (1:1:1. Biochemical composition, egg production ratios, growth performance and fatty acids profile of the two different species were analyzed after an experimental period of 15 days, all the nutritional values were found to be high and statistically variable. On the basis of biochemical composition, egg production ratio, growth performance, amino acids and fatty acids profile it is found that M. aspericornis was the suitable candidate for larval fish diets.

  19. Algal carbohydrates affect polyketide synthesis of the lichen-forming fungus Cladonia rangiferina. (United States)

    Elshobary, Mostafa E; Osman, Mohamed E; Abo-Shady, Atef M; Komatsu, Emy; Perreault, Hélène; Sorensen, John; Piercey-Normore, Michele D


    Lichen secondary metabolites (polyketides) are produced by the fungal partner, but the role of algal carbohydrates in polyketide biosynthesis is not clear. This study examined whether the type and concentration of algal carbohydrate explained differences in polyketide production and gene transcription by a lichen fungus (Cladonia rangiferina). The carbohydrates identified from a free-living cyanobacterium (Spirulina platensis; glucose), a lichen-forming alga (Diplosphaera chodatii; sorbitol) and the lichen alga that associates with C. rangiferina (Asterochloris sp.; ribitol) were used in each of 1%, 5% and 10% concentrations to enrich malt yeast extract media for culturing the mycobiont. Polyketides were determined by high performance liquid chromatography (HPLC), and polyketide synthase (PKS) gene transcription was measured by quantitative PCR of the ketosynthase domain of four PKS genes. The lower concentrations of carbohydrates induced the PKS gene expression where ribitol up-regulated CrPKS1 and CrPKS16 gene transcription and sorbitol up-regulated CrPKS3 and CrPKS7 gene transcription. The HPLC results revealed that lower concentrations of carbon sources increased polyketide production for three carbohydrates. One polyketide from the natural lichen thallus (fumarprotocetraric acid) also was produced by the fungal culture in ribitol supplemented media only. This study provides a better understanding of the role of the type and concentration of the carbon source in fungal polyketide biosynthesis in the lichen Cladonia rangiferina. © 2016 by The Mycological Society of America.

  20. Piroxicam and C-phycocyanin mediated apoptosis in 1,2-dimethylhydrazine dihydrochloride induced colon carcinogenesis: exploring the mitochondrial pathway. (United States)

    Saini, Manpreet Kaur; Sanyal, Sankar Nath; Vaiphei, Kim


    Apoptosis is a synchronized procedure of cell death that is regulated by caspases and proapoptotic proteins. During apoptosis, translocation of cytochrome c, an electron carrier, from mitochondria into the cytosol is regulated by Bcl-2 family members. Cytochrome c in association with an apoptotic protease activating factor (Apaf), a proapoptotic protein essential for cell differentiation and procaspase-9 form the apoptosome complex, which consecutively activates effector caspase, caspase-3, and coordinate the implementation of apoptosis. In the current study, an attempt has been made to gain insight into piroxicam, a traditional nonsteroidal antiinflammatory drug and c-phycocyanin, a biliprotein from Spirulina platensis (cyanobacterium) mediated apoptosis in DMH-induced colon cancer. Male Sprague-Dawley rats were segregated into 5 groups: control, DMH, DMH + piroxicam, DMH + c-phycocyanin, and DMH + piroxicam + c-phycocyanin. Results illustrated that piroxicam and c-phycocyanin treatments stimulate cytochrome c release by downregulating the Bcl-2 (an antiapoptotic protein) expression significantly, while promoting the level of Bax (a proapoptotic protein), thereby activating caspases (caspases-9 and -3) and Apaf-1. The outcomes of the present study clearly signify that piroxicam and c-phycocyanin may mediate mitochondrial-dependent apoptosis in DMH-induced colon cancer. Moreover, apoptosis induction was more apparent in the combination regimen of piroxicam and c-phycocyanin than the individual drugs alone.

  1. Thermogravimetric and kinetic analysis of thermal decomposition characteristics of low-lipid microalgae. (United States)

    Gai, Chao; Zhang, Yuanhui; Chen, Wan-Ting; Zhang, Peng; Dong, Yuping


    The thermal decomposition behavior of two microalgae, Chlorella pyrenoidosa (CP) and Spirulina platensis (SP), were investigated on a thermogravimetric analyzer under non-isothermal conditions. Iso-conversional Vyazovkin approach was used to calculate the kinetic parameters, and the universal integral method was applied to evaluate the most probable mechanisms for thermal degradation of the two feedstocks. The differential equations deduced from the models were compared with experimental data. For the range of conversion fraction investigated (20-80%), the thermal decomposition process of CP could be described by the reaction order model (F3), which can be calculated by the integral equation of G(α) = [(1 - α)(-2) - 1]/2. And the apparent activation energy was in the range of 58.85-114.5 kJ/mol. As for SP, it can be described by the reaction order model (F2), which can be calculated by the integral equation of G(α) = (1 - α)(-1) - 1, and the range of apparent activation energy was 74.35-140.1 kJ/mol. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. Combustion behavior and kinetics of low-lipid microalgae via thermogravimetric analysis. (United States)

    Gai, Chao; Liu, Zhengang; Han, Guanghua; Peng, Nana; Fan, Aonan


    Thermogravimetric analysis and differential thermal analysis were employed to investigate combustion characteristics of two low-lipid microalgae, Chlorella pyrenoidosa (CP) and Spirulina platensis (SP) and iso-conversional Starink approach was used to calculate the kinetic parameters in the present study. The results showed that three stages of mass loss, including dehydration, devolatilization and char oxidation, were observed during combustion of both of two low-lipid microalgae. The whole weight loss of combustion of two microalgae was both shifted to higher temperature zones with increased heating rates from 10 to 40 K/min. In the 0.1-0.9 conversion range, the apparent activation energy of CP increased first from 51.96 to 79.53 kJ/mol, then decreased to 55.59 kJ/mol. Finally, it slightly increased to 67.27 kJ/mol. In the case of SP, the apparent activation energy gradually increased from 68.51 to 91.06 kJ/mol. Copyright © 2015 Elsevier Ltd. All rights reserved.

  3. Algal massive growth in relation to water quality and salinity at Damietta, north of Egypt

    Directory of Open Access Journals (Sweden)

    Mohamed Ali Ibraheem Deyab


    Full Text Available Objective: To relate the proliferation and dominance of certain algal species at the Damietta and its relation to water quality. Methods: Water and algal biomass were bimonthly sampled from five selected sites at Damietta Province, Egypt during 2012. Algae were identified and quantified. Waters, algae and sediment were analyzed. Results: The physicochemical properties of water showed limited seasonal but substantial local variation. The high levels of nitrogen and phosphorus and turbidity of water pointed to marked eutrophication, which could enhance massive algal growth. The temporal fluctuation in temperature, exposure to industrial and domestic sewage and salinity results in succession between blooming algal species. Spirulina platensis and Chlorella vulgaris alternated in a moderately saline water and Oscillatoria agardhii and Mougeotia scalaris in a fresh water body during summer and winter respectively. Likewise, Microcystis aureginosa and Ulva lactuca alternated in a moderately saline site during autumn and summer respectively. Cladophora albida dominated a fish pond of brackish water and Dunaliella salina dominated the most saline water over the whole period of study. Conclusions: Growth of the predominant algal species is correlated to water quality. These species are of considerable nutritive value, with moderate contents of protein, carbohydrate, macronutrients and micronutrients, which evaluates them for usage as food (green and macroalgae, fodder or bio-fertilizer (cyanophytes.

  4. Design of suitable carrier buffer for free-flow zone electrophoresis by charge-to-mass ratio and band broadening analysis. (United States)

    Kong, Fan-Zhi; Yang, Ying; He, Yu-Chen; Zhang, Qiang; Li, Guo-Qing; Fan, Liu-Yin; Xiao, Hua; Li, Shan; Cao, Cheng-Xi


    In this work, charge-to-mass ratio (C/M) and band broadening analyses were combined to provide better guidance for the design of free-flow zone electrophoresis carrier buffer (CB). First, the C/M analyses of hemoglobin and C-phycocyanin (C-PC) under different pH were performed by CLC Protein Workbench software. Second, band dispersion due to the initial bandwidth, diffusion, and hydrodynamic broadening were discussed, respectively. Based on the analyses of the C/M and band broadening, a better guidance for preparation of free-flow zone electrophoresis CB was obtained. Series of experiments were performed to validate the proposed method. The experimental data showed high accordance with our prediction allowing the CB to be prepared easily with our proposed method. To further evaluate this method, C-PC was purified from crude extracts of Spirulina platensis with the selected separation condition. Results showed that C-PC was well separated from other phycobiliproteins that have similar physicochemical properties, and analytical grade product with purity up to 4.5 (A620/A280) was obtained. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Protective effect of Hongxue tea mixture against radiation injury in mice

    International Nuclear Information System (INIS)

    Zhao Chun; Zhang Xuehui; Wang Qi


    Objective: To develop health food of anti-radiation among biological source in Yunnan. Methods: Screening test was done of the health food of biological source of anti-radiation injury in mice. It is indicated that Hong-Xue Tea Mixture among the biological source has the effect against radiation injury, observing experiment of dose-effect of Hong-Xue Tea Mixture was done. Micronuclei in the bone marrow polychromatophilic erythrocytes in each dose group of mice were examined, leucocytes number and 30 day survival rate of mice following whole-body 5.0 Gy γ irradiation were also determined. Results: Research showed that Hong-Xue Tea Mixture and Spirulina Platensis Mixture among the biological source have protective effect against radiation injury in mice. Observing experiment of dose-effect of Hong-Xue Tea Mixture show that low, medium and high dose of Hong-Xue Tea Mixture can significantly decrease bone marrow PECMN rate of mice, increase leucocytes number and 30 day survival rate. Conclusion: Hong-Xue Tea Mixture has potent protective effects against radiation injury in mice. (authors)

  6. Effect of Ultrasonic Extraction on Production and Structural Changes of C-Phycocyanin from Marine Spirulina maxima. (United States)

    Choi, Woon Yong; Lee, Hyeon Yong


    This work first showed that very high amounts of phycocyanins, such as 11.3 mg/mL C-phycocyanin (C-PC), 3.1 mg/mL allophycocyanin (APC), and 0.8 mg/mL phycoerythrin (PE), can be obtained using an ultrasonic extraction process (UE) with a 60 kHz frequency and 3 h of process time at 25 °C, without any other pretreatments. These yields were higher than those from most conventional water extractions at 4 °C for 24 h (Control condition) or at 25 °C for 24 h (WE), namely, 9.8 and 5.7 mg/mL C-PC, 2.3 and 1.2 mg/mL APC, and 0.7 and 0.3 mg/mL PE, respectively. These yields were also shown to be even higher than yields from other reported data. Structural changes in C-PC in the extracts were also found for the first time, according to extraction conditions, showing that the total concentration of C-PC and of the α-subunit of C-PC in the UE were much higher than in the WE, with little difference in the amount of β-subunit of C-PC in the UE or WE. It was also shown that the structural changes in C-PC in the WE decreased both antioxidant and anti-inflammation activities-29.83% vs. 32.09% of α,α-diphenyl-β-picrylhydrazyl (DPPH) scavenging activity and 8.21 vs. 7.25 µM of NO production for the WE and UE, respectively-while the UE, with similar patterns to standard C-PC, showed very high biological effects, which may suggest that the biologically active part is the α-subunit of C-PC, not the β-subunit.

  7. Effect of Ultrasonic Extraction on Production and Structural Changes of C-Phycocyanin from Marine Spirulina maxima

    Directory of Open Access Journals (Sweden)

    Woon Yong Choi


    Full Text Available This work first showed that very high amounts of phycocyanins, such as 11.3 mg/mL C-phycocyanin (C-PC, 3.1 mg/mL allophycocyanin (APC, and 0.8 mg/mL phycoerythrin (PE, can be obtained using an ultrasonic extraction process (UE with a 60 kHz frequency and 3 h of process time at 25 °C, without any other pretreatments. These yields were higher than those from most conventional water extractions at 4 °C for 24 h (Control condition or at 25 °C for 24 h (WE, namely, 9.8 and 5.7 mg/mL C-PC, 2.3 and 1.2 mg/mL APC, and 0.7 and 0.3 mg/mL PE, respectively. These yields were also shown to be even higher than yields from other reported data. Structural changes in C-PC in the extracts were also found for the first time, according to extraction conditions, showing that the total concentration of C-PC and of the α-subunit of C-PC in the UE were much higher than in the WE, with little difference in the amount of β-subunit of C-PC in the UE or WE. It was also shown that the structural changes in C-PC in the WE decreased both antioxidant and anti-inflammation activities—29.83% vs. 32.09% of α,α-diphenyl-β-picrylhydrazyl (DPPH scavenging activity and 8.21 vs. 7.25 µM of NO production for the WE and UE, respectively—while the UE, with similar patterns to standard C-PC, showed very high biological effects, which may suggest that the biologically active part is the α-subunit of C-PC, not the β-subunit.

  8. Ozone Application for Tofu Waste Water Treatment and Its Utilisation for Growth Medium of Microalgae Spirulina sp

    Directory of Open Access Journals (Sweden)

    Hadiyanto Hadiyanto


    Full Text Available Tofu industries produce waste water containing high organic contents and suspendid solid which is harmful if directly discharged to the environment. This waste can lead to disruption of water quality and lowering the environmental carrying capacity of waters around the tofu industries. Besides, the tofu waste water still contains high nitrogen contents which can be used for microalgae growth. This study was aimed to reduce the pollution load (chemical oxygen demand-COD of tofue wastewater by using ozone treatments and to utilize nutrients in treated tofu waste water as medium growth of microalgae. The result showed that the reduction of COD by implementation of ozone treatment followed first order kinetic. Under variation of waste concentrations between 10-40%, the degradation rate constant was in the range of 0.00237-0.0149 min-1. The microalgae was able to grow in the tofue waste medium by the growth rate constants of 0.15-0.29 day-1. This study concluded that tofu waste was highly potent for microalgae growth.

  9. Ozone Application for Tofu Waste Water Treatment and Its Utilisation for Growth Medium of Microalgae Spirulina sp (United States)

    Hadiyanto, Hadiyanto


    Tofu industries produce waste water containing high organic contents and suspendid solid which is harmful if directly discharged to the environment. This waste can lead to disruption of water quality and lowering the environmental carrying capacity of waters around the tofu industries. Besides, the tofu waste water still contains high nitrogen contents which can be used for microalgae growth. This study was aimed to reduce the pollution load (chemical oxygen demand-COD) of tofue wastewater by using ozone treatments and to utilize nutrients in treated tofu waste water as medium growth of microalgae. The result showed that the reduction of COD by implementation of ozone treatment followed first order kinetic. Under variation of waste concentrations between 10-40%, the degradation rate constant was in the range of 0.00237-0.0149 min-1. The microalgae was able to grow in the tofue waste medium by the growth rate constants of 0.15-0.29 day-1. This study concluded that tofu waste was highly potent for microalgae growth.

  10. Isolation, characterization and localization of extracellular polymeric substances from the cyanobacterium

    NARCIS (Netherlands)

    Ahmed, M.; Wijnholds, A.; Stal, L.J.; Hasnain, S.


    Arthrospira platensis is a cyanobacterium known for its nutritional value and secondary metabolites. Extracellular polymeric substances (EPS) are an important trait of most cyanobacteria, including A. platensis. Here, we extracted and analysed different fractions of EPS from a locally isolated

  11. Development of Bio-Oil Commodity Fuel as a Refinery Feedstock from High Impact Algae Biomass

    Energy Technology Data Exchange (ETDEWEB)

    Kastner, James [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemical Engineering; Mani, Sudhagar [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemical Engineering; Das, K. C. [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemical Engineering; Hilten, Roger [Univ. of Georgia, Athens, GA (United States). Dept. of Biochemical Engineering; Jena, Umakanta [Desert Research Inst. (DRI), Reno, NV (United States)


    A two-stage hydrothermal liquefaction (HTL) process was developed to 1) reduce nitrogen levels in algal oil, 2) generate a nitrogen rich stream with limited inhibitors for recycle and algae cultivation, and 3) improve downstream catalytic hydrodenitrogenation and hydrodeoxygenation of the algal oil to refinery intermediates. In the first stage, low temperature HTL was conducted at 125, 175, and 225°C at holding times ranging from 1 to 30 min (time at reaction temperature). A consortium of three algal strains, namely Chlorella sorokiniana, Chlorella minutissima, and Scenedesmus bijuga were used to grow and harvest biomass in a raceway system – this consortium is called the UGA Raceway strain throughout the report. Subsequent analysis of the final harvested product indicated that only two strains predominated in the final harvest - Chlorella sorokiniana and Scenedesmus bijuga. Two additional strains representing a high protein (Spirulina platensis) and high lipid algae (Nannochloropsis) strains were also used in this study. These strains were purchased from suppliers. S. platensis biomass was provided by Earthrise Nutritionals LLC (Calipatria, CA) in dry powder form with defined properties, and was stored in airtight packages at 4°C prior to use. A Nannochloropsis paste from Reed Mariculture was purchased and used in the two-stage HTL/HDO experiments. The solids and liquids from this low temperature HTL pretreatment step were separated and analyzed, leading to the following conclusions. Overall, these results indicate that low temperature HTL (200-250°C) at short residence times (5-15 min) can be used to lyse algae cells and remove/separate protein and nitrogen before subsequent higher temperature HTL (for lipid and other polymer hydrolysis) and HDO. The significant reduction in nitrogen when coupled with low protein/high lipid algae cultivation methods at scale could significantly improve downstream catalytic HDO results. However, significant barriers and

  12. Protein (Cyanobacteria): 479132094 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  13. Life sciences research at JINR, Dubna, Russia

    International Nuclear Information System (INIS)

    Frontasyeva, M.V.


    Within the broad spectrum of activities in the Life Sciences at JINR such as nuclear medicine and pharmacy, radiation biology, radioecology, radioisotope production radioanalytical investigations play a special role due to the long-term experience in multi-element instrumental neutron activation analysis (INAA) at the reactor IBR-2 of FLNP, JINR. INAA is presently being used in several projects on air pollution studies using bio monitors (moss, lichens, tree bark). The results for some selected areas of Central Russia, South Urals, and countries of Europe (Bulgaria, Poland, Romania, Bosnia and Herzegovina, Serbia and Montenegro, Macedonia, Slovakia, Western Ukraine) are reported to the European Atlas of Heavy Metal Atmospheric Deposition edited under the auspices of the Environmental Commission of the United Nations. Battering-ram studies using NAA were initiated also in Turkey, China and South Korea. Applied to the analysis of air filters, INAA is successfully used in assessing quality of London underground air, Sahara desert impact on the Greater Cairo Area. Epithermal activation analysis in combination with atomic absorption spectrometry and energy-disperse X-ray fluorescence allowed source evaluation of metals in soil from some industrial and metropolitan areas of Russia (South Urals, Cola Peninsula) and the USA (Minneapolis). The analytical possibilities of NAA are favorably used in biotechnology, (i) for investigation of bacterial leaching of metals, including uranium and thorium from low-grade ores, rocks and industrial wastes; (i i) in the development of new pharmaceuticals based on the blue-green alga Spirulina platensis. Occupational health studies are carried out at several fertilizer plants in Russia, Uzbekistan, Poland, Romania, Denmark and the Netherlands in the framework of the 5th Programme Copernicus. The quality of foodstuffs grown in some contaminated areas of Russia is investigated in the framework of IAEA Coordinated Research Programme. In

  14. Salubrious effect of C-phycocyanin against oxalate-mediated renal cell injury. (United States)

    Farooq, Shukkur Muhammed; Asokan, Devarajan; Sakthivel, Ramasamy; Kalaiselvi, Periandavan; Varalakshmi, Palaninathan


    C-phycocyanin, a biliprotein pigment found in some blue green algae (Spirulina platensis) with nutritional and medicinal properties, was investigated for its efficacy on sodium oxalate-induced nephrotoxicity in experimentally induced urolithic rats. Male Wistar rats were divided into four groups. Hyperoxaluria was induced in two of these groups by intraperitoneal infusion of sodium oxalate (70 mg/kg), and a pretreatment of phycocyanin (100 mg/kg) as a single oral dosage was given to one of these groups by 1 h prior to sodium oxalate infusion challenges. The study also encompasses an untreated control group and a phycocyanin-alone treated drug control group. The extent of lipid peroxidation (LPO) was evaluated in terms of renal concentrations of MDA, conjugated diene and hydroperoxides. The following assay was performed in the renal tissue (a) antioxidant enzymes such as superoxide dismutase (SOD) and catalase, (b) glutathione metabolizing enzymes such as glutathione peroxidase (GPx), glutathione reductase (GR), glutathione-S-transferase (GST) and glucose 6-phosphate dehydrogenase (G6PD), (c) the low molecular weight antioxidants (GSH, vitamins E and C) and protein carbonyl content. The increased concentrations of MDA, conjugated diene and hydroperoxide (index of the lipid peroxidation) were controlled (P antioxidants were appreciably increased (P antioxidants. It was noticed that the activities of antioxidant enzymes and glutathione metabolizing enzymes were considerably stabilized in rats pretreated with phycocyanin. We suggest that phycocyanin protects the integrity of the renal cell by stabilizing the free radical mediated LPO and protein carbonyl, as well as low molecular weight antioxidants and antioxidant enzymes in renal cells. Thus, the present analysis reveals that the antioxidant nature of C-phycocyanin protects the renal cell against oxalate-induced injury and may be a nephroprotective agent.

  15. Allelopathic effects of water hyacinth [Eichhornia crassipes].

    Directory of Open Access Journals (Sweden)

    Sanaa M M Shanab

    Full Text Available Eichhornia crassipes (Mart Solms is an invasive weed known to out-compete native plants and negatively affect microbes including phytoplankton. The spread and population density of E. crassipes will be favored by global warming. The aim here was to identify compounds that underlie the effects on microbes. The entire plant of E. crassipes was collected from El Zomor canal, River Nile (Egypt, washed clean, then air dried. Plant tissue was extracted three times with methanol and fractionated by thin layer chromatography (TLC. The crude methanolic extract and five fractions from TLC (A-E were tested for antimicrobial (bacteria and fungal and anti-algal activities (green microalgae and cyanobacteria using paper disc diffusion bioassay. The crude extract as well as all five TLC fractions exhibited antibacterial activities against both the gram positive bacteria; Bacillus subtilis and Streptococcus faecalis; and the gram negative bacteria; Escherichia coli and Staphylococcus aureus. Growth of Aspergillus flavus and Aspergillus niger were not inhibited by either E. crassipes crude extract nor its five fractions. In contrast, Candida albicans (yeast was inhibited by all. Some antialgal activity of the crude extract and its fractions was manifest against the green microalgae; Chlorella vulgaris and Dictyochloropsis splendida as well as the cyanobacteria; Spirulina platensis and Nostoc piscinale. High antialgal activity was only recorded against Chlorella vulgaris. Identifications of the active antimicrobial and antialgal compounds of the crude extract as well as the five TLC fractions were carried out using gas chromatography combined with mass spectroscopy. The analyses showed the presence of an alkaloid (fraction A and four phthalate derivatives (Fractions B-E that exhibited the antimicrobial and antialgal activities.

  16. Identification of localized redox states in plant-type two-iron ferrodoxins using the nuclear Overhauser effect

    International Nuclear Information System (INIS)

    Dugad, L.B.; La Mar, G.N.; Banci, L.; Bertini, I.


    The homonuclear Overhauser effect (NOE), in conjunction with nonselective spin-lattice relaxation measurements, has been employed to assign the contact-shifted resonances for the reduced form of two typical plant-type two-iron ferrodoxins from the algae Spirulina platensis and Porphyra umbilicalis. These results demonstrate that the NOE should have broad general applicability for the assignments and electronic structural elucidation of diverse subclasses of paramagnetic iron-sulfur cluster proteins. NOE connectivities were detected only among sets of resonances exhibiting characteristically different deviations from Curie behavior, providing strong support for the applicability of the spin Hamiltonian formulation for the NMR properties of the antiferromagnetically coupled iron clusters. The geminal β-methylene protons for the two cysteines bound to the iron(II) center were clearly identified, as well as the C α H and one C β H for each of the cysteines bound to the iron(III). The identification of the iron bound to cysteines 41 and 46 as the iron(II) in the reduced protein was effected on the basis of dipolar contacts between the bound cysteines. Resolved labile proton contact-shifted resonances are attributed to hydrogen bonding to the iron(III) center, and it is concluded that the contact-shifted resonances for the more numerous hydrogen bonds to the iron(II) center are not resolved from the diamagnetic envelope. The identification of the iron closer to the protein surface as the more reducible one is consistent with predictions based on a larger number of hydrogen bonds to this center

  17. Chemoprevention of DMH-induced rat colon carcinoma initiation by combination administration of piroxicam and C-phycocyanin. (United States)

    Saini, Manpreet Kaur; Vaiphei, Kim; Sanyal, Sankar Nath


    Cancer research illustrated that combinatorial studies can provide significant improvement in safety and effectiveness over the monotherapy regimens. A combination of two drugs may restrain precancerous colon polyps, opening a new possible opportunity for chemoprevention of colon cancer. In this context, chemopreventive efficacy of a combination regimen of C-phycocyanin, a biliprotein present in Spirulina platensis, a cyanobacterium, which is a selective cycloxygenase-2 (COX-2) inhibitor and piroxicam, a traditional non-steroidal anti-inflammatory drug was considered in 1,2 dimethylhyadrazine (DMH)-induced colon carcinogenesis in rats. Western blotting, immunohistochemistry, DNA fragmentation, fluorescent staining, PGE(2) enzyme immunoassay, and carrageenan-induced paw edema test were performed along with morphological and histological analysis. DMH treatment showed a rich presence of preneoplastic lesions such as multiple plaque lesions, aberrant crypt foci, and well-characterized dysplasia. These features were reduced with piroxicam and C-phycocyanin administration. The number of apoptotic cells was featured prominently in all the groups compared with DMH. DMH treatment revealed intact high molecular weight genomic DNA with no signs of laddering/DNA fragmentation while it was noticeable significantly in control and DMH + piroxicam + C-phycocyanin. DMH group showed highest COX-2 expression and PGE(2) level in comparison with other groups. Doses of piroxicam and C-phycocyanin used in the present study were established at an anti-inflammatory range. A combination regimen of piroxicam and C-phycocyanin, rather than individually has the much greater potential for reduction of DMH-induced colon cancer development and COX-2 being the prime possible target in such chemoprevention.

  18. [Studies on evaluation of natural products for antiviral effects and their applications]. (United States)

    Hayashi, Toshimitsu


    In the search for novel antiviral molecules from natural products, we have discovered various antiviral molecules with characteristic mechanisms of action. Scopadulciol (SDC), isolated from the tropical medicinal plant Scoparia dulcis L., showed stimulatory effects on the antiviral potency of acyclovir (ACV) or ganciclovir (GCV). This effect of SDC was exerted via the activation of viral thymidine kinase (HSV-1 TK) and, as a result, an increase in the cellular concentration of the active form of ACV/GCV, i.e., the triphosphate of ACV or GCV. On the basis of these experimental results, cancer gene therapy using the HSV-1 tk gene and ACV/GCV together with SDC was found to be effective in suppressing the growth of cancer cells in animals. Acidic polysaccharides such as calcium spirulan (Ca-SP) from Spirulina platensis, nostoflan from Nostoc flagelliforme, and a fucoidan from the sporophyll of Undaria pinnatifida (mekabu fucoidan) were also found to be potent inhibitors against several enveloped viruses. Their antiviral potency was dependent on molecular weight and content of the sulfate or carboxyl group as well as counterion species chelating with sulfate groups, indicating the importance of the three-dimensional structure of the molecules. In addition, unlike dextran sulfate, Ca-SP was shown to target not only viral absorption/penetration stages but also some replication stages of progeny viruses after penetration into cells. When mekabu fucoidan or nostoflan was administered with oseltamivir phosphate, their synergistic antiviral effects on influenza A virus were confirmed in vitro as well as in vivo.

  19. Simultaneous determination of 13 carbohydrates using high-performance anion-exchange chromatography coupled with pulsed amperometric detection and mass spectrometry. (United States)

    Zhao, Dan; Feng, Feng; Yuan, Fei; Su, Jin; Cheng, Yan; Wu, Hanqiu; Song, Kun; Nie, Bo; Yu, Lian; Zhang, Feng


    A simple, accurate, and highly sensitive method was developed for the determination of 13 carbohydrates in polysaccharide of Spirulina platensis based on high-performance anion-exchange chromatography coupled with pulsed amperometric detection and mass spectrometry. Samples were extracted with deionized water using ultrasonic-assisted extraction, and the ultrasound-assisted extraction conditions were optimized by Box-Behnken design. Then the extracted polysaccharide was hydrolyzed by adding 1 mol/L trifluoroacetic acid before determination by high-performance anion-exchange chromatography coupled with pulsed amperometric detection and confirmed by high-performance anion-exchange chromatography coupled with mass spectrometry. The high-performance anion-exchange chromatography coupled with pulsed amperometric detection method was performed on a CarboPac PA20 column by gradient elution using deionized water, 0.1 mol/L sodium hydroxide solution, and 0.4 mol/L sodium acetate solution. Excellent linearity was observed in the range of 0.05-10 mg/L. The average recoveries ranged from 80.7 to 121.7%. The limits of detection and limits of quantification for 13 carbohydrates were 0.02-0.10 and 0.2-1.2  μg/kg, respectively. The developed method has been successfully applied to ambient samples, and the results indicated that high-performance anion-exchange chromatography coupled with pulsed amperometric detection and mass spectrometry could provide a rapid and accurate method for the simultaneous determination of carbohydrates. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Cyanobacterial Polyhydroxybutyrate (PHB): Screening, Optimization and Characterization. (United States)

    Ansari, Sabbir; Fatma, Tasneem


    In modern life petroleum-based plastic has become indispensable due to its frequent use as an easily available and a low cost packaging and moulding material. However, its rapidly growing use is causing aquatic and terrestrial pollution. Under these circumstances, research and development for biodegradable plastic (bioplastics) is inevitable. Polyhydroxybutyrate (PHB), a type of microbial polyester that accumulates as a carbon/energy storage material in various microorganisms can be a good alternative. In this study, 23 cyanobacterial strains (15 heterocystous and 8 non-heterocystous) were screened for PHB production. The highest PHB (6.44% w/w of dry cells) was detected in Nostoc muscorum NCCU- 442 and the lowest in Spirulina platensis NCCU-S5 (0.51% w/w of dry cells), whereas no PHB was found in Cylindrospermum sp., Oscillatoria sp. and Plectonema sp. Presence of PHB granules in Nostoc muscorum NCCU- 442 was confirmed microscopically with Sudan black B and Nile red A staining. Pretreatment of biomass with methanol: acetone: water: dimethylformamide [40: 40: 18: 2 (MAD-I)] with 2 h magnetic bar stirring followed by 30 h continuous chloroform soxhlet extraction acted as optimal extraction conditions. Optimized physicochemical conditions viz. 7.5 pH, 30°C temperature, 10:14 h light:dark periods with 0.4% glucose (as additional carbon source), 1.0 gl-1 sodium chloride and phosphorus deficiency yielded 26.37% PHB on 7th day instead of 21st day. Using FTIR, 1H NMR and GC-MS, extracted polymer was identified as PHB. Thermal properties (melting temperature, decomposition temperatures etc.) of the extracted polymer were determined by TGA and DSC. Further, the polymer showed good tensile strength and young's modulus with a low extension to break ratio comparable to petrochemical plastic. Biodegradability potential tested as weight loss percentage showed efficient degradation (24.58%) of PHB within 60 days by mixed microbial culture in comparison to petrochemical plastic.

  1. Adsorptive removal of dye using biochar derived from residual algae after in-situ transesterification: Alternate use of waste of biodiesel industry. (United States)

    Nautiyal, Piyushi; Subramanian, K A; Dastidar, M G


    The primary aim of this present study was to utilize the residual biomass (DB) of Spirulina platensis algae, left after in-situ transesterification, for biochar preparation. This is a solid waste residue of biodiesel industry. The biochar (BC) prepared was examined for its capacity to adsorb congo red dye from the aqueous solution. The results were compared with other adsorbents used in the study such as commercial activated carbon (AC), original algae biomass (AB) and DB. The results of proximate analysis of BC showed the decrease in the percentage of volatile matter and an increase in fixed carbon content compared to DB. The physico-chemical properties of BC were studied using elemental analysis, SEM, FTIR and XRD techniques. The AC and BC adsorbents showed better performance in removing 85.4% and 82.6% of dye respectively from solution compared to AB (76.6%) and DB (78.1%). The effect of initial dye concentration, adsorbent dosage and pH of solution on the adsorption phenomena was studied by conducting the batch adsorption experiments. The highest specific uptake for biochar was observed at acidic pH of 2 with 0.2 g/100 ml of adsorbent dosage and 90 mg/l of initial concentration. The equilibrium adsorption data were fitted to three isotherms, namely Langmuir, Freundlich and Temkin. Freundlich model proved to show the best suited results with value of correlation coefficient of 99.12%. Thus, the application of DB for production of biochar as potential adsorbent supports sustainability of algae biodiesel. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. 11_64 - 68_Abdullahi and Ibrahim_BAJOPAS 5th paper

    African Journals Online (AJOL)

    user pc

    Stigeoclonium, Clamydomonas. Lyngbya, Oscillatoria, Chlorococcum, Spirulina etc are the indicators of organic pollution. 5.Wastewater treatment pond algae. Scenedesmus, Ankistrodesmus, Spirulina, Closteridium, Clamydomonas,. Schizothrix, Cloterium, Chodatella, Chlosteriopsis. Source: Maiti (2004). Test Using Fishes.

  3. Enhancement of human adaptive immune responses by administration of a high-molecular-weight polysaccharide extract from the cyanobacterium Arthrospira platensis

    DEFF Research Database (Denmark)

    Løbner, Morten; Walsted, Anette; Larsen, Rune


    administration for 3 days (P production persisted after 56 days (P ... production of the Th1 cytokines tumor necrosis factor (TNF)-alpha, interleukin (IL)-2, and interferon (IFN)-gamma was increased after Immunlina...

  4. Resultados econômicos da produção de cordeiros em confinamento utilizando na dieta casca de soja associada a quatro fontes de nitrogênio não-proteico Economic results of feedlot lamb using soybean husks associated with different non-protean nitrogen sources

    Directory of Open Access Journals (Sweden)

    Evâneo Alcides Ziguer


    Full Text Available O objetivo neste estudo foi avaliar o custo de produção e a resposta econômica da utilização de casca de soja (CS associada a duas fontes de nitrogênio não-proteico (NNP na terminação de cordeiros em confinamento. Foram utilizados 80 cordeiros mestiços Suffolk, com idade inicial de 69 ± 6 dias e peso vivo inicial de 23,11 ± 1,78 kg. Os animais foram distribuídos em quatro grupos, cada um com uma dieta formulada com uma fonte de NNP: grupo ureia convencional, na proporção de 1%; grupo ureia protegida, na proporção de 1%; grupo ureia protegida convencional, na proporção de 1% + 0,5% de ureia convencional, da dieta total, respectivamente; e grupo controle, sem fonte adicional de NNP. O custo total de produção do cordeiro até a desmama foi de R$ 85,27/animal. Entre os componentes desse custo, a categoria de ovelhas foi a principal contribuinte, com 68,55%, seguida pelos custos referentes ao próprio cordeiro (0-67 dias, que representaram 25,57%, e a dos carneiros, com participação de apenas 5,88%. O custo total médio da terminação em confinamento foi de R$ 57,73/cordeiro. O custo operacional efetivo (COEf representou R$ 57,35, ou 99,33% do custo total à terminação. As variáveis de maior representatividade do COEf foram alimentação (61,56% e impostos (31,06%. As dietas que permitiram obter margem bruta/cordeiro positiva foram aquelas com ureia convencional e sem fonte adicional de NNP (R$ 1,77 e R$ 4,35, respectivamente. No entanto, todas as dietas apresentaram margem líquida e resultado econômico negativos. Em sistemas de terminação de cordeiros em confinamento, o uso de dietas sem fonte adicional de nitrogênio não-proteico é a opção que permite obter melhor resultado zootécnico e econômico.The aim of this study was to evaluate the production costs and economic return of soybean husks (CS associated with two non-protein nitrogen (NNP sources, in feedlot finishing lamb. Eighty (80 Suffolk cross lambs, averaging initial age of 79 ± 6 days and initial live weight of 23.11 ± 1.78 kg were used. The animals were grouped in four experimental lots accordingly to NNP source: conventional urea group (CUG, n = 20, which received 1% of common urea; protected urea group (PUG, n = 20, which received 1% of protected urea, at the ratio of 1% + 0.5% conventional urea, of total diet, respectively; and control group, with no additional source of NNP. Total production cost (CT of lambs at weaning was R$ 85.27/animal. In this cost ewes contributed with 68.55%, followed by the lamb cost (0-67 days, which represented 25.57% and rams with only 5.88%. The average CT in feedlot finishing was of R$ 57.73/lamb. Effective operational cost (COEf represented R$ 57.35 or 99.33% of CT finishing. Variables of higher representativeness of COEf were: ration (61.56% and taxes (31.06%. Diets with higher positive gross margin (MB/lamb were GUC and CG (R$ 1.77 and R$ 44.35, respectively. All diets presented negative net margin (ML and economic return (RE. In finishing systems of feedlot lamb, the use of diets with no additional source of non-protein nitrogen is the option that allows better economic and productivity results.

  5. CO2 partial pressure - pH relationships in the memdium and relevance to CO2 mass balance in outdoor open thin-layer Arthrospira (Spirulina) cultures

    Czech Academy of Sciences Publication Activity Database

    Lívanský, Karel; Doucha, Jiří; Hu, H.; Li, Y.


    Roč. 165, č. 3 (2006), s. 365-381 ISSN 0003-9136 R&D Projects: GA MŠk ME 637 Institutional research plan: CEZ:AV0Z50200510 Keywords : medium * carbon dioxide * equilibrium Subject RIV: EE - Microbiology, Virology Impact factor: 1.362, year: 2006

  6. UTILIZAÇÃO DA CIANOBACTÉRIA Spirulina maxima E DA LEVEDURA Saccharomyces cerevisiae COMO DIETAS COMPLEMENTARES NO CULTIVO DE Artemia franciscana

    Directory of Open Access Journals (Sweden)

    Ivanildo Surini de Souza


    Full Text Available Diferentes combinações da cianobactéria S. maxima e da levedura S. cerevisiae foram utilizadas no cultivo de A. franciscana, com o objetivo de avaliar dietas de baixo custo e fácil manuseio, e que mantivessem as larvas desse microcrustáceo em laboratório, de modo a propiciar estudos de sua ecologia, biologia e uso na aquicultura. Para isso, 12 cones de Imhoff contendo 1 L de água do mar filtrada foram estocados com 100 náuplios e submetidos à aeração contínua, monitoramento do pH, temperatura, salinidade, oxigênio dissolvido e luminosidade, além de renovação diária de 50 % do volume de água. Durante dez dias, os náuplios foram alimentados duas vezes ao dia com 25 mg de diferentes combinações de S. maxima e S. cerevisiae, nas seguintes proporções: 100/0; 75/25; 50/50; 25/75 e 0/100. Foram avaliadas a taxa de sobrevivência, proporção sexual, proporção juvenis/adultos e performance reprodutiva. Os resultados indicaram um melhor desempenho zootécnico de A. franciscana nos tratamentos que associaram S. maxima à S. cerevisiae (75/25, 50/50 e 25/75, e desta maneira, demonstram que a referida mistura dietética, em tais proporções, é viável para manter as larvas em cultivo laboratorial.

  7. Cyanobacterial Polyhydroxybutyrate (PHB: Screening, Optimization and Characterization.

    Directory of Open Access Journals (Sweden)

    Sabbir Ansari

    Full Text Available In modern life petroleum-based plastic has become indispensable due to its frequent use as an easily available and a low cost packaging and moulding material. However, its rapidly growing use is causing aquatic and terrestrial pollution. Under these circumstances, research and development for biodegradable plastic (bioplastics is inevitable. Polyhydroxybutyrate (PHB, a type of microbial polyester that accumulates as a carbon/energy storage material in various microorganisms can be a good alternative. In this study, 23 cyanobacterial strains (15 heterocystous and 8 non-heterocystous were screened for PHB production. The highest PHB (6.44% w/w of dry cells was detected in Nostoc muscorum NCCU- 442 and the lowest in Spirulina platensis NCCU-S5 (0.51% w/w of dry cells, whereas no PHB was found in Cylindrospermum sp., Oscillatoria sp. and Plectonema sp. Presence of PHB granules in Nostoc muscorum NCCU- 442 was confirmed microscopically with Sudan black B and Nile red A staining. Pretreatment of biomass with methanol: acetone: water: dimethylformamide [40: 40: 18: 2 (MAD-I] with 2 h magnetic bar stirring followed by 30 h continuous chloroform soxhlet extraction acted as optimal extraction conditions. Optimized physicochemical conditions viz. 7.5 pH, 30°C temperature, 10:14 h light:dark periods with 0.4% glucose (as additional carbon source, 1.0 gl-1 sodium chloride and phosphorus deficiency yielded 26.37% PHB on 7th day instead of 21st day. Using FTIR, 1H NMR and GC-MS, extracted polymer was identified as PHB. Thermal properties (melting temperature, decomposition temperatures etc. of the extracted polymer were determined by TGA and DSC. Further, the polymer showed good tensile strength and young's modulus with a low extension to break ratio comparable to petrochemical plastic. Biodegradability potential tested as weight loss percentage showed efficient degradation (24.58% of PHB within 60 days by mixed microbial culture in comparison to


    Directory of Open Access Journals (Sweden)

    F. T. SOUZA


    Full Text Available

    Objetivou-se avaliar o potencial antioxidante da ficocianina, frente a peroxidação lipídica dos sistemas lipídicos óleo de soja e azeite de oliva. A ficocianina é uma ficobiliproteína extraída de algas verde-azuladas como a Spirulina platensis. Esta proteína apresenta três grupos cromogênicos (tetrapirólicos lineares por unidades monométricas, que possuem uma estrutura muito similar a da bilirrubina, que é um reconhecido antioxidante endógeno. Para tal, o óleo de soja e o azeite de oliva foram submetidos à oxidação lipídica, através de aquecimento a 80ºC durante 11 h, sob aeração constante, em presença e ausência de ficocianina. A ficocianina foi adicionada nas concentrações de 0,5, 1,0 e 1,5%. A oxidação lipídica foi avaliada nos óleos de soja e azeite de oliva através da determinação do índice de peróxidos a cada hora. A análise estatística demonstrou que as concentrações de 0,5% e 1% de ficocianina apresentaram igualdade quanto ao potencial antioxidante tanto para o óleo de soja como para o sistema azeite de oliva e superior potencial antioxidante quando comparadas à concentração de 1,5% de ficocianina.

  9. Cyanobacterial Polyhydroxybutyrate (PHB): Screening, Optimization and Characterization (United States)

    Ansari, Sabbir; Fatma, Tasneem


    In modern life petroleum-based plastic has become indispensable due to its frequent use as an easily available and a low cost packaging and moulding material. However, its rapidly growing use is causing aquatic and terrestrial pollution. Under these circumstances, research and development for biodegradable plastic (bioplastics) is inevitable. Polyhydroxybutyrate (PHB), a type of microbial polyester that accumulates as a carbon/energy storage material in various microorganisms can be a good alternative. In this study, 23 cyanobacterial strains (15 heterocystous and 8 non-heterocystous) were screened for PHB production. The highest PHB (6.44% w/w of dry cells) was detected in Nostoc muscorum NCCU- 442 and the lowest in Spirulina platensis NCCU-S5 (0.51% w/w of dry cells), whereas no PHB was found in Cylindrospermum sp., Oscillatoria sp. and Plectonema sp. Presence of PHB granules in Nostoc muscorum NCCU- 442 was confirmed microscopically with Sudan black B and Nile red A staining. Pretreatment of biomass with methanol: acetone: water: dimethylformamide [40: 40: 18: 2 (MAD-I)] with 2 h magnetic bar stirring followed by 30 h continuous chloroform soxhlet extraction acted as optimal extraction conditions. Optimized physicochemical conditions viz. 7.5 pH, 30°C temperature, 10:14 h light:dark periods with 0.4% glucose (as additional carbon source), 1.0 gl-1 sodium chloride and phosphorus deficiency yielded 26.37% PHB on 7th day instead of 21st day. Using FTIR, 1H NMR and GC-MS, extracted polymer was identified as PHB. Thermal properties (melting temperature, decomposition temperatures etc.) of the extracted polymer were determined by TGA and DSC. Further, the polymer showed good tensile strength and young’s modulus with a low extension to break ratio comparable to petrochemical plastic. Biodegradability potential tested as weight loss percentage showed efficient degradation (24.58%) of PHB within 60 days by mixed microbial culture in comparison to petrochemical plastic

  10. Characterization of microalga Chlorella as a fuel and its thermogravimetric behavior

    International Nuclear Information System (INIS)

    Rizzo, Andrea Maria; Prussi, Matteo; Bettucci, Lorenzo; Libelli, Ilaria Marsili; Chiaramonti, David


    Highlights: ► Proximate and ultimate analysis of two microalgae (Nannochloropsis and Chlorella spp.). ► TGA of Chlorella spp. and Nannochloropsis investigated at 15 °C/min up to 800 °C. ► 1.2 kg of Chlorella pyrolyzed in a novel batch, intermediate pyrolysis pilot reactor at 450 °C. ► Bio-oil from Chlorella oil analysed and compared to pine chips fast pyrolysis oil. ► Bio-oil from Chlorella exhibited superior properties compared to lignocellulosic pyrolysis oil as intermediate energy carrier. -- Abstract: Microalgae are photosynthetic microorganisms living in marine or freshwater environment. In this study, samples of Chlorella spp. and Nannochloropsis from two different origins were analysed to settle a preliminary characterization of these microorganisms as intermediate energy carriers and their properties compared to a conventional lignocellulosic feedstock (pine chips). Both microalgae samples were characterized in terms of elemental composition (CHONS and P) and thermogravimetric behavior. This was investigated through non-isothermal thermogravimetric analysis in nitrogen atmosphere at heating rate of 15 °C min −1 and temperature up to 800 °C. Solid residues produced at 300 °C and 800 °C from TGA were also analysed to determine the ultimate composition of chars. Activation energy, reaction order and pre-exponential factor were calculated for the single step conversion mechanism of 1 g of Chlorella spp. and compared to literature data on Chlorella protothecoides and Spirulina platensis. Calculated kinetic parameters, given as intervals of several determinations, resulted to be: pre-exponential factor (A) 1.47–1.62E6 min −1 , activation energy (E) 7.13–7.92E4 J mol −1 , reaction order (n) 1.69–2.41. 1.2 kg of Chlorella spp. was then processed in a newly designed batch pyrolysis pilot reactor, capable of converting up to 1.5 kg h −1 of material, and pyrolysis liquid collected, analysed and compared with a sample of fast pyrolysis

  11. Fabrication and electromagnetic properties of bio-based helical soft-core particles by way of Ni-Fe alloy electroplating

    Energy Technology Data Exchange (ETDEWEB)

    Lan Mingming, E-mail: [Bionic and Micro/Nano/Bio Manufacturing Technology Research Center, School of Mechanical Engineering and Automation, Beihang University, Beijing 100191 (China); Zhang Deyuan; Cai Jun; Zhang Wenqiang; Yuan Liming [Bionic and Micro/Nano/Bio Manufacturing Technology Research Center, School of Mechanical Engineering and Automation, Beihang University, Beijing 100191 (China)


    Ni-Fe alloy electroplating was used as a bio-limited forming process to fabricate bio-based helical soft-core ferromagnetic particles, and a low frequency vibration device was applied to the cathode to avoid microorganism (Spirulina platens) cells adhesion to the copper net during the course of plating. The morphologies and ingredients of the coated Spirulina cells were characterized using scanning electron microscopy and energy dispersive spectrometer. The complex permittivity and permeability of the samples containing the coated Spirulina cells before and after heat treatment were measured and investigated by a vector network analyzer. The results show that the Spirulina cells after plating keep their initial helical shape, and applying low frequency vibration to the copper net cathode in the plating process can effectively prevent agglomeration and intertwinement of the Spirulina cells. The microwave absorbing and electromagnetic properties of the samples containing the coated Spirulina cells particles with heat treatment are superior to those samples containing the coated Spirulina cells particles without heat treatment. - Highlights: > We used the microorganism cells as forming template to fabricate the bio-based helical soft-core ferromagnetic particles. > Microorganism selected as forming templates was Spirulina platens, which are of natural helical shape and have high aspect ratio. > Coated Spirulina cells were a kind lightweight ferromagnetic particle.

  12. A Lithium-Sensitive and Sodium-Tolerant 3′-Phosphoadenosine-5′-Phosphatase Encoded by halA from the Cyanobacterium Arthrospira platensis Is Closely Related to Its Counterparts from Yeasts and Plants


    Zhang, Ju-Yuan; Zou, Jie; Bao, Qiyu; Chen, Wen-Li; Wang, Li; Yang, Huanming; Zhang, Cheng-Cai


    3′-Phosphoadenosine-5′-phosphatase (PAPase) is required for the removal of toxic 3′-phosphoadenosine-5′-phosphate (PAP) produced during sulfur assimilation in various eukaryotic organisms. This enzyme is a well-known target of lithium and sodium toxicity and has been used for the production of salt-resistant transgenic plants. In addition, PAPase has also been proposed as a target in the treatment of manic-depressive patients. One gene, halA, which could encode a protein closely related to th...

  13. Enhancement of biodiesel production from different species of algae

    Directory of Open Access Journals (Sweden)

    El-Moneim M. R. Afify, Abd


    Full Text Available Eight algal species (4 Rhodo, 1 chloro and 1 phaeophycean macroalgae, 1 cyanobacterium and 1 green microalga were used for the production of biodiesel using two extraction solvent systems (Hexane/ether (1:1, v/v and (Chloroform/ methanol (2:1, v/v. Biochemical evaluations of algal species were carried out by estimating biomass, lipid, biodiesel and sediment (glycerin and pigments percentages. Hexane/ ether (1:1, v/v extraction solvent system resulted in low lipid recoveries (2.3-3.5% dry weight while; chloroform/methanol (2: 1, v/v extraction solvent system was proved to be more efficient for lipid and biodiesel extraction (2.5 – 12.5% dry weight depending on algal species. The green microalga Dictyochloropsis splendida extract produced the highest lipid and biodiesel yield (12.5 and 8.75% respectively followed by the cyanobacterium Spirulina platensis (9.2 and 7.5 % respectively. On the other hand, the macroalgae (red, brown and green produced the lowest biodiesel yield. The fatty acids of Dictyochloropsis splendida Geitler biodiesel were determined using gas liquid chromatography. Lipids, biodiesel and glycerol production of Dictyochloropsis splendida Geitler (the promising alga were markedly enhanced by either increasing salt concentration or by nitrogen deficiency with maximum production of (26.8, 18.9 and 7.9 % respectively at nitrogen starvation condition.

    Ocho especies de algas (4 Rhodo, 1 cloro y 1 macroalgas phaeophycean, 1 cianobacteria y 1 microalga verde fueron utilizados para la producción de biodiesel utilizando dos sistemas de extracción con disolventes (hexano/éter (1:1, v/v y (Cloroformo / metanol (2:1, v/v. La evaluación bioquímica de las especies de algas se llevó a cabo mediante la estimación de los porcentajes de biomasa, de lípidos, de biodiesel y de sedimento (glicerina y pigmentos. El sistema extracción con el disolvente hexano/éter (1:1, v

  14. Влияние препаратов БиоР и Бутофан на функциональное состояние печени и некоторых показателей продуктивности у перепелов на откорме

    Directory of Open Access Journals (Sweden)

    Василе МАКАРЬ


    Full Text Available The paper presents the results of the influence of the BioR remedy, obtained through modern tech-nologies from Spirulina platensis, as well as of the alternative preparation Butofan on the functional state of the liver and certain productive parameters in fattening quails. The study was carried out on 3 batches of quails, 50 birds each. The positive impact of the researched BioR remedy on liver is shown through the analysis of multiple marker parameters of the functional status of liver, such as alkaline phosphatase and its fractions (thermolabile and thermostable, bilirubin, and its fractions (direct and indirect as well as alanine transaminase, aspartate transami-nase and the activity of these transaminases in liver tissue. Реферат. В работе представлены результаты влияния препарата БиоР, полученного с помощью современных методов из Spirulina platensis и также альтернативного препарата Бутофан на функциональное состояние печени и некоторые показатели продуктивности у перепелов на откорме. Опыт проводился на 3-х группах перепелов, по 50 голов в каждой. Положительное влияние препарата БиоР на функцию печени представлено посредством большинства маркеров, характеризующих состояние печени, такие как – щелочная фосфатаза и ее фракции: термолабильная и термостабильная, билирубин и его фракции: прямой и непрямой, аланинтрансаминаза и аспартаттрансаминаза и их функции в печеночной ткани.

  15. Impact de l'emballage et de la durée de conservation sur la qualité ...

    African Journals Online (AJOL)

    English Title: Impact of the packaging and conservation on the quality, nutritional and microbiological of sorghum cookies fortified with moringa and Spirulina. English Abstract. Objective: Changes in the quality of two types of sorghum biscuits enriched with 10% moringa and 4% spirulina were studied in two types of ...

  16. The Effect of Food Quality and Rearing Density on the Growth and ...

    African Journals Online (AJOL)

    Abstract—Seven combinations of aquatic plant extracts were tested to feed juveniles of H. scabra: Thalassia hemprichii, T. hemprichii with 3 % Spirulina, Sargassum latifolium, S. latifolium with 3 % Spirulina, Thalassodendron ciliatum, Syringodium isoetifolium and organic biofilm. A control test consisted in rearing ...

  17. Development of optimal enzymatic and microbial conversion systems for biofuel production (United States)

    Aramrueang, Natthiporn

    materials can range from 470 to 533 L ethanol/metric ton (d.b.) Sugar beet leaves contain nearly equal amounts of cellulose (13%), hemicellulose (16%), and pectin (17%). The potential ethanol yield of sugar beet leaves is 340 L ethanol/metric ton (d.b.). As remaining unused in great quantities during the production of sugar beet as a sugar and energy crop, sugar beet leaves was studied as a potential feedstock for the production of biofuel and valuable products. The enzymatic hydrolysis of sugar beet leaves was optimized for fermentable sugar production. Optimization of enzyme usage was performed to make the biorefinery process more cost- and energy-effective. In this research, response surface methodology was used to study the effects of enzyme loadings during the hydrolysis of sugar beet leaves at 10% total solids content, using a mix of cellulases, hemicellulases, and pectinases. The effects of enzyme loadings were studied with a five-level rotatable central composite design for maximum conversion of sugar beet leaves to fermentable sugars. The last part of this study investigated biogas production through the anaerobic digestion of microalgae as they have received much attention as another potential biofuel feedstock. Anaerobic digestion of Spirulina ( Arthrospira platensis) was conducted in batch reactors for the study of the kinetics and, in continuous stirred tank reactors (CSTR), for the study of the two important operating parameters: hydraulic retention time (HRT) and organic loading rate (OLR). The kinetics study on methane production from batch experiments shows first order kinetics and a reaction rate constant of 0.382 d-1. The maximum biogas and methane yields for Spirulina are 0.514 L/gVS and 0.360 L CH4/gVS, respectively. The methane content of the biogas is 68%. During the continuous anaerobic digestion in CSTR for OLR in the range of 1.0-4.0 gVS/L/d, biogas and methane yields are in the ranges of 0.276-0.502 L/ gVS and 0.163-0.342 L CH4/gVS, respectively

  18. Antibacterial, antioxidant and cytotoxic activities of extracts from the ...

    African Journals Online (AJOL)



    Oct 11, 2012 ... capacity of each sample to scavenge the ABTS radical cation, we revealed that the EPS aqueous ... evaluated using the brine shrimp Artemia salina, as test organism. ..... released by cyanobacterium Arthrospira platensis.

  19. Protein (Cyanobacteria): 479131140 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available xylamine reductase Arthrospira platensis NIES-39 MFCEQCEQTASGQGCHQWGACGKGPDVNAVQDLL... YP_005071100.1 NC_016640 1117:23174 ... 1150:27534 1301283:45982 ... 35823:1467 118562:2804 696747:2804 ... hydro

  20. Protein (Cyanobacteria): 479130489 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_005070449.1 NC_016640 1117:22154 ... 1150:29420 1301283:48078 ... 35823:3164 118562:2384 696747:2384 ... creat...ininase Arthrospira platensis NIES-39 MHNFIPPHRFFPYLTWTEIAEMPDRENTVIIQPIGAIEQHGPHLP