Chlamydia caviae infection alters abundance but not composition of the guinea pig vaginal microbiota.

Science.gov (United States)

Neuendorf, Elizabeth; Gajer, Pawel; Bowlin, Anne K; Marques, Patricia X; Ma, Bing; Yang, Hongqiu; Fu, Li; Humphrys, Michael S; Forney, Larry J; Myers, Garry S A; Bavoil, Patrik M; Rank, Roger G; Ravel, Jacques

2015-06-01

In humans, the vaginal microbiota is thought to be the first line of defense again pathogens including Chlamydia trachomatis. The guinea pig has been extensively used as a model to study chlamydial infection because it shares anatomical and physiological similarities with humans, such as a squamous vaginal epithelium as well as some of the long-term outcomes caused by chlamydial infection. In this study, we aimed to evaluate the guinea pig-C. caviae model of genital infection as a surrogate for studying the role of the vaginal microbiota in the early steps of C. trachomatis infection in humans. We used culture-independent molecular methods to characterize the relative and absolute abundance of bacterial phylotypes in the guinea pig vaginal microbiota in animals non-infected, mock-infected or infected by C. caviae. We showed that the guinea pig and human vaginal microbiotas are of different bacterial composition and abundance. Chlamydia caviae infection had a profound effect on the absolute abundance of bacterial phylotypes but not on the composition of the guinea pig vaginal microbiota. Our findings compromise the validity of the guinea pig-C. caviae model to study the role of the vaginal microbiota during the early steps of sexually transmitted infection. © FEMS 2015.

The effect of infectious dose on humoral and cellular immune responses in Chlamydophila caviae primary ocular infection.

Directory of Open Access Journals (Sweden)

Ana Filipovic

Full Text Available Following infection, the balance between protective immunity and immunopathology often depends on the initial infectious load. Several studies have investigated the effect of infectious dose; however, the mechanism by which infectious dose affects disease outcomes and the development of a protective immune response is not known. The aim of this study was to investigate how the infectious dose modulates the local and systemic humoral and the cellular immune responses during primary ocular chlamydial infection in the guinea pig animal model. Guinea pigs were infected by ocular instillation of a Chlamydophila caviae-containing eye solution in the conjunctival sac in three different doses: 1×102, 1×104, and 1×106 inclusion forming units (IFUs. Ocular pathology, chlamydial clearance, local and systemic C. caviae-specific humoral and cellular immune responses were assessed. All inocula of C. caviae significantly enhanced the local production of C. caviae-specific IgA in tears, but only guinea pigs infected with the higher doses showed significant changes in C. caviae-specific IgA levels in vaginal washes and serum. On complete resolution of infection, the low dose of C. caviae did not alter the ratio of CD4+ and CD8+ cells within guinea pigs' submandibular lymph node (SMLN lymphocytes while the higher doses increased the percentages of CD4+ and CD8+ cells within the SMLN lymphocytes. A significant negative correlation between pathology intensity and the percentage of CD4+ and CD8+ cells within SMLN lymphocyte pool at selected time points post-infection was recorded for both 1×104, and 1×106 IFU infected guinea pigs. The relevance of the observed dose-dependent differences on the immune response should be further investigated in repeated ocular chlamydial infections.

Treatment and control of Trixacarus caviae infestation in a conventional guinea pig (Cavia porcellus) breeding colony

OpenAIRE

Nath, Anjan Jyoti

2015-01-01

A case of sarcoptic mange caused by Trixacarus caviae in a conventional guinea pig breeding colony is reported. The infestation was reported in a large colony of guinea pigs during the month of July, 2013 affecting 30 breeder guinea pigs. Severely infested animals were treated individually with subcutaneous injection of ivermectin 1 % w/v (Neomec®) at the rate of 400 µg/kg body weight 10 days apart. Three doses of ivermectin were sufficient to eliminate the parasite which tested negative afte...

Performances de production des cobayes (Cavia porcellus L.) en ...

African Journals Online (AJOL)

Production performance of guinea pigs (Cavia porcellus L.) in function of dietary protein level. ABSTRACT. In Cameroon, guinea pigs raising is still practiced in kitchens and on the ground and their food is ... females were previously crossed with 12 males for a period of 31 days according to a factorial design of three.

Do young guinea pigs (Cavia porcellus) develop an attachment to inanimate objects?

NARCIS (Netherlands)

Janzen, MID; Timmermans, PJA; Kruijt, JP; Vossen, JMH

1999-01-01

Filial imprinting has been studied extensively in precocial birds. In these studies, inanimate objects were used as imprinting objects. Although attachment to the parents is common in mammals, experiments with inanimate objects are rare and mostly restricted to guinea pigs (Cavia porcellus). The

Efecto modulador del sulfuro de hidrógeno en el metabolismo basal en Cavia porcellus (cuy) normales

OpenAIRE

Gómez Herreros, César Gonzalo

2016-01-01

Evalúa el efecto modulador del H2S a 80 ppm sobre el metabolismo basal en Cavia porcellus (cuy) normales. Para ello mide el consumo de oxígeno y producción de dióxido de carbono del Cavia porcellus (cuy) normales inmediatamente antes y después de la exposición al sulfuro de hidrógeno. Para luego determinar los cambios histológicos a nivel de tejido pulmonar, cardiaco y renal, y los niveles de hemoglobina entre los grupos experimentales (control, experimental y gold estándar). Tesis

Breeding of guinea-pig (Cavia porcellus, L. 1758) for meat production in Butembo, Democratic Republic of Congo : Literature review and breeding scheme

OpenAIRE

Sikiminywa, K.-L.; Godeau, Jean-Marie; Nyongombe, U.-F.; Hornick, Jean-Luc

2013-01-01

Providing animal proteins to humans requires choosing the animal species to be raised when access to land is limited. Butembo, is a refuge city of conflicts area in the east of Democratic Republic of Congo, where guinea-pig (Cavia porcellus) is considered as food. Therefore the breeding of this animal is an option to make more meat available. Genetic selection of guinea pigs and popularization of improved farming techniques can contribute to solve problems of food security in the region. The ...

Treatment and control of Trixacarus caviae infestation in a conventional guinea pig (Cavia porcellus) breeding colony.

Science.gov (United States)

Nath, Anjan Jyoti

2016-12-01

A case of sarcoptic mange caused by Trixacarus caviae in a conventional guinea pig breeding colony is reported. The infestation was reported in a large colony of guinea pigs during the month of July, 2013 affecting 30 breeder guinea pigs. Severely infested animals were treated individually with subcutaneous injection of ivermectin 1 % w/v (Neomec ® ) at the rate of 400 µg/kg body weight 10 days apart. Three doses of ivermectin were sufficient to eliminate the parasite which tested negative after 30 days of the first treatment. The entire colony was given preventive dose of ivermectin spray (2 mg/ml solution) following the same schedule. Strict hygienic measures were followed. New hair growth in the severely affected animals was evidenced on 30th day of treatment.

Lactobacillus caviae sp. nov., an obligately heterofermentative bacterium isolated from the oral cavity of a guinea pig (Cavia aperea f. porcellus).

Science.gov (United States)

Killer, Jiri; Pechar, Radko; Švec, Pavel; Salmonová, Hana; Švejstil, Roman; Geigerová, Martina; Rada, Vojtěch; Vlková, Eva; Mekadim, Chahrazed

2017-08-01

A Gram-stain-positive, facultatively anaerobic, and catalase- and oxidase-negative bacterial strain designated MOZM2T, having 98.4 % 16S rRNA gene sequence identity with Lactobacillus reuteri DSM 20016T, was isolated from a swab of the oral cavity of a home-bred guinea pig. Comparative analyses based on the hsp60, pheS and tuf genes confirmed L. reuteri as its closest relative species, with calculated sequence similarities of 92.8, 88.8 and 96.9 %, respectively. DNA-DNA hybridisation revealed a 42 % degree of genetic similarity between the novel strain and L. reuteri DSM 20016T. Strain MOZM2T degrades carbohydrates via the 6-phosphogluconate/phosphoketolase pathway, evidenced by its production of gas from glucose and the end products of hexose catabolism. Comparative analysis of the cellular fatty acid profiles determined significant differences between MOZM2T and L. reuteri DSM 20016T in their proportions of C8 : 0, C14 : 1, C17 : 0, C18 : 2ω6t and C20 : 0 fatty acids. Results of genotypic analyses also demonstrated differences between these two strains. They also differed in DNA G+C content, and some biochemical and physiological characteristics. We therefore believe that the examined bacterial isolate should be considered as a new taxon within the group of obligately heterofermentative lactobacilli. The species name Lactobacillus caviae sp. nov. is proposed, of which the type strain is MOZM2T (=CCM 8609T=DSM 100239T=LMG 28780T).

Cryptosporidium homai n. sp. (Apicomplexa: Cryptosporidiiae) from the guinea pig (Cavia porcellus).

Science.gov (United States)

Zahedi, Alireza; Durmic, Zoey; Gofton, Alexander W; Kueh, Susan; Austen, Jill; Lawson, Malcolm; Callahan, Lauren; Jardine, John; Ryan, Una

2017-10-15

The morphological, biological, and molecular characterisation of a new Cryptosporidium species from the guinea pig (Cavia porcellus) are described, and the species name Cryptosporidium homai n. sp. is proposed. Histological analysis conducted on a post-mortem sample from a guinea pig euthanised due to respiratory distress, identified developmental stages of C. homai n. sp. (trophozoites and meronts) along the intestinal epithelium. Molecular analysis at 18S rRNA (18S), actin and hsp70 loci was then conducted on faeces from an additional 7 guinea pigs positive for C. homai n. sp. At the 18S, actin and hsp70 loci, C. homai n. sp. exhibited genetic distances ranging from 3.1% to 14.3%, 14.4% to 24.5%, and 6.6% to 20.9% from other Cryptosporidium spp., respectively. At the 18S locus, C. homai n. sp. shared 99.1% similarity with a previously described Cryptosporidium genotype in guinea pigs from Brazil and it is likely that they are the same species, however this cannot be confirmed as actin and hsp70 sequences from the Brazilian guinea pig genotype are not available. Phylogenetic analysis of concatenated 18S, actin and hsp70 sequences showed that C. homai n. sp. exhibited 9.1% to 17.3% genetic distance from all other Cryptosporidium spp. This clearly supports the validity of C. homai n. sp. as a separate species. Copyright © 2017 Elsevier B.V. All rights reserved.

Een bijdrage tot de kennis van de experimentele tuberculeuze super-infectie bij de cavia

NARCIS (Netherlands)

Goslinga, Jan

1960-01-01

Er werd een beschrijving gegeven van een in 1954 in het sanatorium "de KLOKKENBERG" te Breda verricht onderzoek, waarbij 37 caviae achtereenvolgens enkele malen met virulente, tegen bepaalde stoffen selectief resistent gekweekte tuberkelbacteriën, afgeleid van &n bepaalde, bij een van de patienten

Prolactin family of the guinea pig, Cavia porcellus.

Science.gov (United States)

Alam, S M Khorshed; Konno, Toshihiro; Rumi, M A Karim; Dong, Yafeng; Weiner, Carl P; Soares, Michael J

2010-08-01

Prolactin (PRL) is a multifunctional hormone with prominent roles in regulating growth and reproduction. The guinea pig (Cavia porcellus) has been extensively used in endocrine and reproduction research. Thus far, the PRL cDNA and protein have not been isolated from the guinea pig. In the present study, we used information derived from the public guinea pig genome database as a tool for identifying guinea pig PRL and PRL-related proteins. Guinea pig PRL exhibits prominent nucleotide and amino acid sequence differences when compared with PRLs of other eutherian mammals. In contrast, guinea pig GH is highly conserved. Expression of PRL and GH in the guinea pig is prominent in the anterior pituitary, similar to known expression patterns of PRL and GH for other species. Two additional guinea pig cDNAs were identified and termed PRL-related proteins (PRLRP1, PRLRP2). They exhibited a more distant relationship to PRL and their expression was restricted to the placenta. Recombinant guinea pig PRL protein was generated and shown to be biologically active in the PRL-responsive Nb2 lymphoma cell bioassay. In contrast, recombinant guinea pig PRLRP1 protein did not exhibit PRL-like bioactivity. In summary, we have developed a new set of research tools for investigating the biology of the PRL family in an important animal model, the guinea pig.

Phylogenetic patterns in populations of Chilean species of the genus Orestias (Teleostei: Cyprinodontidae): results of mitochondrial DNA analysis.

Science.gov (United States)

Lüssen, Arne; Falk, Thomas M; Villwock, Wolfgang

2003-10-01

Patterns of molecular genetic differentiation among taxa of the "agassii species complex" (Parenti, 1984) were analysed based on partial mtDNA control region sequences. Special attention has been paid to Chilean populations of Orestias agassii and species from isolated lakes of northern Chile, e.g., O. agassii, Orestias chungarensis, Orestias parinacotensis, Orestias laucaensis, and Orestias ascotanensis. Orestias tschudii, Orestias luteus, and Orestias ispi were analysed comparatively. Our findings support the utility of mtDNA control region sequences for phylogenetic studies within the "agassii species complex" and confirmed the monophyly of this particular lineage, excluding O. luteus. However, the monophyly of further morphologically defined lineages within the "agassii complex" appears doubtful. No support was found for the utility of these data sets for inferring phylogenetic relationships between more distantly related taxa originating from Lake Titicaca.

Expression of Aeromonas caviae ST pyruvate dehydrogenase complex components mediate tellurite resistance in Escherichia coli

International Nuclear Information System (INIS)

Castro, Miguel E.; Molina, Roberto C.; Diaz, Waldo A.; Pradenas, Gonzalo A.; Vasquez, Claudio C.

2009-01-01

Potassium tellurite (K 2 TeO 3 ) is harmful to most organisms and specific mechanisms explaining its toxicity are not well known to date. We previously reported that the lpdA gene product of the tellurite-resistant environmental isolate Aeromonas caviae ST is involved in the reduction of tellurite to elemental tellurium. In this work, we show that expression of A. caviae ST aceE, aceF, and lpdA genes, encoding pyruvate dehydrogenase, dihydrolipoamide transacetylase, and dihydrolipoamide dehydrogenase, respectively, results in tellurite resistance and decreased levels of tellurite-induced superoxide in Escherichia coli. In addition to oxidative damage resulting from tellurite exposure, a metabolic disorder would be simultaneously established in which the pyruvate dehydrogenase complex would represent an intracellular tellurite target. These results allow us to widen our vision regarding the molecular mechanisms involved in bacterial tellurite resistance by correlating tellurite toxicity and key enzymes of aerobic metabolism.

A First Generation Comparative Chromosome Map between Guinea Pig (Cavia porcellus) and Humans.

Science.gov (United States)

Romanenko, Svetlana A; Perelman, Polina L; Trifonov, Vladimir A; Serdyukova, Natalia A; Li, Tangliang; Fu, Beiyuan; O'Brien, Patricia C M; Ng, Bee L; Nie, Wenhui; Liehr, Thomas; Stanyon, Roscoe; Graphodatsky, Alexander S; Yang, Fengtang

2015-01-01

The domesticated guinea pig, Cavia porcellus (Hystricomorpha, Rodentia), is an important laboratory species and a model for a number of human diseases. Nevertheless, genomic tools for this species are lacking; even its karyotype is poorly characterized. The guinea pig belongs to Hystricomorpha, a widespread and important group of rodents; so far the chromosomes of guinea pigs have not been compared with that of other hystricomorph species or with any other mammals. We generated full sets of chromosome-specific painting probes for the guinea pig by flow sorting and microdissection, and for the first time, mapped the chromosomal homologies between guinea pig and human by reciprocal chromosome painting. Our data demonstrate that the guinea pig karyotype has undergone extensive rearrangements: 78 synteny-conserved human autosomal segments were delimited in the guinea pig genome. The high rate of genome evolution in the guinea pig may explain why the HSA7/16 and HSA16/19 associations presumed ancestral for eutherians and the three syntenic associations (HSA1/10, 3/19, and 9/11) considered ancestral for rodents were not found in C. porcellus. The comparative chromosome map presented here is a starting point for further development of physical and genetic maps of the guinea pig as well as an aid for genome assembly assignment to specific chromosomes. Furthermore, the comparative mapping will allow a transfer of gene map data from other species. The probes developed here provide a genomic toolkit, which will make the guinea pig a key species to unravel the evolutionary biology of the Hystricomorph rodents.

Injury Thresholds for Topical Cream-Coated Skin of Hairless Guinea Pigs (Cavia Procellus) in Near Infrared Region

National Research Council Canada - National Science Library

Stolarski, David J; Zohner, Justin J; Imholte, Michelle L; Chavey, Lucas J; Pocock, Ginger M; Buchanan, Kelvin C; Jindra, Nichole M; Figueroa, Manuel A; Thomas, Robert J; Rockwell, Benjamin A

2006-01-01

.... Hairless guinea pigs (cavia porcellus) in vivo were used to evaluate how the minimum visible lesion threshold for single-pulse laser exposure is changed with a topical agent applied to the skin...

A new karyotype for the genus Cavia from a southern island of Brazil (Rodentia - Caviidae

Directory of Open Access Journals (Sweden)

A. Gava

1998-03-01

Full Text Available Intraspecific karyotype variation in mammal species is very common and often caused by centromeric fusion of acrocentric chromosomes. We describe here a new karyotype 2n = 62 (FN = 112 for the genus Cavia from the Moleques do Sul Islands, of the southern coast of Brazil. We analyzed two male and four female karyotypes that had twenty-four biarmed pairs and six pairs of acrocentric chromosomes. The sexual pair consisted of a metacentric X-chromosome and a large acrocentric Y. C-bands were found in the centromeric and pericentromeric regions of almost all chromosomes, except for some small biarmed and acrocentric ones. Nucleolus organizer regions appeared in two biarmed chromosomes, and G-banding patterns were also seen.RESUMO A variação cariotípica nas espécies de mamíferos é bastante comum e geralmente causada pela fusão de cromossomos acrocêntricos. Foi descrito neste trabalho um novo cariótipo, com 2n = 62 e FN = 112, para o gênero Cavia proveniente das ilhas Moleques do Sul, da costa sul do Brasil. Foram analisados os cariótipos de dois machos e quatro fêmeas que possuiam 24 pares de cromossomos com dois braços e seis pares de acrocêntricos. O par sexual era constituído por um cromossomo X metacêntrico grande e um Y acrocêntrico. As bandas C estavam localizadas nas regiões centroméricas e pericentroméricas da maioria dos cromossomos, com exceção de alguns acrocêntricos e os cromossomos de dois braços menores. As regiões organizadoras de nucléolo ocorreram em dois cromossomos com dois braços e o padrão de bandamento G foi também apresentado.

Aeromonas caviae alters the cytosolic and mitochondrial creatine kinase activities in experimentally infected silver catfish: Impairment on renal bioenergetics.

Science.gov (United States)

Baldissera, Matheus D; Souza, Carine F; Júnior, Guerino B; Verdi, Camila Marina; Moreira, Karen L S; da Rocha, Maria Izabel U M; da Veiga, Marcelo L; Santos, Roberto C V; Vizzotto, Bruno S; Baldisserotto, Bernardo

2017-09-01

Cytosolic and mitochondrial creatine kinases (CK), through the creatine kinase-phosphocreatine (CK/PCr) system, provide a temporal and spatial energy buffer to maintain cellular energy homeostasis. However, the effects of bacterial infections on the kidney remain poorly understood and are limited only to histopathological analyses. Thus, the aim of this study was to investigate the involvement of cytosolic and mitochondrial CK activities in renal energetic homeostasis in silver catfish experimentally infected with Aeromonas caviae. Cytosolic CK activity decreased in infected animals, while mitochondrial CK activity increased compared to uninfected animals. Moreover, the activity of the sodium-potassium pump (Na + , K + -ATPase) decreased in infected animals compared to uninfected animals. Based on this evidence, it can be concluded that the inhibition of cytosolic CK activity by A. caviae causes an impairment on renal energy homeostasis through the depletion of adenosine triphosphate (ATP) levels. This contributes to the inhibition of Na + , K + -ATPase activity, although the mitochondrial CK activity acted in an attempt to restore the cytosolic ATP levels through a feedback mechanism. In summary, A. caviae infection causes a severe energetic imbalance in infected silver catfish, which may contribute to disease pathogenesis. Copyright © 2017 Elsevier Ltd. All rights reserved.

A comparative analysis of the intestinal metagenomes present in guinea pigs (Cavia porcellus) and humans (Homo sapiens)

DEFF Research Database (Denmark)

Hildebrand, Falk; Ebersbach, Tine; Nielsen, Henrik Bjørn

2012-01-01

Background: Guinea pig (Cavia porcellus) is an important model for human intestinal research. We have characterized the faecal microbiota of 60 guinea pigs using Illumina shotgun metagenomics, and used this data to compile a gene catalogue of its prevalent microbiota. Subsequently, we compared th...

Characterisation of potential virulence markers in Aeromonas caviae isolated from polluted and unpolluted aquatic environments in Morocco

DEFF Research Database (Denmark)

Imziln, Boujama; Krovacek, Karel; Baloda, Suraj B.

1998-01-01

A total of 100 Aeromonas caviae strains isolated from river waters (38 isolates), raw sewage (30 isolates) and effluents of stabilisation ponds (i.e. treated sewage; 32 isolates) in Marrakech, Morocco, were tested for the presence of putative virulence factors to delineate differences, if any...

Validation of a Behavioral Ethogram for Assessing Postoperative Pain in Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Dunbar, Misha L; David, Emily M; Aline, Marian R; Lofgren, Jennifer L

2016-01-01

Although guinea pigs (Cavia porcellus) have been used in research for more than a century and remain the most prevalent USDA-covered species, little has been elucidated regarding the recognition of clinical pain or analgesic efficacy in this species. We sought to assess pain in guinea pigs by using newer, clinically relevant methods that have been validated in other rodent species: the behavioral ethogram and cageside proxy indicator. In this study, 10 male guinea pigs underwent electronic von Frey testing of nociception, remote videorecording of behavior, and cageside assessment by using time-to-consumption (TTC) of a preferred treat test. These assessments were performed across 2 conditions (anesthesia only and castration surgery under anesthesia) at 3 time points (2, 8, and 24 h after the event). The anesthesia only condition served to control for the nonpainful but potentially distressing components of the surgical experience. Compared with those after anesthesia only conditions, subtle body movements were increased and nociceptive thresholds were decreased at 2 and 8 h after surgery. At 24 h, neither subtle body movement behaviors nor nociceptive thresholds differed between the 2 conditions. In contrast, TTC scores did not differ between the anesthesia only and surgery conditions at any time point, underscoring the challenge of identifying pain in this species through cageside evaluation. By comparing ethogram scores with measures of nociception, we validated select behaviors as pain-specific. Therefore, our novel ethogram allowed us to assess postoperative pain and may further serve as a platform for future analgesia efficacy studies in guinea pigs.

Endoparasitos em cobaias (Cavia porcellus (Mammalia, Rodentia, Caviidae provenientes de biotérios de criação e experimentação do município do Rio de Janeiro, Brasil Endoparasites in guinea pigs (Cavia porcellus (Mammalia, Rodentia, Caviidae from breeding and experimentation animal housing of the municipality of Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

Luciana Casartelli Alves

2007-10-01

Full Text Available Foi realizado um levantamento sobre a prevalência e intensidade de infecção de endoparasitos em cobaias convencionais de linhagem Short Hair provenientes de biotérios de criação (A e experimentação (B do município do Rio de Janeiro, Brasil, avaliando-se a eficácia das medidas de prevenção entre eles. Para a realização do estudo, utilizou-se exame direto de mucosa e do conteúdo intestinal, a técnica de tricromo de WHEATLEY e exames coproparasitológicos pelas técnicas de Ritchie e Kinyoun. Os parasitos encontrados através da técnica de exame direto da mucosa e do conteúdo intestinal e de tricromo de WHEATLEY com as respectivas prevalências foram: Balantidium sp. (78%, Cyathodinium sp. (68%, Eimeria caviae (38%, Paraspidodera uncinata (34% e Giardia muris (24%. Nos exames de fezes realizados pelas técnicas de Ritchie e Kinyoun, foram encontrados os seguintes parasitos com as respectivas prevalências no biotério A: E. caviae (74%, Balantidium sp. (68%, Cyathodinium sp. (68% e Cryptosporidium sp. (5%. No biotério B, observou-se: E. caviae (58%, Balantidium sp. (42%, Cyathodinium sp. (25% e G. muris (8%. A alta prevalência de endoparasitos nos biotérios sugere a necessidade de se rever a eficácia das barreiras sanitárias adotadas.This paper discusses the prevalence and intensity of infection of endoparasites in conventionally maintained Short Hair guinea pigs colonies from a breeding (A and an experimental (B facilities in Rio de Janeiro, Brazil. It also evaluates the efficacy of the methods of prevention adopted by both facilities. The search of parasites was performed by direct examination of intestinal mucosa and its contents, WHEATLEY's trichrome method and coproparasitological examinations by Ritchie's and Kinyoun's techniques. The prevalences of endoparasites found throught direct examination of intestinal mucosa and its contents were: Balantidium sp. (78%, Cyathodinium sp. (68%, Eimeria caviae (38%, Paraspidodera

Histological and Immunohistochemical Characterization of a Case of Endometriosis in a Guinea Pig (Cavia tschudii

Directory of Open Access Journals (Sweden)

Alfonso Baldi

2017-01-01

Full Text Available Endometriosis is a chronic gynecological disease characterized by the ectopic proliferation of endometrial tissue outside of the uterine cavity. The pathogenesis of this disease is still obscure, and Sampson’s theory of retrograde menstruation is still the most widely accepted explanation. Endometriosis in animals has been so far described not only in baboons and a rhesus macaque but also in dogs and horses that are nonmenstruating animals. In this article, we report the histological and immunohistochemical characterization of the first case of ovarian cystic endometriosis and adenomyosis in a guinea pig. The case presented supports the hypothesis that endometriosis is a disease not at all related to the phenomenon of retrograde menstruation but is a consequence of some alterations in the morphogenesis of the female genital system and therefore it could be found in any mammal. We suggest considering endometriosis among the other pathological phenotypes in animals displaying ovarian and uterine alterations and having a history of difficulties in conceiving.

Hyperendemic Campylobacter jejuni in guinea pigs (Cavia porcellus) raised for food in a semi-rural community of Quito, Ecuador.

Science.gov (United States)

Graham, Jay P; Vasco, Karla; Trueba, Gabriel

2016-06-01

Domestic animals and animal products are the source of pathogenic Campylobacter jejuni and C. coli in industrialized countries, yet little is known about the transmission of these bacteria in developing countries. Guinea pigs (Cavia porcellus) are commonly raised for food in the Andean region of South America, however, limited research has characterized this rodent as a reservoir of zoonotic enteric pathogens. In this study, we examined the prevalence of Campylobacter spp. in 203 fecal samples from domestic animals of 59 households in a semi-rural parish of Quito, Ecuador. Of the twelve animal species studied, guinea pigs showed the highest prevalence of C. jejuni (n = 39/40; 97.5%). Multilocus sequence typing (MLST) was used to characterize the genetic relationship of C. jejuni from domestic animals and 21 sequence types (STs) were identified. The majority of STs from guinea pigs appeared to form new clonal complexes that were not related to STs of C. jejuni isolated from other animal species and shared only a few alleles with other C. jejuni previously characterized. The study identifies guinea pigs as a major reservoir of C. jejuni and suggests that some C. jejuni strains are adapted to this animal species. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

Helminths of the guinea pig, Cavia porcellus (Linnaeus, in Brazil

Directory of Open Access Journals (Sweden)

Roberto Magalhães Pinto

2002-07-01

Full Text Available Worm burdens were evaluated and compared in two groups of the guinea pig, Cavia poreellus (Linnaeus, 1758: animals of the first group were conventionally maintained in an institutional animal house and those of the second group were openly kept in pet shops in Brazil. Animals from both sources were infected only with the nematode Paraspidodera uncinata (Rudolphi, 1819 Travassos, 1914 (10% of prevalence in guinea pigs from lhe institutional facility and 40% in those animals from the pet shop. Other helminth samples recovered from Brazilian guinea pigs during 52 years and that are deposited in the Helminthological Collection of the Oswaldo Cruz Institute (CHIOC were also analyzed. Paraspidodera uncinata and the cestode Monoecocestus parcitesticulatus Rêgo, 1960 were identified in these samples.

Jejuno-jejunal intussusception in a guinea pig (Cavia porcellus

Directory of Open Access Journals (Sweden)

Tara J. Fetzer

2017-09-01

Full Text Available An approximately four-year-old male castrated guinea pig (Cavia porcellus was presented for painful defecation with a 24-hour history of hyporexia and intermittent episodes of rolling behavior. Upon presentation the patient was quiet, alert, and responsive, and mildly hypothermic. Abdominal palpation revealed an approximately 2-cm long oblong mass within the caudal abdomen. Abdominal radiographs revealed gastric dilation without volvulus and a peritoneal mass effect. The patient was euthanized following gastric reflux of brown malodorous fluid from his nares and oral cavity. A necropsy was performed and revealed a jejuno-jejunal intussusception causing mechanical gastrointestinal ileus, and gastric dilatation without volvulus. While non-obstructive gastrointestinal stasis is common and obstructive ileus is uncommon in guinea pigs, this report shows that intestinal intussusception is a differential in guinea pigs with ileus and gastric dilatation.

Aeromonas caviae inhibits hepatic enzymes of the phosphotransfer network in experimentally infected silver catfish: Impairment on bioenergetics.

Science.gov (United States)

Baldissera, M D; Souza, C F; Verdi, C M; Dos Santos, K L M; Da Veiga, M L; da Rocha, M I U M; Santos, R C V; Vizzotto, B S; Baldisserotto, B

2018-03-01

Several studies have been demonstrated that phosphotransfer network, through the adenylate kinase (AK) and pyruvate kinase (PK) activities, allows for new perspectives leading to understanding of disease conditions associated with disturbances in energy metabolism, metabolic monitoring and signalling. In this sense, the aim of this study was to evaluate whether experimental infection by Aeromonas caviae alters hepatic AK and PK activities of silver catfish Rhamdia quelen. Hepatic AK and PK activities decreased in infected animals compared to uninfected animals, as well as the hepatic adenosine triphosphate (ATP) levels. Also, a severe hepatic damage was observed in the infected animals due to the presence of dilation and congestion of vessels, degeneration of hepatocytes and loss of liver parenchyma architecture and sinusoidal structure. Therefore, we have demonstrated, for the first time, that experimental infection by A. caviae inhibits key enzymes linked to the communication between sites of ATP generation and ATP utilization. Moreover, the absence of a reciprocal compensatory mechanism between these enzymes contributes directly to hepatic damage and for a severe energetic imbalance, which may contribute to disease pathophysiology. © 2017 John Wiley & Sons Ltd.

Trixacarus caviae Fain, Howell & Hyatt 1972 (Acari: Sarcoptidae) as a cause of mange in guinea-pigs and papular urticaria in man

NARCIS (Netherlands)

Dorrestein, G.M.; Bronswijk, J.E.M.H. van

1979-01-01

The clinical symptoms of infestation with Trixacarus caviae in guinea-pigs are described. In general large areas of thickened, denuded skin, with a heavy secondary bacterial infection, and sometimes neurological signs, are observed in mangy cases. Antiparasitic therapy was successful with one or

Isolation and identification of Aeromonas caviae strain KS-1 as TBTC- and lead-resistant estuarine bacteria.

Science.gov (United States)

Shamim, Kashif; Naik, Milind Mohan; Pandey, Anju; Dubey, Santosh Kumar

2013-06-01

Tributyltin chloride (TBTC)- and lead-resistant estuarine bacterium from Mandovi estuary, Goa, India was isolated and identified as Aeromonas caviae strain KS-1 based on biochemical characteristics and FAME analysis. It tolerates TBTC and lead up to 1.0 and 1.4 mM, respectively, in the minimal salt medium (MSM) supplemented with 0.4 % glucose. Scanning electron microscopy clearly revealed a unique morphological pattern in the form of long inter-connected chains of bacterial cells on exposure to 1 mM TBTC, whereas cells remained unaltered in presence of 1.4 mM Pb(NO₃)₂ but significant biosorption of lead (8 %) on the cell surface of this isolate was clearly revealed by scanning electron microscopy coupled with energy dispersive X-ray spectroscopy. SDS-PAGE analysis of whole-cell proteins of this lead-resistant isolate interestingly demonstrated three lead-induced proteins with molecular mass of 15.7, 16.9 and 32.4 kDa, respectively, when bacterial cells were grown under the stress of 1.4 mM Pb (NO₃)₂. This clearly demonstrated their possible involvement exclusively in lead resistance. A. caviae strain KS-1 also showed tolerance to several other heavy metals, viz. zinc, cadmium, copper and mercury. Therefore, we can employ this TBTC and lead-resistant bacterial isolate for lead bioremediation and also for biomonitoring TBTC from lead and TBTC contaminated environment.

Streptococcus caviae sp. nov., isolated from guinea pig faecal samples.

Science.gov (United States)

Palakawong Na Ayudthaya, Susakul; Hilderink, Loes J; Oost, John van der; Vos, Willem M de; Plugge, Caroline M

2017-05-01

A novel cellobiose-degrading and lactate-producing bacterium, strain Cavy grass 6T, was isolated from faecal samples of guinea pigs (Cavia porcellus). Cells of the strain were ovalshaped, non-motile, non-spore-forming, Gram-stain-positive and facultatively anaerobic. The strain gr at 25-40 °C (optimum 37 °C) and pH 4.5-9.5 (optimum 8.0). Phylogenetic analysis based on 16S rRNA gene sequences showed that strain Cavy grass 6T belongs to the genus Streptococcus with its closest relative being Streptococcus devriesei CCUG 47155T with only 96.5 % similarity. Comparing strain Cavy grass 6T and Streptococcus devriesei CCUG 47155T, average nucleotide identity and level of digital DNA-DNA hybridization dDDH were only 86.9 and 33.3 %, respectively. Housekeeping genes groEL and gyrA were different between strain Cavy grass 6T and other streptococci. The G+C content of strain Cavy grass 6T was 42.6±0.3 mol%. The major (>10 %) cellular fatty acids of strain Cavy grass 6T were C16:0, C20 : 1ω9c and summed feature 8 (C18 : 1ω7c and/or C18 : 1ω6c). Strain Cavy grass 6T ferment a range of plant mono- and disaccharides as well as polymeric carbohydrates, including cellobiose, dulcitol, d-glucose, maltose, raffinose, sucrose, l-sorbose, trehalose, inulin and dried grass extract, to lactate, formate, acetate and ethanol. Based on phylogenetic and physiological characteristics, Cavy grass 6T can be distinguished from other members of the genus Streptococcus. Therefore, a novel species of the genus Streptococcus, family Streptococcaceae, order Lactobacillales is proposed, Streptococcuscaviae sp. nov. (type strain Cavy grass 6T=TISTR 2371T=DSM 102819T).

Female novelty and the courtship behavior of male guinea pigs (Cavia porcellus

Directory of Open Access Journals (Sweden)

Cohn D.W.H.

2004-01-01

Full Text Available In several rodent species, an increase or recovery of sexual behavior can be observed when sexually satiated males are placed in contact with a novel mate. In order to assess the influence of female novelty on the courtship behavior of guinea pigs (Cavia porcellus, four adult males were observed during four daily 15-min sessions while interacting with the same pregnant female (same-female sessions. A new female was presented during the fifth session (switched-female session. The duration of behavioral categories was obtained from videotape records using an observational software. From the first to the second session, all males decreased the time allocated to investigating (sniffing and licking, following, and mounting the female, and that response did not recover by the end of the same-female sessions. No similar decreasing tendencies were detected in the circling or rumba categories. A marked increase of investigating occurred in all males from the last same-female session (8.1, 11.9, 15.1 and 17.3 percent session time to the switched-female one (16.4, 18.4, 37.1 and 28.9 percent session time, respectively. Increases in following and circling were recorded in three of four males, and full-blown recovery of mounting in one male. No consistent changes in the females' responses to males (following or attacking were observed throughout testing. These results are consistent with the hypothesis that guinea pig males recognize individual females and that courtship responses may suffer a habituation/recovery process controlled by mate novelty.

Spirulina chitosan gel induction on healing process of Cavia cobaya post extraction socket

Directory of Open Access Journals (Sweden)

Rostiny Rostiny

2014-03-01

Full Text Available Background: Prominent residual ridge is necessary to gain retention and stabilility for succesful prosthodontic treatment such as removable, fixed or implant. Spirulina is a natural substance that can help tissue healing and chitosan also a natural substance that reported to have the ability to help bone remodelling. The combination gel of spirulina and chitosan could be considered as an alternative material to maintain residual ridge height after tooth extraction. Purpose: The aim of study was to examine the effect of combination gel of Spirulina and chitosan on healing process of Cavia cobaya post tooth extraction socket by counting the amount of osteoclast, osteoblast and colagen as an indicator. Methods: Twenty eight cavia cobaya were divided into 4 groups. Insisive mandible extraction was done and the sockets were filled with 3% CMCNa for control groups, 3% spirulina chitosan 200 mg for group 1, 6% spirulina chitosan 200 mg for group 2, 12% spirulina chitosan 200 mg for group 3. After 30 days, histopathology examination was done by using microscope to count the amount of osteoclast, osteoblast and collagen. Results: Data was analyzed by using Anova and Tukey HSD. For osteoclast, there was no significant different between every groups, while for osteoblast and collagen there was significant different between groups. The results showed that induction of combination gel spirulina chitosan was able to accumulate collagen fiber and resulting faster wound healing. Conclusion: Combination 12% gel spirulina chitosan 200 mg could be used as an alternative material for better bone remodeling after tooth extraction.Latar belakang: Residual ridge yang prominen sangat dibutuhkan untuk mendapatkan retensi dan stabilitas untuk menunjang keberhasilan perawatan di bidang prostodonsia seperti pada kasus removable, fixed atau implant. Tindakan pencabutan gigi dapat merusak jaringan periodontal, sementum dan tulang alveolar yang mengakibatkan resorbsi ridge

Transmissão do Trypanosoma cruzi em três gerações de Cavia porcellus sem a participação de triatomíneos

Directory of Open Access Journals (Sweden)

Ítalo A. Sherlock

1976-02-01

Full Text Available Foi verificada a transmissão sucessiva do T. cruzi em três gerações da cobaia Cavia porcellus sem a participação de triatomíneos. Embora não fosse determinado qual das vias, se placentária, leite, excreções ou contágio direto pelo qual o protozoário foi transmitido para os descendentes, chama-se atenção para a importância da manutenção de reservatórios da Doença de Chagas, mesmo na ausência de vetores invertebrados.The sucessive transmission of Trypanosoma cruzi among three generations of the guinea pig Cavia porcellus without the participation of triatomine bugs is verified. Although the mode of transmission, such as congenital, infected milk or other excretion or direct contagion was not defined, this maybe of importance in natural maintenance of reservoirs of T. cruzi without the invertebrate vectors.

Estereología Comparativa entre el Bazo del Cuye (Cavia porcellus) y la Rata (Rattus novergicus, Sprague Dawley)

OpenAIRE

Furrianca, María Cristina; Vásquez, Bélgica; del Sol, Mariano

2008-01-01

El bazo es el órgano linfático periférico más grande del organismo y conocer sus aspectos morfológicos cuantitativos es importante para determinar posibles patologías. El objetivo del estudio fue determinar en dos especies: cuye (Cavia porcellus) y rata (Rattus novergicus Sprague Dawley), las características estereológicas del bazo, para obtener patrones de normalidad cuantitativos, los que servirán de base para futuros estudios morfofuncionales. Se utilizaron 5 bazos de cada especie, clínica...

Social preferences of developing guinea pigs (Cavia porcellus) from the preweaning to the periadolescent periods.

Science.gov (United States)

Hennessy, Michael B; Young, Travis L; O'Leary, Shonagh K; Maken, Deborah S

2003-12-01

Preference tests in a novel environment (Experiment 1) and unobtrusive observations in a specialized living environment (Experiment 2) examined the attractiveness of various classes of conspecifics for maturing guinea pigs (Cavia porcellus). It was found that (a). the young continued to remain near the mother well beyond weaning; (b). there was increased time spent with unrelated adult females, but not males, after weaning; (c). male and female offspring behaved similarly; and (d). littermates spent considerable time with each other. These results provide no evidence that guinea pigs approaching sexual maturity begin to associate preferentially with novel animals or potential breeding partners. Choices were largely predictable from earlier findings of the ability of various classes of conspecifics to reduce hypothalamic-pituitary-adrenal activity of the young.

Reação em cadeia da polimerase para detecção de Clostridium chauvoei em tecidos de Cavia porcellus PCR detection of Clostridium chauvoei in tissues of Cavia porcellus

Directory of Open Access Journals (Sweden)

Ronnie Antunes de Assis

2005-12-01

Full Text Available O objetivo deste trabalho foi padronizar uma técnica de reação em cadeia da polimerase (PCR, para detecção de Clostridium chauvoei, em tecidos fixados em formol e incluídos em parafina de cobaias (Cavia porcellus experimentalmente infectadas com esse microrganismo. Os animais foram sacrificados, e amostras do músculo da área de inoculação (MAI, fígado, miocárdio e baço foram disponibilizadas para a técnica de PCR. O clostrídio foi detectado em todas as secções do MAI, fígado e miocárdio, mas não foi observado em secções do baço. Reações cruzadas não foram observadas a partir de secções do MAI dos animais com inoculação de outras espécies de clostrídios, bem como nenhuma amplificação foi observada a partir de secções do MAI dos animais controle. Esses resultados mostram que a técnica de PCR desenvolvida neste estudo, pode ser usada para detecção de Clostridium chauvoei em tecidos fixados em formol e incluídos em parafina.The objective of this work was the standardization of a polymerase chain reaction (PCR for detection of Clostridium chauvoei in formalin-fixed, paraffin-embedded tissues of guinea-pigs (Cavia porcellus infected experimentally with this microorganism. The animals were sacrificed, and samples of muscle from inoculation area (MIA, liver, myocardium and spleen were available for PCR technique. Clostridium chauvoei was detected in all sections of the MIA, liver and myocardium, and no product was observed in sections of the spleen. Cross-reactions were not observed in sections of MIA of the animals inoculated with other clostridia, as well as no amplification was observed in sections of MIA of control animals. These results show that the PCR technique developed in this study may be useful for detection of C. chauvoei in formalin-fixed, paraffin-embedded tissues.

El pH de la carne de cobayo (Cavia porcellus procedente del manejo deficiente del bienestar animal durante el sacrificio en la sierra central del Perú.

Directory of Open Access Journals (Sweden)

LUCAS JR

2017-09-01

Full Text Available En la región andina del Perú es común observar el sacrificio de los cobayos sin aturdimiento ni descanso ante mortem. El objetivo del presente estudio fue evaluar el pH de la carne de cobayo (Cavia porcellus resultante de este manejo. Se evaluó el pH de 60 canales a las 0, 1, 6, 12, y 24 h posteriores al sacrificio sin descanso ante mortem ni aturdimiento. El pH fue de 6.79 ± 0.3, 6.74 ± 0.34, 6.59 ± 0.28, 6.45 ± 0.35 y 5.96 ± 0.11, a la 0, 1, 6, 12 y 24 horas post sacrificio respectivamente. La ecuación que representa la evolución del pH fue Y=6.7765-0.0231X-0.0005X2 (R2=0.996. SUMMARY. The pH of guinea pig (Cavia porcellus meat from the welfare-deficient slaughtering in the Peruvian central Andes. In Andean region of Peru is common to slaughter Guinea pig without lairage and stunning. The aim of this study was to evaluate the pH of meat of Guinea pig (Cavia porcellus from the unsuitable welfare practices during slaughtering in the Peruvian central Andes. The pH of 60 guinea pig carcasses were analyzed at 0, 1, 6, 12 and 24 hours after the end of the slaughter process. The pH was 6.79 ± 0.3, 6.74 ± 0.34, 6.59 ± 0.28, 6.45 ± 0.35 and 5.96 ± 0.11 for 0, 1, 6, 12 y 24 h post slaughtering. The equation that graphs pH evolution was Y=6.7765-0.0231X-0.0005X2 (R2=0.996.

Real-Time Detection and Identification of Chlamydophila Species in Veterinary Specimens by Using SYBR Green-Based PCR Assays

DEFF Research Database (Denmark)

Nordentoft, Steen; Kabell, Susanne; Pedersen, Karl

2011-01-01

of Chlamydiaceae and differentiate the most prevalent veterinary Chlamydophila species: Cp. psittaci, Cp. abortus, Cp. felis, and Cp. caviae. By adding bovine serum albumin to the master mixes, target DNA could be detected directly in crude lysates of enzymatically digested conjunctival or pharyngeal swabs...... or tissue specimens from heart, liver, and spleen without further purification. The assays were evaluated on veterinary specimens where all samples were screened using a family-specific PCR, and positive samples were further tested using species-specific PCRs. Cp. psittaci was detected in 47 birds, Cp...... with a highly sensitive family-specific PCR, we were able to screen for Chlamydiaceae in veterinary specimens and confirm the species in positive samples with additional PCR assays....

Production, characterization, and immobilization of partially purified surfactant-detergent and alkali-thermostable protease from newly isolated Aeromonas caviae.

Science.gov (United States)

Datta, Sumitra; Menon, Gopalakrishnan; Varughese, Bincy

2017-04-21

Proteolytic Aeromonas caviae P-1-1 growing at wide-ranging pH (7.0-11.0) and moderate salinity (0-5% NaCl) was isolated from cattle shed of Thanjavur, India. It produced lipase, gelatinase, and polyhydroxybutyrate. Different culture conditions, incubation time, carbon and nitrogen sources, vitamins, amino acids, surfactants, and metal ions for optimal growth and protease production of P-1-1 were examined. Maximum protease (0.128 U/mL) production was achieved with 1% fructose, 1% yeast extract, 0.1% ammonium sulfate, 3% NaCl, 0.1% CaCl 2  · 2H 2 O, 1% glycine, 0.1% vitamin E, and 0.1% Tween-40 at pH 8.0 after 42 hr of incubation at 37°C. It was active over broad range of pH (7.0-12.0), temperature (15-100°C), and salinity (0-9% NaCl) with optima at pH 10.0, 55°C, and 3% NaCl. It retained 65 and 48% activities at pH 12.0 and 100°C, respectively. Partially purified protease was highly stable (100%) within pH range 7.0-12.0 and salinities of 0-5% NaCl for 48 hr. Cu 2+ , Mn 2+ , Co 2+ , and Ca 2+ did not inhibit its activity. Its stability at extreme pHs, temperatures, and in the presence of surfactants and commercial detergents suggests its possible application in laundry detergents. Partially purified protease was immobilized and reused. This is the first report of alkali-thermotolerant, surfactant-detergent-stable partially purified extracellular protease from A. caviae.

Genospecies and virulence factors of Aeromonas species in different sources in a North African country

Directory of Open Access Journals (Sweden)

Khalifa Sifaw Ghenghesh

2014-09-01

Full Text Available Introduction: Aeromonads of medical importance have been reported from numerous clinical, food, and water sources, but identification of genospecies and virulence factors of Aeromonas species from countries in North Africa and the Middle East are few. Methods: In total 99 Aeromonas species isolates from different sources (diarrheal children [n=23], non-diarrheal children [n=16], untreated drinking water from wells [n=32], and chicken carcasses [n=28] in Tripoli, Libya, were included in the present investigation. Genus identification was confirmed by biochemical analysis, and genospecies were determined using a combination of 16S rDNA variable region and gyrB sequence analysis. Polymerase chain reaction (PCR was used to detect genes encoding toxins from 52 of the isolates. Results: We identified 44 isolates (44% as A. hydrophila (3 [3.0%] subspecies anaerogenes, 23 [23%] subspecies dhakensis, and 18 [18%] subspecies ranae; 27 isolates (27% as A. veronii; 23 isolates (23% as A. caviae; and 5 isolates (5.0% as other genospecies. The genes encoding aerolysin (aer, cytolytic enterotoxin (act, and A. hydrophila isolate SSU enterotoxin (ast were detected in 45 (87%, 4 (7.7%, and 9 (17% of the 52 isolates tested, respectively. The gene encoding an extracellular lipase (alt was not detected. Conclusion: The majority of aeromonads from Libya fall within three genospecies (i.e. A. hydrophila, A. veronii, and A. caviae, and genes coding for toxin production are common among them.

Biochemical characteristics, serogroups, and virulence factors of aeromonas species isolated from cases of diarrhoea and domestic water samples in Chennai

Directory of Open Access Journals (Sweden)

Alavandi S

2003-01-01

Full Text Available PURPOSE: The objective of the present study was to delineate the differences between the clinical and environmental Aeromonas species with respect to their biochemical characteristics, serogrouping and virulence factors, in order to find a phenotypic marker of enteropathogenicity. METHODS: A total of 55 Aeromonas spp. inclusive of 19 isolates from cases of diarrhoea, and 36 from water samples comprising, 10 isolates of A. hydrophila, 21 isolates each of A. sobria, and A. caviae, two isolates of A. jandaei and one isolate of A. veronii were subjected to analysis of their biochemical characteristics, serogrouping, and virulence factors. RESULTS: Among the differences recorded in the biochemical characteristics in the three major species, the most striking characteristic was fermentation of lactose, which was observed in all the 11 A. caviae isolates recovered from water samples. None of the 10 clinical isolates of A. caviae tested fermented lactose. The clinical Aeromonas isolates belonged to seven typable serogroups, O:13, O:14, O:16, O:21, O:27, O:32 and O:35. The environmental isolates belonged to eight different serogroups, such as, O:3, O:11, O:14, O:16, O:18, O:28, O:64 and O:78 and were predominated by serotypes O:18 and O:64. Among the virulence factors tested, 89% of the environmental isolates produced b haemolysin, while only 62.3% of clinical isolates were able to do so. There was no significant difference between the clinical and environmental aeromonads with respect to their enterotoxigenicity in suckling mice in vivo, cytotoxicity in vitro in Vero cell monolayers, and ability to produce siderophores. CONCLUSION: Efforts to delineate the differences between the clinical and environmental Aeromonas spp. did not reveal significant difference between them. However, difference was observed with respect to their ability to produce b haemolysin, wherein, higher percentage of environmental isolates was haemolytic. The results also suggest

The effect of combined Moringa oleifera and demineralized freeze-dried bovine bone xenograft on the amount of osteoblast and osteoclast in the healing of tooth extraction socket of Cavia cobaya

Directory of Open Access Journals (Sweden)

Rostiny Rostiny

2016-12-01

Full Text Available Background: Alveolar bone has an important role in providing support to teeth and dentures. Loss of support caused by alveolar resorption will cause functional and aesthetic problems. Preservation socket using bone graft is one way to maintain the dimensions of the alveolar bone. Moringa oleifera leaf can increase the activity of bone graft in the formation of new bone. Purpose: This study was aimed to evaluate the effect of combined Moringa oleivera leaf extract and demineralized freeze-dried bovine bone xenograft (DFDBBX towards the formation of osteoblasts and osteoclasts in the tooth extraction sockets of cavia cobaya. Method: This study used 28 cavia cobayas divided into four groups. The combination of Moringa oleifera leaf extract and DFDBBX was inducted into the sockets of lower incisor tooth with certain dose in each group, ointment 1 containing PEG (a mixture of PEG 400 and PEG 4000 for control group, ointment 2 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active subtance consentration of 0.5% for group 1, ointment 3 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active substance concentration of 1% for group 2, and Ointment 4 containing Moringa oleifera leaf extract and DFDBBX and PEG (at active substance consentration of 2% for group 3. paraffin block preparations were made for histopathology examination using hematoxylin eosin staining. Result: The results showed that there were significant differences of the number of osteoblasts and osteoclasts in each treatment group (p <0.05. Conclusion: It can be concluded that the combination of Moringa oleifera leaf extract and DFDBBX at 2% cocentration can increase the number of osteoblasts and decrease osteoclasts in the healing of tooth extraction sockets of cavia cobaya.

Teste intradérmico com proteínas recombinantes de Mycobacterium bovis como antígenos em Cavia porcellus

Directory of Open Access Journals (Sweden)

Elaine S.P. Melo

2014-10-01

Full Text Available O teste intradérmico para o diagnóstico da tuberculose bovina utiliza derivados proteicos purificados (PPD de Mycobacterium bovis que são capazes de induzir reações de hipersensibilidade em animais infectados. No entanto, apresenta baixa especificidade devido à ocorrência de reações cruzadas com outras micobactérias. Neste sentido, o objetivo desse trabalho foi produzir proteínas recombinantes (ESAT-6, PE13, PE5 e ESX-1 de Mycobacterium bovis e avaliá-las como antígenos em teste intradérmico utilizando Cavia porcellus como modelo, e verificar se as condições empregadas na purificação (nativa ou desnaturante interferem no desempenho antigênico dessas proteínas. As proteínas foram testadas em Cavia porcellus previamente sensibilizados com cepa M. bovis AN5 inativada, individualmente (160 µg ou combinadas na forma de um coquetel (40 µg cada. O coquetel de proteínas induziu reações de hipersensibilidade nos animais sensibilizados significativamente superiores (p=0,002 as observadas nos animais não sensibilizados, possibilitando diferenciação. No entanto, as proteínas isoladamente não foram capazes de promover essa diferenciação. As condições de solubilização e purificação influenciaram o desempenho antigênico da proteína ESAT-6, pois, quando produzida em condição desnaturante desencadeou reações inespecíficas nos animais não sensibilizados, enquanto que aquela produzida em condições nativas e aplicada em concentrações de 6, 12, 24 e 48µg induziu reações significativas apenas nos animais sensibilizados, confirmando o seu potencial como antígeno.

Ractopamina y nivel de proteína de la dieta, respuesta productiva y características de la carcasa de cuyes (Cavia porcellus)

OpenAIRE

García Leandro, Madeline Victoria

2017-01-01

Universidad Nacional Agraria La Molina. Escuela de Posgrado. Maestría en Nutrición El objetivo del presente trabajo fue determinar el efecto del Clorhidrato de Ractopamina (RAC) y el nivel de proteína de la dieta sobre la respuesta productiva y características de la carcasa de cuyes (Cavia porcellus). Se emplearon 96 cuyes machos de 49 días de edad que se distribuyeron en 24 pozas. Cada poza fue una unidad experimental con cuatro cuyes. Se les administró seis dietas con dos niveles de RAC ...

Effet de Panicum maximum sur la productivité des femelles primipares durant le cycle de reproduction chez le cobaye (Cavia porcellus L.

Directory of Open Access Journals (Sweden)

Danho, M.

2012-01-01

Full Text Available Effect of Panicum maximum on Productivity of Primiparous Females during Reproduction Cycle in Guinea Pigs (Cavia porcellus L.. In Ivory Coast, Guinea pigs reared for meat (Cavia porcellus L. are mainly fed with Panicum maximum. To assess the effect of the latter during pregnancy and lactation (RC of these animals, primiparous dams were fed ad libitum, Panicum maximum alone during the RC (MOD1 or associated with pellets for rabbits during lactation (MOD2, or associated with pellets for rabbits during the last part of the pregnancy period and the lactation (MOD3, or associated with pellets for rabbits during the entire RC (MOD4. The number of corpora lutea per female was 1.3 ± 0.5 and 2.0 ± 0.0 respectively for MOD1 and MOD4. No pre-embryonic mortality was recorded. The mean weight of the young guinea pigs of MOD1 (54.7 ± 10. g was only 55% of that of MOD4 (98.6 ± 13.6 g. At weaning, the average weight gain of young guinea pigs of MOD1 (40.5 ± 22.2 g represented a third of those obtained with other diets that did not significantly differ. At the end of RC, the weight gain of dams was 17 ± 13.3% for MOD1 compared to 50% for MOD2, MOD3 and MOD4. Feeding Panicum maximum alone induces chronic malnutrition which in turn is responsible of the low ovulation rate and reduced growth in guinea pig breeding.

Detection of all Chlamydophila and Chlamydia spp. of veterinary interest using species-specific real-time PCR assays.

Science.gov (United States)

Pantchev, Alexandra; Sting, Reinhard; Bauerfeind, Rolf; Tyczka, Judith; Sachse, Konrad

2010-12-01

The aim of the present study was to analyse the occurrence of chlamydiae in several mammalian host species. Clinical samples that previously tested positive in a Chlamydiaceae-specific real-time PCR were retested using six species-specific real-time PCR assays to identify the chlamydial species involved. Chlamydophila (Cp.) abortus was the agent most frequently found in cattle, sheep, horses, goats, and pigs. Detection in cattle of Cp. psittaci (11% of samples) and Chlamydia (C.) suis (9%), as well as Cp. psittaci in a goat sample was somewhat unexpected. DNA of two different chlamydiae was identified in 56 (12.7%) of 440 samples tested. Cp. felis was the predominant species found in cats, while in guinea pigs and rabbits only Cp. caviae was detected. Interestingly, the latter two pathogens were also identified in samples from dogs. The data show that mixed chlamydial infections are not rare and suggest an extended host range of individual species. Copyright © 2009 Elsevier Ltd. All rights reserved.

Characterization of fetal growth by repeated ultrasound measurements in the wild guinea pig (Cavia aperea).

Science.gov (United States)

Schumann, K; Guenther, A; Göritz, F; Jewgenow, K

2014-08-01

Fetal growth during pregnancy has previously been studied in the domesticated guinea pig (Cavia aperea f. porcellus) after dissecting pregnant females, but there are no studies describing the fetal growth in their wild progenitor, the wild guinea pig (C aperea). In this study, 50 pregnancies of wild guinea pig sows were investigated using modern ultrasound technique. The two most common fetal growth parameters (biparietal diameter [BPD] and crown-rump-length [CRL]) and uterine position were measured. Data revealed similar fetal growth patterns in the wild guinea pig and domesticated guinea pig in the investigated gestation period, although they differ in reproductive milestones such as gestation length (average duration of pregnancy 68 days), average birth weight, and litter mass. In this study, pregnancy lasted on average 60.2 days with a variance of less than a day (0.96 days). The measured fetal growth parameters are strongly correlated with each (R = 0.91; P guinea pig. Copyright © 2014 Elsevier Inc. All rights reserved.

Species Distribution and Prevalence of Putative Virulence Factors in Mesophilic Aeromonas spp. Isolated from Fresh Retail Sushi

Directory of Open Access Journals (Sweden)

Sunniva Hoel

2017-05-01

Full Text Available Aeromonas spp. are ubiquitous bacteria that have received increasing attention as human pathogens because of their widespread occurrence in food, especially seafood and vegetables. The aim of this work was to assess the species identity and phylogenetic relationship of 118 Aeromonas strains isolated from fresh retail sushi from three producers, and to characterize the isolates with respect to genetic and phenotypic virulence factors. We also evaluate the potential hazard associated with their presence in ready-to-eat seafood not subjected to heat treatment. Mesophilic Aeromonas salmonicida was most prevalent (74%, followed by A. bestiarum (9%, A. dhakensis (5%, A. caviae (5%, A. media (4%, A. hydrophila (2%, and A. piscicola (1%. All isolates were considered potentially pathogenic due to the high prevalence of genes encoding hemolysin (hlyA (99%, aerolysin (aerA (98%, cytotoxic enterotoxin (act (86%, heat-labile cytotonic enterotoxin (alt (99%, and heat-stable cytotonic enterotoxin (ast (31%. The shiga-like toxins 1 and 2 (stx-1 and stx-2 were not detected. Moreover, there was heterogeneity in toxin gene distribution among the isolates, and the combination of act/alt/hlyA/aerA was most commonly detected (63%. β-hemolysis was species-dependent and observed in 91% of the isolates. All A. media and A. caviae strains were non-hemolytic. For isolates belonging to this group, lack of hemolysis was possibly related to the absence of the act gene. Swimming motility, linked to adhesion and host invasion, occurred in 65% of the isolates. Partial sequencing of the gyrB gene demonstrated its suitability as a genetic marker for Aeromonas species identification and for assessment of the phylogenetic relationship between the isolates. The gyrB sequence divergence within a given species ranged from 1.3 to 2.9%. A. bestiarum, A. salmonicida, and A. piscicola were the most closely related species; their sequences differed by 2.7–3.4%. The average gyrB sequence

Congenital malformations caused by Stryphnodendron fissuratum (Leg. Mimosoideae) in guinea pigs (Cavia porcellus).

Science.gov (United States)

Macedo, Josenaldo S; Rocha, Brena P; Colodel, Edson M; Freitas, Sílvio H; Dória, Renata G S; Riet-Correa, Franklin; Evêncio-Neto, Joaquim; Mendonça, Fábio S

2015-11-01

The aim of this study was to evaluate the toxicity of Stryphnodendron fissuratum pods in guinea pigs (Cavia porcellus) and test the hypothesis that this plant has teratogenic effects. Thus, sixteen guinea pigs were randomly divided into four groups of four animals each. Groups 10, 20 and 40 consisted of guinea pigs that received commercial food that contained crushed pods of S. fissuratum at concentrations of 10, 20 and 40 g/kg, respectively, during the period of organogenesis. Control group consisted of guinea pigs under the same management conditions that did not receive crushed pods of S. fissuratum in their food. In all experimental groups, the main clinical signs of poisoning consisted of anorexia, prostration, absence of vocalizations, alopecia, diarrhea, and abortions within the adult guinea pigs. Those that did not abort gave birth to weak, malnourished pups, some of which had fetal malformations. The main teratogenic changes consisted of eventration, arthrogryposis, amelia of the forelimbs, anophthalmia, microphthalmia, anotia and agnathia. The reductions in the number of offspring and the malformations observed in the experimental groups suggest that S. fissuratum affects fetal development and is teratogenic. Copyright © 2015 Elsevier Ltd. All rights reserved.

Combination of Aloe vera and xenograft induction on decreasing of NF-kb of tooth extraction socket preservation in Cavia cobaya

Directory of Open Access Journals (Sweden)

Utari Kresnoadi

2014-03-01

Full Text Available Background: Tooth extraction can naturally cause inflammation triggering osteoclast proliferation and alveolar bone resorption. Preservation of the tooth extraction sockets is needed for patients in order to reduce alveolar bone resorption risks. Aloe vera is known to have anthraquinones components, namely Aloin, Aloe emedin, and barbaloin, considered as anti-inflammation. Therefore, to overcome the inflammation, the role of NF-kb is very significant to decrease nuclear factor kappa b (NF-kb. As a result, inflammation risks will be decreased. Purpose: The study was aimed to determine the induction effect of combination of Aloe vera and XCB into tooth extraction sockets to reduce inflammation by reducing NF-kb expression, osteoclasts and osteoblasts. Methods: Forty-eight Cavia cobaya were divided into eight groups, each group consisted of six animals. The mandibular incisors of those Cavia cobaya were extracted and induced with either PEG, XCB, Aloe vera, or the combination of Aloe vera + XCB. Those animals were sacrificed on day 7 and day 30 after the extraction. Then immunohistochemical and histopathology examinations were conducted to observe NF-kb expression, osteoblasts and osteoclasts. Results: It was known that in group induced with the combination of Aloe vera and xenograft concelous bovine, the growth of osteoblasts was high, while NF-kb expression and osteoclasts reduced. Conclusion: It can be concluded that the induction of the combination of Aloe vera and XCB into the tooth extraction sockets can reduce NF-kb expression and osteoclast, as a result, alveolar bone resorption risks decrease, and osteoblast increase.Latar belakang: Trauma mekanis akibat pencabutan gigi asli menyebabkan keradangan. Keradangan memicu proliferasi osteoklas sehingga menyebabkan resorpsi tulang alveolararis. Pada pembuatan gigi tiruan, resorpsi tulang alveolar yang terjadi, sangat tidak diinginkan, sebab resorpsi tulang alveolar mengurangi keberhasilan

Intake, selection, digesta retention, digestion and gut fill of two coprophageous species, rabbits (Oryctolagus cuniculus) and guinea pigs (Cavia porcellus), on a hay-only diet.

Science.gov (United States)

Franz, R; Kreuzer, M; Hummel, J; Hatt, J-M; Clauss, M

2011-10-01

A colonic separation mechanism (CSM) is the prerequisite for the digestive strategy of coprophagy. Two different CSM are known in small herbivores, the 'wash-back' CSM of lagomorphs and the 'mucous-trap' CSM of rodents. Differences between these groups in their digestive pattern when fed exclusively hay were investigated in six rabbits (Oryctolagus cuniculus) and six guinea pigs (Cavia porcellus). Intake, digestibility (by total faecal collection), solute and particle mean retention times (MRT, using Co-EDTA and Cr-mordanted fibres) were measured. Rabbits selected less fibrous parts of the hay than guinea pigs, leaving orts with higher content of neutral detergent fibre [NDF; 721 ± 21 vs. 642 ± 31 g/kg dry matter (DM) in guinea pigs]. They also expressed a lower NDF digestibility (0.44 ± 0.10 vs. 0.55 ± 0.05 of total), a similar particle MRT (15 ± 3 vs. 18 ± 6 h), a longer solute MRT (51 ± 9 vs. 16 ± 4 h), and a lower calculated dry matter gut fill (19.6 ± 4.7 vs. 29.7 ± 4.1 g DM/kg body mass) than guinea pigs (p bacterial matter from the colonic digesta plug than the 'mucous-trap' CSM found in the guinea pigs. Related to metabolic body mass, rabbits therefore need a less capacious colon for their CSM where a more efficient bacteria wash-out is reflected in the lower fibre digestibility. A lighter digestive tract could contribute to a peculiarity of lagomorphs: their ability to run faster than other similar-sized mammals. © 2010 Blackwell Verlag GmbH.

Temperature Preference in IAF Hairless and Hartley Guinea Pigs (Cavia porcellus).

Science.gov (United States)

Kleven, Gale A; Joshi, Prianca

2016-03-01

The Hairless strain of guinea pigs (Cavia porcellus) is the result of a spontaneous recessive mutation first identified at the Institute Armand Frappier (IAF) in 1978. Despite the longstanding availability of this strain, little is known about its thermoregulatory behavior. The aim of this study was to determine temperature preference in Hartley and Hairless guinea pigs by observing each strain in a ring-shaped apparatus containing a nonlinear temperature gradient. Temperatures were maintained by separately controlled heating mats lining the apparatus. Set point temperatures ranged from 24 to 38 °C. Guinea pigs (Hartley female, Hairless female, and Hairless male guinea pigs; n = 8 each group) were placed either singly or in pairs at 1 of the 8 randomized starting points within the apparatus. Subjects were observed for 30 min and coded for location within the temperature gradient by both frequency and duration. When placed singly in the apparatus, all 3 groups spent more time in the 30 °C zones. However, when placed as pairs with a cagemate, Hartley female guinea pigs spent more time in the cooler range of temperatures from 24 to 30 °C, whereas Hairless guinea pigs preferred a range of 30 to 38 °C. These results confirm a temperature preference of 30 ± 2 °C for both Hartley and Hairless guinea pigs when singly housed. However, data from the paired housing condition suggest that context plays an important role in thermoregulatory behavior.

Transmissão do Trypanosoma cruzi em três gerações de Cavia porcellus sem a participação de triatomíneos

Directory of Open Access Journals (Sweden)

Ítalo A. Sherlock

1976-02-01

Full Text Available Foi verificada a transmissão sucessiva do T. cruzi em três gerações da cobaia Cavia porcellus sem a participação de triatomíneos. Embora não fosse determinado qual das vias, se placentária, leite, excreções ou contágio direto pelo qual o protozoário foi transmitido para os descendentes, chama-se atenção para a importância da manutenção de reservatórios da Doença de Chagas, mesmo na ausência de vetores invertebrados.

Investigation Into the Humaneness of Slaughter Methods for Guinea Pigs (Cavia porcelus) in the Andean Region.

Science.gov (United States)

Limon, Georgina; Gonzales-Gustavson, Eloy A; Gibson, Troy J

2016-01-01

Guinea pigs (Cavia porcelus) are an important source of nonhuman animal protein in the Andean region of South America. Specific guidelines regarding the welfare of guinea pigs before and during slaughter have yet to be developed. This study critically assessed the humaneness of 4 different stunning/slaughter methods for guinea pigs: cervical neck dislocation (n = 60), electrical head-only stunning (n = 83), carbon dioxide (CO2) stunning (n = 21), and penetrating captive bolt (n = 10). Following cervical neck dislocation, 97% of guinea pigs had at least 1 behavioral or cranial/spinal response. Six percent of guinea pigs were classified as mis-stunned after electrical stunning, and 1% were classified as mis-stunned after captive bolt. Increased respiratory effort was observed during CO2 stunning. Apart from this finding, there were no other obvious behavioral responses that could be associated with suffering. Of the methods assessed, captive bolt was deemed the most humane, effective, and practical method of stunning guinea pigs. Cervical neck dislocation should not be recommended as a slaughter method for guinea pigs.

Evaluation of Pain Assessment Techniques and Analgesia Efficacy in a Female Guinea Pig (Cavia porcellus) Model of Surgical Pain

Science.gov (United States)

Oliver, Vanessa L; Athavale, Stephanie; Simon, Katherine E; Kendall, Lon V; Nemzek, Jean A; Lofgren, Jennifer L

2017-01-01

Guinea pigs (Cavia porcellus) are a frequently used species in research, often involving potentially painful procedures. Therefore, evidence-based recommendations regarding analgesia are critically needed to optimize their wellbeing. Our laboratory examined the efficacy of carprofen and extended-release (ER) buprenorphine, alone and as a multimodal combination, for relieving postsurgical pain in guinea pigs. Animals were assessed by using evoked (mechanical hypersensitivity), nonevoked (video ethogram, cageside ethogram, time-to-consumption test), and clinical (weight loss) measurements for 96 h during baseline, anesthesia–analgesia, and hysterectomy conditions. In addition, ER buprenorphine was evaluated pharmacologically. Guinea pigs treated with a single analgesic showed increased mechanical sensitivity for at least 96 h and indices of pain according to the video ethogram for as long as 8 h, compared with levels recorded during anesthesia–analgesia. In contrast, animals given both analgesics demonstrated increased mechanical sensitivity and behavioral evidence of pain for only 2 h after surgery compared with anesthesia–analgesia. The cageside ethogram and time-to-consumption tests failed to identify differences between conditions or treatment groups, highlighting the difficulty of identifying pain in guinea pigs without remote observation. Guinea pigs treated with multimodal analgesia or ER buprenorphine lost at least 10% of their baseline weights, whereas weight loss in carprofen animals was significantly lower (3%). Plasma levels for ER buprenorphine exceeded 0.9 ng/mL from 8 to 96 h after injection. Of the 3 analgesia regimens evaluated, multimodal analgesia provided the most effective pain control in guinea pigs. However the weight loss in the ER buprenorphine–treated animals may need to be considered during analgesia selection. PMID:28724492

Consommation de quelques graminées tropicales par le cobaye [Cavia porcellus : performances et détermination des surfaces nécessaires à l'entretien d'un cheptel

Directory of Open Access Journals (Sweden)

Kouonmenioc, J.

2000-01-01

Full Text Available Consumption of some Tropical Grass Forages by Guinea-Pigs (Cavia porcellus ; Performances and Determination of Required Areas to Maintain a Flock. In order to develop the mini-livestock sector in the agricultural production systems, investigations have been carried out on five tropical grass forages in the Cameroon forest humid zone in order to show the impact of organic manure on the total biomass production for guinea-pigs feeding. Adequate forages area required to maintain a family size guinea-pigs flock was determined. These various forage species compared in terms of growth showed positive response to guinea pigs manure. Panicum maximum with a 8 weeks regrowth which yielded 5146.7 kg DM/ha (on increase of 1500.8 kg seemed to be the best forage in terms of production. Positive response of these grasses to organic manure from guinea-pigs farming may direct the farmer not to use the manure not only for food and cash cropping, but also to sustain forage production. For a 8 weeks cutting frequency the adequate forage area to maintain a family flock size of 20 animals ranges from 90.8 m2 x2 for Brachiaria ruziziensis to 152.9 m2 x 2 for Trypsacum laxum.

Skin diseases in companion guinea pigs (Cavia porcellus): a retrospective study of 293 cases seen at the Veterinary Medical Teaching Hospital, University of California at Davis (1990-2015).

Science.gov (United States)

White, Stephen D; Guzman, David Sanchez-Migallon; Paul-Murphy, Joanne; Hawkins, Michelle G

2016-10-01

Guinea pigs (Cavia porcellus) are popular companion animals with reported skin diseases, but most reports are accessed from textbooks or review articles. To document skin diseases and their prevalence in companion guinea pigs in northern California, USA, and to investigate predilections for the most common conditions over a 25 year period. Two hundred and ninety three guinea pigs from the hospital population met inclusion criteria. A retrospective study was performed by searching computerized medical records seen at the Veterinary Medical Teaching Hospital (VMTH), School of Veterinary Medicine, University of California from 1 January 1990 to 31 July 2015 using key words relevant to dermatology. Of the 580 guinea pigs seen at the VMTH, 50% (293) had skin disease. Of the 293 cases, 154 (52%) presented for nondermatological reasons. Guinea pigs with skin disease were significantly older than those without skin disease (P = 0.0002); females with skin disease were more likely to have cystic ovaries (P = 0.0203), although these were not always associated with alopecia. Pododermatitis and infestation with Trixacarus caviae or lice were the most common skin diseases. Ivermectin or selamectin was used for ectoparasite treatment. Abscesses unassociated with pododermatitis were the most common nodules. Benign follicular tumours were the most common neoplasm. Despite the frequent mention of dermatophytosis in the veterinary literature, only two cases of Trichophyton mentagrophytes were diagnosed. Cutaneous conditions in companion guinea pigs in the USA are common. Clinicians should include a dermatological examination when examining these rodents regardless of the reason for presentation. © 2016 ESVD and ACVD.

Effect of chest wall radiotherapy in different manners using tissue equivalent bolus on skin and lung of cavia cobayas

International Nuclear Information System (INIS)

Huang Wei; Qu Yaqin; Song Xiangfu; Liu Shixin; Jia Xiaojing; Guo He; Yang Lei

2009-01-01

Objective: To probe the influence of electron beam radiotherapy in different manners using different tissue equivalent boluses on skin and lung. Methods: Adult female cavia cobayas were randomly divided into four groups as control group, half-time with bolus group, half-time with bolus group and without bolus group. Acute-irradiation animal models were established using electron beam in different manners with or without 0.5 cm tissue equivalent bolus. Pathological changes in lung, hair vesicle and fibroblast cell count were analyzed 40 clays after irradiation. Results: The radiation dermatitis in the group with bolus was slighter than that of the group without bolus, but the radiation pneumonia was reverse. With bolus, the radiation dermatitis of haft-time group was slighter than that of full-time group. The injury repair of half-time group was more active than full-time group. Conclusions: The treatment of haft-time bolus could protect lung without serious skin complications. (authors)

[Dermatophyte colonization on guinea pigs (Cavia porcellus) kept in pet stores. First report from Santiago, Chile].

Science.gov (United States)

Thomson, Pamela; Monsalves, Pamela; Maier, Liliana; Silva, Víctor

2015-01-01

Dermatophytes are pathogenic fungi that can be present in the flora of mammals, such as dogs, cats and rodents, which can be a source and transmission vehicle to other hosts, including humans. In Chile, there is a steady increase of acquiring guinea pigs (Cavia porcellus) as pets, with no local studies on their colonization by dermatophytes. To determine the presence of dermatophytes on clinically healthy guinea pigs, kept in pet stores in Santiago, Chile. A total of 52 clinically healthy animals were studied using the method by Mariat and Tapia (1966). The specimen culture and identification of the dermatophytes were performed using classical mycological procedures. Four guinea pigs (7.7%) out of 52 were colonized by dermatophytes, and were identified as Trichophyton mentagrophytes (3 cases) and Trichophyton verrucosum (one case). This study shows, for the first time in Chile, that guinea pigs can be colonized by dermatophytes, which should alert administrators of pet stores, veterinarians and physicians, to keep this in mind when purchasing or looking after this type of pet in a veterinary office. Copyright © 2013 Revista Iberoamericana de Micología. Published by Elsevier Espana. All rights reserved.

Prevalence, species differentiation, haemolytic activity, and antibiotic susceptibility of aeromonads in untreated well water

Directory of Open Access Journals (Sweden)

Khalifa Sifaw Ghenghesh

2001-02-01

Full Text Available The use of untreated water for drinking and other activities have been associated with intestinal and extraintestinal infections in humans due to Aeromonas species. In the present study aeromonads were isolated from 48.7% of 1,000 water samples obtained from wells and other miscellaneous sources. Aeromonas species were detected in 45% of samples tested in spring, 34.5% in summer, 48% in autumn and 60% of samples tested in winter. Speciation of 382 strains resulted in 225 (59% being A. hydrophila, 103 (27% A. caviae, 42 (11% A. sobria and 11 (3% atypical aeromonads. Of 171 Aeromonas strains tested for their haemolytic activity, 53%, 49%, 40% and 37% were positive in this assay using human, horse, sheep and camel erythrocytes respectively. The results obtained indicate that potentially enteropathogenic Aeromonas species are commonly present in untreated drinking water obtained from wells in Libya (this may also apply to other neighbouring countries which may pose a health problem to users of such water supplies. In addition, ceftriaxone and ciprofloxacin are suitable drugs that can be used in the treatment of Aeromonas-associated infections, particularly in the immunocompromised, resulting from contact with untreated sources of water.

Study on postpartum estrus of guinea pigs (Cavia cobaya using Anredera cordifolia leaf extract

Directory of Open Access Journals (Sweden)

D. Wijayanti

2017-04-01

Full Text Available Aim: The purpose of this study was to determine the postpartum estrus cycle of guinea pigs (Cavia cobaya using Anredera cordifolia leaf extract. Materials and Methods: Materials used were 8 males and 8 females of C. cobaya with body weight ranged 400-450 g. Mating ratio applied was 1:1. Treatments given were 0, 10, 50 and 90 mg of A. cordifolia leaf extract/head, designated as T0, T1, T2 and T3, respectively. Two females were subjected for each treatment. A. cordifolia leaf extract was administered orally from 10 days prepartum to 10 days postpartum. Observation of mating behavior, vulva morphology, and vaginal smear preparation was done in the afternoon for 10 days subsequence postpartum. Data were analyzed by univariate method and descriptively. Results: The results showed that the addition of A. cordifolia leaf extract 50 mg orally could accelerate the time of postpartum estrus based on the average frequency of mating behavior consisting of behavioral approach, allow the buck to sniffing her, mating positions, standing heat, lordosis position, and copulation. During estrus, vulva morphology was red color, had much mucus and no thin membrane covering vagina. There were a lot of superficial cells on vagina. Conclusion: The best treatment to accelerate occurring postpartum estrus was the addition of A. cordifolia leaf extract as many as 50 mg/head weight (T2 orally.

The influence of Aloe vera and xenograft XCB toward of bone morpho protein 2 BMP2 expression and amount of osteoblast of alveolar bone induced into tooth extraction sockets Cavia cobaya

Directory of Open Access Journals (Sweden)

Utari Kresnoadi

2014-12-01

Full Text Available Tooth extraction can cause inflammation leading to alveolar ridge resorption. In addition, prominent ridge has crucial role for making denture su-ccessfully. Thus, socket preservation is needed to prevent greater alveolar ridge resorption. An innovative material, a combination of Aloe vera and xe-nograft (XCB, is then considered as a biogenic stimulator that can reduce inflammation, as a result, the growth of alveolar bone is expected to be impro-ved. This research is aimed to prove whether the mixture of Aloe vera and xenograft can stimulate BMP2 and increase osteoblasts. Forty-eight Cavia co-baya animals were divided into eight groups each of which consisted of six animals. The mandibular incisors of those Cavia cobaya animals were then extracted and filled with PEG as Group Control, XCB as Group XCB, Aloe vera as Group Aloe vera, and a combination of Aloe vera +XCB as Group Aloe vera +XCB. Next, the first four groups were sacrificed seven days after extraction, and the second four groups were sacrificed 30 days after extrac-tion. And then, immunohistochemical and histopathology examinations were conducted to examine BMP2 expression and osteoblasts. Based on the re-sult known that the mixture of Aloe vera and xenograft can increase BMP2 expression and amount of osteoblasts. It can be concluded that the mixture of Aloe vera and xenograft can increase BMP2 expression and amount of osteoblast cel . It can be used as an alternative material to increase the growth of alveolar bone after extraction.

Salivary Gland Extract Modulates the Infection of Two Leishmania enriettii Strains by Interfering With Macrophage Differentiation in the Model of Cavia porcellus

Directory of Open Access Journals (Sweden)

Lucélia J. Pinheiro

2018-05-01

Full Text Available The subgenus Mundinia includes several Leishmania species that have human and veterinary importance. One of those members, Leishmania Mundinia enriettii was isolated from the guinea pig Cavia porcellus in the 1940s. Several histopathological studies have already been performed in this species in the absence of salivary gland extract (SGE, which are determinant and the early and future events of the infection. Our main hypothesis is that SGE could differentially modulate the course of the lesion and macrophage differentiation caused by avirulent and virulent L. enriettii strains. Here, the C. porcellus nasal region was infected using needles with two strains of L. enriettii (L88 and Cobaia in the presence/absence of SGE and followed for 12 weeks. Those strains vary in terms of virulence, and their histopathological development was characterized. Some L88-infected animals could develop ulcerated/nodular lesions, whereas Cobaia strain developed non-ulcerated nodular lesions. Animals experimentally inoculated developed a protuberance and/or lesion after the 4th and 5th weeks of infection. Macroscopically, the size of lesion in L88-infected animals was smaller in the presence of SGE. Remarkable differences were detected microscopically in the presence of SGE for both strains. After the 6th and 7th weeks, L88-infected animals were heavily parasitized with an intense inflammatory profile bearing amastigotes and pro-inflammatory cells compared to those infected by Cobaia strain. Morphometry analysis revealed that L1+ macrophages were abundant in the L88 infection, but not in the Cobaia infection. In the presence of SGE, an increased CD163+ macrophage infiltrate by both strains was detected. Interestingly, this effect was more pronounced in Cobaia-infected animals. This study showed the role of SGE during the course of L. enriettii (strains L88 and Cobaia infection and its role in modulating macrophage attraction to the lesion site. SGE decreased L1

Glycosylation at the fetomaternal interface in hemomonochorial placentae from five widely separated species of mammal

DEFF Research Database (Denmark)

Jones, Carolyn J. P.; Carter, Anthony M.; Aplin, John D.

2007-01-01

sapiens) and guinea pig (Cavia porcellus)--in order to assess whether evolutionary convergence to the hemomonochorial state is accompanied by a similar convergence of glycan expression. Placentae from 2 E. telfairi, 3 C. crocuta, 1 D. novemcinctus, 4 womenand 1 C. porcellus were fixed and processed...

Emendation of the family Chlamydiaceae: proposal of a single genus, Chlamydia, to include all currently recognized species.

Science.gov (United States)

Sachse, Konrad; Bavoil, Patrik M; Kaltenboeck, Bernhard; Stephens, Richard S; Kuo, Cho-Chou; Rosselló-Móra, Ramon; Horn, Matthias

2015-03-01

The family Chlamydiaceae (order Chlamydiales, phylum Chlamydiae) comprises important, obligate intracellular bacterial pathogens of humans and animals. Subdivision of the family into the two genera Chlamydia and Chlamydophila has been discussed controversially during the past decade. Here, we have revisited the current classification in the light of recent genomic data and in the context of the unique biological properties of these microorganisms. We conclude that neither generally used 16S rRNA sequence identity cut-off values nor parameters based on genomic similarity consistently separate the two genera. Notably, no easily recognizable phenotype such as host preference or tissue tropism is available that would support a subdivision. In addition, the genus Chlamydophila is currently not well accepted and not used by a majority of research groups in the field. Therefore, we propose the classification of all 11 currently recognized Chlamydiaceae species in a single genus, the genus Chlamydia. Finally, we provide emended descriptions of the family Chlamydiaceae, the genus Chlamydia, as well as the species Chlamydia abortus, Chlamydia caviae and Chlamydia felis. Copyright © 2015 Elsevier GmbH. All rights reserved.

Dieta de Leopardus colocolo (Carnivora: Felidae en la Reserva Nacional de Junín, Junín, Perú

Directory of Open Access Journals (Sweden)

Ursula Fajardo

2014-05-01

Full Text Available Este estudio caracteriza la dieta de Leopardus colocolo en los alrededores del lago Junín, en el centro del Perú, a partir de los restos de las presas presentes en 43 heces. El origen de las heces del predador se determinó a partir del ADN mitocondrial de las células epiteliales intestinales adheridas a la superficie de las heces, utilizando como marcador la región de control. Los restos de las presas fueron identificados utilizando literatura especializada y la comparación con especímenes de colección, identificando un total of 14 ítems alimenticios pertenecientes a mamíferos de las familias Cricetidae (6, Chinchillidae (1 y Caviidae (1 y aves de las familias Anatidae (3 y Rallidae (2, y un grupo de aves no identificadas (1. Los roedores fueron el principal componente de la dieta de L. colocolo, en frecuencia y biomasa, seguido por las aves. Entre los ítems alimenticios consumidos, el roedor cricétido pequeño Calomys sp. fue el más frecuente; sin embargo, el mayor aporte de biomasa relativa fue proporcionado por el roedor mediano Cavia tschudii. La amplitud de nicho obtenida fue baja (Bsta= 0.17, indicando una dieta especializada. Nuestros resultados confirman que, como ocurre con la mayoría de felinos pequeños neotropicales, L. colocolo es un predador especializado en la captura de vertebrados, principalmente mamíferos pequeños. No se registró variación estacional en la dieta y el análisis de las clases de edad de los roedores cricétidos mostró que los adultos fueron los más consumidos. Se infiere que L. colocolo tiene un patrón de actividad diurno y nocturno.

Clinical manifestations of bacteremia caused by Aeromonas species in southern Taiwan.

Directory of Open Access Journals (Sweden)

Hung-Jen Tang

Full Text Available This study is conducted to investigate the clinical characteristics of patients with bacteremia caused by Aeromonas species.Patients with bacteremia caused by Aeromonas species during the period 2009 to 2013 were identified from a computerized database of a regional hospital in southern Taiwan. The medical records of these patients were retrospectively reviewed.A total of 91 patients with bacteremia due to Aeromonas species were identified. In addition to 16 (17.6% primary bacteremia, the most common source of secondary infection is peritonitis (n = 27, 29.7%, followed by biliary tract infection (n = 18, 19.8%, and SSTI (n = 12, 13.2%, pneumonia (n = 9, 9.9%, catheter-related bloodstream infection (n =  5, 5.5%, and genitourinary tract infection (n = 4, 4.4%. A. hydrophila (n = 35, 38.5% was the most common pathogen, followed by A. veronii biovar sobria (n = 31, 34.1%, A. caviae (n = 14, 15.4%, and A. veronii biovar veronii (n = 9, 9.9%. Forty-three (47.3% patients were classified as healthcare-associated infections (HCAI causes by Aeromonas species, and patients with HCAI were more likely to have cancer, and receive immunosuppressant than patients with community-acquired bacteremia. The overall outcomes, including rate of ICU admission, acute respiratory failure, and mortality were 33.3%, 28.6%, and 23.1%, respectively. Multivariate analysis showed that the in-hospital day mortality was significantly associated only with underlying cancer (P <.001, and initial shock (P <.001.Aeromonas species should be considered one of the causative pathogens of healthcare-associated bacteremia, especially in immunocompromised patients. In addition, it can be associated with high fatality. Cancer and initial shock were the poor prognostic factors.

Rationalité économique et objectifs de gestion de la production de cobayes (Cavia porcellus L. en zones tropicales

Directory of Open Access Journals (Sweden)

Ndébi, G.

2015-01-01

Full Text Available Economic Rationality and Production Management Goals of Guinea Pigs (Cavia porcellus L. in Tropical Zones. The economic productivity of guinea pig in tropical environment was assessed from one hundred and ninety-seven pairs of measures related to reproductive female and weaning weights per litter reared in-door at the Research and Experimental Farm of the University of Dschang between February 2012 and March 2013. An econometric model of linear regression was developed to take into account the main factors affecting the relative weight productivity index at the weaning age of each gestating female. The main results reveal that the economic productivity of guinea pigs in tropical zone, already of a substantial level, could be even more improved by taking into account the main factors of variability. The analysis thus put into evidence that the relative importance of female reproductive weight; the litter size, and the total weight of the kids at weaning are factors having significant effects on the relative weight productivity index of the guinea pig. However, in linking the female weight to economic productivity, the study led to an irrational management of the reproductive herd and put in evidence that the decrease in productivity observed in guinea pig is mostly attributable to the fattening of the female.

Guinea pig (Cavia porcellus) drinking preferences: do nipple drinkers compensate for behaviourally deficient diets?

Science.gov (United States)

Balsiger, A; Clauss, M; Liesegang, A; Dobenecker, B; Hatt, J-M

2017-10-01

When offered diets with hay ad libitum, rabbits (Oryctolagus cuniculus) clearly prefer open dishes over nipple drinkers, but whether this preference also applies in guinea pigs (Cavia porcellus) is unsure. We tested the drinker preference of 10 guinea pigs when offered open dishes (OD) and nipple drinkers (ND) simultaneously and measured the amount of water consumed by each animal on four different diets (grass hay 100%, or as 10% of intake on diets of fresh parsley, seed mix or pelleted complete feed, respectively) on either of the drinking systems. All animals ingested the hay portion of the combined diets first. The amount of water consumed differed significantly between individual animals. Animals drank less water on parsley than on the other diets. Nine of 10 animals clearly preferred ND when having a choice, and eight of these drank more when on ND only. The difference between the drinking systems was not consistent across all diets: on hay, similar amounts of water were drunk when on OD or ND only. Differences in water intake were reflected in urine production. Because drinking from ND in guinea pigs involves jaw movements similar to those in chewing, the results could suggest that when motivation for oral processing behaviour is not satisfied by a diet, animals may respond in using ND beyond physiological water necessity. Whereas physiological water requirements are probably better investigated with other drinking systems due to a possible overestimation when using ND, offering ND to pet guinea pigs most likely offers a form of behavioural enrichment that at the same time may increase water intake and hence act as prophylaxis against urolithiasis. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.

Mystacial Whisker Layout and Musculature in the Guinea Pig (Cavia porcellus): A Social, Diurnal Mammal.

Science.gov (United States)

Grant, Robyn A; Delaunay, Mariane G; Haidarliu, Sebastian

2017-03-01

All mammals (apart from apes and humans) have whiskers that make use of a similar muscle arrangement. Whisker specialists, such as rats and mice, tend to be nocturnal and arboreal, relying on their whisker sense of touch to guide exploration around tree canopies at night. As such, nocturnal arboreal rodents have many whiskers that are organised into a grid-like pattern, and moved using a complex array of muscles. Indeed, most arboreal, nocturnal mammals tend to have specialised whiskers that are longer and arranged in a dense, regular grid, compared with terrestrial, diurnal mammals. The guinea pig diverged early from murid rodents (around 75 million years ago), and are ground-dwelling, diurnal animals. It would be predicted that, as a terrestrial mammal, they may have less whiskers and a reduced muscle architecture compared to arboreal, nocturnal rodents. We examined the mystacial whisker layout, musculature and movement capacity of Guinea pig (Cavia porcellus) whiskers and found that they did indeed have a disorganized whisker layout, with a fortification around the eye area. In addition, there was a reduction in musculature, especially in the intrinsic muscles. Despite guinea pigs not cyclically moving their whiskers, the mystacial musculature was still very similar to that of murid rodents. We suggest that the conserved presence of whisker layout and musculature, even in visual mammals such as primates and guinea pigs, may indicate that whiskers still play an important role in these animals, including protecting the eyes and being involved in tactile social behaviors. Anat Rec, 300:527-536, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Evaluating the clinical and physiological effects of long term ultraviolet B radiation on guinea pigs (Cavia porcellus).

Science.gov (United States)

Watson, Megan K; Stern, Adam W; Labelle, Amber L; Joslyn, Stephen; Fan, Timothy M; Leister, Katie; Kohles, Micah; Marshall, Kemba; Mitchell, Mark A

2014-01-01

Vitamin D is an important hormone in vertebrates. Most animals acquire this hormone through their diet, secondary to exposure to ultraviolet B (UVB) radiation, or a combination thereof. The objectives for this research were to evaluate the clinical and physiologic effects of artificial UVB light supplementation on guinea pigs (Cavia porcellus) and to evaluate the long-term safety of artificial UVB light supplementation over the course of six months. Twelve juvenile acromelanic Hartley guinea pigs were randomly assigned to one of two treatment groups: Group A was exposed to 12 hours of artificial UVB radiation daily and Group B received only ambient fluorescent light for 12 hours daily. Animals in both groups were offered the same diet and housed under the same conditions. Blood samples were collected every three weeks to measure blood chemistry values, parathyroid hormone, ionized calcium, and serum 25-hydroxyvitamin D3 (25-OHD3) levels. Serial ophthalmologic examinations, computed tomography scans, and dual energy x-ray absorptiometry scans were performed during the course of the study. At the end of the study the animals were euthanized and necropsied. Mean ± SD serum 25-OHD3 concentrations differed significantly in the guinea pigs (pguinea pigs to UVB radiation long term significantly increased their circulating serum 25-OHD3 levels, and that this increase was sustainable over time. Providing guinea pigs exposure to UVB may be an important husbandry consideration that is not currently recommended.

Ingestion et digestibilité in vivo du Panicum maximum associé à trois compléments: tourteau de Jatophra curcas, tourteau de coton Gossypium hirsutum et Euphorbia heterophylla chez le cobaye Cavia porcellus L

Directory of Open Access Journals (Sweden)

N'G.D.V. Kouakou

2010-01-01

Full Text Available The Intake and the in vivo Digestibility of Panicum maximum Associated with Three Supplements: Jatophra curcas Cake, Gossypium hirsutum Cake and Euphorbia heterophylla (Euph in Guinea Pigs (Cavia porcellus L.. The intake and the in vivo digestibility of Panicum maximum associated with three supplements: Jatropha curcas cake, Gossypium hirsutum cake and Euphorbia heterophylla (Euph in guinea pigs (Cavia porcellus L. pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported. In order used weed Euphorbia heterophylla in guinea pigs diet, comparative study of the intake and the in vivo digestibility of four treatments, Panicum maximum (Pan, Panicum maximum and Gossypium hirsutum cake (Pancoton, Panicum maximum and Euphorbia heterophylla (Paneuph and Panicum maximum and Jatropha curcas cake (Panjatro, in male guinea pigs were conducted in Yamoussoukro (Ivory Coast. The means of the intake (g DM/d were 64.8 ± 12.5; 74.3 ± 12.9; 73.7 ± 17.8 and 69.1 ± 12.3 respectively for Pan, Pancoton, Paneuph and Panjatro. Pancoton and Paneuph were significantly better ingested than Pan and Panjatro. Euphorbia heterophylla was significantly better ingested than the other two supplements (P< 0.05 and the mean daily weight gain with its association with Panicum maximum of 3.1 ± 0.6 g/d. The rate of substitution of Panicum maximum by Euphorbia heterophylla was nearly to one (1. The apparent digestibility coefficients (ADC for dry (68.0 ± 10.5% and organic matter (84.1 ± 5.2% of Paneuph were significantly higher (P< 0.05 than the ADC's for the other three treatments. Given the nutritional value of Euphorbia heterophylla in guinea pigs, its association with Panicum maximum could be popularized wherever its abundance has been reported.

GRAMÍNEAS TROPICALES EN EL ENGORDE DE CUYES MEJORADOS SEXADOS (Cavia porcellus Linnaeus EN LA ZONA DE LA MANÁ

Directory of Open Access Journals (Sweden)

Adolfo Sánchez Laiño

2009-06-01

Full Text Available La investigación de gramíneas tropicales en el engorde de cuyes en la zona de La Maná. La misma que persiguió los siguientes objetivos: Incrementar los índices productivos en cuyes (Cavia porcellus Linnaeus peruanos mejorados bajo el efecto del consumo del pasto saboya (Panicum maximun Jack, hojas de maíz (Zea mays y caña de azúcar (Saccharum officinarum L en la zona de La Maná, y determinar la rentabilidad de los tratamientos. Se utilizaron 48 cuyes peruanos mejorados sexados de 35 días de edad con un peso promedio de 305 g. Se aplicó un arreglo factorial 2 (sexo x 3 (gramíneas con cuatro repeticiones, dentro de un (DBCA. Para las comparaciones entre medidas se utilizó la prueba de Tukey al 0.05% de probabilidad. Para obtener la rentabilidad de los tratamientos se utilizó la Relación Beneficio–Costo. Se evaluó el: consumo de gramíneas (g, consumo de alimento (g, ganancia de peso (g, conversión alimenticia, peso vivo (g y rendimiento a la canal (%. Los cuyes machos presentaron el mayor (P0.05 no se vio afectado por el efecto del consumo de gramíneas. La mayor rentabilidad la registraron los cuyes machos alimentados con hoja de maíz + balanceado (52.4%.

Leucocyte profile and offspring production of guinea pig (Cavia cobaya given Anredera cordifolia leaf extract

Directory of Open Access Journals (Sweden)

D. Wijayanti

2018-03-01

Full Text Available The objective of this study was to determine leucocyte and offspring production of guinea pig (Cavia cobaya giving Anredera cordifolia leaf extract. Materials used were female 16 heads of guinea pig with body weight of 425g. The treatments were an extract of A. cordifolia leaf at doses of 0, 10, 50 and 90 mg/head, designated as T0, T1, T2 and T3, respectively. A. cordifolia leaf extract was administered orally from 10 days prepartum to 10 days postpartum. Blood was taken at 10 days prepartum and 10 days postpartum. Total birth of the offspring was observed. Data were analyzed by analysis of variance and if there was effect of treatment, then continued with Duncan multiple range test and Chi-Square test for fetal production between the given A. cordifolia leaf extract and control. The result showed that there was no significant difference for 10 days prepartum after addition of A cordifolia leaf extract treatment. The postpartum treated showed a total 50 mg/head level increaed for monocytes than that of level 0, 10 and 90 mg/head. Ten days postpartum treatment showed the total increase for leucocyte and monocytes total were 50 and 90 mg/head, respectively compared to 10 mg/head level. Total lymphocyte of 90 mg/head increased compared to level 10 and 50 mg/head. The highest total neutrophil as found at level of 50 mg/head which increased compared to the level of 0 and 10 mg/head. ProvisioningA. cordifolialeaf extract at doses level of 50 and 90 mg/head could increase litter size (P<0.05; χ2=9.267 and decreased offspring mortality (P<0.05; χ2=6.4. In conclusion, by giving 50 mg/head A. cordifolia leaf extract could increase leucocyte profile and offspring production of guinea pig.

Experimental infection in Cavia porcellus by infected Amblyomma ovale nymphs with Rickettsia sp. (Atlantic rainforest strain).

Science.gov (United States)

Brustolin, Joice Magali; da Silva Krawczak, Felipe; Alves, Marta Elena Machado; Weiller, Maria Amélia; de Souza, Camila Lopes; Rosa, Fábio Brum; Cadore, Gustavo Cauduro; Dos Anjos Lopes, Sônia Terezinha; Labruna, Marcelo Bahia; Vogel, Fernanda Silveira Flores; de Avila Botton, Sônia; Sangioni, Luís Antônio

2018-03-01

This study describes experimental infection of guinea pigs (Cavia porcellus) infested with naturally infected Amblyomma ovale nymphs with Rickettsia sp. (Atlantic rainforest strain), and the capacity of A. ovale nymphs to transmit this bacterium. Twenty-six guinea pigs were divided into the following groups: G1, 10 animals infested with uninfected A. ovale nymphs; G2, 10 animals infested with nymphs infected with Rickettsia sp. (Atlantic rainforest strain); and G3, 6 animals without tick infestation. Blood samples were taken 7, 14, 21, and 28 days post-infestation for serological and hematological tests. For histopathological analysis and rickettsial DNA detection, fragments of the spleen, lung, brain, and liver were harvested after euthanasia. The average feeding period for nymphs was 6.6 days for G1 and 6 days for G2. Hemolymph and PCR assays, performed to detect the causative agent in ticks, indicated that in G1, all ticks were negative, and in G2, all nymphs were positive by PCR and 80% (8/10) was positive by hemolymph tests. The only clinical change was skin scarring at the tick attachment site. Hematological parameters indicated leukopenia and total plasma protein (TPP) increased with decreased platelets in G1. In G2, leukocytosis, neutrophilia, monocytosis, an increase in platelets, and reduced TPP were observed. Only G2 guinea pigs were seroconverted (80%; 8/10). Histopathology tests indicated mild, diffuse hemosiderosis and mild, multifocal, follicular hyperplasia in the spleen. Molecular analysis did not detect Rickettsia sp. DNA in C. porcellus tissues. We demonstrated the capacity of A. ovale nymphs to transmit Rickettsia sp. (Atlantic rainforest strain) to guinea pigs.

Use of recombinant human thyroid-stimulating hormone for evaluation of thyroid function in guinea pigs (Cavia porcellus).

Science.gov (United States)

Mayer, Jörg; Wagner, Robert; Mitchell, Mark A; Fecteau, Kellie

2013-02-01

To evaluate the effects of administration of recombinant human (rh) thyroid-stimulating hormone (TSH) for evaluation of thyroid function in euthyroid guinea pigs (Cavia porcellus). Prospective, experimental study. 10 healthy, sexually intact, pet guinea pigs (approx 1 year of age). Guinea pigs were given rhTSH (100 μg, IM); plasma thyroxine concentrations were determined prior to and 3 and 4 hours after rhTSH injection. The animals were housed in 2 groups on the basis of sex and fed different commercial maintenance diets according to their husbandry. There was no significant difference in thyroxine concentrations between males and females before or after rhTSH injection. There was also no difference between thyroxine concentrations at 3 versus 4 hours after rhTSH injection. There was a significant difference between thyroxine concentrations before (median, 9.05 nmol/L [0.70 μg/dL]; 10% to 90% range, 7.39 to 16.99 nmol/L [0.57 to 1.32 μg/dL]) and after (mean ± SD, 23.95 ± 4.2 nmol/L) rhTSH injection. Euthyroid guinea pigs had plasma thyroxine concentrations of at least 7.30 nmol/L (0.57 μg/dL) and an increase of at least 2.6 times prestimulation thyroxine concentrations at 3 or 4 hours after stimulation. The results suggested that rhTSH administered IM can be used for the TSH stimulation testing in guinea pigs. We suggest thyroxine concentration in a euthyroid guinea pig should at least double 3 to 4 hours after rhTSH injection.

Aeromonas spp. isolated from oysters (Crassostrea rhizophorea from a natural oyster bed, Ceará, Brazil Aeromonas spp. isoladas de ostras (Crassostrea rhizophorea coletadas em um criadouro natural, Ceará, Brazil

Directory of Open Access Journals (Sweden)

Norma S. Evangelista-Barreto

2006-06-01

Full Text Available Between April and October 2002, thirty fortnightly collections of oysters (Crassostrea rhizophorea from a natural oyster bed at the Cocó River estuary in the Sabiaguaba region (Fortaleza, Ceará, Brazil were carried out, aiming to isolate Aeromonas spp. strains. Oyster samples were submitted to the direct plating (DP and the presence/absence (P/A methods. Aeromonas were identified in 15 (50% samples analyzed by the DP method and in 13 (43% analyzed by the P/A method. A. caviae, A. eucrenophila, A. media, A. sobria, A. trota, A. veronii bv. sobria, A. veronii bv. veronii and Aeromonas sp. were isolated. The predominant species was A. veronii (both biovars, which was identified in 13 (43% samples, followed by A. media in 11 (37% and A. caviae in seven (23%. From the 59 strains identified, 28 (48% presented resistance to at least one of the eight antibiotics tested.Foram realizadas 30 coletas quinzenais, entre abril e outubro de 2002, de ostras (Crassostrea rhizophorea de um criadouro natural, no estuário do rio Cocó (Fortaleza/Ceará/Brasil, objetivando-se isolar cepas de Aeromonas spp. As amostras de ostras foram submetidas aos métodos de plaqueamento direto (PD e presença/ausência (P/A. Foram identificadas Aeromonas em 15 (50% amostras analisadas pelo método PD e em 13 (43% pelo método P/A. Foram isoladas: A. caviae, A. eucrenophila, A. media, A. sobria, A. trota, A. veronii bv. sobria, A. veronii bv. veronii e Aeromonas sp. A espécie predominate foi A. veronii (ambos biovars, identificada em 13 (43% amostras, seguida de A. media em 11 (37% e A. caviae em 7 (23%. Das 59 cepas identificadas, 28 (48% apresentaram resistência a pelo menos um, dos oitos antibióticos testados.

Potential enterotoxicity and antimicrobial resistance pattern of Aeromonas species isolated from pet turtles and their environment.

Science.gov (United States)

Wimalasena, S H M P; Shin, Gee-Wook; Hossain, Sabrina; Heo, Gang-Joon

2017-05-23

To investigate the potential enterotoxicity and antimicrobial resistance of aeromonads from pet turtles as a risk for human infection, one hundred and two Aeromonas spp. were isolated from the feces, skin and rearing environments of pet turtles and identified by biochemical and gyrB sequence analyses. Aeromonas enteropelogenes was the predominant species among the isolates (52.9%) followed by A. hydrophila (32.4%), A. dharkensis (5.9%), A. veronii (4.9%) and A. caviae (3.9%). Their potential enterotoxicities were evaluated by PCR assays for detecting genes encoding cytotoxic enterotoxin (act) and two cytotonic enterotoxins (alt and ast). 75.8% of A. hydrophila isolates exhibited the act + /alt + /ast + genotype, whereas 94.4% of A. enteropelogenes isolates were determined to be act - /alt - /ast - . In an antimicrobial susceptibility test, most isolates were susceptible to all tested antibiotics except amoxicillin, ampicillin, cephalothin, chloramphenicol and tetracycline. Non-susceptible isolates to penicillins (ampicillin and amoxicillin) and fluoroquinolones (ciprofloxacin and norfloxacin) were frequently observed among the A. enteropelogenes isolates. Few isolates were resistant to imipenem, amikacin, ceftriaxone and cefotaxime. Collectively, these results suggest that pet turtles may pose a public health risk of infection by enterotoxigenic and antimicrobial resistant Aeromonas strains.

Etude comparative de la digestibilité in vivo de l'herbe de guinée (Panicum maximum Jacq.) associée aux feuilles et tiges de patate douce (Ipomoea batatas (L.) Lam) (régime Panipo) ou à l'herbe de lait (Euphorbia heterophylla L.) (régime Paneuph) chez le lapin (Oryctolagus cuniculus L.) et le cobaye (Cavia porcellus L.)

OpenAIRE

Kouakou, NGDV.; Kouba, M.; Thys, E.

2016-01-01

Digestibility of Guinea grass (Panicum maximum Jacq.) associated with sweet potato leaves and stems (Ipomoea batatas (L.) Lam) (Panipo diet) or poison milk (Euphorbia heterophylla L.) (Paneuph diet) in Rabbits (Oryctolagus cuniculus L.) and in Guinea Pigs (Cavia porcellus L.). A comparative study of in vivo digestibility of Guinea grass (Panicum maximum Jacq.) associated with sweet potato leaves and stems (Ipomoea batatas (L.) Lam) (Panipo diet) or with poison milk (Euphorbia heterophylla L.)...

Multi locus sequence typing of Chlamydia reveals an association between Chlamydia psittaci genotypes and host species.

Science.gov (United States)

Pannekoek, Yvonne; Dickx, Veerle; Beeckman, Delphine S A; Jolley, Keith A; Keijzers, Wendy C; Vretou, Evangelia; Maiden, Martin C J; Vanrompay, Daisy; van der Ende, Arie

2010-12-02

Chlamydia comprises a group of obligate intracellular bacterial parasites responsible for a variety of diseases in humans and animals, including several zoonoses. Chlamydia trachomatis causes diseases such as trachoma, urogenital infection and lymphogranuloma venereum with severe morbidity. Chlamydia pneumoniae is a common cause of community-acquired respiratory tract infections. Chlamydia psittaci, causing zoonotic pneumonia in humans, is usually hosted by birds, while Chlamydia abortus, causing abortion and fetal death in mammals, including humans, is mainly hosted by goats and sheep. We used multi-locus sequence typing to asses the population structure of Chlamydia. In total, 132 Chlamydia isolates were analyzed, including 60 C. trachomatis, 18 C. pneumoniae, 16 C. abortus, 34 C. psittaci and one of each of C. pecorum, C. caviae, C. muridarum and C. felis. Cluster analyses utilizing the Neighbour-Joining algorithm with the maximum composite likelihood model of concatenated sequences of 7 housekeeping fragments showed that C. psittaci 84/2334 isolated from a parrot grouped together with the C. abortus isolates from goats and sheep. Cluster analyses of the individual alleles showed that in all instances C. psittaci 84/2334 formed one group with C. abortus. Moving 84/2334 from the C. psittaci group to the C. abortus group resulted in a significant increase in the number of fixed differences and elimination of the number of shared mutations between C. psittaci and C. abortus. C. psittaci M56 from a muskrat branched separately from the main group of C. psittaci isolates. C. psittaci genotypes appeared to be associated with host species. The phylogenetic tree of C. psittaci did not follow that of its host bird species, suggesting host species jumps. In conclusion, we report for the first time an association between C. psittaci genotypes with host species.

Multi locus sequence typing of Chlamydia reveals an association between Chlamydia psittaci genotypes and host species.

Directory of Open Access Journals (Sweden)

Yvonne Pannekoek

2010-12-01

Full Text Available Chlamydia comprises a group of obligate intracellular bacterial parasites responsible for a variety of diseases in humans and animals, including several zoonoses. Chlamydia trachomatis causes diseases such as trachoma, urogenital infection and lymphogranuloma venereum with severe morbidity. Chlamydia pneumoniae is a common cause of community-acquired respiratory tract infections. Chlamydia psittaci, causing zoonotic pneumonia in humans, is usually hosted by birds, while Chlamydia abortus, causing abortion and fetal death in mammals, including humans, is mainly hosted by goats and sheep. We used multi-locus sequence typing to asses the population structure of Chlamydia. In total, 132 Chlamydia isolates were analyzed, including 60 C. trachomatis, 18 C. pneumoniae, 16 C. abortus, 34 C. psittaci and one of each of C. pecorum, C. caviae, C. muridarum and C. felis. Cluster analyses utilizing the Neighbour-Joining algorithm with the maximum composite likelihood model of concatenated sequences of 7 housekeeping fragments showed that C. psittaci 84/2334 isolated from a parrot grouped together with the C. abortus isolates from goats and sheep. Cluster analyses of the individual alleles showed that in all instances C. psittaci 84/2334 formed one group with C. abortus. Moving 84/2334 from the C. psittaci group to the C. abortus group resulted in a significant increase in the number of fixed differences and elimination of the number of shared mutations between C. psittaci and C. abortus. C. psittaci M56 from a muskrat branched separately from the main group of C. psittaci isolates. C. psittaci genotypes appeared to be associated with host species. The phylogenetic tree of C. psittaci did not follow that of its host bird species, suggesting host species jumps. In conclusion, we report for the first time an association between C. psittaci genotypes with host species.

Phenotypic and Genetic Diversity of Aeromonas Species Isolated from Fresh Water Lakes in Malaysia.

Directory of Open Access Journals (Sweden)

Wei Ching Khor

Full Text Available Gram-negative bacilli of the genus Aeromonas are primarily inhabitants of the aquatic environment. Humans acquire this organism from a wide range of food and water sources as well as during aquatic recreational activities. In the present study, the diversity and distribution of Aeromonas species from freshwater lakes in Malaysia was investigated using glycerophospholipid-cholesterol acyltransferase (GCAT and RNA polymerase sigma-factor (rpoD genes for speciation. A total of 122 possible Aeromonas strains were isolated and confirmed to genus level using the API20E system. The clonality of the isolates was investigated using ERIC-PCR and 20 duplicate isolates were excluded from the study. The specific GCAT-PCR identified all isolates as belonging to the genus Aeromonas, in agreement with the biochemical identification. A phylogenetic tree was constructed using the rpoD gene sequence and all 102 isolates were identified as: A. veronii 43%, A. jandaei 37%, A. hydrophila 6%, A. caviae 4%, A. salmonicida 2%, A. media 2%, A. allosaccharophila 1%, A. dhakensis 1% and Aeromonas spp. 4%. Twelve virulence genes were present in the following proportions--exu 96%, ser 93%, aer 87%, fla 83%, enolase 70%, ela 62%, act 54%, aexT 33%, lip 16%, dam 16%, alt 8% and ast 4%, and at least 2 of these genes were present in all 102 strains. The ascV, aexU and hlyA genes were not detected among the isolates. A. hydrophila was the main species containing virulence genes alt and ast either present alone or in combination. It is possible that different mechanisms may be used by each genospecies to demonstrate virulence. In summary, with the use of GCAT and rpoD genes, unambiguous identification of Aeromonas species is possible and provides valuable data on the phylogenetic diversity of the organism.

Anatomia do fígado de fetos de Guinea pig em final de gestação (Cavia porcellus [Linnaeus, 1758

Directory of Open Access Journals (Sweden)

Mariangela Toledo Barbino

2011-08-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n3p97 Desenvolveu-se este trabalho com o objetivo de descrever a anatomia do fígado de fetos de Guinea pig (Cavia porcellus [Linnaeus, 1758] em final de gestação e obter caracterizações anatômicas que possam fundamentar e auxiliar na compreensão da fisiologia da circulação fetal. Coletou-se os fetos de 3 fêmeas em final de gestação, os quais foram dissecados e retirado o fígado. Estes foram analisados, descritos e fotodocumentados macroscopicamente, por microscopia de luz em coloração HE e por microscopia eletrônica de varredura. O fígado dos fetos apresenta coloração castanho avermelhada e sua divisão em lobos é nitidamente observada, assim como a presença da vesícula biliar.  O fígado divide-se em lobo lateral esquerdo, lobo medial esquerdo, lobo lateral direito, lobo medial direito, lobo quadrado e lobo caudado com processos papilar e caudado Através da microscopia de luz, observa-se o tecido intensamente vascularizado sendo que, a porção esquerda do fígado recebe o sangue oriundo da placenta pela veia umbilical, e a porção direita é irrigada pela veia porta. Através desses resultados pode-se concluir que os fetos de Guinea pig possuem estruturas semelhantes anatomicamente aos de outras espécies de mamíferos.

ANÁLISIS PROXIMAL, PERFIL DE ÁCIDOS GRASOS DE LAS VÍSCERAS DEL CUY (Cavia porcellus Y SU USO POTENCIAL EN ALIMENTACIÓN ANIMAL

Directory of Open Access Journals (Sweden)

A. S. Parra

2016-01-01

Full Text Available Con el fin de evaluar el valor nutritivo de materias primas no convencionales en la elaboración de concentrado animal, de bajo coste y que no compitan con la alimentación del hombre, en la presente investigación se analizó el contenido nutricional de las vísceras abdominales de cuy (Cavia porcellus y de su harina, usando análisis proximal y perfil de ácidos grasos mediante cromatografía de gases. Se compararon estos resultados con materias primas convencionales como la harina de pescado y con vísceras de diversos animales. Los resultados obtenidos indican que la harina de vísceras de cuy puede competir con harinas de diversas procedencias dadas sus cualidades nutricionales (58% proteína, 28% grasa, 4% cenizas; además, el alto contenido de grasa en las vísceras frescas (55% base seca está constituido principalmente ácidos grasos poliinsaturados tipo omega 3, 6 y 9, siendo relevante el contenido de ácido linolénico, ácidos grasos que en la dieta de los animales son escasos y de alto costo. Es posible concluir que los componentes nutricionales de las vísceras de cuy la convierten en una materia prima promisoria en alimentación animal, estimulando así el aprovechamiento de estos residuos.

Feasibility of same-day identification of members of the family Vibrionaceae by the API 20E system.

OpenAIRE

Overman, T L; Overley, J K

1986-01-01

Sixty isolates, comprising nine species of the family Vibrionaceae, were tested with the API 20E 5-h same-day procedure (Analytab Products, Plainview, N.Y.). Included were 27 Aeromonas hydrophila isolates, 10 Aeromonas sobria isolates, 7 Aeromonas caviae isolates, 3 Plesiomonas shigelloides isolates, 3 Vibrio alginolyticus isolates, 3 Vibrio cholerae isolates, 1 Vibrio fluvialis isolate, 5 Vibrio parahaemolyticus isolates, and 1 Vibrio vulnificus isolate. The 5-h profile numbers were specific...

CARACTERIZAÇÃO DE AEROMONAS SPP ISOLADAS DE AMOSTRAS DE OSTRAS E ÁGUA POR MÉTODO MICROBIOLÓGICO E MOLECULAR

Directory of Open Access Journals (Sweden)

Ana Carolina Miranda de Melo Silva

2014-09-01

Full Text Available This study aimed to isolate and identify Aeromonas bacteria from samples of oysters and water, by microbiological and molecular methods. Identification of Aeromonas was performed by the conventional method and by PCR and species characterization was performed by identification key Aerokey II and by RFLP-PCR of 16S rDNA. 59 (98.3% samples of oysters and 15 (75% samples of water contaminated by Aeromonas bacteria were identified. Of the 74 isolates of Aeromonas spp. obtained by microbiological analysis, 53 (71.62%, 38 (65.51% oyster samples and 15 (100% of water samples confirmed the characterization of the genus by molecular technique. As to biochemical species identification, 59.3% (n = 35 and 40.6% (n = 24 of isolates from Aeromonas sp. obtained from oyster samples were rated as A. hydrophila and A. caviae, respectively; and from isolates obtained from water samples, 60% (n = 9 were classified as A. hydrophila and 40% (n = 6 as A. caviae; however, only the A. hydrophila was confirmed by genetic sequencing. Regarding the classification by RFLP-PCR 16S rDNA, patterns of nonspecific bands were obtained, making it impossible to identify the species by this technique. The large number of oyester samples contaminated with Aeromonas spp. and identification of A. hydrophila, demonstrate that this mollusk might present a risk to consumer health, mainly because it is consumed raw and is to a potentially pathogenic micro-organism to humans.

Occurrence of potential pathogenic Aeromonas species in tropical seafood, aquafarms and mangroves off Cochin coast in South India

Directory of Open Access Journals (Sweden)

Alphonsa Vijaya Joseph

2013-12-01

Full Text Available Background: The genus Aeromonas include gram-negative, motile, facultative anaerobic, rod shaped and oxidase positive bacteria comprising several species, associated with the aquatic environment. Aeromonas species have been implicated in human pathogenesis and are linked with gastroenteritis, muscle infections, septicemia, and skin diseases. In fish they are renowned as enteric pathogens causing haemorrhagic septicemia, fin rot, soft tissue rot and furunculosis resulting in major die-offs and fish kills. Aim: This study reports the occurrence of potential pathogenic Aeromonas sp. in tropical seafood (Squids, Prawns and Mussels, aquafarms and mangroves of Cochin, Kerala, South India. Materials and Methods :Tropical seafood (Squid, Prawn and Mussel, sediment and water samples from aquafarms and associated mangroves were screened for Aeromonas contamination. The isolates were identified by 16S rDNA sequence analysis and subjected to morphological and biochemical characterization. Haemolytic assay was used for determining pathogenicity of the organisms. Antibiotic susceptibility against 12 antibiotics were performed and the MAR index was calculated. Results: A total of 134 isolates were recovered from the samples of which 15 were identified as Aeromonas species by 16S rDNA sequence analysis and were assigned to 5 species namely, A. hydrophila, A. enteropelogenes, A. caviae, A. punctataand A. aquarorium. Morphological, biochemical and phylogenetic analyses revealed relatedness and variability among the strains. All the isolates were haemolytic on blood agar indicating their pathogenicity. The isolates exhibited varying degrees of resistance to vancomycin (86.66%, ampicillin (46.66%, nalidixic acid (20%, tetracycline (6.66%, co-trimaxozole (6.66% and rifampicin (6.66% and were susceptible to antibiotics like gentamycin, streptomycin, trimethoprim, azithromycin, cefixime and chloramphenicol. 20% of Aeromonas sp. showed MAR index > 0.2 indicative of the

EFEK ANTIPIRETIK KOMBINASI EKSTRAK DAUN COCOR BEBEK (Kalanchoe pinnata L. DAN EKSTRAK DAUN TEMBELEKAN(Lantana camara L. PERS.TERHADAP MARMUT (Cavia porcellus DENGAN DEMAM YANG DIINDUKSI PEPTON

Directory of Open Access Journals (Sweden)

Heni Purwitasari

2017-03-01

Full Text Available Cocor Bebek (Kalanchoe pinnata L. is a medicinal plant that has been used as traditional medicine for long period, used to fight fever, but it empirically leaves of  Tembelekan (Lantana camara L. are also generally primarily used to treat fever. Research on the effects of the combination of Cocor Bebek’s leaf extract (Kalanchoe pinnata L. and the leaf extract of tembelekan (Lantana camara L. Pers on male guinea pig (Cavia porcellus is induced peptone 5% at a dose of 150 mg / kg body weight. With the aim to determine the effect of the combination and determine the effects of the most effective as an antipyretic. Extracts prepared by maceration method using ethanol 95%. Marmots were divided into 4 groups. Each guinea pig was induced using peptone 5%. The first group was given Na CMC as a negative control group 2nd given a combination of one dose combinations (50 + 720. Group 3 was given a second dose combination (100 + 720. Group-4 were given a 3-dose combination (150 + 720. Temperature measurement is carried out for 2 hours with a 30 minute interval. Data were analyzed temperature measurements were statistically analyzed using ANOVA (Analisys Of Variance. The research result was addressing, that the combination of extracts can reduce fever. The combination is most effective as an antipyretic is cocor duck leaf extract 50 mg and 720 mg tembelekan leaf extract (50 + 720.

Chlorinated and ultraviolet radiation -treated reclaimed irrigation water is the source of Aeromonas found in vegetables used for human consumption

Energy Technology Data Exchange (ETDEWEB)

Latif-Eugenín, Fadua; Beaz-Hidalgo, Roxana; Silvera-Simón, Carolina [Unidad de Microbiología, Facultad de Medicina y Ciencias de la Salud, IISPV, Universidad Rovira i Virgili, Reus (Spain); Fernandez-Cassi, Xavi [Departamento de Microbiología, Facultad de Biología, Universidad de Barcelona, Barcelona (Spain); Figueras, María J., E-mail: mariajose.figueras@urv.cat [Unidad de Microbiología, Facultad de Medicina y Ciencias de la Salud, IISPV, Universidad Rovira i Virgili, Reus (Spain)

2017-04-15

Wastewater is increasingly being recognized as a key water resource, and reclaimed water (or treated wastewater) is used for irrigating vegetables destined for human consumption. The aim of the present study was to determine the diversity and prevalence of Aeromonas spp. both in reclaimed water used for irrigation and in the three types of vegetables irrigated with that water. Seven of the 11 (63.6%) samples of reclaimed water and all samples of vegetables were positive for the presence of Aeromonas. A total of 216 Aeromonas isolates were genotyped and corresponded to 132 different strains that after identification by sequencing the rpoD gene belonged to 10 different species. The prevalence of the species varied depending on the type of sample. In the secondary treated reclaimed water A. caviae and A. media dominated (91.4%) while A. salmonicida, A. media, A. allosaccharophila and A. popoffii represented 74.0% of the strains in the irrigation water. In vegetables, A. caviae (75.0%) was the most common species, among which a strain isolated from lettuce had the same genotype (ERIC pattern) as a strain recovered from the irrigation water. Furthermore, the same genotype of the species A. sanarellii was recovered from parsley and tomatoes demonstrating that irrigation water was the source of contamination and confirming the risk for public health. - Highlights: • Reclaimed water (= treated wastewater) is used for the irrigation of vegetables. • Aeromonas was found in reclaimed water and irrigated vegetables with this water. • The prevalence of Aeromonas spp. varied between irrigation water and vegetables. • Epidemiological relationships were found between irrigation water and vegetables. • The water was the source of contamination which means a risk for the public health.

Chlorinated and ultraviolet radiation -treated reclaimed irrigation water is the source of Aeromonas found in vegetables used for human consumption

International Nuclear Information System (INIS)

Latif-Eugenín, Fadua; Beaz-Hidalgo, Roxana; Silvera-Simón, Carolina; Fernandez-Cassi, Xavi; Figueras, María J.

2017-01-01

Wastewater is increasingly being recognized as a key water resource, and reclaimed water (or treated wastewater) is used for irrigating vegetables destined for human consumption. The aim of the present study was to determine the diversity and prevalence of Aeromonas spp. both in reclaimed water used for irrigation and in the three types of vegetables irrigated with that water. Seven of the 11 (63.6%) samples of reclaimed water and all samples of vegetables were positive for the presence of Aeromonas. A total of 216 Aeromonas isolates were genotyped and corresponded to 132 different strains that after identification by sequencing the rpoD gene belonged to 10 different species. The prevalence of the species varied depending on the type of sample. In the secondary treated reclaimed water A. caviae and A. media dominated (91.4%) while A. salmonicida, A. media, A. allosaccharophila and A. popoffii represented 74.0% of the strains in the irrigation water. In vegetables, A. caviae (75.0%) was the most common species, among which a strain isolated from lettuce had the same genotype (ERIC pattern) as a strain recovered from the irrigation water. Furthermore, the same genotype of the species A. sanarellii was recovered from parsley and tomatoes demonstrating that irrigation water was the source of contamination and confirming the risk for public health. - Highlights: • Reclaimed water (= treated wastewater) is used for the irrigation of vegetables. • Aeromonas was found in reclaimed water and irrigated vegetables with this water. • The prevalence of Aeromonas spp. varied between irrigation water and vegetables. • Epidemiological relationships were found between irrigation water and vegetables. • The water was the source of contamination which means a risk for the public health.

Chlamydial plasmids and bacteriophages.

Science.gov (United States)

Pawlikowska-Warych, Małgorzata; Śliwa-Dominiak, Joanna; Deptuła, Wiesław

2015-01-01

Chlamydia are absolute pathogens of humans and animals; despite being rather well recognised, they are still open for discovery. One such discovery is the occurrence of extrachromosomal carriers of genetic information. In prokaryotes, such carriers include plasmids and bacteriophages, which are present only among some Chlamydia species. Plasmids were found exclusively in Chlamydia (C.) trachomatis, C. psittaci, C. pneumoniae, C. suis, C. felis, C. muridarum and C. caviae. In prokaryotic organisms, plasmids usually code for genes that facilitate survival of the bacteria in the environment (although they are not essential). In chlamydia, their role has not been definitely recognised, apart from the fact that they participate in the synthesis of glycogen and encode proteins responsible for their virulence. Furthermore, in C. suis it was evidenced that the plasmid is integrated in a genomic island and contains the tetracycline-resistance gene. Bacteriophages specific for chlamydia (chlamydiaphages) were detected only in six species: C. psittaci, C. abortus, C. felis, C. caviae C. pecorum and C. pneumoniae. These chlamydiaphages cause inhibition of the developmental cycle, and delay transformation of reticulate bodies (RBs) into elementary bodies (EBs), thus reducing the possibility of infecting other cells in time. Plasmids and bacteriophages can be used in the diagnostics of chlamydioses; although especially in the case of plasmids, they are already used for detection of chlamydial infections. In addition, bacteriophages could be used as therapeutic agents to replace antibiotics, potentially addressing the problem of increasing antibiotic-resistance among chlamydia.

Review of gastric torsion in eight guinea pigs (Cavia porcellus).

Science.gov (United States)

Nógrádi, Anna Linda; Cope, Iain; Balogh, Márton; Gál, János

2017-12-01

The authors present eight cases of gastric dilatation and volvulus (GDV) in guinea pigs from the Department and Clinic of Exotic Animal and Wildlife Medicine, University of Veterinary Medicine, Budapest, Hungary between 2012 and 2016. Seven animals were operated on and two survived. Gastric torsion has been noted in many mammalian species. Gastric volvulus has a high morbidity and high mortality rate with a guarded to poor prognosis in all of these species. How GDV develops is still not widely understood. Postmortem examinations, in both our cases and previously reported cases, have failed to reveal the exact causes of the gastric torsions. The aetiology of gastric torsion in guinea pigs is probably multifactorial. Feeding fewer meals per day, eating rapidly, decreased food particle size, exercise, stress after a meal, competition, age, and an aggressive or fearful temperament, are all likely and potential risk factors for GDV development in a similar fashion to dogs. Sex, breeding, dental diseases, anatomical abnormalities, pain and pregnancy may also be contributing factors.

Prevalence and resistance to antibiotics for Aeromonas species from retail fish in Malaysia.

Science.gov (United States)

Radu, Son; Ahmad, Noorlis; Ling, Foo Hooi; Reezal, Abdul

2003-03-25

A total of 87 market fish samples representing five types of fish were evaluated for the presence of Aeromonas spp. Of the samples examined, 69%, 55%, 11.5% and 2.3% harbored Aeromonas spp., A. veronii biovar sobria, A. hydrophila and A. caviae, respectively. The 60 isolated Aeromonas spp. strains were further examined for hemolytic activity, resistance to antimicrobial agents and presence of plasmids. Hemolytic activity varied widely among the isolated strains. Though all the isolates demonstrated resistance to three or more of the antibiotics tested, all were susceptible to ceptazidime. Thirty-four (56.7%) of the sixty isolates harbored plasmids, with sizes ranging from 2.3 to 15.7 kb. These results indicate that hemolytic, multiple antibiotic resistant and genetically diverse aeromonads are easily recovered from fish in this region.

Wild genius - domestic fool? Spatial learning abilities of wild and domestic guinea pigs

OpenAIRE

Sachser Norbert; Pickel Thorsten; Lewejohann Lars; Kaiser Sylvia

2010-01-01

Abstract Background Domestic animals and their wild relatives differ in a wide variety of aspects. The process of domestication of the domestic guinea pig (Cavia aperea f. porcellus), starting at least 4500 years ago, led to changes in the anatomy, physiology, and behaviour compared with their wild relative, the wild cavy, Cavia aperea. Although domestic guinea pigs are widely used as a laboratory animal, learning and memory capabilities are often disregarded as being very scarce. Even less i...

Guinea pigs experimentally infected with vaccinia virus replicate and shed, but do not transmit the virus Cobaias infectadas experimentalmente com vírus vaccínia replicam e excretam, porém não transmitem o vírus

Directory of Open Access Journals (Sweden)

Juliana Felipetto Cargnelutti

2012-06-01

Full Text Available The origin of vaccinia viruses (VACV associated with vesicular disease in cattle and humans in Southeast Brazil remains uncertain, yet the role of wild species in virus transmission has been suggested. This study investigated the susceptibility and transmission potential by guinea pigs (Cavia porcellus - phylogenetically close to an abundant Brazilian rodent (Cavia aperea - to two VACV strains (P1V and P2V isolated from an outbreak of cutaneous disease in horses in Southern Brazil. Eight guinea pigs inoculated intranasally with P1V and P2V (10(6 TCID50.ml-1 did not develop clinical signs, but six animals shed virus in nasal secretions (day 1 to 9 post-inoculation - pi, developed viremia (between days 1 and 10 pi and seroconverted to VACV. In spite of virus replication and shedding, the virus was not transmitted to sentinel animals by direct or indirect contact (aerosols or through food and water contaminated with virus. These results demonstrate that, in spite of replicating and shedding the virus, guinea pigs do not transmit the virus upon experimental inoculation. This finding makes unlikely a possible participation of related species in VACV maintenance and transmission in nature.A origem dos vírus vaccínia (VACV, envolvidos em surtos de doença vesicular em bovinos e humanos no Sudeste do Brasil, permanece desconhecida, e a participação de espécies silvestres na manutenção e transmissão do vírus tem sido sugerida. O objetivo deste trabalho foi investigar a susceptibilidade e o potencial de transmissão por cobaias (Cavia porcellus - filogeneticamente relacionada a uma espécie de roedor, conhecido por preá (Cavia aperea, bastante abundante no país - a duas cepas de VACV (P1V e P2V isoladas de um surto de doença cutânea em equinos no Rio Grande do Sul. Oito cobaias inoculadas pela via intranasal com uma mistura das amostras P1V e P2V (10(6 DICC50.ml-1 não apresentaram sinais clínicos, porém seis animais excretaram o vírus nas

Potential of pomegranate fruit extract (Punica granatum Linn.) to increase vascular endothelial growth factor and platelet-derived growth factor expressions on the post-tooth extraction wound of Cavia cobaya.

Science.gov (United States)

Nirwana, Intan; Rachmadi, Priyawan; Rianti, Devi

2017-08-01

Pomegranates fruit extracts have several activities, among others, anti-inflammatory, antibacterial, and antioxidants that have the main content punicalagin and ellagic acid. Pomegranate has the ability of various therapies through different mechanisms. Vascular endothelial growth factor (VEGF) function was to form new blood vessels produced by various cells one of them was macrophages. Platelet-derived growth factor (PDGF) was a growth factor proven chemotactic, increased fibroblast proliferation and collagen matrix production. In addition, VEGF and PDGF synergize in their ability to vascularize tissues. The PDGF function was to stabilize and regulate maturation of new blood vessels. Activities of pomegranate fruit extract were observed by measuring the increased of VEGF and PDGF expression as a marker of wound healing process. To investigate the potential of pomegranate extracts on the tooth extraction wound to increase the expression of VEGF and PDGF on the 4 th day of wound healing process. This study used 12 Cavia cobaya , which were divided into two groups, namely, the provision of 3% sodium carboxymethyl cellulose and pomegranate extract. The 12 C. cobaya would be executed on the 4 th day, the lower jaw of experimental animals was taken, decalcified about 30 days. The expression of VEGF and PDGF was examined using immunohistochemical techniques. The differences of VEGF and PDGF expression were evaluated statistically using t-test. Statistically analysis showed that there were significant differences between control and treatment groups (p<0.05). Pomegranate fruit extract administration increased VEGF and PDGF expression on post-tooth extraction wound.

Survey of endoparasites in pet guinea pigs in Italy.

Science.gov (United States)

d'Ovidio, Dario; Noviello, Emilio; Ianniello, Davide; Cringoli, Giuseppe; Rinaldi, Laura

2015-03-01

Little information is available on the occurrence of endoparasites in pet guinea pigs (Cavia porcellus). The purpose of this study was to evaluate the prevalence of intestinal parasites in cavies kept as pets in southern Italy. Fresh fecal samples were randomly collected from 60 guinea pigs housed in pet shops or privately owned. All fecal samples were processed using the FLOTAC pellet technique to identify and count helminthic eggs/larvae and protozoan cysts/oocysts. In addition, the specimens were analyzed also by the Remel Xpect® Giardia/Cryptosporidium immunoassay. Intestinal parasites were detected in 19 out of 60 guinea pigs (31.7 %). Paraspidodera uncinata eggs were found in 13.3 % (8/60) of the rodents examined, Nippostrongylus-like eggs in 10 % (6/60), and finally Eimeria caviae oocysts were found in 10 % (6/60) of the animals. In one case, both E. caviae oocysts and P. uncinata eggs were found. None of the samples was positive for Cryptosporidium or Giardia. To the authors' knowledge, this is the first survey of endoparasites in pet guinea pigs in Italy.

Hemoglobin affinity in Andean rodents

Directory of Open Access Journals (Sweden)

HRVOJ OSTOJIC

2002-01-01

Full Text Available Blood hemoglobin oxygen affinity (P50 was measured in three Andean species and in the laboratory rat (control, all raised near sea level. Chinchilla lanigera (Molina, 1792 has an altitudinal habitat range from low Andean slopes up to 3000 m., while Chinchilla brevicaudata (Waterhouse, 1848 has an altitudinal range from 3000 to 5000 m. The laboratory type guinea pig, wild type guinea pig (Cavia porcellus, (Waterhouse, 1748, and laboratory rat (Rattus norvegicus were also raised at sea level. The Andean species had high hemoglobin oxygen affinities (low P50 compared with the rat. Chinchilla brevicaudata had a higher affinity than Chinchilla lanigera. The wild type guinea pig had a higher affinity than the laboratory type. As has been shown in other species, this is another example of an inverse correlation between the altitude level and the P50 values. This is the first hemoglobin oxygen affinity study in Chinchilla brevicaudata.

Effect of mangosteen peel extract combined with demineralized freezed-dried bovine bone xenograft on osteoblast and osteoclast formation in post tooth extraction socket

Directory of Open Access Journals (Sweden)

Utari Kresnoadi

2016-12-01

Full Text Available Background: Tooth extraction, a common procedure in dentistry, can cause bone resorption during socket healing. Therefore, it is important to perform socket preservation procedure to maintain alveolar bone. Providing a combination of mangosteen peel extract with demineralized freezed-dried bovine bone xenograft (DFDBBX in tooth extraction socket was expected to accelerate alveol bone formation. Purpose: This study aims to determine the effect of mangosteen peel extract combined with DFDBBX introduced into the socket of post tooth extraction on the formation of osteoblasts and osteoclasts. Method: Twenty-eight (28 Cavia cobayas were divided into four groups. Extraction to the lower left incisor of Cavia cobaya was performed. The extraction socket was filled with 25 gram of PEG (group I as a control, active materials consisted of mangosteen peel extract and DFDBBX 0.5% (group II, active materials consisted of mangosteen peel extract and DFDBBX 1% (group III, and active materials consisted of mangosteen peel extract and DFDBBX 2% (group IV. After thirty days, those Cavia cobayas were sacrificed. By using HE on Histopatological examination, the number of osteoblasts and osteoclasts were measured by light microscope with 400 times of magnification. The statistical analysis was then performed using oneway Anova & TukeyHSD test. Result: The component active materials consisted of mangosteen peel extract and DFDBBX 2% had the most significant results related to the formation of osteoblasts and osteoclasts. Conclusion: Mangosteen peel extract combined with DFDBBX can increase osteoblasts and decrease osteoclasts in the socket of tooth extraction in Cavia cobaya. The combination of mangosteen peel extract and DFDBBX 2% is the most effective material in increasing osteoblast and decreasing osteoclast.

Immunoglobulin Genomics in the Guinea Pig (Cavia porcellus)

Science.gov (United States)

Guo, Yongchen; Bao, Yonghua; Meng, Qingwen; Hu, Xiaoxiang; Meng, Qingyong; Ren, Liming; Li, Ning; Zhao, Yaofeng

2012-01-01

In science, the guinea pig is known as one of the gold standards for modeling human disease. It is especially important as a molecular and cellular biology model for studying the human immune system, as its immunological genes are more similar to human genes than are those of mice. The utility of the guinea pig as a model organism can be further enhanced by further characterization of the genes encoding components of the immune system. Here, we report the genomic organization of the guinea pig immunoglobulin (Ig) heavy and light chain genes. The guinea pig IgH locus is located in genomic scaffolds 54 and 75, and spans approximately 6,480 kb. 507 VH segments (94 potentially functional genes and 413 pseudogenes), 41 DH segments, six JH segments, four constant region genes (μ, γ, ε, and α), and one reverse δ remnant fragment were identified within the two scaffolds. Many VH pseudogenes were found within the guinea pig, and likely constituted a potential donor pool for gene conversion during evolution. The Igκ locus mapped to a 4,029 kb region of scaffold 37 and 24 is composed of 349 Vκ (111 potentially functional genes and 238 pseudogenes), three Jκ and one Cκ genes. The Igλ locus spans 1,642 kb in scaffold 4 and consists of 142 Vλ (58 potentially functional genes and 84 pseudogenes) and 11 Jλ -Cλ clusters. Phylogenetic analysis suggested the guinea pig’s large germline VH gene segments appear to form limited gene families. Therefore, this species may generate antibody diversity via a gene conversion-like mechanism associated with its pseudogene reserves. PMID:22761756

Antimicrobial property of lemongrass (Cymbopogon citratus) oil against pathogenic bacteria isolated from pet turtles.

Science.gov (United States)

De Silva, B C J; Jung, Won-Gi; Hossain, Sabrina; Wimalasena, S H M P; Pathirana, H N K S; Heo, Gang-Joon

2017-06-01

The usage of essential oils as antimicrobial agents is gaining attention. Besides, pet turtles were known to harbor a range of pathogenic bacteria while the turtle keeping is a growing trend worldwide.The current study examined the antimicrobial activity of lemon grass oil (LGO) against seven species of Gram negative bacteria namely; Aeromonas hydrophila , A. caviae , Citrobacter freundii , Salmonella enterica , Edwardsiella tarda , Pseudomonas aeruginosa , and Proteus mirabilis isolated from three popular species of pet turtles. Along with the results of disc diffusion, minimum inhibitory and minimum bactericidal concentration (MIC and MBC) tests, LGO was detected as effective against 6 species of bacteria excluding P. aeruginosa . MIC of LGO for the strains except P. aeruginosa ranged from 0.016 to 0.5% (V/V). The lowest MIC recorded in the E. tarda strain followed by A. hydrophilla , C. freundii , P. mirabilis , and S. enterica . Interestingly, all the bacterial species except E. tarda were showing high multiple antimicrobial resistance (MAR) index values ranging from 0.36 to 0.91 upon the 11 antibiotics tested although they were sensitive to LGO.

ORF Alignment: NC_003361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available on ... tolerance protein [Chlamydophila caviae GPIC] ... Length = 102 ... Query: 2 ... TPVIIFTQLPSQEEADCISH...ALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI 61 ... TPVIIFTQLPSQEEADCISH...ALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI Sbjct: 1 ... TPVIIFTQLPSQEEADCISHALVTQKLAACVHVFPKGNSTYMWEGKLYISEEYHMHIKTI 60 ...

ORF Alignment: NC_003361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Chlamydophila caviae GPIC] ... Length = 212 ... Query: 1 ... MNKKQRQKTLIAPSIMGGDLACIGAEAKKIEESGADLIHID...VMDGHFVPNLTFGPGVIAA 60 ... MNKKQRQKTLIAPSIMGGDLACIGAEAKKIEESGADLIHIDVMDGHF...VPNLTFGPGVIAA Sbjct: 1 ... MNKKQRQKTLIAPSIMGGDLACIGAEAKKIEESGADLIHIDVMDGHFVPNLTFGPGVIAA 60 ... Query: 121 FSPETSI

Translation inhibition of the developmental cycle protein HctA by the small RNA IhtA is conserved across Chlamydia.

Directory of Open Access Journals (Sweden)

Jeremiah Tattersall

Full Text Available The developmental cycle of the obligate intracellular pathogen Chlamydia trachomatis serovar L2 is controlled in part by the small non-coding RNA (sRNA, IhtA. All Chlamydia alternate in a regulated fashion between the infectious elementary body (EB and the replicative reticulate body (RB which asynchronously re-differentiates back to the terminal EB form at the end of the cycle. The histone like protein HctA is central to RB:EB differentiation late in the cycle as it binds to and occludes the genome, thereby repressing transcription and translation. The sRNA IhtA is a critical component of this regulatory loop as it represses translation of hctA until late in infection at which point IhtA transcription decreases, allowing HctA expression to occur and RB to EB differentiation to proceed. It has been reported that IhtA is expressed during infection by the human pathogens C. trachomatis serovars L2, D and L2b and C. pneumoniae. We show in this work that IhtA is also expressed by the animal pathogens C. caviae and C. muridarum. Expression of HctA in E. coli is lethal and co-expression of IhtA relieves this phenotype. To determine if regulation of HctA by IhtA is a conserved mechanism across pathogenic chlamydial species, we cloned hctA and ihtA from C. trachomatis serovar D, C. muridarum, C. caviae and C. pneumoniae and assayed for rescue of growth repression in E. coli co-expression studies. In each case, co-expression of ihtA with the cognate hctA resulted in relief of growth repression. In addition, expression of each chlamydial species IhtA rescued the lethal phenotype of C. trachomatis serovar L2 HctA expression. As biolayer interferometry studies indicate that IhtA interacts directly with hctA message for all species tested, we predict that conserved sequences of IhtA are necessary for function and/or binding.

Translation inhibition of the developmental cycle protein HctA by the small RNA IhtA is conserved across Chlamydia.

Science.gov (United States)

Tattersall, Jeremiah; Rao, Geeta Vittal; Runac, Justin; Hackstadt, Ted; Grieshaber, Scott S; Grieshaber, Nicole A

2012-01-01

The developmental cycle of the obligate intracellular pathogen Chlamydia trachomatis serovar L2 is controlled in part by the small non-coding RNA (sRNA), IhtA. All Chlamydia alternate in a regulated fashion between the infectious elementary body (EB) and the replicative reticulate body (RB) which asynchronously re-differentiates back to the terminal EB form at the end of the cycle. The histone like protein HctA is central to RB:EB differentiation late in the cycle as it binds to and occludes the genome, thereby repressing transcription and translation. The sRNA IhtA is a critical component of this regulatory loop as it represses translation of hctA until late in infection at which point IhtA transcription decreases, allowing HctA expression to occur and RB to EB differentiation to proceed. It has been reported that IhtA is expressed during infection by the human pathogens C. trachomatis serovars L2, D and L2b and C. pneumoniae. We show in this work that IhtA is also expressed by the animal pathogens C. caviae and C. muridarum. Expression of HctA in E. coli is lethal and co-expression of IhtA relieves this phenotype. To determine if regulation of HctA by IhtA is a conserved mechanism across pathogenic chlamydial species, we cloned hctA and ihtA from C. trachomatis serovar D, C. muridarum, C. caviae and C. pneumoniae and assayed for rescue of growth repression in E. coli co-expression studies. In each case, co-expression of ihtA with the cognate hctA resulted in relief of growth repression. In addition, expression of each chlamydial species IhtA rescued the lethal phenotype of C. trachomatis serovar L2 HctA expression. As biolayer interferometry studies indicate that IhtA interacts directly with hctA message for all species tested, we predict that conserved sequences of IhtA are necessary for function and/or binding.

COMPARACIÓN DE DOS TIPOS DE SACRIFICIO Y DIFERENTES TIEMPOS DE MADURACIÓN SOBRE VARIABLES FÍSICO-QUÍMICAS Y MICROBIOLÓGICAS DE LA CARNE DE CUY (Cavia porcellus

Directory of Open Access Journals (Sweden)

H. A. Jurado-Gámez

2016-01-01

Full Text Available El objetivo fue determinar el comportamiento de las variables fisicoquímicas y microbiológicasdurante la maduración de la carne de cuy (Cavia porcellus, utilizandodos métodos de insensibilización (desnucamiento y electronarcosis. La investigaciónse realizó en los laboratorios de la Universidad de Nariño y se utilizaron 24 animales:12 para cada método. Los animales ayunaron 12 h antes del sacrificio y las canalesse maduraron en refrigeración (2 a 4°C durante 24 h. Se determinaron las variablespH, acidez, temperatura, capacidad de retención de agua (CRA, conductibilidadeléctrica (CE y pérdida de agua en refrigeración cada 4 h. Se evaluaron los parámetrosmicrobiológicos coliformes totales y fecales a las 0, 16 y 24 h, además de Listeria sp. yla presencia de antibióticos (sulfamidas al inicio de la maduración. Para detectar diferenciaentre métodos de insensibilización para las variables fisicoquímicas se utilizó undiseño de medidas repetidas en el tiempo; para las demás variables se utilizó estadísticadescriptiva. Los resultados mostraron que el mejor tiempo de maduración fue a las 16horas, con un pH promedio de 5,42, acidez de 0,272 % y CRA de 12,73. Además, lasvariables microbiológicas estuvieron por debajo de la norma vigente garantizando lainocuidad de la carne evaluada. No se observó diferencia estadísticas entre métodos deinsensibilización y los resultados de antibióticos fueron negativos. Se concluye que eltiempo adecuado de maduración para la carne de cuy fue de 16 horas sin diferencias enel método de insensibilización.

The influence of p H during growth of bacteria in toluene

International Nuclear Information System (INIS)

Nahar, N.; Quilty, B.; Alauddin, M.

2000-01-01

Five toluene tolerant species were isolated from the activated sludge of a wastewater treatment plant (Dublin). The isolate were investigated for influence of pH on the growth in toluene. Four of the bacteria have been identified as Pseudomonas putida and one as an Aeromonas caviae. When these bacteria were grown with toluene as the sole source of carbon and energy, the pH of the culture medium became acidic and dropped. 0.5 M sodium phosphate buffer was selected to investigate the optimum pH for growth in the presence of 500 mu l of toluene. In general, the growth was optimum between pH 5.8 and 7.4. (author)

Risk Prioritization Tool to Identify the Public Health Risks of Wildlife Trade: The Case of Rodents from Latin America.

Science.gov (United States)

Bueno, I; Smith, K M; Sampedro, F; Machalaba, C C; Karesh, W B; Travis, D A

2016-06-01

Wildlife trade (both formal and informal) is a potential driver of disease introduction and emergence. Legislative proposals aim to prevent these risks by banning wildlife imports, and creating 'white lists' of species that are cleared for importation. These approaches pose economic harm to the pet industry, and place substantial burden on importers and/or federal agencies to provide proof of low risk for importation of individual species. As a feasibility study, a risk prioritization tool was developed to rank the pathogens found in rodent species imported from Latin America into the United States with the highest risk of zoonotic consequence in the United States. Four formally traded species and 16 zoonotic pathogens were identified. Risk scores were based on the likelihood of pathogen release and human exposure, and the severity of the disease (consequences). Based on the methodology applied, three pathogens (Mycobacterium microti, Giardia spp. and Francisella tularensis) in one species (Cavia porcellus) were ranked as highest concern. The goal of this study was to present a methodological approach by which preliminary management resources can be allocated to the identified high-concern pathogen-species combinations when warranted. This tool can be expanded to other taxa and geographic locations to inform policy surrounding the wildlife trade. © 2015 Blackwell Verlag GmbH.

Bone morphology of the hind limbs in two caviomorph rodents.

Science.gov (United States)

de Araújo, F A P; Sesoko, N F; Rahal, S C; Teixeira, C R; Müller, T R; Machado, M R F

2013-04-01

In order to evaluate the hind limbs of caviomorph rodents a descriptive analysis of the Cuniculus paca (Linnaeus, 1766) and Hydrochoerus hydrochaeris (Linnaeus, 1766) was performed using anatomical specimens, radiography, computed tomography (CT) and full-coloured prototype models to generate bone anatomy data. The appendicular skeleton of the two largest rodents of Neotropical America was compared with the previously reported anatomical features of Rattus norvegicus (Berkenhout, 1769) and domestic Cavia porcellus (Linnaeus, 1758). The structures were analyzed macroscopically and particular findings of each species reported. Features including the presence of articular fibular projection and lunulae were observed in the stifle joint of all rodents. Imaging aided in anatomical description and, specifically in the identification of bone structures in Cuniculus paca and Hydrochoerus hydrochaeris. The imaging findings were correlated with the anatomical structures observed. The data may be used in future studies comparing these animals to other rodents and mammalian species. © 2012 Blackwell Verlag GmbH.

Blood profiles in unanesthetized and anesthetized guinea pigs (Cavia porcellus).

Science.gov (United States)

Williams, Wendy R; Johnston, Matthew S; Higgins, Sarah; Izzo, Angelo A; Kendall, Lon V

2016-01-01

The guinea pig is a common animal model that is used in biomedical research to study a variety of systems, including hormonal and immunological responses, pulmonary physiology, corticosteroid response and others. However, because guinea pigs are evolutionarily a prey species, they do not readily show behavioral signs of disease, which can make it difficult to detect illness in a laboratory setting. Minimally invasive blood tests, such as complete blood counts and plasma biochemistry assays, are useful in both human and veterinary medicine as an initial diagnostic technique to rule in or rule out systemic illness. In guinea pigs, phlebotomy for such tests often requires that the animals be anesthetized first. The authors evaluated hematological and plasma biochemical effects of two anesthetic agents that are commonly used with guinea pigs in a research setting: isoflurane and a combination of ketamine and xylazine. Hematological and plasma biochemical parameters were significantly different when guinea pigs were under either anesthetic, compared to when they were unanesthetized. Plasma proteins, liver enzymes, white blood cells and red blood cells appeared to be significantly altered by both anesthetics, and hematological and plasma biochemical differences were greater when guinea pigs were anesthetized with the combination of ketamine and xylazine than when they were anesthetized with isoflurane. Overall these results indicate that both anesthetics can significantly influence hematological and plasma biochemical parameters in guinea pigs.

Biosorption of Cr (III) from aqueous solution by the leaf biomass of ...

African Journals Online (AJOL)

Michael Horsfall

long time contact causes skin allergy and cancer. (Yun et al., 2001). ... same active metal binding sites such as carboxylate or amino groups ..... (silverleaf night shade). Proceedings of ... caviae, cell surface adsorption: Physical. Chemistry and ...

Use of a Guinea pig-specific transcriptome array for evaluation of protective immunity against genital chlamydial infection following intranasal vaccination in Guinea pigs.

Science.gov (United States)

Wali, Shradha; Gupta, Rishein; Veselenak, Ronald L; Li, Yansong; Yu, Jieh-Juen; Murthy, Ashlesh K; Cap, Andrew P; Guentzel, M Neal; Chambers, James P; Zhong, Guangming; Rank, Roger G; Pyles, Richard B; Arulanandam, Bernard P

2014-01-01

Guinea pigs have been used as a second animal model to validate putative anti-chlamydial vaccine candidates tested in mice. However, the lack of guinea pig-specific reagents has limited the utility of this animal model in Chlamydia sp. vaccine studies. Using a novel guinea pig-specific transcriptome array, we determined correlates of protection in guinea pigs vaccinated with Chlamydia caviae (C. caviae) via the intranasal route, previously reported by us and others to provide robust antigen specific immunity against subsequent intravaginal challenge. C. caviae vaccinated guinea pigs resolved genital infection by day 3 post challenge. In contrast, mock vaccinated animals continued to shed viable Chlamydia up to day 18 post challenge. Importantly, at day 80 post challenge, vaccinated guinea pigs experienced significantly reduced genital pathology - a sequelae of genital chlamydial infections, in comparison to mock vaccinated guinea pigs. Sera from vaccinated guinea pigs displayed antigen specific IgG responses and increased IgG1 and IgG2 titers capable of neutralizing GPIC in vitro. Th1-cellular/inflammatory immune genes and Th2-humoral associated genes were also found to be elevated in vaccinated guinea pigs at day 3 post-challenge and correlated with early clearance of the bacterium. Overall, this study provides the first evidence of guinea pig-specific genes involved in anti-chlamydial vaccination and illustrates the enhancement of the utility of this animal model in chlamydial pathogenesis.

Use of a chiA probe for detection of chitinase genes in bacteria from the Chesapeake Bay

Digital Repository Service at National Institute of Oceanography (India)

Ramaiah, N.; Hill, R.T.; Chun, J.; Ravel, J.; Matte, M.H.; Straube, W.L.; Colwell, R.R.

PCR primers specific for the chiA gene were designed by alignment and selection of highly conserved regions of chiA sequences from Serratia marcescens, Alteromonas sp., Bacillus circulans and Aeromonas caviae. These primers were used to amplify a...

Endangered Species Day | Endangered Species Coalition

Science.gov (United States)

Annual Top 10 Report Protecting the Endangered Species Act Wildlife Voices Stand for Wolves Endangered Campaigns Wildlife Voices Protecting the Endangered Species Act Annual Top 10 Report Endangered Species Day Stand for Wolves Vanishing BOOK: A Wild Success The Endangered Species Act at 40 Endangered Species The

Aeromonas associated diarrhoeal disease in south Brazil: prevalence, virulence factors and antimicrobial resistance Aeromonas associadas a diarréias no sul do Brasil: prevalência, fatores de virulência, e resistência a antibiótico

Directory of Open Access Journals (Sweden)

Ivani M.F. Guerra

2007-12-01

Full Text Available Aeromonas were isolated from 27 (6.6% of 408 patients admitted with acute gastroenteritis in two hospitals at Rio Grande do Sul, Brazil. Isolates were classified as A. hydrophila (51.8%, A. caviae (40.8%, and A. veronii biotype sobria (7.4%. The highest prevalence of Aeromonas associated infections occurred in lactants and children. Virulence genes (aerA -aerolysin/hemolysin, ahpA -serine-protease, satA - glycerophospholipid-cholesterol acyltransferase, lipA -lipase, and ahyB -elastase and virulence factors (hemolytic, proteolitic, lipolitic activities, and biofilm formation were identified in most A. hydrophila and A. veronii biotype sobria isolates, with lower frequencies on A. caviae. All Aeromonas isolates were resistant to ampicillin, ticarcillin/clavulanic acid, cephalotin, and cephazolin, and most of them (>70% exhibited resistance to imipenem, carbenicillin, amoxillin/sulbactan, and piperacillin. Multiple-resistance, more than four antibiotics, was evidenced in 29.6% of the isolates. The most efficient antibiotics were the quinolones (ciprofloxacin and norfloxacin, and the aminoglycosides (amikacin and netilmicin.Aeromonas foram isoladas de 27 (6.6% dos 408 pacientes admitidos com gastroenterite aguda em dois hospitais do Rio Grande do Sul, Brasil. Os isolados foram classificados com A. hydrophila (51.8%, A. caviae (40.8%, e A. veronii biotype sobria (7.4%. A maior prevalência de Aeromonas ocorreu em lactantes e crianças. Genes (aerA -aerolisina/hemolisina, ahpA -serina-protease, satA - glicerofosfolipidio-colesterol aciltransferase, lipA -lipase, e ahyB -elastase e factores (atividade hemolítica, proteolítica, lipolítica, e formação de biofilme de virulência foram identificados na maioria dos isolados de A. hydrophila e A. veronii biotype sobria, com freqüências menores em A. caviae. Todos os isolados de Aeromonas apresentaram resistência a ampicilina, ticarcilina/ácido clavulânico, cefalotina e cefazolina, e a maior parte

Suckling behaviour in captive Dendrohyrax arboreus

African Journals Online (AJOL)

1980-11-06

Nov 6, 1980 ... the subject of several studies (Coe 1962; Rahm 1963; Sale. 1965a,b,c; 1966, .... possibly olfactory, stimulus which is not functional until some time after the ... Notes on the habits of the Mount Kenya hyrax (Pro- cavia johnstoni ...

Etude comparative de la digestibilité in vivo de l'herbe de guinée (Panicum maximum Jacq. associée aux feuilles et tiges de patate douce (Ipomoea batatas (L. Lam (régime Panipo ou à l'herbe de lait (Euphorbia heterophylla L. (régime Paneuph chez le lapin (Oryctolagus cuniculus L. et le cobaye (Cavia porcellus L.

Directory of Open Access Journals (Sweden)

Kouakou, NGDV.

2016-01-01

Full Text Available Digestibility of Guinea grass (Panicum maximum Jacq. associated with sweet potato leaves and stems (Ipomoea batatas (L. Lam (Panipo diet or poison milk (Euphorbia heterophylla L. (Paneuph diet in Rabbits (Oryctolagus cuniculus L. and in Guinea Pigs (Cavia porcellus L.. A comparative study of in vivo digestibility of Guinea grass (Panicum maximum Jacq. associated with sweet potato leaves and stems (Ipomoea batatas (L. Lam (Panipo diet or with poison milk (Euphorbia heterophylla L. (Paneuph diet was conducted involving 16 rabbits and 16 weaned guinea pigs fed ad libitum. Paneuph was significantly better ingested (P0.05 for guinea pigs. Poison milk was better ingested than the leaves and stems of sweet potato (P0.05. The ADC of DM, OM and MAT of Paneuph exceeded 80% and were higher than those of Panipo in rabbits and guinea pigs (P<0.05. Based on the results obtained, the effects of the distribution of the Guinea grass associated with the poison milk during rabbits growing have to be further studied before recommending this new diet to farmers in areas where poison milk and Guinea grass are present and rabbit breeding enough developed.

Spot-on Treatments of Diflubenzuron and Permethrin to Control a Guinea Pig Louse, Gliricola Porcelli (Phthiraptera: Gyropidae)

Science.gov (United States)

Guinea pigs (Cavia porcellus (L.)) (Rodentia: Caviidae) are pets and laboratory animals. They can be infested by a chewing louse, Gliricola porcelli (Schrank) (Phthiraptera: Gyropidae), which is fairly common in some animal rearing facilities, pet stores, and on wild guinea pigs. Infestation with G....

Journal of the Cameroon Academy of Sciences - Vol 4, No 1 (2004)

African Journals Online (AJOL)

DOWNLOAD FULL TEXT Open Access DOWNLOAD FULL TEXT Subscription or Fee ... Influence of birth weight and litter size on the preweaning growth performance and survival of guinea pigs (Cavia porcellus L.) EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

Production systems, diversity and richness of cavy culture in ...

African Journals Online (AJOL)

In order to assess existing cavy (Cavia porcellus) production systems of Cameroon western highlands and rain forest agro-ecological zones, a household ... for a well designed and comprehensive national breeding program for cavies, and increased capacity building of farmers to address mortality rates and health issues.

Comparative proteomic analysis of lung tissue from guinea pigs with Leptospiral Pulmonary Haemorrhage Syndrome (LPHS) reveals a decrease in abundance of host proteins involved in cytoskeletal and cellular organization

Science.gov (United States)

The recent completion of the complete genome sequence of the guinea pig (Cavia porcellus) provides innovative opportunities to apply proteomic technologies to an important animal model of disease. In this study, a 2-D guinea pig proteome lung map was used to investigate the pathogenic mechanisms of ...

AEROMONAS SPP BACTEREMIA OF RAINBOW TROUT FRY (ONCORHYNCHUS MYKISS: BIOCHEMICAL CHARACTERIZATION OF THE CAUSATIVE ORGANISM AND ANTIMICROBIAL SUSCEPTIBILITY

Directory of Open Access Journals (Sweden)

Damir Kapetanović

2004-09-01

Full Text Available Aeromonas hydrophila and other members of Aeromonas genus are ubiquitus in aquatic environment and make part of normal bacterial flora of rainbow trout. Aeromonas spp. infections are worldwide registered. Here we present our experience and knowledge on Aeromonas bacteremia, which causes mortality of rainbow trout fry. Rainbow trout fry, 7 month old, started to die in November 2003. Fish samples (17 samples of dead and moribund fish were delivered to the Laboratory for aquaculture. With Api 20 NE tests Aeromonas hydrophila / caviae type I was identified with an average probability of 99.9 % (one test against, as well as Aeromonas hydrophila / caviae type II with an average probability of 99.5 % (one test against from liver, spleen, kidney, intestines and damaged eye. All of isolated and identified samples were tested for antibiotic susceptibility by disc diffusion method. The test showed that specimens were most sensitive on flumequin, and relatively less sensitive on chloramphenicol and enrofloxacin. Therapy was successfully applied with Flubactin®.

NDM 1 Gene Carrying Gram negative Bacteria Isolated from Rats ...

African Journals Online (AJOL)

In this study, we screened 56 Gram negative bacteria comprising: 3 isolates of Enterobacter ludwigii, 30 Pseudomonas aeruginosa, 22 Proteus mirabilis, and 1 Aeromonas caviae isolated from oral cavity and rectum of rats captured from commercial poultry houses in Ibadan, Oyo State, Nigeria that were resistant to at least ...

NIGERIAN VETERINARY JOURNAL

African Journals Online (AJOL)

ADEYEYE

In this study, we screened 56 Gram negative bacteria comprising: 3 isolates of Enterobacter ludwigii, 30 Pseudomonas aeruginosa, 22. Proteus mirabilis, and 1 Aeromonas caviae isolated from oral cavity and rectum of rats captured from commercial poultry houses in Ibadan, Oyo State, Nigeria that were resistant to at least ...

Multinucleation during C. trachomatis infections is caused by the contribution of two effector pathways.

Directory of Open Access Journals (Sweden)

Heather M Brown

Full Text Available Chlamydia trachomatis is an obligate intracellular bacterial pathogen and the second leading cause of sexually transmitted infections in the US. Infections cause significant morbidity and can lead to serious reproductive sequelae, including an epidemiological link to increased rates of reproductive cancers. One of the overt changes that infected cells exhibit is the development of genomic instability leading to multinucleation. Here we demonstrate that the induction of multinucleation is not conserved equally across chlamydial species; C. trachomatis L2 caused high levels of multinucleation, C. muridarum intermediate levels, and C. caviae had very modest effects on multinucleation. Our data show that at least two effector pathways together cause genomic instability during infection leading to multinucleation. We find that the highly conserved chlamydial protease CPAF is a key effector for one of these pathways. CPAF secretion is required for the loss of centrosome duplication regulation as well as inducing early mitotic exit. The second effector pathway involves the induction of centrosome position errors. This function is not conserved in three chlamydial species tested. Together these two pathways contribute to the induction of high levels of genomic instability and multinucleation seen in C. trachomatis infections.

Integration of metabolism and digestion in the hyrax | Fairall | South ...

African Journals Online (AJOL)

Metabolic adaptations and digestive ability were integrated to explain the ecological efficiency of the hyrax (Procavia capensis). Metabolic rate was shown to decrease linearly with a drop in ambient temperature, but at a lower rate than an animal of equivalent size, the guinea-pig (Cavia porcel/us). This is achieved by ...

A prospective study on Aeromonas in outpatients with diarrhea in the central region of Rio Grande do Sul State

Directory of Open Access Journals (Sweden)

Karoline de Campos Prediger

2012-09-01

Full Text Available Aeromonas spp. were identified in five (2,7% of 182 diarrheal stool cultures, A. caviae was predominant, resistant mainly to ampicillin and cephalotin. This is the first study showing the presence of Aeromonas spp. in diarrheal stools of outpatients in the central region of Rio Grande do Sul State, Brazil.

Endangered Species

Science.gov (United States)

EPA's Endangered Species Protection Program helps promote recovery of listed species. The ESPP determines if pesticide use in a geographic area may affect any listed species. Find needed limits on pesticide use in Endangered Species Protection Bulletins.

Ocular disease in the guinea pig (Cavia porcellus): a survey of 1000 animals.

Science.gov (United States)

Williams, David; Sullivan, Ann

2010-09-01

Anecdotal evidence has suggested that guinea pigs have a high prevalence of ocular lesions. Here we undertook a survey of 1000 guinea pigs from populations of animals kept as laboratory animals, breeding show cavies, animals kept as pets and those from rescue and rehoming centers. Each animal was examined to assess for ocular abnormalities. A full ophthalmic examination was performed on each animal with direct and indirect ophthalmoscopy and with slit lamp biomicroscopy. Measurement of tear production using the Schirmer tear test 1 and intraocular pressure using the Tonopen applanation tonometer after topical anesthesia was undertaken in selected animals. Forty-five percent of animals examined had some ocular abnormality. The majority were lens lesions including 17% with cataract and 21% with subclinical lens abnormalities such as nuclear sclerosis. Other abnormalities included conjunctivitis in 4.7% and keratitis in 3.6%. Lipid deposition in conjunctiva was observed in 2.3% of guinea pigs and ciliary body heterotopic bone formation in 0.8% of animals. This study shows a high proportion of eyes with some degree of abnormality in animals otherwise considered healthy. Information on diseases of the guinea pig eye is important given the use of the species as a laboratory rodent and also the number kept as pets and show animals.

The nuclear question: rethinking species importance in multi-species animal groups.

Science.gov (United States)

Srinivasan, Umesh; Raza, Rashid Hasnain; Quader, Suhel

2010-09-01

1. Animals group for various benefits, and may form either simple single-species groups, or more complex multi-species associations. Multi-species groups are thought to provide anti-predator and foraging benefits to participant individuals. 2. Despite detailed studies on multi-species animal groups, the importance of species in group initiation and maintenance is still rated qualitatively as 'nuclear' (maintaining groups) or 'attendant' (species following nuclear species) based on species-specific traits. This overly simplifies and limits understanding of inherently complex associations, and is biologically unrealistic, because species roles in multi-species groups are: (i) likely to be context-specific and not simply a fixed species property, and (ii) much more variable than this dichotomy indicates. 3. We propose a new view of species importance (measured as number of inter-species associations), along a continuum from 'most nuclear' to 'least nuclear'. Using mixed-species bird flocks from a tropical rainforest in India as an example, we derive inter-species association measures from randomizations on bird species abundance data (which takes into account species 'availability') and data on 86 mixed-species flocks from two different flock types. Our results show that the number and average strength of inter-species associations covary positively, and we argue that species with many, strong associations are the most nuclear. 4. From our data, group size and foraging method are ecological and behavioural traits of species that best explain nuclearity in mixed-species bird flocks. Parallels have been observed in multi-species fish shoals, in which group size and foraging method, as well as diet, have been shown to correlate with nuclearity. Further, the context in which multi-species groups occur, in conjunction with species-specific traits, influences the role played by a species in a multi-species group, and this highlights the importance of extrinsic factors in

Native species that can replace exotic species in landscaping

Directory of Open Access Journals (Sweden)

Elisabeth Regina Tempel Stumpf

2015-08-01

Full Text Available Beyond aesthetics, the contemporary landscaping intends to provide other benefits for humans and environment, especially related to the environmental quality of urban spaces and conservation of the species. A trend in this direction is the reduction in the use of exotic plants in their designs, since, over time, they can become agents of replacement of native flora, as it has occurred in Rio Grande do Sul with many species introduced by settlers. However, the use of exotic species is unjustifiable, because the flora diversity of the Bioma Pampa offers many native species with appropriate features to the ornamental use. The commercial cultivation and the implantation of native species in landscaped areas constitute innovations for plant nurseries and landscapers and can provide a positive reduction in extractivism, contributing to dissemination, exploitation and preservation of native flora, and also decrease the impact of chemical products on environment. So, this work intends to identify native species of Bioma Pampa with features and uses similar to the most used exotic species at Brazilian landscaping. The species were selected from consulting books about native plants of Bioma Pampa and plants used at Brazilian landscaping, considering the similarity on habit and architecture, as well as characteristics of leafs, flowers and/or fruits and environmental conditions of occurrence and cultivation. There were identified 34 native species able to properly replace exotic species commonly used. The results show that many native species of Bioma Pampa have interesting ornamental features to landscape gardening, allowing them to replace exotic species that are traditionally cultivated.

MICROBIAL POPULATION OF HOT SPRING WATERS IN ESKİŞEHİR/TURKEY

Directory of Open Access Journals (Sweden)

Nalan YILMAZ SARIÖZLÜ

2012-02-01

Full Text Available In order to investigate and find out the bacterial community of hot spring waters in Eskişehir, Turkey, 7 hot spring water samples were collected from 7 different hot springs. All samples were inoculated using four different media (nutrient agar, water yeast extract agar, trypticase soy agar, starch casein agar. After incubation at 50 ºC for 14 days, all bacterial colonies were counted and purified. Gram reaction, catalase and oxidase properties of all isolates were determined and investigated by BIOLOG, VITEK and automated ribotyping system (RiboPrinter. The resistance of these bacteriawas examined against ampiciline, gentamisine, trimethoprime-sulphamethoxazole and tetracycline. As a result, heat resistant pathogenic microorganisms in addition to human normal flora were determined in hot spring waters (43-50 ºC in investigated area. Ten different species belong to 6 genera were identified as Alysiella filiformis, Bordetella bronchiseptica, B. pertussis, Molexalla caprae, M. caviae, M. cuniculi, M. phenylpyruvica, Roseomonas fauriae, Delftia acidovorans and Pseudomonas taetrolens.

ConSpeciFix: Classifying prokaryotic species based on gene flow.

Science.gov (United States)

Bobay, Louis-Marie; Ellis, Brian Shin-Hua; Ochman, Howard

2018-05-16

Classification of prokaryotic species is usually based on sequence similarity thresholds, which are easy to apply but lack a biologically-relevant foundation. Here, we present ConSpeciFix, a program that classifies prokaryotes into species using criteria set forth by the Biological Species Concept, thereby unifying species definition in all domains of life. ConSpeciFix's webserver is freely available at www.conspecifix.com. The local version of the program can be freely downloaded from https://github.com/Bobay-Ochman/ConSpeciFix. ConSpeciFix is written in Python 2.7 and requires the following dependencies: Usearch, MCL, MAFFT and RAxML. ljbobay@uncg.edu.

Estimating Effects of Species Interactions on Populations of Endangered Species.

Science.gov (United States)

Roth, Tobias; Bühler, Christoph; Amrhein, Valentin

2016-04-01

Global change causes community composition to change considerably through time, with ever-new combinations of interacting species. To study the consequences of newly established species interactions, one available source of data could be observational surveys from biodiversity monitoring. However, approaches using observational data would need to account for niche differences between species and for imperfect detection of individuals. To estimate population sizes of interacting species, we extended N-mixture models that were developed to estimate true population sizes in single species. Simulations revealed that our model is able to disentangle direct effects of dominant on subordinate species from indirect effects of dominant species on detection probability of subordinate species. For illustration, we applied our model to data from a Swiss amphibian monitoring program and showed that sizes of expanding water frog populations were negatively related to population sizes of endangered yellow-bellied toads and common midwife toads and partly of natterjack toads. Unlike other studies that analyzed presence and absence of species, our model suggests that the spread of water frogs in Central Europe is one of the reasons for the decline of endangered toad species. Thus, studying population impacts of dominant species on population sizes of endangered species using data from biodiversity monitoring programs should help to inform conservation policy and to decide whether competing species should be subject to population management.

Confronting species distribution model predictions with species functional traits.

Science.gov (United States)

Wittmann, Marion E; Barnes, Matthew A; Jerde, Christopher L; Jones, Lisa A; Lodge, David M

2016-02-01

Species distribution models are valuable tools in studies of biogeography, ecology, and climate change and have been used to inform conservation and ecosystem management. However, species distribution models typically incorporate only climatic variables and species presence data. Model development or validation rarely considers functional components of species traits or other types of biological data. We implemented a species distribution model (Maxent) to predict global climate habitat suitability for Grass Carp (Ctenopharyngodon idella). We then tested the relationship between the degree of climate habitat suitability predicted by Maxent and the individual growth rates of both wild (N = 17) and stocked (N = 51) Grass Carp populations using correlation analysis. The Grass Carp Maxent model accurately reflected the global occurrence data (AUC = 0.904). Observations of Grass Carp growth rate covered six continents and ranged from 0.19 to 20.1 g day(-1). Species distribution model predictions were correlated (r = 0.5, 95% CI (0.03, 0.79)) with observed growth rates for wild Grass Carp populations but were not correlated (r = -0.26, 95% CI (-0.5, 0.012)) with stocked populations. Further, a review of the literature indicates that the few studies for other species that have previously assessed the relationship between the degree of predicted climate habitat suitability and species functional traits have also discovered significant relationships. Thus, species distribution models may provide inferences beyond just where a species may occur, providing a useful tool to understand the linkage between species distributions and underlying biological mechanisms.

Species delimitation in the Stenocereus griseus (Cactaceae) species complex reveals a new species, S. huastecorum.

Science.gov (United States)

Alvarado-Sizzo, Hernán; Casas, Alejandro; Parra, Fabiola; Arreola-Nava, Hilda Julieta; Terrazas, Teresa; Sánchez, Cristian

2018-01-01

The Stenocereus griseus species complex (SGSC) has long been considered taxonomically challenging because the number of taxa belonging to the complex and their geographical boundaries remain poorly understood. Bayesian clustering and genetic distance-based methods were used based on nine microsatellite loci in 377 individuals of three main putative species of the complex. The resulting genetic clusters were assessed for ecological niche divergence and areolar morphology, particularly spination patterns. We based our species boundaries on concordance between genetic, ecological, and morphological data, and were able to resolve four species, three of them corresponding to S. pruinosus from central Mexico, S. laevigatus from southern Mexico, and S. griseus from northern South America. A fourth species, previously considered to be S. griseus and commonly misidentified as S. pruinosus in northern Mexico showed significant genetic, ecological, and morphological differentiation suggesting that it should be considered a new species, S. huastecorum, which we describe here. We show that population genetic analyses, ecological niche modeling, and morphological studies are complementary approaches for delimiting species in taxonomically challenging plant groups such as the SGSC.

Species delimitation in the Stenocereus griseus (Cactaceae species complex reveals a new species, S. huastecorum.

Directory of Open Access Journals (Sweden)

Hernán Alvarado-Sizzo

Full Text Available The Stenocereus griseus species complex (SGSC has long been considered taxonomically challenging because the number of taxa belonging to the complex and their geographical boundaries remain poorly understood. Bayesian clustering and genetic distance-based methods were used based on nine microsatellite loci in 377 individuals of three main putative species of the complex. The resulting genetic clusters were assessed for ecological niche divergence and areolar morphology, particularly spination patterns. We based our species boundaries on concordance between genetic, ecological, and morphological data, and were able to resolve four species, three of them corresponding to S. pruinosus from central Mexico, S. laevigatus from southern Mexico, and S. griseus from northern South America. A fourth species, previously considered to be S. griseus and commonly misidentified as S. pruinosus in northern Mexico showed significant genetic, ecological, and morphological differentiation suggesting that it should be considered a new species, S. huastecorum, which we describe here. We show that population genetic analyses, ecological niche modeling, and morphological studies are complementary approaches for delimiting species in taxonomically challenging plant groups such as the SGSC.

La domestication animale en Amérique du Sud: le point des connaissances

Directory of Open Access Journals (Sweden)

1990-01-01

Full Text Available Quatre espèces animales, d’importance économique inégale, ont été domestiquées dans les régions andines à l’époque préhistorique: le canard musqué Cairina moschata avant 3000 BP (?, le cobaye Cavia porcellus vers 2500 BP (?, l’alpaca Lama pacos vers 6000 BP et le lama Lama glama entre 5500 et 4000 BP, d’après les données archéologiques et les analyses archéozoologiques les plus récentes. A propos de chacune d’elles sont présentés synthétiquement les gisements-clés et les fouilles effectuées, les méthodes d’analyse archéozoologique mises en oeuvre, les résultats obtenus (modalités et chronologie des processus de domestication. En conclusion sont examinées, à propos des camélidés, les causes possibles de leur domestication et quelques-unes de ses conséquences socio-économiques les plus importantes. La domesticación animal en América del Sur. Balance de los conocimientos. Cuatro especies animales, de importancia económica desigual, han sido domesticadas en las regiones andinas durante la época prehistórica: el pato joque Cairana moschata antes de 3000 BP (?, el cuy Cavia porcellus hacia 2500 BP (?, la alpaca Lama pacos hacia 6000 BP y la llama Lama glama entre 5500 y 4000 BP, según los datos arqueológicos y los análisis arqueozoológicos más recientes. A propósito de cada especie, presentamos sintéticamente los yacimientos claves y las excavaciones efectuadas, los métodos de análisis arqueozoológico utilizados y los resultados obtenidos (modalidades y cronología de los procesos de domesticación. En conclusión y a proposito de los camélidos, se examina las causas posibles de su domesticación y algunas de sus consecuencias socioeconómicas más importantes. The animal domestication in South America. The state of knowledge. Four animal species, of unequal economic importance, have been domesticated in the Andean region during prehistoric times. Muscovy duck Cairina moschata before 3000 BP

948-IJBCS-Article-Joachim D Gbenou

African Journals Online (AJOL)

DR GATSING

Sterculia setigera, Aframomum melegueta et Citrus aurantifolia sont des plantes couramment utilisées en médecine et pharmacopée traditionnelles africaines pour traiter plusieurs affections dont la toux et l'asthme. L'objectif du présent travail est d'évaluer, sur Cavia porcellus (Cochon d'Inde), les propriétés ...

Save Our Species: Protecting Endangered Species from Pesticides.

Science.gov (United States)

Environmental Protection Agency, Washington, DC.

This full-size poster profiles 11 wildlife species that are endangered. Color illustrations of animals and plants are accompanied by narrative describing their habitats and reasons for endangerment. The reverse side of the poster contains information on the Endangered Species Act, why protecting endangered and threatened species is important, how…

Species choice, provenance and species trials among native Brazilian species

Energy Technology Data Exchange (ETDEWEB)

Drumond, M A

1982-01-01

Six papers from the conference are presented. Drumond, M.A., Potential of species native to the semi-arid tropics, 766-781, (Refs. 18), reports on Anadenanthera macrocarpa, Mimosa species, Schinopsis brasiliensis, Spondias tuberosa, Ziziphus joazeiro, Cnidoscolus phyllacanthus, Bursera leptophleos (leptophloeos), Tabebuia impetiginosa, Astronium urundeuva, and Mimosa caesalpinia. Monteiro, R.F.R., Speltz, R.M., Gurgel, J.T. do A.; Silvicultural performance of 24 provenances of Araucaria angustifolia in Parana, 814-824, (Refs. 8). Pires, C.L. da S., Kalil Filho, A.N., Rosa, P.R.F. da, Parente, P.R., Zanatto, A.C.S.; Provenance trials of Cordia alliodora in the State of Sao Paulo, 988-995, (Refs. 9). Nogueira, J.C.B., Siqueira, A.C.M.F., Garrido, M.A.O., Gurgel Garrido, L.M. do A., Rosa, P.R.F., Moraes, J.L. de, Zandarin, M.A., Gurgel Filho, O.A., Trials of some native species in various regions of the State of Sao Paulo, 1051-1063, (Refs. 9) describes Centrolobium tomentosum, Peltophorum dubium, Tabebuia vellosoi, Cariniana legalis, and Balfourodendron riedelianum. Batista, M.P., Borges, J.F., Franco, M.A.B.; Early growth of a native species in comparison with exotics in northeastern Para, Brazil, 1105-1110, (Refs. 3). Jacaranda copaia is compared with Gmelina arborea, Pinus caribaea various hondurensis, Eucalyptus deglupta, and E. urophylla. Lima, P.C.F., Souza, S.M. de, Drumond, M.A.; Trials of native forest species at Petrolina, Pernambuco, 1139-1148, (Refs. 8), deals with Anadenanthera macrocarpa, Piptadenia obliqua, Pithecellobium foliolosum, Astronium urundeuva, Schinopsis brasiliensis, Cassia excelsa, Caesalpinia pyramidalis, Parkia platycephala, Pseudobombax simplicifolium, Tabebuia impetiginosa, Caesalpinia ferrea, and Aspidosperma pyrifolium. 18 references.

Terrestrial animals as invasive species and as species at risk from invasions

Science.gov (United States)

Deborah M. Finch; Dean Pearson; Joseph Wunderle; Wayne Arendt

2010-01-01

Including terrestrial animal species in the invasive species strategy plan is an important step in invasive species management. Invasions by nonindigenous species threaten nearly 50 percent of imperiled native species in the United States and are the Nation's second leading cause of species endangerment. Invasion and conversion of native habitats by exotic species...

Rare species contribute disproportionately to the functional structure of species assemblages.

Science.gov (United States)

Leitão, Rafael P; Zuanon, Jansen; Villéger, Sébastien; Williams, Stephen E; Baraloto, Christopher; Fortunel, Claire; Mendonça, Fernando P; Mouillot, David

2016-04-13

There is broad consensus that the diversity of functional traits within species assemblages drives several ecological processes. It is also widely recognized that rare species are the first to become extinct following human-induced disturbances. Surprisingly, however, the functional importance of rare species is still poorly understood, particularly in tropical species-rich assemblages where the majority of species are rare, and the rate of species extinction can be high. Here, we investigated the consequences of local and regional extinctions on the functional structure of species assemblages. We used three extensive datasets (stream fish from the Brazilian Amazon, rainforest trees from French Guiana, and birds from the Australian Wet Tropics) and built an integrative measure of species rarity versus commonness, combining local abundance, geographical range, and habitat breadth. Using different scenarios of species loss, we found a disproportionate impact of rare species extinction for the three groups, with significant reductions in levels of functional richness, specialization, and originality of assemblages, which may severely undermine the integrity of ecological processes. The whole breadth of functional abilities within species assemblages, which is disproportionately supported by rare species, is certainly critical in maintaining ecosystems particularly under the ongoing rapid environmental transitions. © 2016 The Author(s).

Molecular characterization and susceptibility to antimicrobial drugs of isolated bacterials from shrimps (“Litopenaeus vannamei” Caracterização molecular e susceptibilidade aos antimicrobianos de isolados bacterianos de camarões

Directory of Open Access Journals (Sweden)

Ricardo Castelo Branco Albinati

2010-06-01

Full Text Available The objective was to isolate bacteria from gut of shrimps from Litopenaeus vannamei, by biochemical characterization and molecular identification, inhibition activity in vitro of Bacillus cereus and sensitivity pattern determination. The bacterial species isolated were: Aeromonas caviae (n = 7, Alcaligenes denitrificans (n = 1, Bacillus cereus (n = 1 and Enterobacter spp. (n = 3. Bacillus cereus isolated in this study did not have inhibitory activity to other shrimps isolated bacteria evaluated. In the susceptibility to antimicrobial drug test, it were observed 68,7% to erythromycin, 50% to tetracycline, 81,2% to trimethoprim:sulfamethoxazole, neomycin and estreptomycin, 12,5% to lincomycin and ampicillin, 87,5% to enrofloxacin and nitrofurantoin, 93,7% to ceftriaxone, 100% to norfloxacin and nalidix acid. The characterization molecular is important on identifying the microrganisms studied. The nalidixic acid and norfloxacin are antimicrobial drugs with high sensitivity for bacteria isolated from shrimps.Objetivou-se isolar bactérias provenientes do trato intestinal de camarões da espécie Litopenaeus vannamei, por meio da caracterização bioquímica e molecular, atividade de inibição in vitro do Bacillus cereus e perfil de sensibilidade aos antimicrobianos. As espécies bacterianas identificadas foram Aeromonas caviae (n = 7, Alcaligenes denitrificans (n = 1, Bacillus cereus (n = 1 e Enterobacter spp. (n = 3. Bacillus cereus obtido neste estudo não apresentou atividade de inibição frente às demais bactérias isoladas de camarões. Quanto ao perfil de sensibilidade aos antimicrobianos, foram observados 68,7% de eritromicina, 50% de tetraciclina, 81,2% de sulfametoxazol/trimetoprina, neomicina e estreptomicina, 12,5% de lincomicina e ampicilina, 87,5% de enrofloxacina e nitrofurantoína, 93,7% de ceftriaxona, 100% de norfloxacina e ácido nalidíxico. A caracterização molecular é útil para identificação dos microrganismos estudados

Core-satellite species hypothesis and native versus exotic species in secondary succession

Science.gov (United States)

Martinez, Kelsey A.; Gibson, David J.; Middleton, Beth A.

2015-01-01

A number of hypotheses exist to explain species’ distributions in a landscape, but these hypotheses are not frequently utilized to explain the differences in native and exotic species distributions. The core-satellite species (CSS) hypothesis predicts species occupancy will be bimodally distributed, i.e., many species will be common and many species will be rare, but does not explicitly consider exotic species distributions. The parallel dynamics (PD) hypothesis predicts that regional occurrence patterns of exotic species will be similar to native species. Together, the CSS and PD hypotheses may increase our understanding of exotic species’ distribution relative to natives. We selected an old field undergoing secondary succession to study the CSS and PD hypotheses in conjunction with each other. The ratio of exotic to native species (richness and abundance) was observed through 17 years of secondary succession. We predicted species would be bimodally distributed and that exotic:native species ratios would remain steady or decrease through time under frequent disturbance. In contrast to the CSS and PD hypotheses, native species occupancies were not bimodally distributed at the site, but exotic species were. The exotic:native species ratios for both richness (E:Nrichness) and abundance (E:Ncover) generally decreased or remained constant throughout supporting the PD hypothesis. Our results suggest exotic species exhibit metapopulation structure in old field landscapes, but that metapopulation structures of native species are disrupted, perhaps because these species are dispersal limited in the fragmented landscape.

Two-species occupancy modeling accounting for species misidentification and nondetection

Science.gov (United States)

Chambert, Thierry; Grant, Evan H. Campbell; Miller, David A. W.; Nichols, James; Mulder, Kevin P.; Brand, Adrianne B,

2018-01-01

1. In occupancy studies, species misidentification can lead to false positive detections, which can cause severe estimator biases. Currently, all models that account for false positive errors only consider omnibus sources of false detections and are limited to single species occupancy. 2. However, false detections for a given species often occur because of the misidentification with another, closely-related species. To exploit this explicit source of false positive detection error, we develop a two-species occupancy model that accounts for misidentifications between two species of interest. As with other false positive models, identifiability is greatly improved by the availability of unambiguous detections at a subset of site-occasions. Here, we consider the case where some of the field observations can be confirmed using laboratory or other independent identification methods (“confirmatory data”). 3. We performed three simulation studies to (1) assess the model’s performance under various realistic scenarios, (2) investigate the influence of the proportion of confirmatory data on estimator accuracy, and (3) compare the performance of this two-species model with that of the single-species false positive model. The model shows good performance under all scenarios, even when only small proportions of detections are confirmed (e.g., 5%). It also clearly outperforms the single-species model.

Incorporating Context Dependency of Species Interactions in Species Distribution Models.

Science.gov (United States)

Lany, Nina K; Zarnetske, Phoebe L; Gouhier, Tarik C; Menge, Bruce A

2017-07-01

Species distribution models typically use correlative approaches that characterize the species-environment relationship using occurrence or abundance data for a single species. However, species distributions are determined by both abiotic conditions and biotic interactions with other species in the community. Therefore, climate change is expected to impact species through direct effects on their physiology and indirect effects propagated through their resources, predators, competitors, or mutualists. Furthermore, the sign and strength of species interactions can change according to abiotic conditions, resulting in context-dependent species interactions that may change across space or with climate change. Here, we incorporated the context dependency of species interactions into a dynamic species distribution model. We developed a multi-species model that uses a time-series of observational survey data to evaluate how abiotic conditions and species interactions affect the dynamics of three rocky intertidal species. The model further distinguishes between the direct effects of abiotic conditions on abundance and the indirect effects propagated through interactions with other species. We apply the model to keystone predation by the sea star Pisaster ochraceus on the mussel Mytilus californianus and the barnacle Balanus glandula in the rocky intertidal zone of the Pacific coast, USA. Our method indicated that biotic interactions between P. ochraceus and B. glandula affected B. glandula dynamics across >1000 km of coastline. Consistent with patterns from keystone predation, the growth rate of B. glandula varied according to the abundance of P. ochraceus in the previous year. The data and the model did not indicate that the strength of keystone predation by P. ochraceus varied with a mean annual upwelling index. Balanus glandula cover increased following years with high phytoplankton abundance measured as mean annual chlorophyll-a. M. californianus exhibited the same

Agroforestry Species Switchboard

DEFF Research Database (Denmark)

Kindt, R.; John, I.; Ordonez, J.

2016-01-01

The current version of the Agroforestry Species Switchboard documents the presence of a total of 26,135 plant species (33,813 species including synonyms) across 19 web-based databases. When available, hyperlinks to information on the selected species in particular databases are provided. In total...

The occurrence of Aeromonas in drinking water, tap water and the Porsuk River

Directory of Open Access Journals (Sweden)

Merih Kivanc

2011-03-01

Full Text Available The occurrence of Aeromonas spp. in the Porsuk River, public drinking water and tap water in the City of Eskisehir (Turkey was monitored. Fresh water samples were collected from several sampling sites during a period of one year. Total 102 typical colonies of Aeromonas spp. were submitted to biochemical tests for species differentiation and of 60 isolates were confirmed by biochemical tests. Further identifications of isolates were carried out first with the VITEK system (BioMe˜rieux and then selected isolates from different phenotypes (VITEK types were identified using the DuPont Qualicon RiboPrinter® system. Aeromonas spp. was detected only in the samples from the Porsuk River. According to the results obtained with the VITEK system, our isolates were 13% Aeromonas hydrophila, 37% Aeromonas caviae, 35% Pseudomonas putida, and 15% Pseudomonas acidovorans. In addition Pseudomonas sp., Pseudomonas maltophila, Aeromonas salmonicida, Aeromonas hydrophila, and Aeromonas media species were determined using the RiboPrinter® system. The samples taken from the Porsuk River were found to contain very diverse Aeromonas populations that can pose a risk for the residents of the city. On the other hand, drinking water and tap water of the City are free from Aeromonas pathogens and seem to be reliable water sources for the community.

Effect of season on reproductive behaviors and fertilization success in cavies (Cavia aperea).

Science.gov (United States)

Hribal, Romy; Rübensam, Kathrin; Bernhardt, Sandra; Jewgenow, Katarina; Guenther, Anja

2018-04-05

Finding the optimal timing for breeding is crucial for small mammals to ensure survival and maximize lifetime reproductive success. Species living in temperate regions therefore often restrict breeding to seasons with favorable food and weather conditions. Although caviomorph rodents such as guinea pigs are described as non-seasonal breeders, a series of recent publications has shown seasonal adaptations in litter size, offspring birth mass and maternal investment. Here, we aim to test if seasonal patterns of litter size variation found in earlier studies, are mediated by seasonal differences in female estrus length, fertilization rate and mating behavior. The female estrus period was longer in fall compared to all other seasons (p < 0.001), frequently lasting 7-9 days while estrus in spring usually lasted less than 2 days. In fall, females mated later during estrus (p < 0.001), resulting in reduced fertilization rates (p < 0.001). Fertilization rate was well above 95% in summer while it dropped to less than 85% in fall and winter. While none of the male mating characteristics such as number and duration of copulations differed across seasons, the number of mating bouts was reduced in fall (p = 0.04). Finally, the developmental stages of flushed embryos were more diverse in spring and summer compared to fall and winter. These results suggest that seasonal differences in fertilization rate and quality of implanted embryos are mediated by female estrus length and timing and intensity of mating behavior. Together, these effects contribute to the observed differences in litter size across seasons. Copyright © 2018 Elsevier Inc. All rights reserved.

Ring species as demonstrations of the continuum of species formation

DEFF Research Database (Denmark)

Pereira, Ricardo José Do Nascimento; Wake, David B.

2015-01-01

In the mid-20th century, Ernst Mayr (1942) and Theodosius Dobzhansky (1958) championed the significance of 'circular overlaps' or 'ring species' as the perfect demonstration of the gradual nature of species formation. As an ancestral species expands its range, wrapping around a geographic barrier......? What conditions favour their formation? Modelling studies have attempted to address these knowledge gaps by estimating the biological parameters that result in stable ring species (Martins et al. 2013), and determining the necessary topographic parameters of the barriers encircled (Monahan et al. 2012......). However, any generalization is undermined by a major limitation: only a handful of ring species are known to exist in nature. In addition, many of them have been broken into multiple species presumed to be evolving independently, usually obscuring the evolutionary dynamics that generate diversity. A paper...

Indicator species of essential forest tree species in the Burdur district.

Science.gov (United States)

Negiz, Mehmet Güvenç; Eser, Yunus; Kuzugüdenll, Emre; Izkan, Kürşad

2015-01-01

The forests of Burdur district for long have been subjected to over grazing and individual selection. As a result of this, majority of the forest areas in the district were degraded. In the district, afforestation efforts included majority of forestry implementations. It is well known that selecting suitable species plays an important role for achieving afforestation efforts. In this context, knowing the indicator species among the target species would be used in afforestation efforts, studies on the interrelationships between environmental factors and target species distribution is vital for selecting suitable species for a given area. In this study, Anatolian Black pine (Pinus nigra), Red pine (Pinus brutia), Crimean juniper (Juniperus excelsa) and Taurus cedar (Cedrus libani), essential tree species, were considered as target species. The data taken from 100 sample plots in Burdur district was used. Interspecific correlation analysis was performed to determine the positive and negative indicator species among each of the target species. As a result of ICA, 2 positive (Berberis crataegina, Juniperus oxycedrus), 2 negative (Phillyrea latifolia, Quercus coccifera) for Crimean Juniper, I positive (Juniperus oxycedrus), 3 negative (Onopordium acanthium, Fraxinus ornus, Phillyrea latifolia) for Anatolian black pine, 3 positive (Paliurus spina-christi, Quercus coccifer, Crataegus orientalis), 2 negative (Berberis crataegina, Astragalus nanus) for Red pine and 3 positive (Berberis crataegina, Rhamnus oleoides, Astragalus prusianus) 2 negative (Paliurus spina-christi, Quercus cerris) for Taurus cedarwere defined as indicator plant species. In this way, practical information was obtained for selecting the most suitable species, among the target species, for afforestation efforts in Burdur district.

Species concept and speciation

Directory of Open Access Journals (Sweden)

Amal Y. Aldhebiani

2018-03-01

Full Text Available Defining and recognizing a species has been a controversial issue for a long time. To determine the variation and the limitation between species, many concepts have been proposed. When a taxonomist study a particular taxa, he/she must adopted a species concept and provide a species limitation to define this taxa. In this paper some of species concepts are discussed starting from the typological species concepts to the phylogenetic concept. Positive and negative aspects of these concepts are represented in addition to their application. Keywords: Species concept, Species limitation, Species, Taxonomy, Classification

Assessment of toxicity of a glyphosate-based formulation using bacterial systems in lake water.

Science.gov (United States)

Amorós, I; Alonso, J L; Romaguera, S; Carrasco, J M

2007-05-01

A new Aeromonas bioassay is described to assess the potential harmful effects of the glyphosate-based herbicide, Roundup, in the Albufera lake, a protected area near Valencia. Viability markers as membrane integrity, culturability and beta-galactosidase production of Aeromonas caviae were studied to determine the influence of the herbicide in the bacterial cells. Data from the multifactor analysis of variance test showed no significant differences (P>0.05) between A. caviae counts of viability markers at the studied concentrations (0, 50 and 100 mg l-1 of glyphosate). The effects of Roundup on microbial biota present in the lake were assessed by measuring the number of indigenous mesophilic Aeromonas in presence of different amounts of the herbicide at 0, 50 and 100 mg l-1 of glyphosate. In samples containing 50 and 100 mg l-1 of glyphosate a significant (PAlbufera lake water to Microtox luminescent bacterium (Vibrio fischeri) also was determined. The EC50 values obtained were 36.4 mg l-1 and 64.0 mgl-1 of glyphosate respectively. The acidity (pH 4.5) of the herbicide formulation was the responsible of the observed toxicity.

Species-area relationships are controlled by species traits.

Science.gov (United States)

Franzén, Markus; Schweiger, Oliver; Betzholtz, Per-Eric

2012-01-01

The species-area relationship (SAR) is one of the most thoroughly investigated empirical relationships in ecology. Two theories have been proposed to explain SARs: classical island biogeography theory and niche theory. Classical island biogeography theory considers the processes of persistence, extinction, and colonization, whereas niche theory focuses on species requirements, such as habitat and resource use. Recent studies have called for the unification of these two theories to better explain the underlying mechanisms that generates SARs. In this context, species traits that can be related to each theory seem promising. Here we analyzed the SARs of butterfly and moth assemblages on islands differing in size and isolation. We tested whether species traits modify the SAR and the response to isolation. In addition to the expected overall effects on the area, traits related to each of the two theories increased the model fit, from 69% up to 90%. Steeper slopes have been shown to have a particularly higher sensitivity to area, which was indicated by species with restricted range (slope = 0.82), narrow dietary niche (slope= 0.59), low abundance (slope= 0.52), and low reproductive potential (slope = 0.51). We concluded that considering species traits by analyzing SARs yields considerable potential for unifying island biogeography theory and niche theory, and that the systematic and predictable effects observed when considering traits can help to guide conservation and management actions.

Synopsis of the Oxyethira flavicornis species group with new Japanese Oxyethira species (Trichoptera, Hydroptilidae

Directory of Open Access Journals (Sweden)

Oláh, J.

2013-06-01

Full Text Available A brief synopsis of the Oxyethira flavicornis species group is produced by the examination of type materials. Diagrammatic drawings with similar style were prepared for all the known and for the new species. Short description of genus Oxyethira, subgenus Oxyethira, species group of Oxyethira flavicornis are presented together with the description of five species clusters: O. datra new species cluster, O. ecornuta new species cluster, O. flavicornis new species cluster, O. hiroshima new species cluster, O. tiunovae new species cluster. Five new species are described from the O. flavicornis species group: O chitosea sp. n., O. hena sp. n., O. hiroshima sp. n., O. kakida sp. n., O. mekunna sp. n. One new species is described from the Oxyethira grisea species group: Oxyethira ozea sp. n. and two new species from the Oxyethira ramosa species group: Oxyethira miea sp. n., Oxyethira okinawa sp. n.

Relating species abundance distributions to species-area curves in two Mediterranean-type shrublands

Science.gov (United States)

Keeley, Jon E.

2003-01-01

Based on both theoretical and empirical studies there is evidence that different species abundance distributions underlie different species-area relationships. Here I show that Australian and Californian shrubland communities (at the scale from 1 to 1000 m2) exhibit different species-area relationships and different species abundance patterns. The species-area relationship in Australian heathlands best fits an exponential model and species abundance (based on both density and cover) follows a narrow log normal distribution. In contrast, the species-area relationship in Californian shrublands is best fit with the power model and, although species abundance appears to fit a log normal distribution, the distribution is much broader than in Australian heathlands. I hypothesize that the primary driver of these differences is the abundance of small-stature annual species in California and the lack of annuals in Australian heathlands. Species-area is best fit by an exponential model in Australian heathlands because the bulk of the species are common and thus the species-area curves initially rise rapidly between 1 and 100 m2. Annuals in Californian shrublands generate very broad species abundance distributions with many uncommon or rare species. The power function is a better model in these communities because richness increases slowly from 1 to 100 m2 but more rapidly between 100 and 1000 m2due to the abundance of rare or uncommon species that are more likely to be encountered at coarser spatial scales. The implications of this study are that both the exponential and power function models are legitimate representations of species-area relationships in different plant communities. Also, structural differences in community organization, arising from different species abundance distributions, may lead to different species-area curves, and this may be tied to patterns of life form distribution.

Use of species-specific PCR for the identification of 10 sea cucumber species

Science.gov (United States)

Wen, Jing; Zeng, Ling

2014-11-01

We developed a species-specific PCR method to identify species among dehydrated products of 10 sea cucumber species. Ten reverse species-specific primers designed from the 16S rRNA gene, in combination with one forward universal primer, generated PCR fragments of ca. 270 bp length for each species. The specificity of the PCR assay was tested with DNA of samples of 21 sea cucumber species. Amplification was observed in specific species only. The species-specific PCR method we developed was successfully applied to authenticate species of commercial products of dehydrated sea cucumber, and was proven to be a useful, rapid, and low-cost technique to identify the origin of the sea cucumber product.

Diversity of cuticular wax among Salix species and Populus species hybrids.

Science.gov (United States)

Cameron, Kimberly D; Teece, Mark A; Bevilacqua, Eddie; Smart, Lawrence B

2002-08-01

The leaf cuticular waxes of three Salix species and two Populus species hybrids, selected for their ability to produce high amounts of biomass, were characterized. Samples were extracted in CH(2)Cl(2) three times over the growing season. Low kV SEM was utilized to observe differences in the ultrastructure of leaf surfaces from each clone. Homologous series of wax components were classified into organic groups, and the variation in wax components due to clone, sample time, and their interaction was identified. All Salix species and Populus species hybrids showed differences in total wax load at each sampling period, whereas the pattern of wax deposition over time differed only between the Salix species. A strong positive relationship was identified between the entire homologous series of alcohols and total wax load in all clones. Similarly strong relationships were observed between fatty acids and total wax load as well as fatty acids and alcohols in two Salix species and one Populus species hybrid. One Salix species, S. dasyclados, also displayed a strong positive relationship between alcohols and alkanes. These data indicate that species grown under the same environmental conditions produce measurably different cuticular waxes and that regulation of wax production appears to be different in each species. The important roles cuticular waxes play in drought tolerance, pest, and pathogen resistance, as well as the ease of wax extraction and analysis, strongly suggest that the characteristics of the cuticular wax may prove to be useful selectable traits in a breeding program.

Scale dependence in species turnover reflects variance in species occupancy.

Science.gov (United States)

McGlinn, Daniel J; Hurlbert, Allen H

2012-02-01

Patterns of species turnover may reflect the processes driving community dynamics across scales. While the majority of studies on species turnover have examined pairwise comparison metrics (e.g., the average Jaccard dissimilarity), it has been proposed that the species-area relationship (SAR) also offers insight into patterns of species turnover because these two patterns may be analytically linked. However, these previous links only apply in a special case where turnover is scale invariant, and we demonstrate across three different plant communities that over 90% of the pairwise turnover values are larger than expected based on scale-invariant predictions from the SAR. Furthermore, the degree of scale dependence in turnover was negatively related to the degree of variance in the occupancy frequency distribution (OFD). These findings suggest that species turnover diverges from scale invariance, and as such pairwise turnover and the slope of the SAR are not redundant. Furthermore, models developed to explain the OFD should be linked with those developed to explain species turnover to achieve a more unified understanding of community structure.

Cryptic species as a window into the paradigm shift of the species concept.

Science.gov (United States)

Fišer, Cene; Robinson, Christopher T; Malard, Florian

2018-02-01

The species concept is the cornerstone of biodiversity science, and any paradigm shift in the delimitation of species affects many research fields. Many biologists now are embracing a new "species" paradigm as separately evolving populations using different delimitation criteria. Individual criteria can emerge during different periods of speciation; some may never evolve. As such, a paradigm shift in the species concept relates to this inherent heterogeneity in the speciation process and species category-which is fundamentally overlooked in biodiversity research. Cryptic species fall within this paradigm shift: they are continuously being reported from diverse animal phyla but are poorly considered in current tests of ecological and evolutionary theory. The aim of this review is to integrate cryptic species in biodiversity science. In the first section, we address that the absence of morphological diversification is an evolutionary phenomenon, a "process" counterpart to the long-studied mechanisms of morphological diversification. In the next section regarding taxonomy, we show that molecular delimitation of cryptic species is heavily biased towards distance-based methods. We also stress the importance of formally naming of cryptic species for better integration into research fields that use species as units of analysis. Finally, we show that incorporating cryptic species leads to novel insights regarding biodiversity patterns and processes, including large-scale biodiversity assessments, geographic variation in species distribution and species coexistence. It is time for incorporating multicriteria species approaches aiming to understand speciation across space and taxa, thus allowing integration into biodiversity conservation while accommodating for species uncertainty. © 2018 John Wiley & Sons Ltd.

A globally-distributed alien invasive species poses risks to United States imperiled species.

Science.gov (United States)

McClure, Meredith L; Burdett, Christopher L; Farnsworth, Matthew L; Sweeney, Steven J; Miller, Ryan S

2018-03-28

In the midst of Earth's sixth mass extinction event, non-native species are a driving factor in many imperiled species' declines. One of the most widespread and destructive alien invasive species in the world, wild pigs (Sus scrofa) threaten native species through predation, habitat destruction, competition, and disease transmission. We show that wild pigs co-occur with up to 87.2% of imperiled species in the contiguous U.S. identified as susceptible to their direct impacts, and we project increases in both the number of species at risk and the geographic extent of risks by 2025. Wild pigs may therefore present a severe threat to U.S. imperiled species, with serious implications for management of at-risk species throughout wild pigs' global distribution. We offer guidance for efficient allocation of research effort and conservation resources across species and regions using a simple approach that can be applied to wild pigs and other alien invasive species globally.

Assessing species boundaries using multilocus species delimitation in a morphologically conserved group of neotropical freshwater fishes, the Poecilia sphenops species complex (Poeciliidae.

Directory of Open Access Journals (Sweden)

Justin C Bagley

Full Text Available Accurately delimiting species is fundamentally important for understanding species diversity and distributions and devising effective strategies to conserve biodiversity. However, species delimitation is problematic in many taxa, including 'non-adaptive radiations' containing morphologically cryptic lineages. Fortunately, coalescent-based species delimitation methods hold promise for objectively estimating species limits in such radiations, using multilocus genetic data. Using coalescent-based approaches, we delimit species and infer evolutionary relationships in a morphologically conserved group of Central American freshwater fishes, the Poecilia sphenops species complex. Phylogenetic analyses of multiple genetic markers (sequences of two mitochondrial DNA genes and five nuclear loci from 10/15 species and genetic lineages recognized in the group support the P. sphenops species complex as monophyletic with respect to outgroups, with eight mitochondrial 'major-lineages' diverged by ≥2% pairwise genetic distances. From general mixed Yule-coalescent models, we discovered (conservatively 10 species within our concatenated mitochondrial DNA dataset, 9 of which were strongly supported by subsequent multilocus Bayesian species delimitation and species tree analyses. Results suggested species-level diversity is underestimated or overestimated by at least ~15% in different lineages in the complex. Nonparametric statistics and coalescent simulations indicate genealogical discordance among our gene tree results has mainly derived from interspecific hybridization in the nuclear genome. However, mitochondrial DNA show little evidence for introgression, and our species delimitation results appear robust to effects of this process. Overall, our findings support the utility of combining multiple lines of genetic evidence and broad phylogeographical sampling to discover and validate species using coalescent-based methods. Our study also highlights the

Providing Homes For The Homeless - The Viable Alternative

Directory of Open Access Journals (Sweden)

Herbstein, D.

1994-01-01

Full Text Available Guinea pig Cavia porcellus farming for meat production remains a marginalised activity in Cameroon in spite of the advantages this specie offers. With the view to promote its production, a national countrywide survey was carried out in order to evaluate the production systems and constraints. Traditional guinea pig farming appears to be a secondary household activity undertaken by small farmers basically women. The extensive production system which reveals no management practices, integrates very well in the agricultural systems (small livestock, food crops and natural forages production of the western highlands and southern forest zones of Cameroon. Guinea pig productivity remains low due to many constraints such as predation, uncontrolled breeding, inbreeding, poor feeding, negative selection and lack of veterinary care. Nevertheless, guinea pig farming plays an important role in the well being of low income village dwellers as food security, cash savings and socio-cultural values within the populations of South Cameroon. The promotion of its production requires an awareness of animal scientists, development authorities, as well as on station research if improved raising conditions.

Multiple mechanisms enable invasive species to suppress native species.

Science.gov (United States)

Bennett, Alison E; Thomsen, Meredith; Strauss, Sharon Y

2011-07-01

Invasive plants represent a significant threat to ecosystem biodiversity. To decrease the impacts of invasive species, a major scientific undertaking of the last few decades has been aimed at understanding the mechanisms that drive invasive plant success. Most studies and theories have focused on a single mechanism for predicting the success of invasive plants and therefore cannot provide insight as to the relative importance of multiple interactions in predicting invasive species' success. We examine four mechanisms that potentially contribute to the success of invasive velvetgrass Holcus lanatus: direct competition, indirect competition mediated by mammalian herbivores, interference competition via allelopathy, and indirect competition mediated by changes in the soil community. Using a combination of field and greenhouse approaches, we focus on the effects of H. lanatus on a common species in California coastal prairies, Erigeron glaucus, where the invasion is most intense. We found that H. lanatus had the strongest effects on E. glaucus via direct competition, but it also influenced the soil community in ways that feed back to negatively influence E. glaucus and other native species after H. lanatus removal. This approach provided evidence for multiple mechanisms contributing to negative effects of invasive species, and it identified when particular strategies were most likely to be important. These mechanisms can be applied to eradication of H. lanatus and conservation of California coastal prairie systems, and they illustrate the utility of an integrated set of experiments for determining the potential mechanisms of invasive species' success.

Species climate range influences hydraulic and stomatal traits in Eucalyptus species.

Science.gov (United States)

Bourne, Aimee E; Creek, Danielle; Peters, Jennifer M R; Ellsworth, David S; Choat, Brendan

2017-07-01

Plant hydraulic traits influence the capacity of species to grow and survive in water-limited environments, but their comparative study at a common site has been limited. The primary aim of this study was to determine whether selective pressures on species originating in drought-prone environments constrain hydraulic traits among related species grown under common conditions. Leaf tissue water relations, xylem anatomy, stomatal behaviour and vulnerability to drought-induced embolism were measured on six Eucalyptus species growing in a common garden to determine whether these traits were related to current species climate range and to understand linkages between the traits. Hydraulically weighted xylem vessel diameter, leaf turgor loss point, the water potential at stomatal closure and vulnerability to drought-induced embolism were significantly ( P Eucalyptus trees has important implications for the limits of species responses to changing environmental conditions and thus for species survival and distribution into the future, and yields new information for physiological models. © The Author 2017. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com

Palpi aplenty: New species in the Chrysotus longipalpus species group (Diptera: Dolichopodidae)

Science.gov (United States)

Justin B. Runyon; Renato S. Capellari

2018-01-01

Four new Nearctic species belonging to the Chrysotus longipalpus species group are described: Chrysotus keyensis sp. nov. (Florida), Chrysotus mccreadiei sp. nov. (Alabama), Chrysotus mystax sp. nov. (Alabama), and Chrysotus plumarista sp. nov. (Alabama). This brings the number of known species in this group to twelve. A key to species of males of the C. longipalpus...

Species recovery in the United States: Increasing the effectiveness of the Endangered Species Act

Science.gov (United States)

Daniel M. Evans; Judy P. Che-Castaldo; Deborah Crouse; Frank W. Davis; Rebecca Epanchin-Niell; Curtis H. Flather; R. Kipp Frohlich; Dale D. Goble; Ya-Wei Li; Timothy D. Male; Lawrence L. Master; Matthew P. Moskwik; Maile C. Neel; Barry R. Noon; Camille Parmesan; Mark W. Schwartz; J. Michael Scott; Byron K. Williams

2016-01-01

The Endangered Species Act (ESA) has succeeded in shielding hundreds of species from extinction and improving species recovery over time. However, recovery for most species officially protected by the ESA - i.e., listed species - has been harder to achieve than initially envisioned. Threats to species are persistent and pervasive, funding has been insufficient...

Valuing local endangered species. The role of intra-species substitutes

Energy Technology Data Exchange (ETDEWEB)

Loureiro, Maria L. [Department of Economic Analysis, Universidade de Santiago (Spain); IDEGA, Universidade de Santiago de Compostela, Campus Sur, Avda das Ciencias, S/N. 15782, Santiago de Compostela (Spain); Ojea, Elena [IDEGA, Universidade de Santiago de Compostela, Campus Sur, Avda das Ciencias, S/N. 15782, Santiago de Compostela (Spain)

2008-12-01

Valuation of endangered species is important in many circumstances, and particularly when assessing the impact of large accidental oil spills. Previous studies have tested the effects of including in the contingent valuation survey reminders about the existence of diverse substitutes (in terms of other natural resources also in danger of extinction in the same area, other programs to be valued, or alternative uses of money). We include a reminder about the existence of the same biological species not being under danger of extinction elsewhere. We believe this reminder allows individuals to make an easy assessment of the biological scarcity of the species they are supposed to value. Thus, the key difference with previous studies is that valuation of endangered species is combined with an assessment of preferences towards conservation of local and native species. Our WTP results are not sensitive to the information provided about other foreign substitutes. Implications of this finding are discussed. (author)

Valuing local endangered species. The role of intra-species substitutes

International Nuclear Information System (INIS)

Loureiro, Maria L.; Ojea, Elena

2008-01-01

Valuation of endangered species is important in many circumstances, and particularly when assessing the impact of large accidental oil spills. Previous studies have tested the effects of including in the contingent valuation survey reminders about the existence of diverse substitutes (in terms of other natural resources also in danger of extinction in the same area, other programs to be valued, or alternative uses of money). We include a reminder about the existence of the same biological species not being under danger of extinction elsewhere. We believe this reminder allows individuals to make an easy assessment of the biological scarcity of the species they are supposed to value. Thus, the key difference with previous studies is that valuation of endangered species is combined with an assessment of preferences towards conservation of local and native species. Our WTP results are not sensitive to the information provided about other foreign substitutes. Implications of this finding are discussed. (author)

Caractérisation biomoléculaire et structure de la population des ...

African Journals Online (AJOL)

En vue de caractériser la diversité génétique des populations de cobayes domestiques (Cavia porcellus) dans la région agro-écologique du Cameroun, un panel de16 marqueurs microsatellites ont été utilisés. L'ADN génomique provenait de 110 prélèvements sanguins obtenus chez des animaux non apparentés des ...

Detection of cryptic species

International Nuclear Information System (INIS)

Cockburn, A.F.; Jensen, T.; Seawright, J.A.

1998-01-01

Morphologically similar cryptic species are common in insects. In Anopheles mosquitoes morphologically described species are complexes of cryptic species. Cryptic species are of great practical importance for two reasons: first, one or more species of the complex might not be a pest and control efforts directed at the complex as a whole would therefore be partly wasted; and second, genetic (and perhaps biological) control strategies directed against one species of the complex would not affect other species of the complex. At least one SIT effort has failed because the released sterile insect were of a different species and therefore did not mate with the wild insects being targeted. We use a multidisciplinary approach for detection of cryptic species complexes, focusing first on identifying variability in wild populations using RFLPs of mitochondrial and ribosomal RNA genes (mtDNA and rDNA); followed by confirmation using a variety of other techniques. For rapid identification of wild individuals of field collections, we use a DNA dot blot assay. DNA probes can be isolated by differential screening, however we are currently focusing on the sequencing of the rDNA extragenic spacers. These regions are repeated several hundred times per genome in mosquitoes and evolve rapidly. Molecular drive tends to keen the individual genes homogeneous within a species. (author)

Species-specific associations between overstory and understory tree species in a semideciduous tropical forest

Directory of Open Access Journals (Sweden)

Flaviana Maluf Souza

2015-03-01

Full Text Available We investigated the occurrence of associations between overstory and understory tree species in a semideciduous tropical forest. We identified and measured all trees of nine canopy species with diameter at breast height ≥4.8 cm in a 10.24 ha plot and recorded all individuals beneath their canopies ("understory individuals" within the same diameter class. The total density of understory individuals did not significantly differ under different overstory species. One overstory species (Ceiba speciosa showed higher understory species richness compared with five other species. There was a strong positive association between three overstory species (Esenbeckia leiocarpa, Savia dictyocarpa, and C. speciosa and the density of seven understory species (Balfourodendron riedelianum, Chrysophyllum gonocarpum, E. leiocarpa, Holocalyx balansae, Machaerium stipitatum, Rhaminidium elaeocarpum, and S. dictyocarpa. These results probably reflect the outcome of a complex set of interactions including facilitation and competition, and further studies are necessary to better understand the magnitude and type of the effects of individual overstory species on understory species. The occurrence of species-specific associations shown here reinforces the importance of non-random processes in structuring plant communities and suggest that the influence of overstory species on understory species in high-diversity forests may be more significant than previously thought.

Species of Wadicosa (Araneae, Lycosidae): a new species from Madagascar.

Science.gov (United States)

Kronestedt, Torbjörn

2017-05-10

Since establishing the wolf spider genus Wadicosa Zyuzin, 1985 (Zyuzin 1985), eleven species have been accepted in it, either by transfer from Lycosa Latreille, 1804 or Pardosa C.L. Koch, 1847 or by original designation (WSC 2017). However, according to Kronestedt (1987), additional species wait to be formally transferred to Wadicosa. The genus is restricted to the Old World, with one species, Wadicosa jocquei Kronestedt, 2015, recently described from Madagascar and surrounding islands.

Invasive non-native species' provision of refugia for endangered native species.

Science.gov (United States)

Chiba, Satoshi

2010-08-01

The influence of non-native species on native ecosystems is not predicted easily when interspecific interactions are complex. Species removal can result in unexpected and undesired changes to other ecosystem components. I examined whether invasive non-native species may both harm and provide refugia for endangered native species. The invasive non-native plant Casuarina stricta has damaged the native flora and caused decline of the snail fauna on the Ogasawara Islands, Japan. On Anijima in 2006 and 2009, I examined endemic land snails in the genus Ogasawarana. I compared the density of live specimens and frequency of predation scars (from black rats [Rattus rattus]) on empty shells in native vegetation and Casuarina forests. The density of land snails was greater in native vegetation than in Casuarina forests in 2006. Nevertheless, radical declines in the density of land snails occurred in native vegetation since 2006 in association with increasing predation by black rats. In contrast, abundance of Ogasawarana did not decline in the Casuarina forest, where shells with predation scars from rats were rare. As a result, the density of snails was greater in the Casuarina forest than in native vegetation. Removal of Casuarina was associated with an increased proportion of shells with predation scars from rats and a decrease in the density of Ogasawarana. The thick and dense litter of Casuarina appears to provide refugia for native land snails by protecting them from predation by rats; thus, eradication of rats should precede eradication of Casuarina. Adaptive strategies, particularly those that consider the removal order of non-native species, are crucial to minimizing the unintended effects of eradication on native species. In addition, my results suggested that in some cases a given non-native species can be used to mitigate the impacts of other non-native species on native species.

Detection of cryptic species

Energy Technology Data Exchange (ETDEWEB)

Cockburn, A F; Jensen, T; Seawright, J A [United States Dept. of Agriculture, Agricultural Research Service, Medical and Veterinary Entomology Research Lab., Gainesville, FL (United States)

1998-01-01

Morphologically similar cryptic species are common in insects. In Anopheles mosquitoes morphologically described species are complexes of cryptic species. Cryptic species are of great practical importance for two reasons: first, one or more species of the complex might not be a pest and control efforts directed at the complex as a whole would therefore be partly wasted; and second, genetic (and perhaps biological) control strategies directed against one species of the complex would not affect other species of the complex. At least one SIT effort has failed because the released sterile insect were of a different species and therefore did not mate with the wild insects being targeted. We use a multidisciplinary approach for detection of cryptic species complexes, focusing first on identifying variability in wild populations using RFLPs of mitochondrial and ribosomal RNA genes (mtDNA and rDNA); followed by confirmation using a variety of other techniques. For rapid identification of wild individuals of field collections, we use a DNA dot blot assay. DNA probes can be isolated by differential screening, however we are currently focusing on the sequencing of the rDNA extragenic spacers. These regions are repeated several hundred times per genome in mosquitoes and evolve rapidly. Molecular drive tends to keen the individual genes homogeneous within a species. (author). 11 refs, 2 figs, 2 tabs.

Invasive Species Science Branch: research and management tools for controlling invasive species

Science.gov (United States)

Reed, Robert N.; Walters, Katie D.

2015-01-01

Invasive, nonnative species of plants, animals, and disease organisms adversely affect the ecosystems they enter. Like “biological wildfires,” they can quickly spread and affect nearly all terrestrial and aquatic ecosystems. Invasive species have become one of the greatest environmental challenges of the 21st century in economic, environmental, and human health costs, with an estimated effect in the United States of more than $120 billion per year. Managers of the Department of the Interior and other public and private lands often rank invasive species as their top resource management problem. The Invasive Species Science Branch of the Fort Collins Science Center provides research and technical assistance relating to management concerns for invasive species, including understanding how these species are introduced, identifying areas vulnerable to invasion, forecasting invasions, and developing control methods. To disseminate this information, branch scientists are developing platforms to share invasive species information with DOI cooperators, other agency partners, and the public. From these and other data, branch scientists are constructing models to understand and predict invasive species distributions for more effective management. The branch also has extensive herpetological and population biology expertise that is applied to harmful reptile invaders such as the Brown Treesnake on Guam and Burmese Python in Florida.

Evaluating species richness: biased ecological inference results from spatial heterogeneity in species detection probabilities

Science.gov (United States)

McNew, Lance B.; Handel, Colleen M.

2015-01-01

Accurate estimates of species richness are necessary to test predictions of ecological theory and evaluate biodiversity for conservation purposes. However, species richness is difficult to measure in the field because some species will almost always be overlooked due to their cryptic nature or the observer's failure to perceive their cues. Common measures of species richness that assume consistent observability across species are inviting because they may require only single counts of species at survey sites. Single-visit estimation methods ignore spatial and temporal variation in species detection probabilities related to survey or site conditions that may confound estimates of species richness. We used simulated and empirical data to evaluate the bias and precision of raw species counts, the limiting forms of jackknife and Chao estimators, and multi-species occupancy models when estimating species richness to evaluate whether the choice of estimator can affect inferences about the relationships between environmental conditions and community size under variable detection processes. Four simulated scenarios with realistic and variable detection processes were considered. Results of simulations indicated that (1) raw species counts were always biased low, (2) single-visit jackknife and Chao estimators were significantly biased regardless of detection process, (3) multispecies occupancy models were more precise and generally less biased than the jackknife and Chao estimators, and (4) spatial heterogeneity resulting from the effects of a site covariate on species detection probabilities had significant impacts on the inferred relationships between species richness and a spatially explicit environmental condition. For a real dataset of bird observations in northwestern Alaska, the four estimation methods produced different estimates of local species richness, which severely affected inferences about the effects of shrubs on local avian richness. Overall, our results

Multi-species biofilm of Candida albicans and non-Candida albicans Candida species on acrylic substrate

Directory of Open Access Journals (Sweden)

Apurva K Pathak

2012-02-01

Full Text Available OBJECTIVE: In polymicrobial biofilms bacteria extensively interact with Candida species, but the interaction among the different species of the Candida is yet to be completely evaluated. In the present study, the difference in biofilm formation ability of clinical isolates of four species of Candida in both single-species and multi-species combinations on the surface of dental acrylic resin strips was evaluated. MATERIAL AND METHODS: The species of Candida, isolated from multiple species oral candidiasis of the neutropenic patients, were used for the experiment. Organisms were cultured on Sabouraud dextrose broth with 8% glucose (SDB. Biofilm production on the acrylic resins strips was determined by crystal violet assay. Student's t-test and ANOVA were used to compare in vitro biofilm formation for the individual species of Candida and its different multi-species combinations. RESULTS: In the present study, differences between the mean values of the biofilm-forming ability of individual species (C. glabrata>C. krusei>C. tropicalis>C. albicans and in its multi-species' combinations (the highest for C. albicans with C. glabrata and the lowest for all the four species combination were reported. CONCLUSIONS: The findings of this study showed that biofilm-forming ability was found greater for non-Candida albicans Candida species (NCAC than for C. albicans species with intra-species variation. Presence of C. albicans in multi-species biofilms increased, whereas; C. tropicalis decreased the biofilm production with all other NCAC species.

TECNOLOGÍA Y SUBSISTENCIA EN EL SITIO ARQUEOLÓGICO CERRO TAPERA VÁZQUEZ (PARQUE NACIONAL PRE-DELTA, REPÚBLICA ARGENTINA

Directory of Open Access Journals (Sweden)

Mariano Bonomo

2014-10-01

Full Text Available In this paper the results of the studies carried out on ceramic and bone materials recorded at Cerro Tapera Vázquez site (Argentinean Northeast are presented. Taxonomic, anatomic and taphonomic studies of bone assemblages and technological-decorative analysis and refitting of pottery were undertaken. The site is located on a mound next to El Ceibo Creek, where 16 m2 were excavated in 2008. Abundant smooth, incised and modeled pottery (handles and zoomorphic appendages and numerous bones remains of Myocastor coypus (most frequent taxon, Blastocerus dichotomus, Ozotoceros bezoarticus, Cavia aperea, Leopardus geoffroyi, Lycalopex gymnocercus, Hydrochaeris hydrochaeris, birds and fish (Siluriformes and Characiformes were recorded. Except Cavia aperea rodent and Dusicyon gimnocercus fox, all taxa show evidence of anthropic modification (cut marks, fresh fractures and burning. Two radiocarbon dates were obtained: 650 and 520 yrs. BP. The results reached in this study lead to the conclusion that the pre-Hispanic populations that occupied Cerro Tapera Vázquez by the end of the Late Holocene were riverine canoe peoples, with complex ceramic technology and subsistence based on hunting of coypu, capybara and cervids, fishing and small-scale horticulture.

Separation of chemical species

International Nuclear Information System (INIS)

Rentzepis, P.M.

1977-01-01

Isotopic separation is accomplished by (1) a second photon irradiation step for selective ionization of a first isotopic species and (2) selective precipitation of a generally immiscible liquid from the saturating vapor phase on the ionized species. The first photon corresponds with a sharply defined spectral portion of the irradiation which exclusively excites the first species to a vibrational level. The second photon further excites this species to its ionization level. Selective precipitation is by coulombic attraction between the ionized species and the vapor. The procedure is applicable to any vapor phase ionizable material

Processing of Chlamydia abortus polymorphic membrane protein 18D during the chlamydial developmental cycle.

Directory of Open Access Journals (Sweden)

Nick M Wheelhouse

Full Text Available Chlamydia possess a unique family of autotransporter proteins known as the Polymorphic membrane proteins (Pmps. While the total number of pmp genes varies between Chlamydia species, all encode a single pmpD gene. In both Chlamydia trachomatis (C. trachomatis and C. pneumoniae, the PmpD protein is proteolytically cleaved on the cell surface. The current study was carried out to determine the cleavage patterns of the PmpD protein in the animal pathogen C. abortus (termed Pmp18D.Using antibodies directed against different regions of Pmp18D, proteomic techniques revealed that the mature protein was cleaved on the cell surface, resulting in a100 kDa N-terminal product and a 60 kDa carboxy-terminal protein. The N-terminal protein was further processed into 84, 76 and 73 kDa products. Clustering analysis resolved PmpD proteins into three distinct clades with C. abortus Pmp18D, being most similar to those originating from C. psittaci, C. felis and C. caviae.This study indicates that C. abortus Pmp18D is proteolytically processed at the cell surface similar to the proteins of C. trachomatis and C. pneumoniae. However, patterns of cleavage are species-specific, with low sequence conservation of PmpD across the genus. The absence of conserved domains indicates that the function of the PmpD molecule in chlamydia remains to be elucidated.

Processing of Chlamydia abortus polymorphic membrane protein 18D during the chlamydial developmental cycle.

Science.gov (United States)

Wheelhouse, Nick M; Sait, Michelle; Aitchison, Kevin; Livingstone, Morag; Wright, Frank; McLean, Kevin; Inglis, Neil F; Smith, David G E; Longbottom, David

2012-01-01

Chlamydia possess a unique family of autotransporter proteins known as the Polymorphic membrane proteins (Pmps). While the total number of pmp genes varies between Chlamydia species, all encode a single pmpD gene. In both Chlamydia trachomatis (C. trachomatis) and C. pneumoniae, the PmpD protein is proteolytically cleaved on the cell surface. The current study was carried out to determine the cleavage patterns of the PmpD protein in the animal pathogen C. abortus (termed Pmp18D). Using antibodies directed against different regions of Pmp18D, proteomic techniques revealed that the mature protein was cleaved on the cell surface, resulting in a100 kDa N-terminal product and a 60 kDa carboxy-terminal protein. The N-terminal protein was further processed into 84, 76 and 73 kDa products. Clustering analysis resolved PmpD proteins into three distinct clades with C. abortus Pmp18D, being most similar to those originating from C. psittaci, C. felis and C. caviae. This study indicates that C. abortus Pmp18D is proteolytically processed at the cell surface similar to the proteins of C. trachomatis and C. pneumoniae. However, patterns of cleavage are species-specific, with low sequence conservation of PmpD across the genus. The absence of conserved domains indicates that the function of the PmpD molecule in chlamydia remains to be elucidated.

Alien species recorded in the United Arab Emirates: an initial list of terrestrial and freshwater species

Directory of Open Access Journals (Sweden)

Pritpal Soorae

2015-10-01

Full Text Available Little is documented on the alien terrestrial and freshwater species in the United Arab Emirates. To address this, an assessment of terrestrial and freshwater alien species was conducted using various techniques such as a questionnaire, fieldwork data, networking with relevant people, and a detailed literature review. The results of the initial assessment show that there are 146 alien species recorded in the following seven major taxonomic groups: invertebrates 49 species, freshwater fish five species, amphibian one species, reptiles six species, birds 71 species, mammals six species and plants eight species. To inform decision makers a full list of the 146 species identified in this assessment is presented. 

Linking Keystone Species and Functional Groups: A New Operational Definition of the Keystone Species Concept

OpenAIRE

Robert D. Davic

2003-01-01

The concept of the "keystone species" is redefined to allow for the a priori prediction of these species within ecosystems. A keystone species is held to be a strongly interacting species whose top-down effect on species diversity and competition is large relative to its biomass dominance within a functional group. This operational definition links the community importance of keystone species to a specific ecosystem process, e.g., the regulation of species diversity, within functional groups ...

The functional biogeography of species

DEFF Research Database (Denmark)

Carstensen, Daniel W.; Dalsgaard, Bo; Svenning, Jens-Christian

2013-01-01

Biogeographical systems can be analyzed as networks of species and geographical units. Within such a biogeographical network, individual species may differ fundamentally in their linkage pattern, and therefore hold different topological roles. To advance our understanding of the relationship betw...... to distributions at the local community level. We finally discuss how our biogeographical species roles may correspond to the stages of the taxon cycle and other prominent theories of species assembly.......Biogeographical systems can be analyzed as networks of species and geographical units. Within such a biogeographical network, individual species may differ fundamentally in their linkage pattern, and therefore hold different topological roles. To advance our understanding of the relationship...... between species traits and large-scale species distribution patterns in archipelagos, we use a network approach to classify birds as one of four biogeographical species roles: peripherals, connectors, module hubs, and network hubs. These roles are based upon the position of species within the modular...

Comparison of Human and Guinea Pig Acetylcholinesterase Sequences and Rates of Oxime-Assisted Reactivation

Science.gov (United States)

2010-01-01

of appropriate animal model systems. For OP poisoning, the guinea pig (Cavia porcellus) is a commonly used animal model because guinea pigs more...endogenous bioscavenger in vivo. Although guinea pigs historically have been used to test OP poisoning therapies, it has been found recently that guinea pig AChE...transcribed mRNA encoding guinea pig AChE, amplified the resulting cDNA, and sequenced this product. The nucleotide and deduced amino acid sequences of

Linking Keystone Species and Functional Groups: A New Operational Definition of the Keystone Species Concept

Directory of Open Access Journals (Sweden)

Robert D. Davic

2003-07-01

Full Text Available The concept of the "keystone species" is redefined to allow for the a priori prediction of these species within ecosystems. A keystone species is held to be a strongly interacting species whose top-down effect on species diversity and competition is large relative to its biomass dominance within a functional group. This operational definition links the community importance of keystone species to a specific ecosystem process, e.g., the regulation of species diversity, within functional groups at lower trophic levels that are structured by competition for a limited resource. The a priori prediction of keystone species has applied value for the conservation of natural areas.

Invading species in the Eel River, California: Successes, failures, and relationships with resident species

Science.gov (United States)

Brown, L.R.; Moyle, P.B.

1997-01-01

We examined invasions of non-native fishes into the Eel River, California. At least 16 species of fish have been introduced into the drainage which originally supported 12-14 fish species. Our study was prompted by the unauthorized introduction in 1979 of Sacramento squawfish, Ptychocheilus grandis, a large predatory cyprinid. From 1986 to 1990, we conducted growth and diet studies of squaw fish, conducted intensive surveys of the distribution and habitat associations of both native and introduced species, and examined the nature of species-habitat and interspecies relationships. We found no evidence for increased growth or expanded feeding habits, compared to native populations, of Sacramento squawfish as they invaded the Eel River drainage. Ten of the introduced species were well established, with four species limited to a reservoir and six species established in streams. The success or failure of introductions of stream species appeared to be a function of the ability of a species to survive the fluctuating, highly seasonal, flow regime. The present mixture of native and exotic species has not formed stable fish assemblages but it seems likely that four habitat-associated assemblages will develop. The overall effect of the successful species introductions has been to assemble a group of species, with some exceptions, that are native to and occur together in many California streams. The assemblages now forming are similar to those found in other California streams. The assemblage characterized by squawfish and suckers is likely to be resistant to invasion, in the absence of human caused habitat modifications.

Species accounts. Chapter 4

Science.gov (United States)

Margaret K. Trani; W. Mark Ford; Brian R., eds. Chapman

2007-01-01

Narrative accounts for each species are presented by several authors in a consistent format to convey specific information relative to that mammal. The orders are arranged phylogenetically; families and species are arranged alphabetically to facilitate finding a particular species.

Genetic sorting of subordinate species in grassland modulated by intraspecific variation in dominant species.

Directory of Open Access Journals (Sweden)

Danny J Gustafson

Full Text Available Genetic variation in a single species can have predictable and heritable effects on associated communities and ecosystem processes, however little is known about how genetic variation of a dominant species affects plant community assembly. We characterized the genetic structure of a dominant grass (Sorghastrum nutans and two subordinate species (Chamaecrista fasciculata, Silphium integrifolium, during the third growing season in grassland communities established with genetically distinct (cultivated varieties or local ecotypes seed sources of the dominant grasses. There were genetic differences between subordinate species growing in the cultivar versus local ecotype communities, indicating that intraspecific genetic variation in the dominant grasses affected the genetic composition of subordinate species during community assembly. A positive association between genetic diversity of S. nutans, C. fasciculata, and S. integrifolium and species diversity established the role of an intraspecific biotic filter during community assembly. Our results show that intraspecific variation in dominant species can significantly modulate the genetic composition of subordinate species.

Biodiversity in the cyclic competition system of three species according to the emergence of mutant species

Science.gov (United States)

Park, Junpyo

2018-05-01

Understanding mechanisms which promote or hinder existing ecosystems are important issues in ecological sciences. In addition to fundamental interactions such as competition and migration among native species, existing ecosystems can be easily disturbed by external factors, and the emergence of new species may be an example in such cases. The new species which does not exist in a current ecosystem can be regarded as either alien species entered from outside or mutant species born by mutation in existing normal species. Recently, as existing ecosystems are getting influenced by various physical/chemical external factors, mutation due to anthropogenic and environmental factors can occur more frequently and is thus attracting much attention for the maintenance of ecosystems. In this paper, we consider emergences of mutant species among self-competing three species in the cyclic dominance. By defining mutation as the birth of mutant species, we investigate how mutant species can affect biodiversity in the existing ecosystem. Through microscopic and macroscopic approaches, we have found that the society of existing normal species can be disturbed by mutant species either the society is maintained accompanying with the coexistence of all species or jeopardized by occupying of mutant species. Due to the birth of mutant species, the existing society may be more complex by constituting two different groups of normal and mutant species, and our results can be contributed to analyze complex ecosystems of many species. We hope our findings may propose a new insight on mutation in cyclic competition systems of many species.

Attempted integration of multiple species of turaco into a mixed-species aviary.

Science.gov (United States)

Valuska, Annie J; Leighty, Katherine A; Ferrie, Gina M; Nichols, Valerie D; Tybor, Cheryl L; Plassé, Chelle; Bettinger, Tamara L

2013-03-01

Mixed-species exhibits offer a variety of benefits but can be challenging to maintain due to difficulty in managing interspecific interactions. This is particularly true when little has been documented on the behavior of the species being mixed. This was the case when we attempted to house three species of turaco (family: Musophagidae) together with other species in a walk-through aviary. To learn more about the behavior of great blue turacos, violaceous turacos, and white-bellied gray go-away birds, we supplemented opportunistic keeper observations with systematic data collection on their behavior, location, distance from other birds, and visibility to visitors. Keepers reported high levels of aggression among turacos, usually initiated by a go-away bird or a violaceous turaco. Most aggression occurred during feedings or when pairs were defending nest sites. Attempts to reduce aggression by temporarily removing birds to holding areas and reintroducing them days later were ineffective. Systematic data collection revealed increased social behavior, including aggression, during breeding season in the violaceous turacos, as well as greater location fidelity. These behavioral cues may be useful in predicting breeding behavior in the future. Ultimately, we were only able to house three species of turaco together for a short time, and prohibitively high levels of conflict occurred when pairs were breeding. We conclude that mixing these three turaco species is challenging and may not be the most appropriate housing situation for them, particularly during breeding season. However, changes in turaco species composition, sex composition, or exhibit design may result in more compatible mixed-turaco species groups. © 2012 Wiley Periodicals, Inc.

Wild genius - domestic fool? Spatial learning abilities of wild and domestic guinea pigs

Directory of Open Access Journals (Sweden)

Sachser Norbert

2010-03-01

Full Text Available Abstract Background Domestic animals and their wild relatives differ in a wide variety of aspects. The process of domestication of the domestic guinea pig (Cavia aperea f. porcellus, starting at least 4500 years ago, led to changes in the anatomy, physiology, and behaviour compared with their wild relative, the wild cavy, Cavia aperea. Although domestic guinea pigs are widely used as a laboratory animal, learning and memory capabilities are often disregarded as being very scarce. Even less is known about learning and memory of wild cavies. In this regard, one striking domestic trait is a reduction in relative brain size, which in the domesticated form of the guinea pig amounts to 13%. However, the common belief, that such a reduction of brain size in the course of domestication of different species is accomplished by less learning capabilities is not at all very well established in the literature. Indeed, domestic animals might also even outperform their wild conspecifics taking advantage of their adaptation to a man-made environment. In our study we compared the spatial learning abilities of wild and domestic guinea pigs. We expected that the two forms are different regarding their learning performance possibly related to the process of domestication. Therefore wild cavies as well as domestic guinea pigs of both sexes, aged 35 to 45 days, were tested in the Morris water maze to investigate their ability of spatial learning. Results Both, wild cavies and domestic guinea pigs were able to learn the task, proving the water maze to be a suitable test also for wild cavies. Regarding the speed of learning, male as well as female domestic guinea pigs outperformed their wild conspecifics significantly. Interestingly, only domestic guinea pigs showed a significant spatial association of the platform position, while other effective search strategies were used by wild cavies. Conclusion The results demonstrate that domestic guinea pigs do not at all

Wild genius - domestic fool? Spatial learning abilities of wild and domestic guinea pigs.

Science.gov (United States)

Lewejohann, Lars; Pickel, Thorsten; Sachser, Norbert; Kaiser, Sylvia

2010-03-25

Domestic animals and their wild relatives differ in a wide variety of aspects. The process of domestication of the domestic guinea pig (Cavia aperea f. porcellus), starting at least 4500 years ago, led to changes in the anatomy, physiology, and behaviour compared with their wild relative, the wild cavy, Cavia aperea. Although domestic guinea pigs are widely used as a laboratory animal, learning and memory capabilities are often disregarded as being very scarce. Even less is known about learning and memory of wild cavies. In this regard, one striking domestic trait is a reduction in relative brain size, which in the domesticated form of the guinea pig amounts to 13%. However, the common belief, that such a reduction of brain size in the course of domestication of different species is accomplished by less learning capabilities is not at all very well established in the literature. Indeed, domestic animals might also even outperform their wild conspecifics taking advantage of their adaptation to a man-made environment.In our study we compared the spatial learning abilities of wild and domestic guinea pigs. We expected that the two forms are different regarding their learning performance possibly related to the process of domestication. Therefore wild cavies as well as domestic guinea pigs of both sexes, aged 35 to 45 days, were tested in the Morris water maze to investigate their ability of spatial learning. Both, wild cavies and domestic guinea pigs were able to learn the task, proving the water maze to be a suitable test also for wild cavies. Regarding the speed of learning, male as well as female domestic guinea pigs outperformed their wild conspecifics significantly. Interestingly, only domestic guinea pigs showed a significant spatial association of the platform position, while other effective search strategies were used by wild cavies. The results demonstrate that domestic guinea pigs do not at all perform worse than their wild relatives in tests of spatial

Bactérias do gênero Aeromonas em água de matadouro bovino Aeromonas bacteria in beef slaughtering water

Directory of Open Access Journals (Sweden)

O.D. Rossi Jr

2000-10-01

Full Text Available Verificou-se a ocorrência de bactérias do gênero Aeromonas em amostras de água (abastecimento/residuária obtidas em matadouro bovino. Analisaram-se a água utilizada nas dependências internas, a água dos currais, utilizada na dessedentação, pré-higienização e tranqüilização dos animais e a água residuária da lavagem das carcaças. Das 30 amostras representativas de cada tipo, bactérias do gênero Aeromonas foram isoladas em 10 (33,3% amostras da água dos currais e em 10 (33,3% amostras da água residuária da lavagem de carcaças. Nenhuma das amostras da água tratada de abastecimento das instalações revelou-se positiva no isolamento. As espécies isoladas foram Aeromonas hydrophila em duas (2,2% e Aeromonas caviae em 19 (21,1% amostras. Uma cepa considerada atípica foi isolada da água dos currais. Os resultados evidenciaram que a água dos currais pode ser uma importante fonte de contaminação, principalmente para a pele, e através dela as Aeromonas sp. podem chegar à sala de matança.The aim of this work was to verify the occurrence of Aeromonas bacteria in samples of water (supply and residual collected at beef slaughterhouse. Water used at the internal facilities, water from corrals, drinking water, water for pre-hygiene and tranquilization of the animals and residual water from carcasses’ wash, were analyzed. From those 30 samples of each type, Aeromonas bacteria were isolated in 10 (33.3% samples of corral water and in 10 (33.3% samples of residual water from carcasses’ wash. None of the facilities treated water supply samples showed positive in isolation. The isolated species were Aeromonas hydrophila in two (2.2% and Aeromonas caviae in 19 (21.1% of the samples. One non-typical strain was isolated from corral water. The results demonstrated that corral water may be an important contamination source, mainly to the hide and, through it, Aeromonas sp. can reach the slaughter room.

Effect of Robusta coffee beans ointment on full thickness wound healing

Directory of Open Access Journals (Sweden)

Yorinta Putri Kenisa

2012-03-01

Full Text Available Background: Traumatic lesions, whether chemical, physical, or thermal in nature, are among the most common lesion in the mouth. Wound healing is essential for the maintenance of normal structure, function, and survival of organisms. Experiments of Robusta coffee powder on rat-induced alloxan incision wound, clinically demonstrated similar healing rate with the povidone iodine 10%. No studies that look directly the effect of coffee extract in ointment form when viewed in terms of histopathology. Robusta coffee bean (Coffea canephora consists of chlorogenic acid (CGA and caffeic acid which are belived to act as antioxidant and take part in wound healing process. Purpose: The aim of this study was to identify the enhancement of healing process of full-thickness skin wound after Robusta coffee beans extract ointment application. Methods: Sample consisted of 20 Cavia cabaya treated with full-thickness with wounds and was given Robusta coffee beans extract ointment concentration range of 22.5%, 45%, and 90% except the control group which was given ointment base material. Animals were then harvested on the fourth day and made for histopathological preparations. Data were calculated and compared by one-way ANOVA test and LSD test. Results: The study showed that Robusta coffee bean extract ointment can increase the number of lymphocytes, plasma cells, macrophages, fibroblasts, and blood vessels by the presence of chlorogenic acid (CGA and Caffeic acid. Conclusion: In conclusion Robusta coffee bean extract ointment enhance the healing process of fullthickness skin wound of Cavia cabaya.Latar belakang: Lesi traumatik, baik akibat rangsang kimia, fisik, atau termal, merupakan lesi yang paling umum terjadi di dalam rongga mulut. Penyembuhan luka yang terjadi ini penting untuk pemeliharaan struktur normal, fungsi, dan kelangsungan hidup organisme. Percobaan pemberian bubuk kopi Robusta terhadap luka sayatan pada tikus yang diinduksi aloksan, secara klinis

Endangered Species Act

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The purpose of the Endangered Species Act (ESA) is to protect and recover imperiled species and the ecosystems upon which they depend. The U.S. Fish and Wildlife...

Enriched open field facilitates exercise and social interaction in 2 strains of guinea pigs (Cavia porcellus).

Science.gov (United States)

Brewer, Jacob S; Bellinger, Seanceray A; Joshi, Prianca; Kleven, Gale A

2014-07-01

Current housing guidelines for laboratory rodents include recommendations for enrichment. Working with guinea pigs, we have developed an open-field enrichment paradigm that provides several aspects of this species' natural environment. These naturalistic aspects include access to increased space for exploration, access to western timothy (Phleum pratense L.) hay, and grouping as a herd to facilitate social interaction. To determine the immediate effect on behavior from access to the enriched environment, female guinea pigs from 2 strains, IAF Hairless and NIH Hartley, were observed in both standard home cages and an open-field enriched environment. Subjects were housed with cagemates in pairs for the home-cage observation and were grouped as a herd when in the open-field arena. Behaviors were videorecorded for 1 h and then scored. Salivary cortisol levels were measured both prior to and immediately after behavioral observations. Analyses revealed higher levels of activity and social interaction in the open-field arena compared with the home cage, with no significant change in salivary cortisol levels. These results suggest that exposure to the open-field environment provide increased opportunities for exercise and social enrichment. Although additional studies are needed to determine long-term effects on experimental outcomes, the open-field configuration holds promise as a laboratory enrichment paradigm for guinea pigs.

Species diversity modulates predation

NARCIS (Netherlands)

Kratina, P.; Vos, M.; Anholt, B.R.

2007-01-01

Predation occurs in a context defined by both prey and non-prey species. At present it is largely unknown how species diversity in general, and species that are not included in a predator's diet in particular, modify predator–prey interactions.Therefore we studied how both the density and diversity

Positive feedback in species communities

NARCIS (Netherlands)

Gerla, D.J.

2012-01-01

Sometimes the eventual population densities in a species community depend on the initial densities or the arrival times of species. If arrival times determine species composition, a priority effect has occurred. Priority effects may occur if the species community exhibits alternative stable states

Plesiomonasshigelloides and Aeromonadaceae family pathogens isolated from marine mammals of Southern and Southeastern Brazilian coast Plesiomonasshigelloides e patógenos da família Aeromonadaceae isolados de mamíferos marinhos da costa sul e sudeste do Brasil

Directory of Open Access Journals (Sweden)

Christiane S. Pereira

2008-12-01

Full Text Available The aquatic environment is the habitat of many microorganisms, including Plesiomonasshigelloides and Aeromonas species which are pathogenic to human and animals. In the present investigation, we evaluated the occurrence of these pathogens from marine mammals beached or accidentally captured by fishing net in southeastern (RJ and southern (RS coastal Brazilian regions. A total of 198 swabs from 27 specimens of marine mammals, including 11 different species, were collected by DEENSP and GEMARS-CECLIMAR/UFRGS Institutes and sent to LRNCEB/IOC/FIOCRUZ. The samples were enriched in Alkaline Peptone Water (APW added with 1% of sodium chloride (NaCl, APW plus 3% NaCl and incubated at 37ºC for 18-24 hours. Following, samples were streaked onto Pseudomonas-Aeromonas Selective Agar Base (GSP Agar and suspected colonies were biochemically characterized. The results revealed 114 strains, including ten Aeromonas species and P.shigelloides. The main pathogens isolated were A.veronii biogroup veronii (19.3%, A. caviae (12.3%, A. hydrophila (9.6% and P.shigelloides (7%. The pathogens were isolated in both coastal and offshore marine mammals. These data point the importance of epidemiological surveillance and microbiological monitoring and reinforce the need to implement environmental protection programs, especially related to endangered cetacean species.O ambiente aquático é o habitat de vários microrganismos, incluindo Plesiomonasshigelloides e espécies de Aeromonas, os quais são patogênicos para o homem e os animais. Na presente investigação, foi avaliada a ocorrência destes patógenos a partir de swabs coletados de mamíferos marinhos encalhados ou capturados acidentalmente em redes de pesca nas regiões costeiras do sudeste (RJ e sul (RS do Brasil. O total de 198 swabs de 27 espécimes de mamíferos marinhos, incluindo 11 espécies distintas, foi coletado por profissionais dos institutos DEENSP, GEMARS-CECLIMAR/UFRGS e enviado ao LRNCEB

No universal scale-dependent impacts of invasive species on native plant species richness.

Science.gov (United States)

Stohlgren, Thomas J; Rejmánek, Marcel

2014-01-01

A growing number of studies seeking generalizations about the impact of plant invasions compare heavily invaded sites to uninvaded sites. But does this approach warrant any generalizations? Using two large datasets from forests, grasslands and desert ecosystems across the conterminous United States, we show that (i) a continuum of invasion impacts exists in many biomes and (ii) many possible species-area relationships may emerge reflecting a wide range of patterns of co-occurrence of native and alien plant species. Our results contradict a smaller recent study by Powell et al. 2013 (Science 339, 316-318. (doi:10.1126/science.1226817)), who compared heavily invaded and uninvaded sites in three biomes and concluded that plant communities invaded by non-native plant species generally have lower local richness (intercepts of log species richness-log area regression lines) but steeper species accumulation with increasing area (slopes of the regression lines) than do uninvaded communities. We conclude that the impacts of plant invasions on plant species richness are not universal.

Multilocus genetics to reconstruct aeromonad evolution

Directory of Open Access Journals (Sweden)

Roger Frédéric

2012-04-01

Full Text Available Abstract Background Aeromonas spp. are versatile bacteria that exhibit a wide variety of lifestyles. In an attempt to improve the understanding of human aeromonosis, we investigated whether clinical isolates displayed specific characteristics in terms of genetic diversity, population structure and mode of evolution among Aeromonas spp. A collection of 195 Aeromonas isolates from human, animal and environmental sources was therefore genotyped using multilocus sequence analysis (MLSA based on the dnaK, gltA, gyrB, radA, rpoB, tsf and zipA genes. Results The MLSA showed a high level of genetic diversity among the population, and multilocus-based phylogenetic analysis (MLPA revealed 3 major clades: the A. veronii, A. hydrophila and A. caviae clades, among the eleven clades detected. Lower genetic diversity was observed within the A. caviae clade as well as among clinical isolates compared to environmental isolates. Clonal complexes, each of which included a limited number of strains, mainly corresponded to host-associated subsclusters of strains, i.e., a fish-associated subset within A. salmonicida and 11 human-associated subsets, 9 of which included only disease-associated strains. The population structure was shown to be clonal, with modes of evolution that involved mutations in general and recombination events locally. Recombination was detected in 5 genes in the MLSA scheme and concerned approximately 50% of the STs. Therefore, these recombination events could explain the observed phylogenetic incongruities and low robustness. However, the MLPA globally confirmed the current systematics of the genus Aeromonas. Conclusions Evolution in the genus Aeromonas has resulted in exceptionally high genetic diversity. Emerging from this diversity, subsets of strains appeared to be host adapted and/or “disease specialized” while the A. caviae clade displayed an atypical tempo of evolution among aeromonads. Considering that A. salmonicida has been

Population genetics and cryptic species

International Nuclear Information System (INIS)

McPheron, Bruce A.

2000-01-01

Does the definition of a species matter for pest management purposes? Taxonomists provide us with tools - usually morphological characters - to identify a group of organisms that we call a species. The implication of this identification is that all of the individuals that fit the provided description are members of the species in question. The taxonomists have considered the range of variation among individuals in defining the species, but this variation is often forgotten when we take the concept of species to the level of management. Just as there is morphological variation among individuals, there is also variation in practically any character we might imagine, which has implications for the short and long term success of our management tactics. The rich literature on insecticide resistance should be a constant reminder of the fact that the pressure on pest survival and reproduction applied by our management approaches frequently leads to evolutionary changes within the pest species. The degree of variation within a particular species is a defining characteristic of that species. This level of variability may have very important implications for successful management, so it is very important to measure variation and, whenever possible, the genetic basis of that variation, in a target species. Population genetic approaches can provide evidence of genetic structure (or lack thereof) among populations of a species. These types of data can be used to discuss the movement of pest populations on a local or global scale. In other cases, we may have a complex of species that share some, but not all, characteristics. Species complexes that share morphological characters (i.e., cannot be easily distinguished) but not biological characters are referred to as sibling or cryptic species

Extragastric Helicobacter species

DEFF Research Database (Denmark)

On, Stephen L.W.; Hynes, S.; Wadstrom, T.

2002-01-01

The genus Helicobacter has expanded at a rapid pace and no fewer than 31 species have been named since the proposal of the genus in 1989. Of these 31 species, 22 are principally associated with extragastric niches and there is increasing interest in the role of these taxa in diseases of humans...... and animals. Substantial evidence attests to certain species playing a role in the pathogenesis of enteric, hepatic and biliary disorders and some taxa demonstrate zoonotic potential. The importance of extragastric Helicobacters is likely to be an important topic for research in the near future. Here...

Four new species of Pteromalus Swederus (Hymenoptera: Chalcidoidea: Pteromalidae) and redescriptions of three other species

NARCIS (Netherlands)

Gijswijt, M.J.

1999-01-01

A key to the European species of the Pteromalus altus group is presented. The relationship between this group and species of the genus Euphorbia (Euphorbiaceae) is confirmed. One new species: P. villosae, associated with Euphorbia villosa Waldst. & Kit.is presented. Two new species of the albipennis

Fuzzy species among recombinogenic bacteria

Directory of Open Access Journals (Sweden)

Fraser Christophe

2005-03-01

Full Text Available Abstract Background It is a matter of ongoing debate whether a universal species concept is possible for bacteria. Indeed, it is not clear whether closely related isolates of bacteria typically form discrete genotypic clusters that can be assigned as species. The most challenging test of whether species can be clearly delineated is provided by analysis of large populations of closely-related, highly recombinogenic, bacteria that colonise the same body site. We have used concatenated sequences of seven house-keeping loci from 770 strains of 11 named Neisseria species, and phylogenetic trees, to investigate whether genotypic clusters can be resolved among these recombinogenic bacteria and, if so, the extent to which they correspond to named species. Results Alleles at individual loci were widely distributed among the named species but this distorting effect of recombination was largely buffered by using concatenated sequences, which resolved clusters corresponding to the three species most numerous in the sample, N. meningitidis, N. lactamica and N. gonorrhoeae. A few isolates arose from the branch that separated N. meningitidis from N. lactamica leading us to describe these species as 'fuzzy'. Conclusion A multilocus approach using large samples of closely related isolates delineates species even in the highly recombinogenic human Neisseria where individual loci are inadequate for the task. This approach should be applied by taxonomists to large samples of other groups of closely-related bacteria, and especially to those where species delineation has historically been difficult, to determine whether genotypic clusters can be delineated, and to guide the definition of species.

Enolonium Species-Umpoled Enolates

DEFF Research Database (Denmark)

Arava, Shlomy; Kumar, Jayprakash N.; Maksymenko, Shimon

2017-01-01

Enolonium species/iodo(III) enolates of carbonyl compounds have been suggested to be intermediates in a wide variety of hypervalent iodine induced chemical transformations of ketones, including α-C-O, α-C-N, α-C-C, and alpha-carbon- halide bond formation, but they have never been characterized. We...... report that these elusive umpoled enolates may be made as discrete species that are stable for several minutes at-78 degrees C, and report the first spectroscopic identification of such species. It is shown that enolonium species are direct intermediates in C-O, C-N, C-Cl, and C-C bond forming reactions....... Our results open up chemical space for designing a variety of new transformations. We showcase the ability of enolonium species to react with prenyl, crotyl, cinnamyl, and allyl silanes with absolute regioselectivity in up to 92% yield....

Two new species of the Phanaeus endymion species group (Coleoptera, Scarabaeidae, Scarabaeinae).

Science.gov (United States)

Moctezuma, Victor; Sánchez-Huerta, José Luis; Halffter, Gonzalo

2017-01-01

Phanaeus bravoensis sp. n. is described from the coniferous-oak forests in the state of Guerrero, and P. huichol sp. n. from coniferous-oak forests and cloud forests in Jalisco and Nayarit. The new species are closely related to P. halffterorum and P. zoque respectively. Morphological trait combination, geographic distribution, and trophic habits show important differences among the studied species. A distribution map and an updated key to separate the species are included.

Bias correction in species distribution models: pooling survey and collection data for multiple species.

Science.gov (United States)

Fithian, William; Elith, Jane; Hastie, Trevor; Keith, David A

2015-04-01

Presence-only records may provide data on the distributions of rare species, but commonly suffer from large, unknown biases due to their typically haphazard collection schemes. Presence-absence or count data collected in systematic, planned surveys are more reliable but typically less abundant.We proposed a probabilistic model to allow for joint analysis of presence-only and survey data to exploit their complementary strengths. Our method pools presence-only and presence-absence data for many species and maximizes a joint likelihood, simultaneously estimating and adjusting for the sampling bias affecting the presence-only data. By assuming that the sampling bias is the same for all species, we can borrow strength across species to efficiently estimate the bias and improve our inference from presence-only data.We evaluate our model's performance on data for 36 eucalypt species in south-eastern Australia. We find that presence-only records exhibit a strong sampling bias towards the coast and towards Sydney, the largest city. Our data-pooling technique substantially improves the out-of-sample predictive performance of our model when the amount of available presence-absence data for a given species is scarceIf we have only presence-only data and no presence-absence data for a given species, but both types of data for several other species that suffer from the same spatial sampling bias, then our method can obtain an unbiased estimate of the first species' geographic range.

Redescription of four species of Mehdiella from Testudinidae, with a key to the species and discussion on the relationships among the species of this genus

Directory of Open Access Journals (Sweden)

Bouamer S.

2003-12-01

Full Text Available Four species of the genus Mehdiella Seurat, 1918 are redescribed: M. cristata Petter, 1966 and M. stylosa dollfusi Petter, 1966, parasite of Pyxix arachnoides Bell, 1827 from Madagascar, M. s. stylosa (Thapar, 1 925 and M. uncinata (Drasche, 1884, parasite of Testudo graeca Linneaus, 1758, Testudo hermanni Gmelin, 1789 and Testudo horsfieldii (Gray, 1844 from Palaearctic region. Light microscopy and scanning electron microscopy (SEM studies revealed new informations on the morphology of these species. On the basis of this morphological study, the sub-species Mehdiella stylosa dollfusi and M. s. stylosa are raised to level of species. The position of Mehdiella cristata among the species of the genus Mehdiella and the relationships among the species of the genus Mehdiella are discussed. A key to the eight valid species Mehdiella is given.

Redescription of four species of Mehdiella from Testudinidae, with a key to the species and discussion on the relationships among the species of this genus.

Science.gov (United States)

Bouamer, S; Morand, S; Kara, M

2003-12-01

Four species of the genus Mehdiella Seurat, 1918 are redescribed: M. cristata Petter, 1966 and M. stylosa dollfusi Petter, 1966, parasite of Pyxix arachnoides Bell, 1827 from Madagascar, M. s. stylosa (Thapar, 1925) and M. uncinata (Drasche, 1884), parasite of Testudo graeca Linneaus, 1758, Testudo hermanni Gmelin, 1789 and Testudo horsfieldii (Gray, 1844) from Palaearctic region. Light microscopy and scanning electron microscopy (SEM) studies revealed new informations on the morphology of these species. On the basis of this morphological study, the sub-species Mehdiella stylosa dollfusi and M. s. stylosa are raised to level of species. The position of Mehdiella cristata among the species of the genus Mehdiella and the relationships among the species of the genus Mehdiella are discussed. A key to the eight valid species Mehdiella is given.

Species composition and abundance of Brevipalpus spp. on different citrus species in Mexican orchards.

Science.gov (United States)

Salinas-Vargas, D; Santillán-Galicia, M T; Valdez-Carrasco, J; Mora-Aguilera, G; Atanacio-Serrano, Y; Romero-Pescador, P

2013-08-01

We studied the abundance of Brevipalpus spp. in citrus orchards in the Mexican states of Yucatan, Quintana Roo and Campeche. Mites were collected from 100 trees containing a mixture of citrus species where sweet orange was always the main species. Eight collections were made at each location from February 2010 to February 2011. Mites from the genus Brevipalpus were separated from other mites surveyed and their abundance and relationships with the different citrus species were quantified throughout the collection period. A subsample of 25% of the total Brevipalpus mites collected were identified to species level and the interaction of mite species and citrus species were described. Brevipalpus spp. were present on all collection dates and their relative abundance was similar on all citrus species studies. The smallest number of mites collected was during the rainy season. Brevipalpus phoenicis (Geijskes) and Brevipalpus californicus (Banks) were the only two species present and they were found in all locations except Campeche, where only B. phoenicis was present. Yucatan and Campeche are at greater risk of leprosis virus transmission than Quintana Roo because the main vector, B. phoenicis, was more abundant than B. californicus. The implications of our results for the design of more accurate sampling and control methods for Brevipalpus spp. are discussed.

Insular species swarm goes underground

DEFF Research Database (Denmark)

P. S. Reboleira, Ana Sofia; Enghoff, Henrik

2014-01-01

Two new species of the genus Cylindroiulus Verhoeff, 1894, C. julesvernei and C. oromii, are described from the subterranean ecosystem of Madeira Island, Portugal. Species are illustrated with photographs and diagrammatic drawings. The new species belong to the Cylindroiulus madeirae......-group, an insular species swarm distributed in the archipelagos of Madeira and the Canary Islands. We discuss the differences between the new species and their relatives and present information on the subterranean environment of Madeira. An updated overview of the subterranean biodiversity of millipedes...

Effects of 'target' plant species body size on neighbourhood species richness and composition in old-field vegetation.

Directory of Open Access Journals (Sweden)

Brandon S Schamp

Full Text Available Competition is generally regarded as an important force in organizing the structure of vegetation, and evidence from several experimental studies of species mixtures suggests that larger mature plant size elicits a competitive advantage. However, these findings are at odds with the fact that large and small plant species generally coexist, and relatively smaller species are more common in virtually all plant communities. Here, we use replicates of ten relatively large old-field plant species to explore the competitive impact of target individual size on their surrounding neighbourhoods compared to nearby neighbourhoods of the same size that are not centred by a large target individual. While target individuals of the largest of our test species, Centaurea jacea L., had a strong impact on neighbouring species, in general, target species size was a weak predictor of the number of other resident species growing within its immediate neighbourhood, as well as the number of resident species that were reproductive. Thus, the presence of a large competitor did not restrict the ability of neighbouring species to reproduce. Lastly, target species size did not have any impact on the species size structure of neighbouring species; i.e. they did not restrict smaller, supposedly poorer competitors, from growing and reproducing close by. Taken together, these results provide no support for a size-advantage in competition restricting local species richness or the ability of small species to coexist and successfully reproduce in the immediate neighbourhood of a large species.

Community structure informs species geographic distributions

KAUST Repository

Montesinos-Navarro, Alicia

2018-05-23

Understanding what determines species\\' geographic distributions is crucial for assessing global change threats to biodiversity. Measuring limits on distributions is usually, and necessarily, done with data at large geographic extents and coarse spatial resolution. However, survival of individuals is determined by processes that happen at small spatial scales. The relative abundance of coexisting species (i.e. \\'community structure\\') reflects assembly processes occurring at small scales, and are often available for relatively extensive areas, so could be useful for explaining species distributions. We demonstrate that Bayesian Network Inference (BNI) can overcome several challenges to including community structure into studies of species distributions, despite having been little used to date. We hypothesized that the relative abundance of coexisting species can improve predictions of species distributions. In 1570 assemblages of 68 Mediterranean woody plant species we used BNI to incorporate community structure into Species Distribution Models (SDMs), alongside environmental information. Information on species associations improved SDM predictions of community structure and species distributions moderately, though for some habitat specialists the deviance explained increased by up to 15%. We demonstrate that most species associations (95%) were positive and occurred between species with ecologically similar traits. This suggests that SDM improvement could be because species co-occurrences are a proxy for local ecological processes. Our study shows that Bayesian Networks, when interpreted carefully, can be used to include local conditions into measurements of species\\' large-scale distributions, and this information can improve the predictions of species distributions.

Introduced species as evolutionary traps

Science.gov (United States)

Schlaepfer, Martin A.; Sherman, P.W.; Blossey, B.; Runge, M.C.

2005-01-01

Invasive species can alter environments in such a way that normal behavioural decision-making rules of native species are no longer adaptive. The evolutionary trap concept provides a useful framework for predicting and managing the impact of harmful invasive species. We discuss how native species can respond to changes in their selective regime via evolution or learning. We also propose novel management strategies to promote the long-term co-existence of native and introduced species in cases where the eradication of the latter is either economically or biologically unrealistic.

Why some plant species are rare.

Science.gov (United States)

Wieger Wamelink, G W; Wamelink, G W Weiger; Goedhart, Paul W; Frissel, Joep; Frissel, Josep Y

2014-01-01

Biodiversity, including plant species diversity, is threatened worldwide as a result of anthropogenic pressures such as an increase of pollutants and climate change. Rare species in particular are on the verge of becoming extinct. It is still unclear as to why some plant species are rare and others are not. Are they rare due to: intrinsic reasons, dispersal capacity, the effects of management or abiotic circumstances? Habitat preference of rare plant species may play an important role in determining why some species are rare. Based on an extensive data set of soil parameters we investigated if rarity is due to a narrow habitat preference for abiotic soil parameters. For 23 different abiotic soil parameters, of which the most influential were groundwater-table, soil-pH and nutrient-contents, we estimated species responses for common and rare species. Based on the responses per species we calculated the range of occurrence, the range between the 5 and 95 percentile of the response curve giving the habitat preference. Subsequently, we calculated the average response range for common and rare species. In addition, we designed a new graphic in order to provide a better means for presentation of the results. The habitat preferences of rare species for abiotic soil conditions are significantly narrower than for common species. Twenty of the twenty-three abiotic parameters showed on average significantly narrower habitat preferences for rare species than for common species; none of the abiotic parameters showed on average a narrower habitat preference for common species. The results have major implications for the conservation of rare plant species; accordingly management and nature development should be focussed on the maintenance and creation of a broad range of environmental conditions, so that the requirements of rare species are met. The conservation of (abiotic) gradients within ecosystems is particularly important for preserving rare species.

Species associations in a species-rich subtropical forest were not well-explained by stochastic geometry of biodiversity.

Science.gov (United States)

Wang, Qinggang; Bao, Dachuan; Guo, Yili; Lu, Junmeng; Lu, Zhijun; Xu, Yaozhan; Zhang, Kuihan; Liu, Haibo; Meng, Hongjie; Jiang, Mingxi; Qiao, Xiujuan; Huang, Handong

2014-01-01

The stochastic dilution hypothesis has been proposed to explain species coexistence in species-rich communities. The relative importance of the stochastic dilution effects with respect to other effects such as competition and habitat filtering required to be tested. In this study, using data from a 25-ha species-rich subtropical forest plot with a strong topographic structure at Badagongshan in central China, we analyzed overall species associations and fine-scale species interactions between 2,550 species pairs. The result showed that: (1) the proportion of segregation in overall species association analysis at 2 m neighborhood in this plot followed the prediction of the stochastic dilution hypothesis that segregations should decrease with species richness but that at 10 m neighborhood was higher than the prediction. (2) The proportion of no association type was lower than the expectation of stochastic dilution hypothesis. (3) Fine-scale species interaction analyses using Heterogeneous Poisson processes as null models revealed a high proportion (47%) of significant species effects. However, the assumption of separation of scale of this method was not fully met in this plot with a strong fine-scale topographic structure. We also found that for species within the same families, fine-scale positive species interactions occurred more frequently and negative ones occurred less frequently than expected by chance. These results suggested effects of environmental filtering other than species interaction in this forest. (4) We also found that arbor species showed a much higher proportion of significant fine-scale species interactions (66%) than shrub species (18%). We concluded that the stochastic dilution hypothesis only be partly supported and environmental filtering left discernible spatial signals in the spatial associations between species in this species-rich subtropical forest with a strong topographic structure.

Species associations in a species-rich subtropical forest were not well-explained by stochastic geometry of biodiversity.

Directory of Open Access Journals (Sweden)

Qinggang Wang

Full Text Available The stochastic dilution hypothesis has been proposed to explain species coexistence in species-rich communities. The relative importance of the stochastic dilution effects with respect to other effects such as competition and habitat filtering required to be tested. In this study, using data from a 25-ha species-rich subtropical forest plot with a strong topographic structure at Badagongshan in central China, we analyzed overall species associations and fine-scale species interactions between 2,550 species pairs. The result showed that: (1 the proportion of segregation in overall species association analysis at 2 m neighborhood in this plot followed the prediction of the stochastic dilution hypothesis that segregations should decrease with species richness but that at 10 m neighborhood was higher than the prediction. (2 The proportion of no association type was lower than the expectation of stochastic dilution hypothesis. (3 Fine-scale species interaction analyses using Heterogeneous Poisson processes as null models revealed a high proportion (47% of significant species effects. However, the assumption of separation of scale of this method was not fully met in this plot with a strong fine-scale topographic structure. We also found that for species within the same families, fine-scale positive species interactions occurred more frequently and negative ones occurred less frequently than expected by chance. These results suggested effects of environmental filtering other than species interaction in this forest. (4 We also found that arbor species showed a much higher proportion of significant fine-scale species interactions (66% than shrub species (18%. We concluded that the stochastic dilution hypothesis only be partly supported and environmental filtering left discernible spatial signals in the spatial associations between species in this species-rich subtropical forest with a strong topographic structure.

Unilateral flank ovariohysterectomy in guinea pigs (Cavia porcellus).

Science.gov (United States)

Rozanska, D; Rozanski, P; Orzelski, M; Chlebicka, N; Putowska, K

2016-11-01

To describe a simple, minimally invasive method of ovariohysterectomy via a unilateral flank approach in guinea pigs, for use in routine desexing of healthy female guinea pigs or treatment of ovarian cysts. The subjects of this retrospective study were 41 client-owned guinea pigs submitted for routine desexing or treatment of ovarian cysts. They included 16 healthy female guinea pigs aged 8-12 months (Group 1), and 15 females aged from 9 months to 3 years (Group 2), and 10 females aged from 3 to 7 years (Group 3) with different-sized ovarian cysts. Prior to surgery, the animals received clinical examination, blood testing (complete blood count and serum biochemistry profile) and examination of the abdomen using ultrasonography, to assess the condition of the reproductive tract and ensure the guinea pigs were fit for surgery. Ovariohysterectomy was performed via a unilateral flank incision made close to the erector spinae muscle starting approximately 1 cm caudal to the last rib. Both ovaries, uterine horns, and the uterine cervix were localised, ligated, and dissected through this unilateral retroperitoneal incision. Ovariohysterectomy was successfully completed via a single flank incision in 38/41 (93%) guinea pigs. Three guinea pigs with ovarian cysts from Group 3, which were >6 years old died during surgery due to circulatory and respiratory failure under anaesthesia. In the remaining 38 cases, surgery proceeded without complications. A further two guinea pigs from Group 3 were reluctant to move or eat for the first 3 days after surgery but recovered after provision of supportive care. All 38 animals fully recovered and wound healing was normal. This is the first report of ovariohysterectomy via a unilateral flank incision in guinea pigs. This approach is a simple, minimally invasive and safe alternative to the midline or bilateral flank approaches currently used for surgery of the reproductive tract in guinea pigs.

Cross-species amplification of 105 Lolium perenne SSR loci in 23 species within the Poaceae

DEFF Research Database (Denmark)

Jensen, Louise Bach; Holm, Preben Bach; Lübberstedt, Thomas

2007-01-01

Amplification of 105 Lolium perenne SSR markers was studied in 23 grass species representing seven tribes from three subfamilies of Poaceae. Twelve of the SSR markers are published for the first time. Between 2% and 96% of the SSR markers could be amplified within a given species. A subset of eight...... SSR markers was evaluated for polymorphism across nine of the 23 grass species. Four to seven of the markers were polymorphic within each species, with an average detection of 2.4 alleles per species....

New species of Moenkhausia Eigenmann, 1903 (Characiformes: Characidae with comments on the Moenkhausia oligolepis species complex

Directory of Open Access Journals (Sweden)

Ricardo C. Benine

Full Text Available A new species of Moenkhausia is described from tributaries of the rio Paraguay, Brazil. The new species is diagnosed from congeners by characters related to body coloration, the number of lateral line scales, the degree of poring of the lateral line, and number of scales rows above and below the lateral line. Molecular analyses using partial sequences of the mitochondrial gene Cytochrome Oxidase I from specimens of the new species and specimens belonging to morphologically similar species demonstrated that the new species is easily differentiated by their high genetic distance and by their position in the phylogenetic hypothesis obtained through the Maximum Parsimony methodology. The analyses of three samples of M. oligolepis also revealed that they have high genetic distances and belong to different monophyletic groups suggesting that this species corresponds to a species complex rather than a single species.

Of Domestic and Wild Guinea Pigs: Studies in Sociophysiology, Domestication, and Social Evolution

Science.gov (United States)

Sachser, Norbert

Among mammals a majority of each individual's daily expectations, motivations, and behaviors are directed to encounters with conspecifics. Therefore the knowledge of the genesis, control, and consequences of social interactions is crucial for understanding their social life. We present here our research on the sociophysiology, domestication, and social evolution of wild (Cavia aperea and Galea musteloides) and domestic (Cavia aperea f. porcellus) guinea pigs, which summarizes general rules for many group-living mammals. It is shown that social interactions have consequences not only for the individuals' reproductive success but also for their degrees of stress and welfare. The way in which individuals interact is controlled not only by the present environment but also by the previous social experiences which they have gathered during their behavioral development. Furthermore, the study of ontogeny does not begin at birth, because prenatal social factors acting on pregnant females can also affect the way in which the offspring will interact when adult. In addition, to understand the genesis of interactions between domesticated animals implies knowledge of the behavioral and physiological changes which occurred during the process of domestication. Finally, understanding the social interactions among individuals of the wild ancestor of the domesticated form requires knowledge of how their behavior patterns were brought about by natural selection during the process of social evolution.

Previously unknown species of Aspergillus.

Science.gov (United States)

Gautier, M; Normand, A-C; Ranque, S

2016-08-01

The use of multi-locus DNA sequence analysis has led to the description of previously unknown 'cryptic' Aspergillus species, whereas classical morphology-based identification of Aspergillus remains limited to the section or species-complex level. The current literature highlights two main features concerning these 'cryptic' Aspergillus species. First, the prevalence of such species in clinical samples is relatively high compared with emergent filamentous fungal taxa such as Mucorales, Scedosporium or Fusarium. Second, it is clearly important to identify these species in the clinical laboratory because of the high frequency of antifungal drug-resistant isolates of such Aspergillus species. Matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF MS) has recently been shown to enable the identification of filamentous fungi with an accuracy similar to that of DNA sequence-based methods. As MALDI-TOF MS is well suited to the routine clinical laboratory workflow, it facilitates the identification of these 'cryptic' Aspergillus species at the routine mycology bench. The rapid establishment of enhanced filamentous fungi identification facilities will lead to a better understanding of the epidemiology and clinical importance of these emerging Aspergillus species. Based on routine MALDI-TOF MS-based identification results, we provide original insights into the key interpretation issues of a positive Aspergillus culture from a clinical sample. Which ubiquitous species that are frequently isolated from air samples are rarely involved in human invasive disease? Can both the species and the type of biological sample indicate Aspergillus carriage, colonization or infection in a patient? Highly accurate routine filamentous fungi identification is central to enhance the understanding of these previously unknown Aspergillus species, with a vital impact on further improved patient care. Copyright © 2016 European Society of Clinical Microbiology and

Revision of the western Palaearctic species of Aleiodes Wesmael (Hymenoptera, Braconidae, Rogadinae. Part 1: Introduction, key to species groups, outlying distinctive species, and revisionary notes on some further species

Directory of Open Access Journals (Sweden)

Cornelis van Achterberg

2016-12-01

Full Text Available Seven new species of the genus Aleiodes Wesmael, 1838 (Braconidae: Rogadinae are described and illustrated: A. abraxanae sp. n., A. angustipterus sp. n., A. artesiariae sp. n., A. carminatus sp. n., A. diarsianae sp. n., A. leptofemur sp. n., and A. ryrholmi sp. n. A neotype is designated for each of Aleiodes circumscriptus (Nees, 1834 and A. pictus (Herrich-Schäffer, 1838, and both species are redescribed and illustrated. Aleiodes ochraceus Hellén, 1927 (not A. ochraceus (Curtis, 1834 is renamed as A. curticornis nom. n. & stat. rev., and redescribed and illustrated. Aleiodes bistrigatus Roman, 1917, A. nigriceps Wesmael, 1838, and A. reticulatus (Noskiewicz, 1956, are re-instated as valid species. A lectotype is designated for Aleiodes bistrigatus Roman. An illustrated key is given to some distinctive species and the residual species groups along which further parts of an entire revision of western Palaearctic species of Aleiodes and Heterogamus will be organised. Biology, host associations and phenology are discussed for the keyed species (in addition to the above, A. albitibia (Herrich-Schäffer, 1838, A. apiculatus (Fahringer, 1932, A. arcticus (Thomson, 1892, A. cantherius (Lyle, 1919, A. esenbeckii (Hartig, 1834, A. jakowlewi (Kokujev, 1898, A. modestus (Reinhard, 1863, A. nigricornis Wesmael, 1838, A. pallidator (Thunberg, 1822, A. praetor (Reinhard, 1863, A. seriatus (Herrich- Schäffer, 1838 sensu lato, A. testaceus (Telenga, 1941, A. ungularis (Thomson, 1892, and A. varius (Herrich-Schäffer, 1838 which are dealt with in full here (with the exception of A. seriatus s.l. which is, however, included in the key. The experimental methodology covering the revision as a whole, which involves some behavioural investigation, is outlined.

Species coextinctions and the biodiversity crisis.

Science.gov (United States)

Koh, Lian Pin; Dunn, Robert R; Sodhi, Navjot S; Colwell, Robert K; Proctor, Heather C; Smith, Vincent S

2004-09-10

To assess the coextinction of species (the loss of a species upon the loss of another), we present a probabilistic model, scaled with empirical data. The model examines the relationship between coextinction levels (proportion of species extinct) of affiliates and their hosts across a wide range of coevolved interspecific systems: pollinating Ficus wasps and Ficus, parasites and their hosts, butterflies and their larval host plants, and ant butterflies and their host ants. Applying a nomographic method based on mean host specificity (number of host species per affiliate species), we estimate that 6300 affiliate species are "coendangered" with host species currently listed as endangered. Current extinction estimates need to be recalibrated by taking species coextinctions into account.

Habitat associations of small mammals in southern Brazil and use of regurgitated pellets of birds of prey for inventorying a local fauna

Directory of Open Access Journals (Sweden)

DR. Scheibler

Full Text Available We inventoried terrestrial small mammals in an agricultural area in southern Brazil by using trapping and prey consumed by Barn Owls (Tyto alba and White-tailed Kites (Elanus leucurus. Small mammals were trapped in three habitat types: corn fields, uncultivated fields ("capoeiras", and native forest fragments. A total of 1,975 small mammal specimens were trapped, another 2,062 identified from the diet of Barn Owls, and 2,066 from the diet of White-tailed Kites. Both trapping and prey in the predators' diet yielded 18 small mammal species: three marsupials (Didelphis albiventris, Gracilinanus agilis, and Monodelphis dimidiata and 15 rodents (Akodon paranaensis, Bruceppatersonius iheringi, Calomys sp., Cavia aperea, Euryzygomatomys spinosus, Holochilus brasiliensis, Mus musculus, Necromys lasiurus, Nectomys squamipes, Oligoryzomys nigripes, Oryzomys angouya, Oxymycterus sp.1, Oxymycterus sp.2, Rattus norvegicus, and Rattus rattus (Linnaeus, 1758. The greatest richness was found in the uncultivated habitat. We concluded that the three methods studied for inventorying small mammals (prey in the diet of Barn Owls, White-tailed Kites, and trapping were complementary, since together, rather than separately, they produced a better picture of local richness.

Unusual microorganisms and antimicrobial resistances in a group of Syrian migrants: Sentinel surveillance data from an asylum seekers centre in Italy.

Science.gov (United States)

Angeletti, Silvia; Ceccarelli, Giancarlo; Vita, Serena; Dicuonzo, Giordano; Lopalco, Maurizio; Dedej, Etleva; Blasi, Aletheia; Antonelli, Francesca; Conti, Alessia; De Cesaris, Marina; Farchi, Francesca; Lo Presti, Alessandra; Ciccozzi, Massimo

2016-01-01

Three years of civil war in Syria have caused death and increase of communicable diseases. The suffering population has been forced to migrate creating a fertile condition for epidemic spread of infection within the refugee camps. Forty-eight Syrian migrants, upon their arrival in Italy, were accommodated at the asylum seekers centre of Castelnuovo di Porto. They received a physical examination and were subjected to microbiological surveillance by blood, rectal, pharyngeal and nasal swabs collection and delivering to the Clinical Pathology and Microbiology Laboratory of the University Campus Bio-Medico of Rome. All refugees resulted negative for HBV, HCV and HIV infections. In swabs a large number of unusual gram-negative bacteria species were isolated, such as Pseudomonas putida, Pseudomonas monteilii, Pseudomonas fulva, Pseudomonas moselii, Aeromonas veronii, Aeromonas caviae, Aeromonas hydrophila, Acinteobacter guilloviae, Acinteobacter lowffii; Acinetobacter johnsonii; Acinteobacter tjernbergae; Pantoea agglomerans; Pantoea calida. Among isolates, strains resistant to carbapenems, ESBL producers and methicillin resistant were found. The microbiological surveillance performed represents a useful action to understand refugees health status and to trace unusual microorganisms movement even carriers of antimicrobial resistance during migrants traveling. Copyright © 2016 Elsevier Ltd. All rights reserved.

Le mini-élevage, son développement villageoiset l'action de BEDIM

Directory of Open Access Journals (Sweden)

Jacques Hardouin

1997-01-01

Full Text Available Minilivestock, village development and the role of BEDIM.Minilivestock encompasses all animals of small site, and little-known in terras of production but usable as food, feed or revenues if not eaten. Sustainable breeding becomes possible, and should progressively replace uncontrolled gathering in the wild. Amongst vertebrates, an important meat supply is based on edible rodents like Thryonomys, Cricetomys, Xerus, Atherurus, Tenrec; Hydrochoerus, Dasyprocta, Myocastor, Capromys, Dolichotis, Agouti, etc. The saine applies to the guinea-pig Cavia porcellus and to frogs. Invertebrates farming is also practised through breeding of maggots, termites, butterflies (pupae and adults for consumption or sale; giant snails are also highly appreciated in many African countries. Minilivestock development is usually a back-yard activity, hence its interest as it relies on local species, substrates and raw materials for infrastructure. The demand for minilivestock product is high but there is still reluctance often from the official authorities, unfortunately. However minilivestock is not an utopia, and a country like Papua-New-Guinea, which bas officially adopted minilivestock production as a tool to help to develop remote villages, is an excellent example of success

Reproductive Impacts of Endocrine-Disrupting Chemicals on Wildlife Species: Implications for Conservation of Endangered Species.

Science.gov (United States)

Tubbs, Christopher W; McDonough, Caitlin E

2018-02-15

Wildlife have proven valuable to our understanding of the potential effects of endocrine-disrupting chemicals (EDCs) on human health by contributing considerably to our understanding of the mechanisms and consequences of EDC exposure. But the threats EDCs present to populations of wildlife species themselves are significant, particularly for endangered species whose existence is vulnerable to any reproductive perturbation. However, few studies address the threats EDCs pose to endangered species owing to challenges associated with their study. Here, we highlight those barriers and review the available literature concerning EDC effects on endangered species. Drawing from other investigations into nonthreatened wildlife species, we highlight opportunities for new approaches to advance our understanding and potentially mitigate the effects of EDCs on endangered species to enhance their fertility.

Ecological impacts of non-native species

Science.gov (United States)

Wilkinson, John W.

2012-01-01

Non-native species are considered one of the greatest threats to freshwater biodiversity worldwide (Drake et al. 1989; Allen and Flecker 1993; Dudgeon et al. 2005). Some of the first hypotheses proposed to explain global patterns of amphibian declines included the effects of non-native species (Barinaga 1990; Blaustein and Wake 1990; Wake and Morowitz 1991). Evidence for the impact of non-native species on amphibians stems (1) from correlative research that relates the distribution or abundance of a species to that of a putative non-native species, and (2) from experimental tests of the effects of a non-native species on survival, growth, development or behaviour of a target species (Kats and Ferrer 2003). Over the past two decades, research on the effects of non-native species on amphibians has mostly focused on introduced aquatic predators, particularly fish. Recent research has shifted to more complex ecological relationships such as influences of sub-lethal stressors (e.g. contaminants) on the effects of non-native species (Linder et al. 2003; Sih et al. 2004), non-native species as vectors of disease (Daszak et al. 2004; Garner et al. 2006), hybridization between non-natives and native congeners (Riley et al. 2003; Storfer et al. 2004), and the alteration of food-webs by non-native species (Nystrom et al. 2001). Other research has examined the interaction of non-native species in terms of facilitation (i.e. one non-native enabling another to become established or spread) or the synergistic effects of multiple non-native species on native amphibians, the so-called invasional meltdown hypothesis (Simerloff and Von Holle 1999). Although there is evidence that some non-native species may interact (Ricciardi 2001), there has yet to be convincing evidence that such interactions have led to an accelerated increase in the number of non-native species and cumulative impacts are still uncertain (Simberloff 2006). Applied research on the control, eradication, and

Seasonal species interactions minimize the impact of species turnover on the likelihood of community persistence.

Science.gov (United States)

Saavedra, Serguei; Rohr, Rudolf P; Fortuna, Miguel A; Selva, Nuria; Bascompte, Jordi

2016-04-01

Many of the observed species interactions embedded in ecological communities are not permanent, but are characterized by temporal changes that are observed along with abiotic and biotic variations. While work has been done describing and quantifying these changes, little is known about their consequences for species coexistence. Here, we investigate the extent to which changes of species composition impact the likelihood of persistence of the predator-prey community in the highly seasonal Białowieza Primeval Forest (northeast Poland), and the extent to which seasonal changes of species interactions (predator diet) modulate the expected impact. This likelihood is estimated extending recent developments on the study of structural stability in ecological communities. We find that the observed species turnover strongly varies the likelihood of community persistence between summer and winter. Importantly, we demonstrate that the observed seasonal interaction changes minimize the variation in the likelihood of persistence associated with species turnover across the year. We find that these community dynamics can be explained as the coupling of individual species to their environment by minimizing both the variation in persistence conditions and the interaction changes between seasons. Our results provide a homeostatic explanation for seasonal species interactions and suggest that monitoring the association of interactions changes with the level of variation in community dynamics can provide a good indicator of the response of species to environmental pressures.

A molecular study on the prevalence and virulence potential of Aeromonas spp. recovered from patients suffering from diarrhea in Israel.

Directory of Open Access Journals (Sweden)

Yigal Senderovich

Full Text Available BACKGROUND: Species of the genus Aeromonas are native inhabitants of aquatic environments and have recently been considered emerging human pathogens. Although the gastrointestinal tract is by far the most common anatomic site from which aeromonads are recovered, their role as etiologic agents of bacterial diarrhea is still disputed. Aeromonas-associated diarrhea is a phenomenon occurring worldwide; however, the exact prevalence of Aeromonas infections on a global scale is unknown. METHODOLOGY/PRINCIPAL FINDINGS: The prevalence and virulence potential of Aeromonas in patients suffering from diarrhea in Israel was studied using molecular methods. 1,033 diarrheal stools were sampled between April and September 2010 and Aeromonas species were identified in 17 (∼2% patients by sequencing the rpoD gene. Aeromonas species identity and abundance was: A. caviae (65%, A. veronii (29% and Aeromonas taiwanensis (6%. This is the first clinical record of A. taiwanensis as a diarrheal causative since its recent discovery from a wound infection in a patient in Taiwan. Most of the patients (77% from which Aeromonas species were isolated were negative for any other pathogens. The patients ranged from 1 to 92 years in age. Aeromonas isolates were found to possess different virulence-associated genes: ahpB (88%, pla/lip/lipH3/apl-1 (71%, act/hlyA/aerA (35%, alt (18%, ast (6%, fla (65%, lafA (41%, TTSS ascV (12%, TTSS ascF-ascG (12%, TTSS-dependent ADP-ribosylating toxins aexU (41% and aexT (6% in various combinations. Most of the identified strains were resistant to beta-lactam antibiotics but susceptible to third-generation cephalosporin antibiotics. CONCLUSIONS: Aeromonas may be a causative agent of diarrhea in patients in Israel and therefore should be included in routine bacteriological screenings.

Lactobacillus caviae sp nov., an obligately heterofermentative bacterium isolated from the oral cavity of a guinea pig (Cavia aperea f. porcellus)

Czech Academy of Sciences Publication Activity Database

Killer, Jiří; Pechar, R.; Švec, P.; Salmonová, H.; Švejstil, R.; Geigerová, M.; Rada, V.; Vlková, E.; Mekadim, Ch.

2017-01-01

Roč. 67, č. 7 (2017), s. 2903-2909 ISSN 1466-5026 R&D Projects: GA ČR GA13-08803S; GA MZe QJ1510338 Institutional support: RVO:67985904 Keywords : Lactobacillus sp. nov. * oral cavity * guinea pig Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.134, year: 2016

Two new species of nocturnal bees of the genus Megalopta (Hymenoptera: Halictidae) with keys to species.

Science.gov (United States)

Gonzalez, Victor H; Griswold, Terry; Ayala, Ricardo

2010-03-01

Megalopta Smith, 1853, is a Neotropical genus of nocturnal or crepuscular bees. Two subgenera are recognized with most of its nearly 30 species placed in the nominate subgenus. Species of Megalopta s. str. are more commonly collected than species of Noctoraptor Engel et al. 1997, all presumably parasites of Megalopta s. str. Two new species of Megalopta are described here: M. (Megalopta) tetewana, n. sp., from Mexico and M. (Noctoraptor) huaoranii, n. sp., from Ecuador. Identification keys to the Central American species of Megalopta s. str. and the species of the parasitic subgenus Noctoraptor are presented.

A new species of Labidocera (Copepoda, Calanoida, Pontellidae) collected from Okinawa, southwestern Japan, with establishment of five Indo-West Pacific species groups in the L.detruncata species complex.

Science.gov (United States)

Hirabayashi, Takeshi; Ohtsuka, Susumu

2014-01-01

Labidocerachuraumi sp. n. is described from Okinawa, southwestern Japan. The female of the new species differs from other congeners in genital compound somite with right postero-lateral and left antero-lateral processes. The male is distinguished from other congeners by the structure of the fifth leg. This new species is assigned to a newly proposed species group, the Labidoceramadurae species group, within the Labidoceradetruncata species complex. In this species complex five Indo-West Pacific species groups are recognized (cervi, detruncata, gangetica, madurae, and pavo) and defined on the basis of difference in sexual dimorphism.

Quantifying the invasiveness of species

Directory of Open Access Journals (Sweden)

Robert Colautti

2014-04-01

Full Text Available The success of invasive species has been explained by two contrasting but non-exclusive views: (i intrinsic factors make some species inherently good invaders; (ii species become invasive as a result of extrinsic ecological and genetic influences such as release from natural enemies, hybridization or other novel ecological and evolutionary interactions. These viewpoints are rarely distinguished but hinge on distinct mechanisms leading to different management scenarios. To improve tests of these hypotheses of invasion success we introduce a simple mathematical framework to quantify the invasiveness of species along two axes: (i interspecific differences in performance among native and introduced species within a region, and (ii intraspecific differences between populations of a species in its native and introduced ranges. Applying these equations to a sample dataset of occurrences of 1,416 plant species across Europe, Argentina, and South Africa, we found that many species are common in their native range but become rare following introduction; only a few introduced species become more common. Biogeographical factors limiting spread (e.g. biotic resistance, time of invasion therefore appear more common than those promoting invasion (e.g. enemy release. Invasiveness, as measured by occurrence data, is better explained by inter-specific variation in invasion potential than biogeographical changes in performance. We discuss how applying these comparisons to more detailed performance data would improve hypothesis testing in invasion biology and potentially lead to more efficient management strategies.

Dna c-values of 20 invasive alien species and 3 native species in south china

Directory of Open Access Journals (Sweden)

Gong Ni

2014-01-01

Full Text Available Cultivated fields and forests in South China are experiencing serious damage due to invasive alien plants. We investigated the relation between DNA C-values and invasiveness. The DNA C-values of 23 species ranged from 0.39 pg to 3.37 pg. Herbs, perennials and native species had higher mean DNA C-values than shrubs, annuals and invasive alien species. DNA C-values decreased with increasing invasiveness. Paederia scandens, a harmful native species, has the lowest DNA C-value among the perennials, indicating that native species with low nuclear content may also possess an invasive potential.

From single-species advice to mixed-species management: taking the next step

DEFF Research Database (Denmark)

Vinther, Morten; Reeves, S.A.; Patterson, K.R.

2004-01-01

Fishery management advice has traditionally been given on a stock-by-stock basis. Recent problems in implementing this advice, particularly for the demersal fisheries of the North Sea, have highlighted the limitations of the approach. In the long term, it would be desirable to give advice...... that accounts for mixed-fishery effects, but in the short term there is a need for approaches to resolve the conflicting management advice for different species within the same fishery, and to generate catch or effort advice that accounts for the mixed-species nature of the fishery. This paper documents...... a recent approach used to address these problems. The approach takes the single-species advice for each species in the fishery as a starting point, then attempts to resolve it into consistent catch or effort advice using fleet-disaggregated catch forecasts in combination with explicitly stated management...

An analysis of species boundaries and biogeographic patterns in a cryptic species complex: the rotifer--Brachionus plicatilis.

Science.gov (United States)

Suatoni, Elizabeth; Vicario, Saverio; Rice, Sean; Snell, Terry; Caccone, Adalgisa

2006-10-01

Since the advent of molecular phylogenetics, there is increasing evidence that many small aquatic and marine invertebrates--once believed to be single, cosmopolitan species--are in fact cryptic species complexes. Although the application of the biological species concept is central to the identification of species boundaries in these cryptic complexes, tests of reproductive isolation do not frequently accompany phylogenetic studies. Because different species concepts generally identify different boundaries in cryptic complexes, studies that apply multiple species concepts are needed to gain a more detailed understanding of patterns of diversification in these taxa. Here we explore different methods of empirically delimiting species boundaries in the salt water rotifer Brachionus plicatilis by comparing reproductive data (i.e., the traditional biological species concept) to phylogenetic data (the genealogical species concept). Based on a high degree of molecular sequence divergence and largely concordant genetic patterns in COI and ITS1, the genealogical species hypothesis indicates the existence of at least 14 species--the highest estimate for the group thus far. A test of the genealogical species concept with biological crosses shows a fairly high level of concordance, depending on the degree of reproductive success used to draw boundaries. The convergence of species concepts in this group suggests that many of the species within the group may be old. Although the diversity of the group is higher than previously understood, geographic distributions remain broad. Efficient passive dispersal has resulted in global distributions for many species with some evidence of isolation by distance over large geographic scales. These patterns concur with expectations that micro-meiofauna (0.1-1mm) have biogeographies intermediate to microbial organisms and large vertebrates. Sympatry of genetically distant strains is common.

[Communication and auditory behavior obtained by auditory evoked potentials in mammals, birds, amphibians, and reptiles].

Science.gov (United States)

Arch-Tirado, Emilio; Collado-Corona, Miguel Angel; Morales-Martínez, José de Jesús

2004-01-01

amphibians, Frog catesbiana (frog bull, 30 animals); reptiles, Sceloporus torcuatus (common small lizard, 22 animals); birds: Columba livia (common dove, 20 animals), and mammals, Cavia porcellus, (guinea pig, 20 animals). With regard to lodging, all animals were maintained at the Institute of Human Communication Disorders, were fed with special food for each species, and had water available ad libitum. Regarding procedure, for carrying out analysis of auditory evoked potentials of brain stem SPL amphibians, birds, and mammals were anesthetized with ketamine 20, 25, and 50 mg/kg, by injection. Reptiles were anesthetized by freezing (6 degrees C). Study subjects had needle electrodes placed in an imaginary line on the half sagittal line between both ears and eyes, behind right ear, and behind left ear. Stimulation was carried out inside a no noise site by means of a horn in free field. The sign was filtered at between 100 and 3,000 Hz and analyzed in a computer for provoked potentials (Racia APE 78). In data shown by amphibians, wave-evoked responses showed greater latency than those of the other species. In reptiles, latency was observed as reduced in comparison with amphibians. In the case of birds, lesser latency values were observed, while in the case of guinea pigs latencies were greater than those of doves but they were stimulated by 10 dB, which demonstrated best auditory threshold in the four studied species. Last, it was corroborated that as the auditory threshold of each species it descends conforms to it advances in the phylogenetic scale. Beginning with these registrations, we care able to say that response for evoked brain stem potential showed to be more complex and lesser values of absolute latency as we advance along the phylogenetic scale; thus, the opposing auditory threshold is better agreement with regard to the phylogenetic scale among studied species. These data indicated to us that seeking of auditory information is more complex in more

Effects of species' characteristics on nongovernmental organizations' attitudes toward species conservation policy

NARCIS (Netherlands)

Knegtering, E; Hendrickx, L.C W P; van der Windt, H.J.; Schoot Uiterkamp, A.J.M.

The authors examined the willingness of nongovernmental organizations (NGOs) to support public species conservation measures as a function of species characteristics, NGOs' interests, and interests harmed by the measures. In an experiment, 39 policy makers from nature conservation, mobility and

Neosilba (Tephritoidea: Lonchaeidae) species reared from coffee in Brazil, with description of a new species

Energy Technology Data Exchange (ETDEWEB)

Striki, Pedro Carlos; Prado, Angelo Pires do, E-mail: apprado@unicamp.b [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Inst. de Biologia. Dept. de Parasitologia

2006-07-01

Neosilba species are believed to be secondary invaders of fruit, so, little attention has been paid to its presence in coffee fruits. In this article we present a key to Neosilba species present in coffee fruits and describe a new species that is considered a primary invader. We hope this will help researchers working with coffee fruits to better quantify the economic importance of Neosilba species associated with coffee fruits. (author)

Neosilba (Tephritoidea: Lonchaeidae) species reared from coffee in Brazil, with description of a new species

International Nuclear Information System (INIS)

Striki, Pedro Carlos; Prado, Angelo Pires do

2006-01-01

Neosilba species are believed to be secondary invaders of fruit, so, little attention has been paid to its presence in coffee fruits. In this article we present a key to Neosilba species present in coffee fruits and describe a new species that is considered a primary invader. We hope this will help researchers working with coffee fruits to better quantify the economic importance of Neosilba species associated with coffee fruits. (author)

Evaluating Hypotheses of Plant Species Invasions on Mediterranean Islands: Inverse Patterns between Alien and Endemic Species

Directory of Open Access Journals (Sweden)

Alexander Bjarnason

2017-08-01

Full Text Available Invasive alien species cause major changes to ecosystem functioning and patterns of biodiversity, and the main factors involved in invasion success remain contested. Using the Mediterranean island of Crete, Greece as a case study, we suggest a framework for analyzing spatial data of alien species distributions, based on environmental predictors, aiming to gain an understanding of their spatial patterns and spread. Mediterranean islands are under strong ecological pressure from invading species due to their restricted size and increased human impact. Four hypotheses of invasibility, the “propagule pressure hypothesis” (H1, “biotic resistance hypothesis vs. acceptance hypothesis” (H2, “disturbance-mediated hypothesis” (H3, and “environmental heterogeneity hypothesis” (H4 were tested. Using data from alien, native, and endemic vascular plant species, the propagule pressure, biotic resistance vs. acceptance, disturbance-mediated, and environmental heterogeneity hypotheses were tested with Generalized Additive Modeling (GAM of 39 models. Based on model selection, the optimal model includes the positive covariates of native species richness, the negative covariates of endemic species richness, and land area. Variance partitioning between the four hypotheses indicated that the biotic resistance vs. acceptance hypothesis explained the vast majority of the total variance. These results show that areas of high species richness have greater invasibility and support the acceptance hypothesis and “rich-get-richer” distribution of alien species. The negative correlation between alien and endemic species appears to be predominantly driven by altitude, with fewer alien and more endemic species at greater altitudes, and habitat richness. The negative relationship between alien and endemic species richness provides potential for understanding patterns of endemic and alien species on islands, contributing to more effective conservation

Construction of analytically solvable models for interacting species. [biological species competition

Science.gov (United States)

Rosen, G.

1976-01-01

The basic form of a model representation for systems of n interacting biological species is a set of essentially nonlinear autonomous ordinary differential equations. A generic canonical expression for the rate functions in the equations is reported which permits the analytical general solution to be obtained by elementary computation. It is shown that a general analytical solution is directly obtainable for models where the rate functions are prescribed by the generic canonical expression from the outset. Some illustrative examples are given which demonstrate that the generic canonical expression can be used to construct analytically solvable models for two interacting species with limit-cycle dynamics as well as for a three-species interdependence.

A new species of Labidocera (Copepoda, Calanoida, Pontellidae collected from Okinawa, southwestern Japan, with establishment of five Indo-West Pacific species groups in the L. detruncata species complex

Directory of Open Access Journals (Sweden)

Takeshi Hirabayashi

2014-10-01

Full Text Available Labidocera churaumi sp. n. is described from Okinawa, southwestern Japan. The female of the new species differs from other congeners in genital compound somite with right postero-lateral and left antero-lateral processes. The male is distinguished from other congeners by the structure of the fifth leg. This new species is assigned to a newly proposed species group, the L. madurae species group, within the L. detruncata species complex. In this species complex five Indo-West Pacific species groups are recognized (cervi, detruncata, gangetica, madurae, and pavo and defined on the basis of difference in sexual dimorphism.

A new species of Labidocera (Copepoda, Calanoida, Pontellidae) collected from Okinawa, southwestern Japan, with establishment of five Indo-West Pacific species groups in the L. detruncata species complex

Science.gov (United States)

Hirabayashi, Takeshi; Ohtsuka, Susumu

2014-01-01

Abstract Labidocera churaumi sp. n. is described from Okinawa, southwestern Japan. The female of the new species differs from other congeners in genital compound somite with right postero-lateral and left antero-lateral processes. The male is distinguished from other congeners by the structure of the fifth leg. This new species is assigned to a newly proposed species group, the Labidocera madurae species group, within the Labidocera detruncata species complex. In this species complex five Indo-West Pacific species groups are recognized (cervi, detruncata, gangetica, madurae, and pavo) and defined on the basis of difference in sexual dimorphism. PMID:25349514

Comparison of species ordinations resulting from alternative indices of interspecific association and different numbers of included species

Energy Technology Data Exchange (ETDEWEB)

Goff, F G

1975-12-19

Several measures of interspecific association are compared. Dispersion and covariance are limited in value because they respond to the commonness of the species compared. Correlation is not so limited but it responds to discrepancies in commonness among the species. The practical result of these relationships between commonness and association is that only the most common species can occupy peripheral positions in a species ordination. Rare species are relegated to positions near the center not on the basis of their phytosociological pattern but simply because of their rarity. Both Cole's index of association and the tetrachoric correlation overcome the problem imposed by the relationship between ordination position and species commonness and they both produce very similar results. The effect of differing numbers of species on the ordination configuration is examined using both Pearson's correlation and Cole's index. The basic pattern of the ordination is set with the first few species when Cole's index is used, however, since rare species are given more weight in the analysis with this index, the addition of several very rare species can change the configuration of the ordination. (auth)

CpDNA-based species identification and phylogeography: application to African tropical tree species.

Science.gov (United States)

Duminil, J; Heuertz, M; Doucet, J-L; Bourland, N; Cruaud, C; Gavory, F; Doumenge, C; Navascués, M; Hardy, O J

2010-12-01

Despite the importance of the African tropical rainforests as a hotspot of biodiversity, their history and the processes that have structured their biodiversity are understood poorly. With respect to past demographic processes, new insights can be gained through characterizing the distribution of genetic diversity. However, few studies of this type have been conducted in Central Africa, where the identification of species in the field can be difficult. We examine here the distribution of chloroplast DNA (cpDNA) diversity in Lower Guinea in two tree species that are difficult to distinguish, Erythrophleum ivorense and Erythrophleum suaveolens (Fabaceae). By using a blind-sampling approach and comparing molecular and morphological markers, we first identified retrospectively all sampled individuals and determined the limits of the distribution of each species. We then performed a phylogeographic study using the same genetic data set. The two species displayed essentially parapatric distributions that were correlated well with the rainfall gradient, which indicated different ecological requirements. In addition, a phylogeographic structure was found for E. suaveolens and, for both species, substantially higher levels of diversity and allelic endemism were observed in the south (Gabon) than in the north (Cameroon) of the Lower Guinea region. This finding indicated different histories of population demographics for the two species, which might reflect different responses to Quaternary climate changes. We suggest that a recent period of forest perturbation, which might have been caused by humans, favoured the spread of these two species and that their poor recruitment at present results from natural succession in their forest formations. © 2010 Blackwell Publishing Ltd.

Endangered Species Protection Bulletins

Science.gov (United States)

Endangered Species Protection Bulletins set forth geographically specific pesticide use limitations for the protection of threatened and endangered (listed) species and their designated critical habitat. Find out how to get and use Bulletins.

New Malesian species of Viscaceae

NARCIS (Netherlands)

Barlow, Bryan A.

1996-01-01

Three new Malesian species of Viscaceae are described. Ginalloa flagellaris Barlow is distinguished as a species from New Guinea and New Britain, previously included within G. arnottiana Korthals. Viscum exile Barlow is recognized as a new species endemic to Celebes, related to V. ovalifolium.

Toward reassessing data-deficient species.

Science.gov (United States)

Bland, Lucie M; Bielby, Jon; Kearney, Stephen; Orme, C David L; Watson, James E M; Collen, Ben

2017-06-01

One in 6 species (13,465 species) on the International Union for Conservation of Nature (IUCN) Red List is classified as data deficient due to lack of information on their taxonomy, population status, or impact of threats. Despite the chance that many are at high risk of extinction, data-deficient species are typically excluded from global and local conservation priorities, as well as funding schemes. The number of data-deficient species will greatly increase as the IUCN Red List becomes more inclusive of poorly known and speciose groups. A strategic approach is urgently needed to enhance the conservation value of data-deficient assessments. To develop this, we reviewed 2879 data-deficient assessments in 6 animal groups and identified 8 main justifications for assigning data-deficient status (type series, few records, old records, uncertain provenance, uncertain population status or distribution, uncertain threats, taxonomic uncertainty, and new species). Assigning a consistent set of justification tags (i.e., consistent assignment to assessment justifications) to species classified as data deficient is a simple way to achieve more strategic assessments. Such tags would clarify the causes of data deficiency; facilitate the prediction of extinction risk; facilitate comparisons of data deficiency among taxonomic groups; and help prioritize species for reassessment. With renewed efforts, it could be straightforward to prevent thousands of data-deficient species slipping unnoticed toward extinction. © 2016 Society for Conservation Biology.

Isolation and antibiotic sensitivity of Aeromonas from children with diarrhea

Directory of Open Access Journals (Sweden)

Meiyanti Meiyanti

2016-02-01

Full Text Available Aeromonas species are gram-negative, motile, facultative anaerobic, rod shaped, oxidase positive bacteria of the recently assigned family Aeromonadaceae. The significance of Aeromonas species as causative agent of human diarrhoea has recently been established. The aim of the present study was to investigate the distribution, and antibiotic sensitivity of Aeromonas in nonhospitalized children with diarrhea.One hundred and seventeen rectal swabs from children with diarhhea were cultured for isolation of Aeromonas organisms as the etiological agents. In addition to Aeromonas, other enteric pathogens were also isolated. Overall, the isolates of enteric pathogens amounted to 36.8%, consisting of Salmonella, Shigella, Aeromonas, and Vibrio. Aeromonas was only found in 5.1% of cultures, with a ratio of A. caviae and A. hydrophila of 2:1, while Salmonella made up the majority of causative organisms with an isolation frequency of 18.8%, followed by Shigella with 11.1%. In this study no isolates of Vibrio cholerae O1 were found as etiological agents of diarrhea; however, V. cholerae non-O1 and V. parahaemolyticus were found in small numbers (<1%. All isolates of Aeromonas were resistant to ampicillin and tetracycline, but sensitive to ciprofloxacin and ceftriaxone, as were the other enteric pathogens. Although the frequency of isolation of these enteric pathogens was higher than for Vibrio spp., their role in infective diarrhea was less clearcut in comparison with Salmonella and Shigella.

Are trade-offs among species' ecological interactions scale dependent? A test using pitcher-plant inquiline species.

Science.gov (United States)

Kneitel, Jamie M

2012-01-01

Trade-offs among species' ecological interactions is a pervasive explanation for species coexistence. The traits associated with trade-offs are typically measured to mechanistically explain species coexistence at a single spatial scale. However, species potentially interact at multiple scales and this may be reflected in the traits among coexisting species. I quantified species' ecological traits associated with the trade-offs expected at both local (competitive ability and predator tolerance) and regional (competitive ability and colonization rate) community scales. The most common species (four protozoa and a rotifer) from the middle trophic level of a pitcher plant (Sarracenia purpurea) inquiline community were used to link species traits to previously observed patterns of species diversity and abundance. Traits associated with trade-offs (competitive ability, predator tolerance, and colonization rate) and other ecological traits (size, growth rate, and carrying capacity) were measured for each of the focal species. Traits were correlated with one another with a negative relationship indicative of a trade-off. Protozoan and rotifer species exhibited a negative relationship between competitive ability and predator tolerance, indicative of coexistence at the local community scale. There was no relationship between competitive ability and colonization rate. Size, growth rate, and carrying capacity were correlated with each other and the trade-off traits: Size was related to both competitive ability and predator tolerance, but growth rate and carrying capacity were correlated with predator tolerance. When partial correlations were conducted controlling for size, growth rate and carrying capacity, the trade-offs largely disappeared. These results imply that body size is the trait that provides the basis for ecological interactions and trade-offs. Altogether, this study showed that the examination of species' traits in the context of coexistence at different scales

A new Amazonian species from the Drosophila annulimana species group (Diptera, Drosophilidae

Directory of Open Access Journals (Sweden)

Marco S. Gottschalk

2012-12-01

Full Text Available Drosophila caxiuana sp. nov., Drosophila subgenus, is described and illustrated. This new species was collected in the Amazonian Biome (Caquajó river, Portel, Pará, Brazil and is an atypical species to the group due the unusual morphology of the male terminalia.

75 FR 78974 - Endangered Species

Science.gov (United States)

2010-12-17

...-XA086 Endangered Species AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and... the Endangered Species Act of 1973, as amended (16 U.S.C. 1531 et seq.) and the regulations governing the taking, importing, and exporting of endangered and threatened species (50 CFR 222-226). Permit...

Dna c-values of 20 invasive alien species and 3 native species in south china

OpenAIRE

Gong Ni; Wang Yu-Tao; Björn Lars Olof; Li Shao-Shan

2014-01-01

Cultivated fields and forests in South China are experiencing serious damage due to invasive alien plants. We investigated the relation between DNA C-values and invasiveness. The DNA C-values of 23 species ranged from 0.39 pg to 3.37 pg. Herbs, perennials and native species had higher mean DNA C-values than shrubs, annuals and invasive alien species. DNA C-values decreased with increasing invasiveness. Paederia scandens, a harmful native species, has the lo...

Biological species in the viral world.

Science.gov (United States)

Bobay, Louis-Marie; Ochman, Howard

2018-06-05

Due to their dependence on cellular organisms for metabolism and replication, viruses are typically named and assigned to species according to their genome structure and the original host that they infect. But because viruses often infect multiple hosts and the numbers of distinct lineages within a host can be vast, their delineation into species is often dictated by arbitrary sequence thresholds, which are highly inconsistent across lineages. Here we apply an approach to determine the boundaries of viral species based on the detection of gene flow within populations, thereby defining viral species according to the biological species concept (BSC). Despite the potential for gene transfer between highly divergent genomes, viruses, like the cellular organisms they infect, assort into reproductively isolated groups and can be organized into biological species. This approach revealed that BSC-defined viral species are often congruent with the taxonomic partitioning based on shared gene contents and host tropism, and that bacteriophages can similarly be classified in biological species. These results open the possibility to use a single, universal definition of species that is applicable across cellular and acellular lifeforms.

Cryptic Species Due to Hybridization: A Combined Approach to Describe a New Species (Carex: Cyperaceae).

Science.gov (United States)

Maguilla, Enrique; Escudero, Marcial

2016-01-01

Disappearance of diagnostic morphological characters due to hybridization is considered to be one of the causes of the complex taxonomy of the species-rich (ca. 2000 described species) genus Carex (Cyperaceae). Carex furva s.l. belongs to section Glareosae. It is an endemic species from the high mountains of the Iberian Peninsula (Spain and Portugal). Previous studies suggested the existence of two different, cryptic taxa within C. furva s.l. Intermediate morphologies found in the southern Iberian Peninsula precluded the description of a new taxa. We aimed to determine whether C. furva s.l. should be split into two different species based on the combination of morphological and molecular data. We sampled ten populations across its full range and performed a morphological study based on measurements on herbarium specimens and silica-dried inflorescences. Both morphological and phylogenetic data support the existence of two different species within C. furva s.l. Nevertheless, intermediate morphologies and sterile specimens were found in one of the southern populations (Sierra Nevada) of C. furva s.l., suggesting the presence of hybrid populations in areas where both supposed species coexist. Hybridization between these two putative species has blurred morphological and genetic limits among them in this hybrid zone. We have proved the utility of combining molecular and morphological data to discover a new cryptic species in a scenario of hybridization. We now recognize a new species, C. lucennoiberica, endemic to the Iberian Peninsula (Sierra Nevada, Central system and Cantabrian Mountains). On the other hand, C. furva s.s. is distributed only in Sierra Nevada, where it may be threatened by hybridization with C. lucennoiberica. The restricted distribution of both species and their specific habitat requirements are the main limiting factors for their conservation.

Leadership of Winter Mixed-Species Flocks by Tufted Titmice (Baeolophus bicolor: Are Titmice Passive Nuclear Species?

Directory of Open Access Journals (Sweden)

Thomas A. Contreras

2011-01-01

Full Text Available The tufted titmouse (Baeolophus bicolor, TUTI is a nuclear species in winter foraging flocks whose antipredator calls are used to manage predation risk by diverse heterospecifics. We hypothesized that satellite species in mixed flocks follow TUTI (not vice versa, thereby defining the role of TUTI as a “passive” nuclear species. We followed 20 winter mixed-species flocks in North-Central Florida and assessed angular-angular correlations between overall flock, TUTI, and satellite species movement directions. We observed significant correlations between overall flock movement directions and those of TUTI, confirming our central prediction. Within flocks, however, fine-scale movement directions of satellite species were often more highly correlated with those of other satellites than with TUTI movements. We conclude that TUTI are passive nuclear species whose movements define flock paths, but within flocks, TUTI movements may have less influence on satellite movements than do other factors.

Efficient distinction of invasive aquatic plant species from non-invasive related species using DNA barcoding.

Science.gov (United States)

Ghahramanzadeh, R; Esselink, G; Kodde, L P; Duistermaat, H; van Valkenburg, J L C H; Marashi, S H; Smulders, M J M; van de Wiel, C C M

2013-01-01

Biological invasions are regarded as threats to global biodiversity. Among invasive aliens, a number of plant species belonging to the genera Myriophyllum, Ludwigia and Cabomba, and to the Hydrocharitaceae family pose a particular ecological threat to water bodies. Therefore, one would try to prevent them from entering a country. However, many related species are commercially traded, and distinguishing invasive from non-invasive species based on morphology alone is often difficult for plants in a vegetative stage. In this regard, DNA barcoding could become a good alternative. In this study, 242 samples belonging to 26 species from 10 genera of aquatic plants were assessed using the chloroplast loci trnH-psbA, matK and rbcL. Despite testing a large number of primer sets and several PCR protocols, the matK locus could not be amplified or sequenced reliably and therefore was left out of the analysis. Using the other two loci, eight invasive species could be distinguished from their respective related species, a ninth one failed to produce sequences of sufficient quality. Based on the criteria of universal application, high sequence divergence and level of species discrimination, the trnH-psbA noncoding spacer was the best performing barcode in the aquatic plant species studied. Thus, DNA barcoding may be helpful with enforcing a ban on trade of such invasive species, such as is already in place in the Netherlands. This will become even more so once DNA barcoding would be turned into machinery routinely operable by a nonspecialist in botany and molecular genetics. © 2012 Blackwell Publishing Ltd.

Usefulness of the wildlife species as a focal species in the forest ...

African Journals Online (AJOL)

yasinucarlı

2011-03-14

Mar 14, 2011 ... keystone species are the most important species in that ecosystems to sustainability. ... bear, Wolf and Eurasian Lynx can be also used as a flagship, indicator and ... Washington's Pacific coast. ... sidered keystones because their effect is not dispro- ..... conservation of South American terrestrial mammals.

76 FR 2348 - Endangered Species

Science.gov (United States)

2011-01-13

.... 15596] Endangered Species AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and... requested permit has been issued under the authority of the Endangered Species Act of 1973, as amended (ESA... endangered and threatened species (50 CFR parts 222-226). The North Carolina Aquarium at Fort Fisher has been...

ICRAF Species Switchboard. Version 1.2

DEFF Research Database (Denmark)

Kindt, R.; Ordonez, J.; Smith, E.

2015-01-01

The current version of the Agroforestry Species Switchboard documents the presence of a total of 26,135 plant species (33,813 species including synonyms) across 19 web-based databases. When available, hyperlinks to information on the selected species in particular databases are provided. In total...

A Theory of Flagship Species Action

Directory of Open Access Journals (Sweden)

Paul Jepson

2015-01-01

Full Text Available The flagship species approach is an enduring strategy in conservation. Academic discussion on flagship species has focussed on two dimensions: on what basis should they be selected and how have they been put to use. Here we consider a third dimension, namely the manner in which flagship species act and have the capacity to galvanise and influence conservation outcomes. Drawing on concepts from the social sciences, viz. affordance, framing, and actor-networks; we discuss examples of flagship species to propose a theory of flagship species action. In brief, our theory posits that a flagship species is one with traits that afford the assembly of relatively coherent networks of associations with ideational elements located in pre-existing cultural framings. These associations give rise to opportunities to align with deep cultural frames, contemporary cultural phenomena and political economy such that when a conservation action is introduced, forms of agency cause the species and human publics to change. The species becomes re-framed (or reinvigorated as a cultural asset speaking for a wider nature, publics and political agendas. Further our theory posits that species with traits that enrol in idea networks incorporating human fears, will have limited flagship capacity. This is because the ability of the representations produced to align with frames incorporating collective aspirations is constrained. In terms of applied conservation practice, our theory suggests that: a key criteria for selecting potential flagship species is presence in existing cultural frames, that effective deployment of flagship species requires an understanding of the species′ cultural associations, and a species ability to galvanise action may be limited to certain times and places. Furthermore, once deployed conservation interests will never have full control over the flagship species: it may act in uncertain and unexpected ways.

Species richness, habitable volume, and species densities in freshwater, the sea, and on land

Directory of Open Access Journals (Sweden)

Michael N Dawson

2012-09-01

Full Text Available Approximately 0.5–2.0 million eukaryotic species inhabit the seas, whereas 2.0–10.0 million inhabit freshwater or the land. Much has been made of this several-fold difference in species richness but there is little consensus about the causes. Here, I ask a related question: what is the relative density of species in marine and non-marine realms? I use recent estimates of global eukaryotic species richness and published estimates of the areal coverage and depth of habitat for freshwater, marine, and terrestrial biomes. I find that the marine realm harbors ~99.83% of the habitable volume on this planet. Eukaryotic species density of the marine realm is ~3600-fold (i.e., 3-4 orders of magnitude less than that of non-marine environments. Species–volume relationships (SVRs help reconcile actinopterygian fish diversity with global primary productivity and emphasize the interacting roles of abiotic and biotic complexity in shaping patterns of biodiversity in freshwater, the sea, and on land. Comparing SVRs of habitats within and across realms may help resolve the factors and interactions that influence species density.

California Endangered Species Resource Guide.

Science.gov (United States)

California State Dept. of Education, Los Angeles.

This document was developed in response to California Senate Bill No. 885, "The Endangered Species Education Project," that called for a statewide program in which schools adopt a local endangered species, research past and current efforts to preserve the species' habitat, develop and implement an action plan to educate the community…

Biological review of 82 species of coral petitioned to be included in the Endangered Species Act

Science.gov (United States)

Brainard, Russell E.; Birkeland, Charles; Eakin, C. Mark; McElhany, Paul; Miller, Margaret W.; Patterson, Matt; Piniak, G.A.

2011-01-01

list 83 coral species as threatened or endangered under the U.S. Endangered Species Act. The petition was based on a predicted decline in available habitat for the species, citing anthropogenic climate change and ocean acidification as the lead factors among the various stressors responsible for the potential decline. The NMFS identified 82 of the corals as candidate species, finding that the petition provided substantive information for a potential listing of these species. The NMFS established a Biological Review Team (BRT) to prepare this Status Review Report that examines the status of these 82 candidate coral species and evaluates extinction risk for each of them. This document makes no recommendations for listing, as that is a separate evaluation to be conducted by the NMFS.

Emergent neutrality drives phytoplankton species coexistence

Science.gov (United States)

Segura, Angel M.; Calliari, Danilo; Kruk, Carla; Conde, Daniel; Bonilla, Sylvia; Fort, Hugo

2011-01-01

The mechanisms that drive species coexistence and community dynamics have long puzzled ecologists. Here, we explain species coexistence, size structure and diversity patterns in a phytoplankton community using a combination of four fundamental factors: organism traits, size-based constraints, hydrology and species competition. Using a ‘microscopic’ Lotka–Volterra competition (MLVC) model (i.e. with explicit recipes to compute its parameters), we provide a mechanistic explanation of species coexistence along a niche axis (i.e. organismic volume). We based our model on empirically measured quantities, minimal ecological assumptions and stochastic processes. In nature, we found aggregated patterns of species biovolume (i.e. clumps) along the volume axis and a peak in species richness. Both patterns were reproduced by the MLVC model. Observed clumps corresponded to niche zones (volumes) where species fitness was highest, or where fitness was equal among competing species. The latter implies the action of equalizing processes, which would suggest emergent neutrality as a plausible mechanism to explain community patterns. PMID:21177680

New species of Auritella (Inocybaceae) from Cameroon, with a worldwide key to the known species.

Science.gov (United States)

Matheny, P Brandon; Henkel, Terry W; Séné, Olivier; Korotkin, Hailee B; Dentinger, Bryn T M; Aime, M Catherine

2017-12-01

Two new species in the genus Auritella ( Inocybaceae ) are described as new from tropical rainforest in Cameroon. Descriptions, photographs, line drawings, and a worldwide taxonomic key to the described species of Auritella are presented. Phylogenetic analysis of 28S rDNA and rpb2 nucleotide sequence data suggests at least five phylogenetic species that can be ascribed to Auritella occur in the region comprising Cameroon and Gabon and constitute a strongly supported monophyletic subgroup within the genus. Phylogenetic analysis of ITS data supports the conspecificity of numerous collections attributed to the two new species as well as the monophyly of Australian species of Auritella . This work raises the known number of described species of Auritella to thirteen worldwide, four of which occur in tropical Africa, one in tropical India, and eight in temperate and tropical regions of Australia. This is the first study to confirm an ectomycorrhizal status of Auritella using molecular data.

Molluscan indicator species and their potential use in ecological status assessment using species distribution modeling.

Science.gov (United States)

Moraitis, Manos L; Tsikopoulou, Irini; Geropoulos, Antonios; Dimitriou, Panagiotis D; Papageorgiou, Nafsika; Giannoulaki, Marianna; Valavanis, Vasilis D; Karakassis, Ioannis

2018-05-24

Marine habitat assessment using indicator species through Species Distribution Modeling (SDM) was investigated. The bivalves: Corbula gibba and Flexopecten hyalinus were the indicator species characterizing disturbed and undisturbed areas respectively in terms of chlorophyll a concentration in Greece. The habitat suitability maps of these species reflected the overall ecological status of the area. The C. gibba model successfully predicted the occurrence of this species in areas with increased physical disturbance driven by chlorophyll a concentration, whereas the habitat map for F. hyalinus showed an increased probability of occurrence in chlorophyll-poor areas, affected mainly by salinity. We advocate the use of C. gibba as a proxy for eutrophication and the incorporation of this species in monitoring studies through SDM methods. For the Mediterranean Sea we suggest the use of F. hyalinus in SDM as an indicator of environmental stability and a possible forecasting tool for salinity fluctuations. Copyright © 2018 Elsevier Ltd. All rights reserved.

The species in primatology.

Science.gov (United States)

Groves, Colin

2014-01-01

Biologists of the late eighteenth and early nineteenth centuries all bandied about the term "species," but very rarely actually said what they meant by it. Often, however, one can get inside their thinking by piecing together some of their remarks. One of the most nearly explicit-appropriately, for the man who wrote a book called The Origin of Species - was Charles Darwin: "Practically, when a naturalist can unite two forms together by others having intermediate characters, he treats the one as a variety of the other… He later translated this into evolutionary terms: "Hereafter, we shall be compelled to acknowledge that the only distinction between species and well-marked varieties is, that the latter are known, or believed, to be connected at the present day by intermediate gradations, whereas species were formerly thus connected"(1:484-5.) Copyright © 2014 Wiley Periodicals, Inc.

Species delimitation of the Hyphydrus ovatus complex in western Palaearctic with an update of species distributions (Coleoptera, Dytiscidae

Directory of Open Access Journals (Sweden)

Johannes Bergsten

2017-06-01

Full Text Available The species status of Hyphydrus anatolicus Guignot, 1957 and H. sanctus Sharp, 1882, previously often confused with the widespread H. ovatus (Linnaeus, 1760, are tested with molecular and morphological characters. Cytochrome c oxidase subunit 1 (CO1 was sequenced for 32 specimens of all three species. Gene-trees were inferred with parsimony, time-free bayesian and strict clock bayesian analyses. The GMYC model was used to estimate species limits. All three species were reciprocally monophyletic with CO1 and highly supported. The GMYC species delimitation analysis unequivocally delimited the three species with no other than the three species solution included in the confidence interval. A likelihood ratio test rejected the one-species null model. Important morphological characters distinguishing the species are provided and illustrated. New distributional data are given for the following species: Hyphydrus anatolicus from Slovakia and Ukraine, and H. aubei Ganglbauer, 1891, and H. sanctus from Turkey.

Incorporating climate science in applications of the US endangered species act for aquatic species.

Science.gov (United States)

McClure, Michelle M; Alexander, Michael; Borggaard, Diane; Boughton, David; Crozier, Lisa; Griffis, Roger; Jorgensen, Jeffrey C; Lindley, Steven T; Nye, Janet; Rowland, Melanie J; Seney, Erin E; Snover, Amy; Toole, Christopher; VAN Houtan, Kyle

2013-12-01

Aquatic species are threatened by climate change but have received comparatively less attention than terrestrial species. We gleaned key strategies for scientists and managers seeking to address climate change in aquatic conservation planning from the literature and existing knowledge. We address 3 categories of conservation effort that rely on scientific analysis and have particular application under the U.S. Endangered Species Act (ESA): assessment of overall risk to a species; long-term recovery planning; and evaluation of effects of specific actions or perturbations. Fewer data are available for aquatic species to support these analyses, and climate effects on aquatic systems are poorly characterized. Thus, we recommend scientists conducting analyses supporting ESA decisions develop a conceptual model that links climate, habitat, ecosystem, and species response to changing conditions and use this model to organize analyses and future research. We recommend that current climate conditions are not appropriate for projections used in ESA analyses and that long-term projections of climate-change effects provide temporal context as a species-wide assessment provides spatial context. In these projections, climate change should not be discounted solely because the magnitude of projected change at a particular time is uncertain when directionality of climate change is clear. Identifying likely future habitat at the species scale will indicate key refuges and potential range shifts. However, the risks and benefits associated with errors in modeling future habitat are not equivalent. The ESA offers mechanisms for increasing the overall resilience and resistance of species to climate changes, including establishing recovery goals requiring increased genetic and phenotypic diversity, specifying critical habitat in areas not currently occupied but likely to become important, and using adaptive management. Incorporación de las Ciencias Climáticas en las Aplicaciones del

[Yeast species in vulvovaginitis candidosa].

Science.gov (United States)

Nemes-Nikodém, Éva; Tamási, Béla; Mihalik, Noémi; Ostorházi, Eszter

2015-01-04

Vulvovaginal candidiasis is the most common mycosis, however, the available information about antifungal susceptibilities of these yeasts is limited. To compare the gold standard fungal culture with a new molecular identification method and report the incidence of yeast species in vulvovaginitis candidosa. The authors studied 370 yeasts isolated from vulvovaginal candidiasis and identified them by phenotypic and molecular methods. The most common species was Candida albicans (85%), followed by Candida glabrata, and other Candida species. At present there are no recommendations for the evaluation of antifungal susceptibility of pathogenic fungal species occurring in vulvovaginal candidiasis and the natural antifungal resistance of the different species is known only. Matrix Assisted Laser Desorption Ionization Time of Flight identification can be used to differentiate the fluconazole resistant Candida dubliniensis and the sensitive Candida albicans strains.

SpeciesGeoCoder: Fast Categorization of Species Occurrences for Analyses of Biodiversity, Biogeography, Ecology, and Evolution.

Science.gov (United States)

Töpel, Mats; Zizka, Alexander; Calió, Maria Fernanda; Scharn, Ruud; Silvestro, Daniele; Antonelli, Alexandre

2017-03-01

Understanding the patterns and processes underlying the uneven distribution of biodiversity across space constitutes a major scientific challenge in systematic biology and biogeography, which largely relies on effectively mapping and making sense of rapidly increasing species occurrence data. There is thus an urgent need for making the process of coding species into spatial units faster, automated, transparent, and reproducible. Here we present SpeciesGeoCoder, an open-source software package written in Python and R, that allows for easy coding of species into user-defined operational units. These units may be of any size and be purely spatial (i.e., polygons) such as countries and states, conservation areas, biomes, islands, biodiversity hotspots, and areas of endemism, but may also include elevation ranges. This flexibility allows scoring species into complex categories, such as those encountered in topographically and ecologically heterogeneous landscapes. In addition, SpeciesGeoCoder can be used to facilitate sorting and cleaning of occurrence data obtained from online databases, and for testing the impact of incorrect identification of specimens on the spatial coding of species. The various outputs of SpeciesGeoCoder include quantitative biodiversity statistics, global and local distribution maps, and files that can be used directly in many phylogeny-based applications for ancestral range reconstruction, investigations of biome evolution, and other comparative methods. Our simulations indicate that even datasets containing hundreds of millions of records can be analyzed in relatively short time using a standard computer. We exemplify the use of SpeciesGeoCoder by inferring the historical dispersal of birds across the Isthmus of Panama, showing that lowland species crossed the Isthmus about twice as frequently as montane species with a marked increase in the number of dispersals during the last 10 million years. [ancestral area reconstruction; biodiversity

A Framework for Spatial Risk Assessments: Potential Impacts of Nonindigenous Invasive Species on Native Species

Directory of Open Access Journals (Sweden)

Craig R. Allen

2006-06-01

Full Text Available Many populations of wild animals and plants are declining and face increasing threats from habitat fragmentation and loss as well as exposure to stressors ranging from toxicants to diseases to invasive nonindigenous species. We describe and demonstrate a spatially explicit ecological risk assessment that allows for the incorporation of a broad array of information that may influence the distribution of an invasive species, toxicants, or other stressors, and the incorporation of landscape variables that may influence the spread of a species or substances. The first step in our analyses is to develop species models and quantify spatial overlap between stressor and target organisms. Risk is assessed as the product of spatial overlap and a hazard index based on target species vulnerabilities to the stressor of interest. We illustrate our methods with an example in which the stressor is the ecologically destructive nonindigenous ant, Solenopsis invicta, and the targets are two declining vertebrate species in the state of South Carolina, USA. A risk approach that focuses on landscapes and that is explicitly spatial is of particular relevance as remaining undeveloped lands become increasingly uncommon and isolated and more important in the management and recovery of species and ecological systems. Effective ecosystem management includes the control of multiple stressors, including invasive species with large impacts, understanding where those impacts may be the most severe, and implementing management strategies to reduce impacts.

Genomic definition of species. Revision 1

Energy Technology Data Exchange (ETDEWEB)

Crkvenjakov, R.; Dramanac, R.

1992-06-01

A genome is the sum total of the DNA sequences in the cells of an individual organism. The common usage that species possess genomes comes naturally to biochemists, who have shown that all protein and nucleic acid molecules are at the same time species and individual-specific, with minor individual variations being superimposed on a consensus sequence that is constant for a species. By extension, this property is attributed to the common features of DNA in the chromosomes of members of a given species and is called (species) genome. The definition of species based on chromosomes, genes, or genome common to its member organisms has been implied or mentioned in passing numerous times. Some population biologists think that members of species have similar ``homeostatic genotypes,`` which are to a degree resistant to mutation or environmental change in the production of a basic phenotype.

Alien species on the coasts of Turkey

Directory of Open Access Journals (Sweden)

M.E. CINAR

2005-12-01

Full Text Available The compilation of data on alien species reported from the Turkish coasts yielded a total of 263 species belonging to 11 systematic groups, of which Mollusca had the highest number of species (85 species, followed by Crustacea (51, fishes (43 and phytobenthos (39. The Black Sea is represented by a total of 20 alien species, the Sea of Marmara by 48 species, the Aegean Sea by 98 species and the Levantine Sea by 202 species. The majority of aliens found in the Black Sea and the Sea of Marmara were transported via shipping, whereas the Levantine coast is extensively subjected to Lessepsian migration. Benthic habitats (soft and hard substrata comprise 76% of the total alien species and the pelagic environment is inhabited by thirty-nine species. Almost 50% of aliens collected from the Turkish coasts were found only at 0-10 m depth. Eight species occur at depths deeper than 100 m. The impacts of aliens on the benthic and pelagic ecosystems are presented.

The Tetramorium tortuosum species group (Hymenoptera, Formicidae, Myrmicinae revisited - taxonomic revision of the Afrotropical T. capillosum species complex

Directory of Open Access Journals (Sweden)

Francisco Hita Garcia

2013-05-01

Full Text Available In this study we revise the taxonomy of the Tetramorium tortuosum species group members encountered in the Afrotropical region, which we have placed in its own subgroup: the T. capillosum species complex. We re-describe the two previously known species T. capillosum Bolton and T. tabarum Bolton, and describe the new species T. hecate sp. n. The geographic distribution of the three species appears to be restricted to the equatorial rainforests of Central Africa. We provide a diagnosis of the T. capillosum species complex, an illustrated identification key to species level, and worker-based species descriptions, which include diagnoses, discussions, high-quality montage images, and distribution maps. Furthermore, we discuss biogeography and composition of the globally distributed T. tortuosum group.

Integrative taxonomy by molecular species delimitation: multi-locus data corroborate a new species of Balkan Drusinae micro-endemics.

Science.gov (United States)

Vitecek, Simon; Kučinić, Mladen; Previšić, Ana; Živić, Ivana; Stojanović, Katarina; Keresztes, Lujza; Bálint, Miklós; Hoppeler, Felicitas; Waringer, Johann; Graf, Wolfram; Pauls, Steffen U

2017-06-06

Taxonomy offers precise species identification and delimitation and thus provides basic information for biological research, e.g. through assessment of species richness. The importance of molecular taxonomy, i.e., the identification and delimitation of taxa based on molecular markers, has increased in the past decade. Recently developed exploratory tools now allow estimating species-level diversity in multi-locus molecular datasets. Here we use molecular species delimitation tools that either quantify differences in intra- and interspecific variability of loci, or divergence times within and between species, or perform coalescent species tree inference to estimate species-level entities in molecular genetic datasets. We benchmark results from these methods against 14 morphologically readily differentiable species of a well-defined subgroup of the diverse Drusinae subfamily (Trichoptera, Limnephilidae). Using a 3798 bp (6 loci) molecular data set we aim to corroborate a geographically isolated new species by integrating comparative morphological studies and molecular taxonomy. Our results indicate that only multi-locus species delimitation provides taxonomically relevant information. The data further corroborate the new species Drusus zivici sp. nov. We provide differential diagnostic characters and describe the male, female and larva of this new species and discuss diversity patterns of Drusinae in the Balkans. We further discuss potential and significance of molecular species delimitation. Finally we argue that enhancing collaborative integrative taxonomy will accelerate assessment of global diversity and completion of reference libraries for applied fields, e.g., conservation and biomonitoring.

The role of biotic interactions in shaping distributions and realised assemblages of species: implications for species distribution modelling.

Science.gov (United States)

Wisz, Mary Susanne; Pottier, Julien; Kissling, W Daniel; Pellissier, Loïc; Lenoir, Jonathan; Damgaard, Christian F; Dormann, Carsten F; Forchhammer, Mads C; Grytnes, John-Arvid; Guisan, Antoine; Heikkinen, Risto K; Høye, Toke T; Kühn, Ingolf; Luoto, Miska; Maiorano, Luigi; Nilsson, Marie-Charlotte; Normand, Signe; Öckinger, Erik; Schmidt, Niels M; Termansen, Mette; Timmermann, Allan; Wardle, David A; Aastrup, Peter; Svenning, Jens-Christian

2013-02-01

Predicting which species will occur together in the future, and where, remains one of the greatest challenges in ecology, and requires a sound understanding of how the abiotic and biotic environments interact with dispersal processes and history across scales. Biotic interactions and their dynamics influence species' relationships to climate, and this also has important implications for predicting future distributions of species. It is already well accepted that biotic interactions shape species' spatial distributions at local spatial extents, but the role of these interactions beyond local extents (e.g. 10 km(2) to global extents) are usually dismissed as unimportant. In this review we consolidate evidence for how biotic interactions shape species distributions beyond local extents and review methods for integrating biotic interactions into species distribution modelling tools. Drawing upon evidence from contemporary and palaeoecological studies of individual species ranges, functional groups, and species richness patterns, we show that biotic interactions have clearly left their mark on species distributions and realised assemblages of species across all spatial extents. We demonstrate this with examples from within and across trophic groups. A range of species distribution modelling tools is available to quantify species environmental relationships and predict species occurrence, such as: (i) integrating pairwise dependencies, (ii) using integrative predictors, and (iii) hybridising species distribution models (SDMs) with dynamic models. These methods have typically only been applied to interacting pairs of species at a single time, require a priori ecological knowledge about which species interact, and due to data paucity must assume that biotic interactions are constant in space and time. To better inform the future development of these models across spatial scales, we call for accelerated collection of spatially and temporally explicit species data. Ideally

Lichen species preference by reindeer

Energy Technology Data Exchange (ETDEWEB)

Holleman, D F; Luick, J R

1977-08-01

The preference by reindeer for five species of lichens commonly found on Central Alaska rangelands was tested under controlled laboratory conditions. Results indicate that reindeer are strongly selective species in their lichen grazing habits. The five tested species ranged as follows in order of decreasing acceptibility: Caldonia alpestris, C. rangiferina, Stereocaulon paschale, Cetraria richardsonii, and Peltigera aphthosa.

Endangered Lilium Species of Turkey

Directory of Open Access Journals (Sweden)

Sevim Demir

2018-01-01

Full Text Available Turkey, which is among the major gene centers of the world and has a special place in plant genetic diversity. However, many plant genetic resources, including geophytes, are under genetic erosion because of the environmental and other problems and therefore face with the danger of extinction. Lilium ciliatum is endemic to North East Anatolia. IUCN (International Union for the Conservation of Natural Resources Red List Category of this species is Endangered (EN. Lilium ciliatum naturally grown in Zigana pass, Bayburt, Trabzon, Bulancak, Giresun and Gümüşhane is endangered and major threats of L. ciliatum are road construction and human disturbance related to ecotourism and recreation. It was reported that Lilium carniolicum naturally grown in Turkey is endangered although it isn’t in the IUCN Red List. Distribution areas of L. carniolicum are Trabzon, Rize, Artvin and it is also endemic to North East Anatolia. These species have high potential for use as ornamental plants with their colorful big flowers. In addition, the bulbs of these species are also used in the cosmetic industry and medicine. These are the main properties that increase the importance of L. ciliatum and L. carniolicum species. Therefore it is very important to protect the habitats of these species, ensure the continuity of their generations. The disappearance of these endemic species from our country means to disappear from the world. This review has been given in order to give some information about the endangered Lilium species of Turkey and conservation actions on these species in Turkey flora and take attention to the issue.

Eighteen microsatellite loci in Salix arbutifolia (Salicaceae) and cross-species amplification in Salix and Populus species.

Science.gov (United States)

Hoshikawa, Takeshi; Kikuchi, Satoshi; Nagamitsu, Teruyoshi; Tomaru, Nobuhiro

2009-07-01

Salix arbutifolia is a riparian dioecious tree species that is of conservation concern in Japan because of its highly restricted distribution. Eighteen polymorphic loci of dinucleotide microsatellites were isolated and characterized. Among these, estimates of the expected heterozygosity ranged from 0.350 to 0.879. Cross-species amplification was successful at 9-13 loci among six Salix species and at three loci in one Populus species. © 2009 Blackwell Publishing Ltd.

Discordance between morphological and molecular species boundaries among Caribbean species of the reef sponge Callyspongia.

Science.gov (United States)

DeBiasse, Melissa B; Hellberg, Michael E

2015-02-01

Sponges are among the most species-rich and ecologically important taxa on coral reefs, yet documenting their diversity is difficult due to the simplicity and plasticity of their morphological characters. Genetic attempts to identify species are hampered by the slow rate of mitochondrial sequence evolution characteristic of sponges and some other basal metazoans. Here we determine species boundaries of the Caribbean coral reef sponge genus Callyspongia using a multilocus, model-based approach. Based on sequence data from one mitochondrial (COI), one ribosomal (28S), and two single-copy nuclear protein-coding genes, we found evolutionarily distinct lineages were not concordant with current species designations in Callyspongia. While C. fallax,C. tenerrima, and C. plicifera were reciprocally monophyletic, four taxa with different morphologies (C. armigera,C. longissima,C. eschrichtii, and C. vaginalis) formed a monophyletic group and genetic distances among these taxa overlapped distances within them. A model-based method of species delimitation supported collapsing these four into a single evolutionary lineage. Variation in spicule size among these four taxa was partitioned geographically, not by current species designations, indicating that in Callyspongia, these key taxonomic characters are poor indicators of genetic differentiation. Taken together, our results suggest a complex relationship between morphology and species boundaries in sponges.

Hierarchical species distribution models

Science.gov (United States)

Hefley, Trevor J.; Hooten, Mevin B.

2016-01-01

Determining the distribution pattern of a species is important to increase scientific knowledge, inform management decisions, and conserve biodiversity. To infer spatial and temporal patterns, species distribution models have been developed for use with many sampling designs and types of data. Recently, it has been shown that count, presence-absence, and presence-only data can be conceptualized as arising from a point process distribution. Therefore, it is important to understand properties of the point process distribution. We examine how the hierarchical species distribution modeling framework has been used to incorporate a wide array of regression and theory-based components while accounting for the data collection process and making use of auxiliary information. The hierarchical modeling framework allows us to demonstrate how several commonly used species distribution models can be derived from the point process distribution, highlight areas of potential overlap between different models, and suggest areas where further research is needed.

Sub specie aeternitatis

Directory of Open Access Journals (Sweden)

Laura Gioeni

2012-10-01

Full Text Available Per delineare il rapporto tra etica ed estetica nell'architettura e rispondere alla domanda principale «che cosa è o dovrebbe essere un buon architetto?», il saggio discute la tesi di Wittgenstein secondo cui «l'opera d'arte è l'oggetto visto sub specie aeternitatis e la vita buona è il mondo visto sub specie aeternitatis. Questa è la connessione tra arte ed etica».

The definition of species richness used by species sensitivity distributions approximates observed effects of salinity on stream macroinvertebrates

Energy Technology Data Exchange (ETDEWEB)

Kefford, Ben J., E-mail: ben.kefford@uts.edu.a [School of Applied Sciences, RMIT University, Victoria (Australia); Centre for Environmental Sustainability, Department of Environmental Science, University of Technology Sydney, New South Wales (Australia); Marchant, Richard [Department of Entomology, Museum of Victoria, Victoria (Australia); Schaefer, Ralf B. [School of Applied Sciences, RMIT University, Victoria (Australia); Metzeling, Leon [EPA Victoria, Macleod, Victoria (Australia); Dunlop, Jason E. [Department of Environment and Resource Management, Indooroopilly, Queensland (Australia); National Research Centre for Environmental Toxicology, University of Queensland, Coopers Plains, Queensland (Australia); Choy, Satish C. [Department of Environment and Resource Management, Indooroopilly, Queensland (Australia); Goonan, Peter [South Australia Environment Protection Authority, Adelaide, South Australia (Australia)

2011-01-15

The risk of chemicals for ecological communities is often forecast with species sensitivity distributions (SSDs) which are used to predict the concentration which will protect p% of species (PC{sub p} value). However, at the PC{sub p} value, species richness in nature would not necessary be p% less than at uncontaminated sites. The definition of species richness inherent to SSDs (contaminant category richness) contrasts with species richness typically measured in most field studies (point richness). We determine, for salinity in eastern Australia, whether these definitions of stream macroinvertebrate species richness are commensurable. There were strong relationships (r{sup 2} {>=} 0.87) between mean point species, family and Ephemeroptera, Trichoptera and Plecoptera species richness and their respective contamination category richness. Despite differences in the definition of richness used by SSDs and field biomonitoring, their results in terms of relative species loss from salinity in south-east Australia are similar. We conclude that in our system both definitions are commensurable. - Definitions of species richness inherit in SSDs and biomonitoring are for salinity in south-east Australia commensurable.

The definition of species richness used by species sensitivity distributions approximates observed effects of salinity on stream macroinvertebrates

International Nuclear Information System (INIS)

Kefford, Ben J.; Marchant, Richard; Schaefer, Ralf B.; Metzeling, Leon; Dunlop, Jason E.; Choy, Satish C.; Goonan, Peter

2011-01-01

The risk of chemicals for ecological communities is often forecast with species sensitivity distributions (SSDs) which are used to predict the concentration which will protect p% of species (PC p value). However, at the PC p value, species richness in nature would not necessary be p% less than at uncontaminated sites. The definition of species richness inherent to SSDs (contaminant category richness) contrasts with species richness typically measured in most field studies (point richness). We determine, for salinity in eastern Australia, whether these definitions of stream macroinvertebrate species richness are commensurable. There were strong relationships (r 2 ≥ 0.87) between mean point species, family and Ephemeroptera, Trichoptera and Plecoptera species richness and their respective contamination category richness. Despite differences in the definition of richness used by SSDs and field biomonitoring, their results in terms of relative species loss from salinity in south-east Australia are similar. We conclude that in our system both definitions are commensurable. - Definitions of species richness inherit in SSDs and biomonitoring are for salinity in south-east Australia commensurable.

Two new species of Aulospongus Norman, 1878 with a key to the Atlantic species (Poecilosclerida; Demospongiae; Porifera).

Science.gov (United States)

Cavalcanti, Thaynã; Santos, George Garcia; Pinheiro, Ulisses

2014-07-03

We describe two new species: Aulospongus trirhabdostylus sp. nov. and Aulospongus mandela sp. nov. from Potiguar Basin (Rio Grande do Norte State, Northeastern Brazil). Both species were compared with their congeners and an identification key for the Atlantic species of Aulospongus is provided. The genus Aulospongus now contains 16 species.

Systematics of the Dendropsophus leucophyllatus species complex (Anura: Hylidae): Cryptic diversity and the description of two new species

Science.gov (United States)

Caminer, Marcel A.; Milá, Borja; Jansen, Martin; Fouquet, Antoine; Venegas, Pablo J.; Chávez, Germán; Lougheed, Stephen C.

2017-01-01

Genetic data in studies of systematics of Amazonian amphibians frequently reveal that purportedly widespread single species in reality comprise species complexes. This means that real species richness may be significantly higher than current estimates. Here we combine genetic, morphological, and bioacoustic data to assess the phylogenetic relationships and species boundaries of two Amazonian species of the Dendropsophus leucophyllatus species group: D. leucophyllatus and D. triangulum. Our results uncovered the existence of five confirmed and four unconfirmed candidate species. Among the confirmed candidate species, three have available names: Dendropsophus leucophyllatus, Dendropsophus triangulum, and Dendropsophus reticulatus, this last being removed from the synonymy of D. triangulum. A neotype of D. leucophyllatus is designated. We describe the remaining two confirmed candidate species, one from Bolivia and another from Peru. All confirmed candidate species are morphologically distinct and have much smaller geographic ranges than those previously reported for D. leucophyllatus and D. triangulum sensu lato. Dendropsophus leucophyllatus sensu stricto occurs in the Guianan region. Dendropsophus reticulatus comb. nov. corresponds to populations in the Amazon basin of Brazil, Ecuador, and Peru previously referred to as D. triangulum. Dendropsophus triangulum sensu stricto is the most widely distributed species; it occurs in Amazonian Ecuador, Peru and Brazil, reaching the state of Pará. We provide accounts for all described species including an assessment of their conservation status. PMID:28248998

Four new species of frogs and one new species of snake from the Chapare region of Bolivia, with notes on other species

Science.gov (United States)

Reynolds, R.P.; Foster, M.S.

1992-01-01

We report on a collection of 74 frogs, 11 lots of frog eggs or tadpoles, and two snakes collected from the Chapare Region in the yungas of the eastern Andean Cordillera de Cochabamba, Bolivia. Collecting localities range from approximately 300 m to >3200 m in elevation. The specimens pertain to 23 species, probably 10 of which are undescribed. We describe four new species of frogs, one each in the genera Bufo, Centrolenella, Colostethus, and Hyla, and one new species of snake, genus Dipsas. We place Atelopus rugulosus in synonymy with A. tricolor.

Deriving field-based species sensitivity distributions (f-SSDs) from stacked species distribution models (S-SDMs).

Science.gov (United States)

Schipper, Aafke M; Posthuma, Leo; de Zwart, Dick; Huijbregts, Mark A J

2014-12-16

Quantitative relationships between species richness and single environmental factors, also called species sensitivity distributions (SSDs), are helpful to understand and predict biodiversity patterns, identify environmental management options and set environmental quality standards. However, species richness is typically dependent on a variety of environmental factors, implying that it is not straightforward to quantify SSDs from field monitoring data. Here, we present a novel and flexible approach to solve this, based on the method of stacked species distribution modeling. First, a species distribution model (SDM) is established for each species, describing its probability of occurrence in relation to multiple environmental factors. Next, the predictions of the SDMs are stacked along the gradient of each environmental factor with the remaining environmental factors at fixed levels. By varying those fixed levels, our approach can be used to investigate how field-based SSDs for a given environmental factor change in relation to changing confounding influences, including for example optimal, typical, or extreme environmental conditions. This provides an asset in the evaluation of potential management measures to reach good ecological status.

Sea Cucumber (Holothuroidea Species of Turkey

Directory of Open Access Journals (Sweden)

Mehmet AYDIN

2016-11-01

Full Text Available There are nearly 1200 sea cucumber species in the world oceans, while only 37 species from Holothuroidea class lives in the Mediterranean Sea. This preliminary study aims identification sea cucumbers species of the Turkish waters. The sea cucumber samples used in this study were obtained from a series of different studies between the years of 2008 and 2014. Identification of the species are mainly based on the morphometric characteristics while some of species are determined from their calcareous spicules. Eight sea species were identified in this research which are; Holothuria tubulosa, Holothuria polii, Holothuria mammata, Holothuria (Platyperona sanctori, Holothuria forskali, Stichopus regalis, Synaptula reciprocans and Stereoderma kirschbergi. There are limited number of studies in the literature focusing on the identification of the sea cucumber species spread in our seas. Therefore, this study is believed to play an important role in guiding future researches.

Floristic analysis of perennial species on flowerbeds in Belgrade with special attention on invasiveness of the recorded species

Directory of Open Access Journals (Sweden)

Popović Marija

2012-01-01

Full Text Available Urban areas are among the most important centres of invasive plant species distribution due to their richness in alien species. Because of that, a detailed floristic analysis of perennial flowerbeds was conducted in the central parks of Belgrade. A total of 53 perennial species were found, of which 55% were the alien species planted on 75% of the research area. Among them, two species (Aster novi belgii and Solidago canadensis are invasive and six species are potentially invasive in Serbia. These are planted on 5% and 20% of the flowerbeds, respectively. We can conclude that both the experts and institutions should be informed about the invasive species and potential damages. In the meantime, planting of native decorative species should be encouraged, since they will not pose a threat to natural habitats. Also, detailed research should be conducted in order to eradicate invasive and potentially invasive species from the surfaces around the research area.

New species of Bacuma Cameron (Hymenoptera: Braconidae: Braconinae) from Kenya and West Darfur with a key to species.

Science.gov (United States)

Quicke, Donald L J; Guy, Travis J; Noort, Simon VAN; Broad, Gavin R; Butcher, Buntika A

2017-05-08

Three new species of the Afrotropical braconine wasp genus Bacuma are described, and biological observations (nectar feeding) by one of them are noted. The new species are: B. kayserae Quicke & Butcher sp. nov. from Kenya, B. madiensis Quicke & Butcher sp. nov. from Uganda and B. darfurensis Quicke & Butcher sp. nov. from Sudan. A group of four large nominal species with red metasomas and finely sculptured tergites (B. granulatus, B. maculipennis, B. rufa and B. whitei) may represent a single widespread species or a pair of species separated by mesoscutum colour, or four separate but morphologically very similar species. However, given the small number of specimens available for study and the poor condition of some of these, including the types, they are not formally synonymised here. A partial key to the species of Bacuma is presented, which recognizes those species that are clearly distinct, including three new species. Interactive Lucid dichotomous and matrix keys are available on www.waspweb.org.

Molecular and morphological approaches for species delimitation and hybridization investigations of two Cichla species

Directory of Open Access Journals (Sweden)

Andrea A. F. Mourão

Full Text Available ABSTRACT The hybridization is a widely-discussed issue in several studies with fish species. For some authors, hybridization may be related with diversification and speciation of several groups, or also with the extinction of populations or species. Difficulties to differentiate species and hybrids may be a problem to correctly apply a management of wild species, because hybrid lineages, especially the advanced ones, may resemble the parental species. The genus Cichla Bloch & Schneider, 1801 constitutes an interesting experimental model, considering that hybridization and taxonomic uncertainties hinder a correct identification. Considering these problems, in this study, we developed genetic methodologies and applied meristic and morphometric approaches in wild samples in order to identify species and for test a possible hybridization between Cichla kelberi Kullander & Ferreira, 2006 and Cichla piquiti Kullander & Ferreira, 2006. For this, C. kelberi, C. piquiti and potential hybrid ( carijó individuals were collected in Paraná and Tietê rivers (SP, Brazil. For meristic and morphometric methods, the individuals were analyzed using the statistical software Pcord 5:31, while for molecular methods, primers for PCR-multiplex were designed and enzyme for PCR-RFLP were selected, under the species-specific nucleotide. All results indicated that the carijó is not an interspecific hybrid, because it presented identical genetic pattern and morphology closed to C. piquiti. Thus, we propose that carijó is a C. piquiti morphotype. In addition, this study promotes a new molecular tool that could be used in future research, monitoring and management programs of the genus Cichla.

Chapter 16: Species Diversity

African Journals Online (AJOL)

zargaran

2012-05-03

May 3, 2012 ... rarefaction method was recorded in Pardanan, with 28 oak gall wasps species. Furthermore, the highest amount of Gini-Simpson and Shannon entropy index were recorded in Sardasht, while the highest evenness was recorded in Shalmash. Differences in the local distribution of oak species, especially.

The Origin of Species

NARCIS (Netherlands)

Darwin, Charles

2005-01-01

In The Origin of Species Darwin outlined his theory of evolution, which proposed that species had been evolving and differentiating over time under the influence of natural selection. On its publication it became hugely influential, bringing about a seismic shift in the scientific view of humanitys

Support your local species

DEFF Research Database (Denmark)

Stärk, Johanna

Nearly a quarter of all animal species within the European Union are threatened with extinction. Protecting many of these species will require the full spectrum of conservation actions from in-situ to ex-situ management. Holding an estimated 44% of EU Red Listed terrestrial vertebrates, zoos hereby...

Socially-parasitic Myrmica species (Hymenoptera, Formicidae) of Himalaya, with the description of a new species.

Science.gov (United States)

Bharti, Himender; Radchenko, Alexander; Sasi, Sishal

2016-01-01

A new socially-parasitic species, Myrmica latra sp. n. is described based on a queen and male from Indian Himalaya. Its queen differs from other species by the distinctly narrower petiole and postpetiole, blunt and non-divergent propodeal spines, and a darker body colour. The taxonomic position of the three known Himalayan socially-parasitic Myrmica species is discussed, and Myrmica ereptrix Bolton 1988 is transferred to the smythiesii species-group. It is supposed that Myrmica nefaria Bharti 2012 is a temporary social parasite, but Myrmica ereptrix and Myrmica latra sp. n. are permanent social parasites, and a key for their identification is provided.

Species concepts, species delimitation and the inherent limitations

Indian Academy of Sciences (India)

Frank Zachos

synchrony and to sexually reproducing organisms would not be a problem anymore ... approach to species delimitation that combines genetic data with .... The datasets or algorithms could then be modified so that the groups yielded conform.

Does temperature-mediated reproductive success drive the direction of species displacement in two invasive species of leafminer fly?

Directory of Open Access Journals (Sweden)

Haihong Wang

Full Text Available Liriomyza sativae and L. trifolii (Diptera: Agromyzidae are two highly invasive species of leafmining flies, which have become established as pests of horticultural crops throughout the world. In certain regions where both species have been introduced, L. sativae has displaced L. trifolii, whereas the opposite has occurred in other regions. These opposing outcomes suggest that neither species is an inherently superior competitor. The regions where these displacements have been observed (southern China, Japan and western USA are climatically different. We determined whether temperature differentially affects the reproductive success of these species and therefore if climatic differences could affect the outcome of interspecific interactions where these species are sympatric. The results of life table parameters indicate that both species can develop successfully at all tested temperatures (20, 25, 31, 33°C. L. sativae had consistently higher fecundities at all temperatures, but L. trifolii developed to reproductive age faster. Age-stage specific survival rates were higher for L. sativae at low temperatures, but these were higher for L. trifolii at higher temperatures. We then compared the net reproductive rates (R0 for both species in pure and mixed cultures maintained at the same four constant temperatures. Both species had significantly lower net reproductive rates in mixed species cultures compared with their respective pure species cultures, indicating that both species are subject to intense interspecific competition. Net reproductive rates were significantly greater for L. sativae than for L. trifolii in mixed species groups at the lower temperatures, whereas the opposite occurred at the higher temperature. Therefore, interactions between the species are temperature dependent and small differences could shift the competitive balance between the species. These temperature mediated effects may contribute to the current ongoing displacement

Protectiveness of Species Sensitivity Distribution Hazard Concentrations for Acute Toxicity Used in Endangered Species Risk Assessment

Science.gov (United States)

A primary objective of threatened and endangered species conservation is to ensure that chemical contaminants and other stressors do not adversely affect listed species. Assessments of the ecological risks of chemical exposures to listed species often rely on the use of surrogate...

The nature of plant species.

Science.gov (United States)

Rieseberg, Loren H; Wood, Troy E; Baack, Eric J

2006-03-23

Many botanists doubt the existence of plant species, viewing them as arbitrary constructs of the human mind, as opposed to discrete, objective entities that represent reproductively independent lineages or 'units of evolution'. However, the discreteness of plant species and their correspondence with reproductive communities have not been tested quantitatively, allowing zoologists to argue that botanists have been overly influenced by a few 'botanical horror stories', such as dandelions, blackberries and oaks. Here we analyse phenetic and/or crossing relationships in over 400 genera of plants and animals. We show that although discrete phenotypic clusters exist in most genera (> 80%), the correspondence of taxonomic species to these clusters is poor (< 60%) and no different between plants and animals. Lack of congruence is caused by polyploidy, asexual reproduction and over-differentiation by taxonomists, but not by contemporary hybridization. Nonetheless, crossability data indicate that 70% of taxonomic species and 75% of phenotypic clusters in plants correspond to reproductively independent lineages (as measured by postmating isolation), and thus represent biologically real entities. Contrary to conventional wisdom, plant species are more likely than animal species to represent reproductively independent lineages.

Two new species of nocturnal bees of the genus Megalopta (Hymenoptera: Halictidae) with keys to species

OpenAIRE

Gonzalez, Victor H; Griswold, Terry; Ayala, Ricardo

2010-01-01

Megalopta Smith, 1853, is a Neotropical genus of nocturnal or crepuscular bees. Two subgenera are recognized with most of its nearly 30 species placed in the nominate subgenus. Species of Megalopta s. str. are more commonly collected than species of Noctoraptor Engel et al. 1997, all presumably parasites of Megalopta s. str. Two new species of Megalopta are described here: M. (Megalopta) tetewana, n. sp., from Mexico and M. (Noctoraptor) huaoranii, n. sp., from Ecuador. Identification keys to...

Genomic definition of species. Revision 2

Energy Technology Data Exchange (ETDEWEB)

Crkvenjakov, R.; Drmanac, R.

1993-03-01

A genome is the sum total of the DNA sequences in the cells of an individual organism. The common usage that species possess genomes comes naturally to biochemists, who have shown that all protein and nucleic acid molecules are at the same time species- and individual-specific, with minor individual variations being superimposed on a consensus sequence that is constant for a species. By extension, this property is attributed to the common features of DNA in the chromosomes of members of a given species and is called species genome. Our proposal for the definition of a biological species is as follows: A species comprises a group of actual and potential biological organisms built according to a unique genome program that is recorded, and at least in part expressed, in the structures of their genomic nucleic acid molecule(s), having intragroup sequence differences which can be fully interconverted in the process of organismal reproduction.

Effects of species biological traits and environmental heterogeneity on simulated tree species distribution shifts under climate change.

Science.gov (United States)

Wang, Wen J; He, Hong S; Thompson, Frank R; Spetich, Martin A; Fraser, Jacob S

2018-09-01

Demographic processes (fecundity, dispersal, colonization, growth, and mortality) and their interactions with environmental changes are not well represented in current climate-distribution models (e.g., niche and biophysical process models) and constitute a large uncertainty in projections of future tree species distribution shifts. We investigate how species biological traits and environmental heterogeneity affect species distribution shifts. We used a species-specific, spatially explicit forest dynamic model LANDIS PRO, which incorporates site-scale tree species demography and competition, landscape-scale dispersal and disturbances, and regional-scale abiotic controls, to simulate the distribution shifts of four representative tree species with distinct biological traits in the central hardwood forest region of United States. Our results suggested that biological traits (e.g., dispersal capacity, maturation age) were important for determining tree species distribution shifts. Environmental heterogeneity, on average, reduced shift rates by 8% compared to perfect environmental conditions. The average distribution shift rates ranged from 24 to 200myear -1 under climate change scenarios, implying that many tree species may not able to keep up with climate change because of limited dispersal capacity, long generation time, and environmental heterogeneity. We suggest that climate-distribution models should include species demographic processes (e.g., fecundity, dispersal, colonization), biological traits (e.g., dispersal capacity, maturation age), and environmental heterogeneity (e.g., habitat fragmentation) to improve future predictions of species distribution shifts in response to changing climates. Copyright © 2018 Elsevier B.V. All rights reserved.

Diversification of Cercopithifilaria species (Nematoda: Filarioidea in Japanese wild ruminants with description of two new species

Directory of Open Access Journals (Sweden)

Uni S.

2002-12-01

Full Text Available Twelve of the 17 Cervus nippon nippon deer from Kyushu Island, Japan, that we examined were infected with one or two Cercopithifilaria species. C. longa n. sp. adults were in the subcutaneous tissues of limbs and the abdomen, and C. crassa n. sp. adults were in the skin, mainly in the anterior part of the back ; the distribution of the dermal microfilariae generally matched that of the adult worms. The two new species were assigned to the group of primitive Cercopithifilaria species that parasitize ruminants (bovids and cervids, but the new species could readily be distinguished from others morphologically. C. longa was more primitive and resembled C. bulboidea, one of the five species from the serow Capricornis crispus, a Japanese member of the Caprinae, and species from Bovidae in Africa. C. crassa had a thick body and large spicules like C. rugosicauda from Capreolus capreolus in Europe, the only previously known Cercopithifilaria species from cervids, but it also had one or two hypertrophied pairs of caudal papillae, an unusual character found so far only in Japanese parasites. Among the 12 species known from ruminants, four are African, one is European and more highly evolved, and seven are Japanese, with some being primitive and some more evolved. The great diversity of Cercopithifilaria species in the two wild ruminants that live in Japan seems to have resulted from local speciation, which occurred during the Pleistocene, from a primitive form of the C. longa type derived from Eurasiatic ancestors, which has disappeared or, more probably, not yet been discovered.

A nuclear DNA-based species determination and DNA quantification assay for common poultry species.

Science.gov (United States)

Ng, J; Satkoski, J; Premasuthan, A; Kanthaswamy, S

2014-12-01

DNA testing for food authentication and quality control requires sensitive species-specific quantification of nuclear DNA from complex and unknown biological sources. We have developed a multiplex assay based on TaqMan® real-time quantitative PCR (qPCR) for species-specific detection and quantification of chicken (Gallus gallus), duck (Anas platyrhynchos), and turkey (Meleagris gallopavo) nuclear DNA. The multiplex assay is able to accurately detect very low quantities of species-specific DNA from single or multispecies sample mixtures; its minimum effective quantification range is 5 to 50 pg of starting DNA material. In addition to its use in food fraudulence cases, we have validated the assay using simulated forensic sample conditions to demonstrate its utility in forensic investigations. Despite treatment with potent inhibitors such as hematin and humic acid, and degradation of template DNA by DNase, the assay was still able to robustly detect and quantify DNA from each of the three poultry species in mixed samples. The efficient species determination and accurate DNA quantification will help reduce fraudulent food labeling and facilitate downstream DNA analysis for genetic identification and traceability.

Genome Sequences of Oryza Species

KAUST Repository

Kumagai, Masahiko

2018-02-14

This chapter summarizes recent data obtained from genome sequencing, annotation projects, and studies on the genome diversity of Oryza sativa and related Oryza species. O. sativa, commonly known as Asian rice, is the first monocot species whose complete genome sequence was deciphered based on physical mapping by an international collaborative effort. This genome, along with its accurate and comprehensive annotation, has become an indispensable foundation for crop genomics and breeding. With the development of innovative sequencing technologies, genomic studies of O. sativa have dramatically increased; in particular, a large number of cultivars and wild accessions have been sequenced and compared with the reference rice genome. Since de novo genome sequencing has become cost-effective, the genome of African cultivated rice, O. glaberrima, has also been determined. Comparative genomic studies have highlighted the independent domestication processes of different rice species, but it also turned out that Asian and African rice share a common gene set that has experienced similar artificial selection. An international project aimed at constructing reference genomes and examining the genome diversity of wild Oryza species is currently underway, and the genomes of some species are publicly available. This project provides a platform for investigations such as the evolution, development, polyploidization, and improvement of crops. Studies on the genomic diversity of Oryza species, including wild species, should provide new insights to solve the problem of growing food demands in the face of rapid climatic changes.

Genome Sequences of Oryza Species

KAUST Repository

Kumagai, Masahiko; Tanaka, Tsuyoshi; Ohyanagi, Hajime; Hsing, Yue-Ie C.; Itoh, Takeshi

2018-01-01

This chapter summarizes recent data obtained from genome sequencing, annotation projects, and studies on the genome diversity of Oryza sativa and related Oryza species. O. sativa, commonly known as Asian rice, is the first monocot species whose complete genome sequence was deciphered based on physical mapping by an international collaborative effort. This genome, along with its accurate and comprehensive annotation, has become an indispensable foundation for crop genomics and breeding. With the development of innovative sequencing technologies, genomic studies of O. sativa have dramatically increased; in particular, a large number of cultivars and wild accessions have been sequenced and compared with the reference rice genome. Since de novo genome sequencing has become cost-effective, the genome of African cultivated rice, O. glaberrima, has also been determined. Comparative genomic studies have highlighted the independent domestication processes of different rice species, but it also turned out that Asian and African rice share a common gene set that has experienced similar artificial selection. An international project aimed at constructing reference genomes and examining the genome diversity of wild Oryza species is currently underway, and the genomes of some species are publicly available. This project provides a platform for investigations such as the evolution, development, polyploidization, and improvement of crops. Studies on the genomic diversity of Oryza species, including wild species, should provide new insights to solve the problem of growing food demands in the face of rapid climatic changes.

Species interactions and plant polyploidy.

Science.gov (United States)

Segraves, Kari A; Anneberg, Thomas J

2016-07-01

Polyploidy is a common mode of speciation that can have far-reaching consequences for plant ecology and evolution. Because polyploidy can induce an array of phenotypic changes, there can be cascading effects on interactions with other species. These interactions, in turn, can have reciprocal effects on polyploid plants, potentially impacting their establishment and persistence. Although there is a wealth of information on the genetic and phenotypic effects of polyploidy, the study of species interactions in polyploid plants remains a comparatively young field. Here we reviewed the available evidence for how polyploidy may impact many types of species interactions that range from mutualism to antagonism. Specifically, we focused on three main questions: (1) Does polyploidy directly cause the formation of novel interactions not experienced by diploids, or does it create an opportunity for natural selection to then form novel interactions? (2) Does polyploidy cause consistent, predictable changes in species interactions vs. the evolution of idiosyncratic differences? (3) Does polyploidy lead to greater evolvability in species interactions? From the scarce evidence available, we found that novel interactions are rare but that polyploidy can induce changes in pollinator, herbivore, and pathogen interactions. Although further tests are needed, it is likely that selection following whole-genome duplication is important in all types of species interaction and that there are circumstances in which polyploidy can enhance the evolvability of interactions with other species. © 2016 Botanical Society of America.

Quantifying species recovery and conservation success to develop an IUCN Green List of Species.

Science.gov (United States)

Akçakaya, H Resit; Bennett, Elizabeth L; Brooks, Thomas M; Grace, Molly K; Heath, Anna; Hedges, Simon; Hilton-Taylor, Craig; Hoffmann, Michael; Keith, David A; Long, Barney; Mallon, David P; Meijaard, Erik; Milner-Gulland, E J; Rodrigues, Ana S L; Rodriguez, Jon Paul; Stephenson, P J; Stuart, Simon N; Young, Richard P

2018-03-26

Stopping declines in biodiversity is critically important, but it is only a first step toward achieving more ambitious conservation goals. The absence of an objective and practical definition of species recovery that is applicable across taxonomic groups leads to inconsistent targets in recovery plans and frustrates reporting and maximization of conservation impact. We devised a framework for comprehensively assessing species recovery and conservation success. We propose a definition of a fully recovered species that emphasizes viability, ecological functionality, and representation; and use counterfactual approaches to quantify degree of recovery. This allowed us to calculate a set of 4 conservation metrics that demonstrate impacts of conservation efforts to date (conservation legacy); identify dependence of a species on conservation actions (conservation dependence); quantify expected gains resulting from conservation action in the medium term (conservation gain); and specify requirements to achieve maximum plausible recovery over the long term (recovery potential). These metrics can incentivize the establishment and achievement of ambitious conservation targets. We illustrate their use by applying the framework to a vertebrate, an invertebrate, and a woody and an herbaceous plant. Our approach is a preliminary framework for an International Union for Conservation of Nature (IUCN) Green List of Species, which was mandated by a resolution of IUCN members in 2012. Although there are several challenges in applying our proposed framework to a wide range of species, we believe its further development, implementation, and integration with the IUCN Red List of Threatened Species will help catalyze a positive and ambitious vision for conservation that will drive sustained conservation action. © 2018 The Authors. Conservation Biology published by Wiley Periodicals, Inc. on behalf of Society for Conservation Biology.

Preferência por hospedeiro e estratificação de Culicidae (Diptera em área de remanescente florestal do Parque Regional do Iguaçu, Curitiba, Paraná, Brasil Host preference and Culicidae stratification in area of degradated inside forest of Regional do Iguaçu Park, Curitiba, Paraná, Brazil

Directory of Open Access Journals (Sweden)

Ana Cristina Tissot

2004-12-01

Full Text Available A investigação das populações de Culicidae em áreas de remanescentes florestais inseridas em área urbana, podem fornecer subsídios para compreensão dos processos de utilização de habitats apresentando diferentes graus de interferência antrópica. Foram investigadas espécies potencialmente zoofílicas durante o período vespertino no interior de remanescente florestal, no espaço urbano de Curitiba, Paraná. Durante o período de setembro de 2000 a junho de 2001, foram realizadas cinco coletas por estação, com auxílio de armadilhas CDC-M instaladas em dois estratos verticais, a 1,5 m do solo e na copa das árvores (6 m. Como iscas foram utilizados mamíferos Cavia porcellus (Linnaeus, 1758 (Rodentia, Cavidae e aves Nothura maculosa (Temminck, 1815 (Tinamiformes, Tinamidae em cada um dos estratos, com revezamento das iscas animais. As armadilhas foram operadas no intervalo horário das 16:00 às 20:00 h, sendo retiradas amostras a cada intervalo de 30 minutos. Em 60 horas de operação das armadilhas CDC-M, foram capturados 1.407 exemplares de Culicidae, sendo 1.143 espécies identificadas, distribuídas em nove gêneros e 13 espécies. As espécies mais freqüentes foram Mansonia(Mansonia fonsecai (Pinto, 1932 e Mansonia (Mansonia pessoai (Barreto e Coutinho, 1944, destaca-se também a ocorrência de: Ochlerotatus (Ochlerotatus scapularis (Rondani, 1848; Psorophora (Janthinosoma ferox (Humboldt, 1819 e Aedes (Stegomyia albopictus (Skuse, 1894. Na área foram detectadas a presença de espécies com graus variados de importância epidemiológica e com tendência a explorar ambientes exófilos, florestais e peridomiciliares.Parks and plazas (green areas or vegetation islands within urban areas can provide conditions for the development of populations of mosquitoes, many species of which are very adaptable to a variety of environments. The species of mosquitoes in the family Culicidae with animal hosts, in a vegetation island within an

Phylogeny and species delineation in European species of the genus Steganacarus (Acari, Oribatida) using mitochondrial and nuclear markers.

Science.gov (United States)

Kreipe, Victoria; Corral-Hernández, Elena; Scheu, Stefan; Schaefer, Ina; Maraun, Mark

2015-06-01

Species of the genus Steganacarus are soil-living oribatid mites (Acari, Phthiracaridae) with a ptychoid body. The phylogeny and species status of the species of Steganacarus are not resolved, some authors group all ten German species of Steganacarus within the genus Steganacarus whereas others split them into three subgenera, Steganacarus, Tropacarus and Atropacarus. Additionally, two species, S. magnus and T. carinatus, comprise morphotypes of questionable species status. We investigated the phylogeny and species status of ten European Steganacarus species, i.e. S. applicatus, S. herculeanus, S. magnus forma magna, S. magnus forma anomala, S. spinosus, Tropacarus brevipilus, T. carinatus forma carinata, T. carinatus forma pulcherrima, Atropacarus striculus and Rhacaplacarus ortizi. We used two molecular markers, a 251 bp fragment of the nuclear gene 28S rDNA (D3) and a 477 bp fragment of the mitochondrial COI region. The phylogeny based on a combined analysis of D3 and COI separated four subgenera (Steganacarus, Tropacarus and Atropacarus, Rhacaplacarus) indicating that they form monophyletic groups. The COI region separated all ten species of the genus Steganacarus and showed variation within some species often correlating with the geographic origin of the species. Resolution of the more conserved D3 region was limited, indicating that radiation events are rather recent. Overall, our results indicate that both genes alone cannot be used for phylogeny and barcoding since variation is too low in D3 and too high in COI. However, when used in combination these genes provide reliable insight into the phylogeny, radiation and species status of taxa of the genus Steganacarus.

Aquatic species and habitats

Science.gov (United States)

Danny C. Lee; James R. Sedell; Bruce E. Rieman; Russell F. Thurow; Jack E. Williams

1998-01-01

Continuing human activities threaten the highly prized aquatic resources of the interior Columbia basin. Precipitous declines in native species, particularly Pacific salmon, and a large influx of introduced species have radically altered the composition and distribution of native fishes. Fortunately, areas of relatively high aquatic integrity remain, much of it on...

Cross-species amplification of microsatellite loci developed for Passiflora edulis Sims. in related Passiflora Species

Directory of Open Access Journals (Sweden)

Gilmara Alvarenga Fachardo Oliveira

2013-10-01

Full Text Available The aim of this study was to evaluate the selected 41 SSR markers developed for yellow passion fruit (Passiflora edulis f. flavicarpa Sims. for their transferability to 11 different Passiflora species. Twenty-one SSR were successfully amplified in 10 wild species of passion fruit producing 101 bands. All the markers were amplifiable for at least one species. The mean transferability was 68,8%, ranging from 15,4% (primer PE11 to 100 % (PE13, PE18, PE37, PE41 and PE88. Transferability was higher for the species from the Passiflora subgenus than for those from the Decaloba and Dysosmia subgenus. The results indicated a high level of nucleotide sequence conservation of the primer regions in the species evaluated, and consequently, they could potentially be used for the establishment of molecular strategies for use in passion fruit breeding and genetics.

Onychiurid species from Wanda Mountains in China, with descriptions of two new species (Collembola, Onychiuridae)

Science.gov (United States)

Sun, Xin; Wu, Donghui

2014-01-01

Abstract A checklist of onychiurid species from the Wanda Mountains in China is presented. Eighteen species belonging to twelve genera have been found, including two new species. Bionychiurus qinglongensis sp. n. can be easily distinguished from other known species of the genus by the absence of pseudocelli on Th. I tergum and fewer number of vesicles in postantennal organ. Onychiurus heilongjiangensis sp. n. is diagnosed by pseudocellar formulae as 32/133/33352 dorsally and 3/011/31120 ventrally, parapseudocellar formula as 0/000/111001+1m, ratio of anal spine/unguis as 0.6, unguiculus without inner basal lamella, and male ventral organ absent. PMID:25147452

77 FR 30261 - Petition To List 83 Species of Coral as Threatened or Endangered Under the Endangered Species Act...

Science.gov (United States)

2012-05-22

... List 83 Species of Coral as Threatened or Endangered Under the Endangered Species Act (ESA) AGENCY... Diversity (CBD) to list 83 coral species as threatened or endangered under the Endangered Species Act (ESA... the U.S. Endangered Species Act (Status Review Report) and the draft Management Report for 82 Corals...

Is Drosophila-microbe association species-specific or region specific? A study undertaken involving six Indian Drosophila species.

Science.gov (United States)

Singhal, Kopal; Khanna, Radhika; Mohanty, Sujata

2017-06-01

The present work aims to identify the microbial diversity associated with six Indian Drosophila species using next generation sequencing (NGS) technology and to discover the nature of their distribution across species and eco-geographic regions. Whole fly gDNA of six Drosophila species were used to generate sequences in an Illumina platform using NGS technology. De novo based assembled raw reads were blasted against the NR database of NCBI using BLASTn for identification of their bacterial loads. We have tried to include Drosophila species from different taxonomical groups and subgroups and from three different eco-climatic regions India; four species belong to Central India, while the rest two, D. melanogaster and D. ananassae, belong to West and South India to determine both their species-wise and region-wide distribution. We detected the presence of 33 bacterial genera across all six study species, predominated by the class Proteobacteria. Amongst all, D. melanogaster was found to be the most diverse by carrying around 85% of the bacterial diversity. Our findings infer both species-specific and environment-specific nature of the bacterial species inhabiting the Drosophila host. Though the present results are consistent with most of the earlier studies, they also remain incoherent with some. The present study outcome on the host-bacteria association and their species specific adaptation may provide some insight to understand the host-microbial interactions and the phenotypic implications of microbes on the host physiology. The knowledge gained may be importantly applied into the recent insect and pest population control strategy going to implement through gut microflora in India and abroad.

The relationship between species diversity and genetic structure in the rare Picea chihuahuana tree species community, Mexico.

Science.gov (United States)

Simental-Rodríguez, Sergio Leonel; Quiñones-Pérez, Carmen Zulema; Moya, Daniel; Hernández-Tecles, Enrique; López-Sánchez, Carlos Antonio; Wehenkel, Christian

2014-01-01

Species diversity and genetic diversity, the most basic elements of biodiversity, have long been treated as separate topics, although populations evolve within a community context. Recent studies on community genetics and ecology have suggested that genetic diversity is not completely independent of species diversity. The Mexican Picea chihuahuana Martínez is an endemic species listed as "Endangered" on the Red List. Forty populations of Chihuahua spruce have been identified. This species is often associated with tree species of eight genera in gallery forests. This rare Picea chihuahuana tree community covers an area no more than 300 ha and has been subject of several studies involving different topics such as ecology, genetic structure and climate change. The overall aim of these studies was to obtain a dataset for developing management tools to help decision makers implement preservation and conservation strategies. However, this unique forest tree community may also represent an excellent subject for helping us to understand the interplay between ecological and evolutionary processes in determining community structure and dynamics. The AFLP technique and species composition data were used together to test the hypothesis that species diversity is related to the adaptive genetic structure of some dominant tree species (Picea chihuahuana, Pinus strobiformis, Pseudotsuga menziesii and Populus tremuloides) of the Picea chihuahuana tree community at fourteen locations. The Hill numbers were used as a diversity measure. The results revealed a significant correlation between tree species diversity and genetic structure in Populus tremuloides. Because the relationship between the two levels of diversity was found to be positive for the putative adaptive AFLP detected, genetic and species structures of the tree community were possibly simultaneously adapted to a combination of ecological or environmental factors. The present findings indicate that interactions between

Species Typing in Dermal Leishmaniasis

Science.gov (United States)

Dujardin, Jean-Claude

2015-01-01

SUMMARY Leishmania is an infectious protozoan parasite related to African and American trypanosomes. All Leishmania species that are pathogenic to humans can cause dermal disease. When one is confronted with cutaneous leishmaniasis, identification of the causative species is relevant in both clinical and epidemiological studies, case management, and control. This review gives an overview of the currently existing and most used assays for species discrimination, with a critical appraisal of the limitations of each technique. The consensus taxonomy for the genus is outlined, including debatable species designations. Finally, a numerical literature analysis is presented that describes which methods are most used in various countries and regions in the world, and for which purposes. PMID:25672782

Cephalosporium maydis is a distinct species in the Gaeumannomyces-Harpophora species complex.

Science.gov (United States)

Saleh, Amgad A; Leslie, John F

2004-01-01

Cephalosporium maydis is an important plant pathogen whose phylogenetic position relative to other fungi has not been established clearly. We compared strains of C. maydis, strains from several other plant-pathogenic Cephalosporium spp. and several possible relatives within the Gaeumannomyces-Harpophora species complex, to which C. maydis has been suggested to belong based on previous preliminary DNA sequence analyses. DNA sequences of the nuclear genes encoding the rDNA ITS region, β-tubulin, histone H3, and MAT-2 support the hypothesis that C. maydis is a distinct taxon within the Gaeumannomyces-Harpophora species complex. Based on amplified fragment length polymorphism (AFLP) profiles, C. maydis also is distinct from the other tested species of Cephalosporium, Phialophora sensu lato and members of Gaeumannomyces-Harpophora species complex, which supports its classification as Harpophora maydis. Oligonucleotide primers for H. maydis were developed that can be used in a PCR diagnostic protocol to rapidly and reliably detect and identify this pathogen. These diagnostic PCR primers will aid the detection of H. maydis in diseased maize because this fungus can be difficult to detect and isolate, and the movement of authentic cultures may be limited by quarantine restrictions.

An empirical assessment of the focal species hypothesis.

Science.gov (United States)

Lindenmayer, D B; Lane, P W; Westgate, M J; Crane, M; Michael, D; Okada, S; Barton, P S

2014-12-01

Biodiversity surrogates and indicators are commonly used in conservation management. The focal species approach (FSA) is one method for identifying biodiversity surrogates, and it is underpinned by the hypothesis that management aimed at a particular focal species will confer protection on co-occurring species. This concept has been the subject of much debate, in part because the validity of the FSA has not been subject to detailed empirical assessment of the extent to which a given focal species actually co-occurs with other species in an assemblage. To address this knowledge gap, we used large-scale, long-term data sets of temperate woodland birds to select focal species associated with threatening processes such as habitat isolation and loss of key vegetation attributes. We quantified co-occurrence patterns among focal species, species in the wider bird assemblage, and species of conservation concern. Some, but not all, focal species were associated with high levels of species richness. One of our selected focal species was negatively associated with the occurrence of other species (i.e., it was an antisurrogate)-a previously undescribed property of nominated focal species. Furthermore, combinations of focal species were not associated with substantially elevated levels of bird species richness, relative to levels associated with individual species. Our results suggest that although there is some merit to the underpinning concept of the FSA, there is also a need to ensure that actions are sufficiently flexible because management tightly focused on a given focal species may not benefit some other species, including species of conservation concern, such of which might not occur in species-rich assemblages. © 2014 Society for Conservation Biology.

Species composition of a soil invertebrate multi-species test system determines the level of ecotoxicity

International Nuclear Information System (INIS)

Sechi, Valentina; D'Annibale, Alessandra; Maraldo, Kristine; Johansen, Anders; Bossi, Rossana; Jensen, John; Krogh, Paul Henning

2014-01-01

A soil multi-species, SMS, experimental test system consisting of the natural microbial community, five collembolan species and a predatory mite along with either Enchytraeus crypticus or the earthworm Eisenia fetida were exposed to α-cypermethrin. A comparison of the performance of these two types of SMSs is given to aid the development of a standard test system. E. fetida had a positive effect on the majority of the species, reducing the negative insecticide effect. E. fetida affected the species sensitivity and decreased the degradation of the insecticide due to the organic matter incorporation of earthworm food. After 8 weeks, the EC50 was 0.76 mg kg −1 for enchytraeids and ranged between 2.7 and 18.9 mg kg −1 for collembolans, more sensitive than previously observed with single species. Changes observed in the community structure and function illustrates the strength of a multi-species test system as an ecotoxicological tool compared to single species tests. -- Highlights: • Degradation of alpha-cypermethrin was faster with enchytraeids than with earthworms. • Lumbricid castings and bioturbation explains bioavailability of α-cypermethrin. • Pesticide effects on soil arthropods alter with the community composition. • Multispecies test systems are feasible with either an enchytraeid or a lumbricid. • Collembolans are more sensitive to cypermethrin with enchytraeids than with earthworms. -- Soil ecotoxicological fate and effects in multispecies test systems are affected by earthworm activity

Fusarium Species and Their Associated Mycotoxins.

Science.gov (United States)

Munkvold, Gary P

2017-01-01

The genus Fusarium includes numerous toxigenic species that are pathogenic to plants or humans, and are able to colonize a wide range of environments on earth. The genus comprises around 70 well-known species, identified by using a polyphasic approach, and as many as 300 putative species, according to phylogenetic species concepts; many putative species do not yet have formal names. Fusarium is one of the most economically important fungal genera because of yield loss due to plant pathogenic activity; mycotoxin contamination of food and feed products which often render them unaccep for marketing; and health impacts to humans and livestock, due to consumption of mycotoxins. Among the most important mycotoxins produced by species of Fusarium are the trichothecenes and the fumonisins. Fumonisins cause fatal livestock diseases and are considered potentially carcinogenic mycotoxins for humans, while trichothecenes are potent inhibitors of protein synthesis. This chapter summarizes the main aspects of morphology, pathology, and toxigenicity of the main Fusarium species that colonize different agricultural crops and environments worldwide, and cause mycotoxin contamination of food and feed.

Alien species in the Finnish weed flora

Directory of Open Access Journals (Sweden)

T. HYVÖNEN

2008-12-01

Full Text Available The present study aimed at assessing the invasion of alien weed species in Finland based on a review of their occurrence in the Finnish weed flora. The evaluation was conducted for the three phases of the invasion process, i.e. introduction, naturalization and invasion. The literature review revealed that 815 alien weed species occur in Finland of which 314 are regarded as naturalized. Based on their occurrence in different climate zones, the risk of naturalization of new harmful alien weed species was deemed low for those species not currently found in Finland, but higher for species occurring as casual aliens in Finland. In the latter group, 10 species of concern were detected. Exploration of the distribution patterns of naturalized species within Finland revealed species occupancy to be dependent on the residence time of the species. Established neophytes can be expected to extend their ranges and to increase occupation of agricultural habitats in the future.;

Evaluation of a multiple-species approach to monitoring species at the ecoregional scale

Science.gov (United States)

Patricia N. Manley; William J. Zielinski; Matthew D. Schlesinger; Sylvia R. Mori

2004-01-01

Monitoring is required of land managers and conservation practitioners to assess the success of management actions. "Shortcuts" are sought to reduce monitoring costs, most often consisting of the selection of a small number of species that are closely monitored to represent the status of many associated species and environmental correlates. Assumptions...

Incorporating population viability models into species status assessment and listing decisions under the U.S. Endangered Species Act

Directory of Open Access Journals (Sweden)

Conor P. McGowan

2017-10-01

Full Text Available Assessment of a species' status is a key part of management decision making for endangered and threatened species under the U.S. Endangered Species Act. Predicting the future state of the species is an essential part of species status assessment, and projection models can play an important role in developing predictions. We built a stochastic simulation model that incorporated parametric and environmental uncertainty to predict the probable future status of the Sonoran desert tortoise in the southwestern United States and North Central Mexico. Sonoran desert tortoise was a Candidate species for listing under the Endangered Species Act, and decision makers wanted to use model predictions in their decision making process. The model accounted for future habitat loss and possible effects of climate change induced droughts to predict future population growth rates, abundances, and quasi-extinction probabilities. Our model predicts that the population will likely decline over the next few decades, but there is very low probability of quasi-extinction less than 75 years into the future. Increases in drought frequency and intensity may increase extinction risk for the species. Our model helped decision makers predict and characterize uncertainty about the future status of the species in their listing decision. We incorporated complex ecological processes (e.g., climate change effects on tortoises in transparent and explicit ways tailored to support decision making processes related to endangered species.

Incorporating population viability models into species status assessment and listing decisions under the U.S. Endangered Species Act

Science.gov (United States)

McGowan, Conor P.; Allan, Nathan; Servoss, Jeff; Hedwall, Shaula J.; Wooldridge, Brian

2017-01-01

Assessment of a species' status is a key part of management decision making for endangered and threatened species under the U.S. Endangered Species Act. Predicting the future state of the species is an essential part of species status assessment, and projection models can play an important role in developing predictions. We built a stochastic simulation model that incorporated parametric and environmental uncertainty to predict the probable future status of the Sonoran desert tortoise in the southwestern United States and North Central Mexico. Sonoran desert tortoise was a Candidate species for listing under the Endangered Species Act, and decision makers wanted to use model predictions in their decision making process. The model accounted for future habitat loss and possible effects of climate change induced droughts to predict future population growth rates, abundances, and quasi-extinction probabilities. Our model predicts that the population will likely decline over the next few decades, but there is very low probability of quasi-extinction less than 75 years into the future. Increases in drought frequency and intensity may increase extinction risk for the species. Our model helped decision makers predict and characterize uncertainty about the future status of the species in their listing decision. We incorporated complex ecological processes (e.g., climate change effects on tortoises) in transparent and explicit ways tailored to support decision making processes related to endangered species.

Species-free species distribution models describe macroecological properties of protected area networks.

Science.gov (United States)

Robinson, Jason L; Fordyce, James A

2017-01-01

Among the greatest challenges facing the conservation of plants and animal species in protected areas are threats from a rapidly changing climate. An altered climate creates both challenges and opportunities for improving the management of protected areas in networks. Increasingly, quantitative tools like species distribution modeling are used to assess the performance of protected areas and predict potential responses to changing climates for groups of species, within a predictive framework. At larger geographic domains and scales, protected area network units have spatial geoclimatic properties that can be described in the gap analysis typically used to measure or aggregate the geographic distributions of species (stacked species distribution models, or S-SDM). We extend the use of species distribution modeling techniques in order to model the climate envelope (or "footprint") of individual protected areas within a network of protected areas distributed across the 48 conterminous United States and managed by the US National Park System. In our approach we treat each protected area as the geographic range of a hypothetical endemic species, then use MaxEnt and 5 uncorrelated BioClim variables to model the geographic distribution of the climatic envelope associated with each protected area unit (modeling the geographic area of park units as the range of a species). We describe the individual and aggregated climate envelopes predicted by a large network of 163 protected areas and briefly illustrate how macroecological measures of geodiversity can be derived from our analysis of the landscape ecological context of protected areas. To estimate trajectories of change in the temporal distribution of climatic features within a protected area network, we projected the climate envelopes of protected areas in current conditions onto a dataset of predicted future climatic conditions. Our results suggest that the climate envelopes of some parks may be locally unique or have

DNA barcoding of shark meats identify species composition and CITES-listed species from the markets in Taiwan.

Science.gov (United States)

Liu, Shang-Yin Vanson; Chan, Chia-Ling Carynn; Lin, Oceana; Hu, Chieh-Shen; Chen, Chaolun Allen

2013-01-01

An increasing awareness of the vulnerability of sharks to exploitation by shark finning has contributed to a growing concern about an unsustainable shark fishery. Taiwan's fleet has the 4th largest shark catch in the world, accounting for almost 6% of the global figures. Revealing the diversity of sharks consumed by Taiwanese is important in designing conservation plans. However, fins make up less than 5% of the total body weight of a shark, and their bodies are sold as filets in the market, making it difficult or impossible to identify species using morphological traits. In the present study, we adopted a DNA barcoding technique using a 391-bp fragment of the mitochondrial cytochrome oxidase I (COI) gene to examine the diversity of shark filets and fins collected from markets and restaurants island-wide in Taiwan. Amongst the 548 tissue samples collected and sequenced, 20 major clusters were apparent by phylogenetic analyses, each of them containing individuals belonging to the same species (most with more than 95% bootstrap values), corresponding to 20 species of sharks. Additionally, Alopias pelagicus, Carcharhinus falciformis, Isurus oxyrinchus, and Prionace glauca consisted of 80% of the samples we collected, indicating that these species might be heavily consumed in Taiwan. Approximately 5% of the tissue samples used in this study were identified as species listed in CITES Appendix II, including two species of Sphyrna, C. longimanus and Carcharodon carcharias. DNA barcoding provides an alternative method for understanding shark species composition when species-specific data is unavailable. Considering the global population decline, stock assessments of Appendix II species and highly consumed species are needed to accomplish the ultimate goal of shark conservation.

A revision of the Australian species of Trimma (Actinopterygii, Gobiidae), with descriptions of six new species and redescriptions of twenty-three valid species.

Science.gov (United States)

Winterbottom, Richard; Hoese, Douglass F

2015-03-17

The gobiid genus Trimma currently contains 75 valid species, with another 20-30 known but undescribed species. There are 29 species in Australian waters (six undescribed). This paper describes the six new species, and provides redescriptions of most of the 23 previously described species known from the region, as well as a key for all the species. The six new species are: T. insularum (endemic to Cocos (Keeling) Islands), T. kitrinum (Fiji to Great Barrier Reef), T. meristum (Cape York to the Bismark Archipelago and Fiji), T. pentherum (Great Barrier Reef to Fiji and the South-West Islands of Palau), T. readerae (Australia to Japan), and T. xanthum (Palau to Fiji, Great Barrier Reef to Christmas Island). The following 23 species have been recorded from Australian waters, and most are redescribed here: T. anaima (Comores to Fiji), T. annosum (Maldives to the Phoenix Islands, Taiwan to the southern Great Barrier Reef), T. benjamini (southern Vietnam to the Marshall Islands, Samoa and southern Barrier Reef), T. caesiura (Ryukyus through the Marshall Islands to Samoa and Elizabeth Reef on the Lord Howe Rise), T. capostriatum (New Caledonia to eastern Australia and Papua New Guinea), T. maiandros (Java to the Ryukyus, Marshalls to Great Barrier Reef), T. emeryi (Comores to Ryukyus and Samoa), T. fangi (western South China Sea through to the Solomons), T. flavatrum (Ryukyu Islands to Western Australia and Samoa), T. hoesei (Chagos Archipelago, central Indian Ocean to Palau and Solomons), T. lantana (Australia, Solomons, northern New Guinea, South-West Islands of Palau), T. macrophthalmus (Ryukyu Islands to Cocos (Keeling) Islands and Samoa), T. milta (Taiwan to Western Australia, Society Islands and Hawaii), T. nasa (Sumbawa, Indonesia to Fiji), T. necopinum (northern tip of Cape York to Sydney), T. nomurai (Japan to northern Australia and New Caledonia), T. okinawae (western Thailand to Japan and the Phoenix Islands, north-west Australia to the Great Barrier Reef), T

Hallazgo de Panstrongylus rufotuberculatus (Champion, 1899 (Hemiptera, Reduviidae, Triatominae en ambiente domiciliario en la Región Piura, Perú Intra-domiciliary capture of Panstrongylus rufotuberculatus (Champion, 1899 (Hemiptera, Reduviidae, Triatominae in Piura, Peru

Directory of Open Access Journals (Sweden)

Edgard Marín

2007-09-01

Full Text Available Panstrongylus rufotuberculatus presenta una amplia distribución en América Central y del Sur con un comportamiento de especie silvestre. En el Perú ha sido registrado en Tumbes, Piura y Cuzco, siendo descrito en casas de localidades de este último departamento. En el presente trabajo se documenta evidencia de domiciliación de P. rufotuberculatus en la localidad de Chirinos-La Pareja, Distrito de Suyo, Provincia de Ayabaca, Región Piura, Perú (4º46'S, 79º93'W. Se capturaron 28 especímenes: 3 ninfas II, 4 ninfas III, 2 ninfas IV, 8 ninfas V, 3 machos y 8 hembras, lo que evidencia la existencia de una colonia intradomiciliar en "cuyeros" (criaderos de Cavia porcellus camas y paredes del dormitorio de la vivienda. Exámenes parasitológicos de heces evacuadas espontáneamente fueron negativos a infección natural por Trypanosoma cruzi. A pesar de que se ha reportado la presencia de P. rufotuberculatus en localidades de Tumbes y Piura, es la primera vez que se documenta su tendencia sinantrópica en la Región. La importancia de esta especie y posteriores investigaciones permitirán evaluar su etología y potencial vectorial de trypanosomiasis americana. Se recomienda una cuidadosa actividad de vigilancia entomo-epidemiológica para esta especie y las otras que coexisten simpátricamente, actualmente en esta región del norte de Perú.Panstrongylus rufotuberculatus is widely distributed in Central and South America. In Peru, it has been found in Tumbes, Piura, and Cuzco. The authors report the presence of P. rufotuberculatus in Chirinos-La Pareja, Suyo district, Ayabaca Province, Piura Region, Peru. Twenty-eight specimens were collected in two of 15 dwellings: three 2nd instar, four 3rd instar, two 4th instar, and eight 5th instar nymphs, three male and eight female, in an intra-domiciliary colony of guinea pigs (Cavia porcellus, raised indoors as a source of diet protein and beds and bedroom walls. None of the fecal samples were naturally

The Gilbertiodendron ogoouense species complex (Leguminosae

NARCIS (Netherlands)

Burgt, van der X.M.; Mackinder, B.A.; Wieringa, J.J.; Estrella, de la Manuel

2015-01-01

The Gilbertiodendron ogoouense species complex consists of 14 tree species. Eight species are here newly described and one is here reinstated: G. bambolense Burgt; G. breteleri Burgt; G. ebo Burgt & Mackinder; G. ecoukense (Pellegr.) Burgt; G. maximum Burgt & Wieringa; G. minkebense Burgt

Competition between species of small mammals

International Nuclear Information System (INIS)

Grant, P.R.

1978-01-01

Interspecific competition has often been inferred from its results. In evolutionary time it has been responsible for patterns of regularity in the structure of mammalian communities, and in the morphological and ecological characteristics of the constituent species. In contemporary time it gives rise to reciprocal (complementary) numbers and distributions of two or more species. These inferences are strengthened by recent experimental demonstrations of competition between species of North American rodents. Recent observations and experiments are reviewed. The most thoroughly studied competitors are two species of microtine rodents, Microtus pennsylvanicus and Clethrionomys gapperi. Species which compete for space have been studied experimentally more often than have food competitors. Overt aggression is frequently implicated, but its importance in nature in relation to other means of interaction (e.g. through vocal or scent communication) is not known. The definitive study of competition for food between mammal species has yet to be performed

Radiation protection of non-human species

International Nuclear Information System (INIS)

Leith, I.S.

1993-01-01

The effects of radiation on non-human species, both animals and plants, have long been investigated. In the disposal of radioactive wastes, the protection of non-human species has been investigated. Yet no radiation protection standard for exposure of animals and plants per se has been agreed. The International Commission on Radiological Protection has long taken the view that, if human beings are properly protected from radiation, other species will thereby be protected to the extent necessary for their preservation. However, the International Atomic Energy Agency has found it necessary to investigate the protection of non-human species where radioactivity is released to an environment unpopulated by human beings. It is proposed that the basis of such protection, and the knowledge of radiation effects on non-human species on which it is based, suggest a practical radiation protection standard for non-human species. (1 tab.)

Three new species of tiger beetles and new data on Cicindelina species from Angola (Coleoptera: Carabidae: Cicindelinae).

Science.gov (United States)

Serrano, Artur R M; Capela, Rúben A; Oesterle, Andreas

2015-10-15

Three new species of tiger beetles, two of the genus Trichotaenia Rivalier, 1957 and one of the genus Cylindera Westwood, 1831, subgenus Ifasina Jeannel, 1946 are described from Angola. An annotated list of species of Cicindelina sampled in this country is provided also. Records for three species previously unknow from Angola are given: Ophryodera smrzi Werner, 2005, Lophyra clatharta (Dejean, 1825) and Lophyra sumlini Cassola, 1976. Some considerations on the distribution and general ecology of these beetles in Angola are also presented. Further, two dichotomic keys are made available for the identification of Trichotaenia species with marked shoulders and Cylindera (Ifasina) species of western and southwestern Africa, respectively.

Theoretical microbial ecology without species

Science.gov (United States)

Tikhonov, Mikhail

2017-09-01

Ecosystems are commonly conceptualized as networks of interacting species. However, partitioning natural diversity of organisms into discrete units is notoriously problematic and mounting experimental evidence raises the intriguing question whether this perspective is appropriate for the microbial world. Here an alternative formalism is proposed that does not require postulating the existence of species as fundamental ecological variables and provides a naturally hierarchical description of community dynamics. This formalism allows approaching the species problem from the opposite direction. While the classical models treat a world of imperfectly clustered organism types as a perturbation around well-clustered species, the presented approach allows gradually adding structure to a fully disordered background. The relevance of this theoretical construct for describing highly diverse natural ecosystems is discussed.

Effect of species rarity on the accuracy of species distribution models for reptiles and amphibians in southern California

Science.gov (United States)

Franklin, J.; Wejnert, K.E.; Hathaway, S.A.; Rochester, C.J.; Fisher, R.N.

2009-01-01

Aim: Several studies have found that more accurate predictive models of species' occurrences can be developed for rarer species; however, one recent study found the relationship between range size and model performance to be an artefact of sample prevalence, that is, the proportion of presence versus absence observations in the data used to train the model. We examined the effect of model type, species rarity class, species' survey frequency, detectability and manipulated sample prevalence on the accuracy of distribution models developed for 30 reptile and amphibian species. Location: Coastal southern California, USA. Methods: Classification trees, generalized additive models and generalized linear models were developed using species presence and absence data from 420 locations. Model performance was measured using sensitivity, specificity and the area under the curve (AUC) of the receiver-operating characteristic (ROC) plot based on twofold cross-validation, or on bootstrapping. Predictors included climate, terrain, soil and vegetation variables. Species were assigned to rarity classes by experts. The data were sampled to generate subsets with varying ratios of presences and absences to test for the effect of sample prevalence. Join count statistics were used to characterize spatial dependence in the prediction errors. Results: Species in classes with higher rarity were more accurately predicted than common species, and this effect was independent of sample prevalence. Although positive spatial autocorrelation remained in the prediction errors, it was weaker than was observed in the species occurrence data. The differences in accuracy among model types were slight. Main conclusions: Using a variety of modelling methods, more accurate species distribution models were developed for rarer than for more common species. This was presumably because it is difficult to discriminate suitable from unsuitable habitat for habitat generalists, and not as an artefact of the

Discordance between morphological and molecular species boundaries among Caribbean species of the reef sponge Callyspongia

OpenAIRE

DeBiasse, Melissa B; Hellberg, Michael E

2015-01-01

Sponges are among the most species-rich and ecologically important taxa on coral reefs, yet documenting their diversity is difficult due to the simplicity and plasticity of their morphological characters. Genetic attempts to identify species are hampered by the slow rate of mitochondrial sequence evolution characteristic of sponges and some other basal metazoans. Here we determine species boundaries of the Caribbean coral reef sponge genus Callyspongia using a multilocus, model-based approach...

50 CFR 451.03 - Endangered Species Committee.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Endangered Species Committee. 451.03... ADMINISTRATION, DEPARTMENT OF COMMERCE); ENDANGERED SPECIES COMMITTEE REGULATIONS ENDANGERED SPECIES EXEMPTION PROCESS APPLICATION PROCEDURE § 451.03 Endangered Species Committee. (a) Scope. This section contains...

Species coexistence in a changing world.

Science.gov (United States)

Valladares, Fernando; Bastias, Cristina C; Godoy, Oscar; Granda, Elena; Escudero, Adrián

2015-01-01

The consequences of global change for the maintenance of species diversity will depend on the sum of each species responses to the environment and on the interactions among them. A wide ecological literature supports that these species-specific responses can arise from factors related to life strategies, evolutionary history and intraspecific variation, and also from environmental variation in space and time. In the light of recent advances from coexistence theory combined with mechanistic explanations of diversity maintenance, we discuss how global change drivers can influence species coexistence. We revise the importance of both competition and facilitation for understanding coexistence in different ecosystems, address the influence of phylogenetic relatedness, functional traits, phenotypic plasticity and intraspecific variability, and discuss lessons learnt from invasion ecology. While most previous studies have focused their efforts on disentangling the mechanisms that maintain the biological diversity in species-rich ecosystems such as tropical forests, grasslands and coral reefs, we argue that much can be learnt from pauci-specific communities where functional variability within each species, together with demographic and stochastic processes becomes key to understand species interactions and eventually community responses to global change.

Design and construction of "synthetic species".

Directory of Open Access Journals (Sweden)

Eduardo Moreno

Full Text Available Synthetic biology is an area of biological research that combines science and engineering. Here, I merge the principles of synthetic biology and regulatory evolution to create a new species with a minimal set of known elements. Using preexisting transgenes and recessive mutations of Drosophila melanogaster, a transgenic population arises with small eyes and a different venation pattern that fulfils the criteria of a new species according to Mayr's Biological Species Concept. The population described here is the first transgenic organism that cannot hybridize with the original wild type population but remains fertile when crossed with other identical transgenic animals. I therefore propose the term "synthetic species" to distinguish it from "natural species", not only because it has been created by genetic manipulation, but also because it may never be able to survive outside the laboratory environment. The use of genetic engineering to design artificial species barriers could help us understand natural speciation and may have practical applications. For instance, the transition from transgenic organisms towards synthetic species could constitute a safety mechanism to avoid the hybridization of genetically modified animals with wild type populations, preserving biodiversity.

New species of Cystolepiota from China

Directory of Open Access Journals (Sweden)

Meng-Lin Xu

2016-10-01

Full Text Available In this paper, a new species, Cystolepiota pseudofumosifolia, is introduced. C. pseudofumosifolia is characterized by granulose or powdery pileus with an anatomic structure that is loosely globose, as well as ellipsoid cells in chains in the pileus covering the cheilocystidia. This new species is compared to the related and similar Cystolepiota species in morphology and molecular phylogeny based on Internal transcribed spacer sequences. Both types of data support our specimens as a new species in the genus Cystolepiota.

Brachyspira Species and Gastroenteritis in Humans

NARCIS (Netherlands)

Westerman, L.J.; Boer, de R.F.; Roelfsema, J.H.; Friesema, I.H.M.; Kortbeek, L.M.; Wagenaar, J.A.; Bonten, M.J.M.; Kusters, J.G.

2013-01-01

Brachyspira species have been implicated as a potential cause of gastroenteritis in humans; this is, however, controversial. In 733 gastroenteritis cases and 464 controls, we found 29 samples positive for Brachyspira species (2.3% of cases and 2.6% of controls; P = 0.77). Brachyspira species were

Brachyspira Species and Gastroenteritis in Humans

NARCIS (Netherlands)

Westerman, L J; de Boer, R F; Roelfsema, J H; Friesema, I H M; Kortbeek, L M; Wagenaar, J A; Bonten, M J M; Kusters, J G

Brachyspira species have been implicated as a potential cause of gastroenteritis in humans; this is, however, controversial. In 733 gastroenteritis cases and 464 controls, we found 29 samples positive for Brachyspira species (2.3% of cases and 2.6% of controls; P = 0.77). Brachyspira species were

77 FR 15701 - Highly Migratory Species; 2006 Consolidated Highly Migratory Species Fishery Management Plan...

Science.gov (United States)

2012-03-16

... Species Fishery Management Plan; Amendment 4 AGENCY: National Marine Fisheries Service (NMFS), National.... SUMMARY: This fishery management plan (FMP) amendment addresses Atlantic highly migratory species (HMS... to create an HMS Caribbean Small Boat Commercial Permit (CSBP) allowing fishing for and sales of...

Endangered Species Act Critical Habitat

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Critical habitat (CH) is designated for the survival and recovery of species listed as threatened or endangered under the Endangered Species Act (ESA). Critical...

Aging and immortality in unicellular species.

Science.gov (United States)

Florea, Michael

2017-10-01

It has been historically thought that in conditions that permit growth, most unicellular species do not to age. This was particularly thought to be the case for symmetrically dividing species, as such species lack a clear distinction between the soma and the germline. Despite this, studies of the symmetrically dividing species Escherichia coli and Schizosaccharomyces pombe have recently started to challenge this notion. They indicate that E. coli and S. pombe do age, but only when subjected to environmental stress. If true, this suggests that aging may be widespread among microbial species in general, and that studying aging in microbes may inform other long-standing questions in aging. This review examines the recent evidence for and against replicative aging in symmetrically dividing unicellular organisms, the mechanisms that underlie aging, why aging evolved in these species, and how microbial aging fits into the context of other questions in aging. Copyright © 2017 Elsevier B.V. All rights reserved.

DNA barcoding of shark meats identify species composition and CITES-listed species from the markets in Taiwan.

Directory of Open Access Journals (Sweden)

Shang-Yin Vanson Liu

Full Text Available BACKGROUND: An increasing awareness of the vulnerability of sharks to exploitation by shark finning has contributed to a growing concern about an unsustainable shark fishery. Taiwan's fleet has the 4th largest shark catch in the world, accounting for almost 6% of the global figures. Revealing the diversity of sharks consumed by Taiwanese is important in designing conservation plans. However, fins make up less than 5% of the total body weight of a shark, and their bodies are sold as filets in the market, making it difficult or impossible to identify species using morphological traits. METHODS: In the present study, we adopted a DNA barcoding technique using a 391-bp fragment of the mitochondrial cytochrome oxidase I (COI gene to examine the diversity of shark filets and fins collected from markets and restaurants island-wide in Taiwan. RESULTS: Amongst the 548 tissue samples collected and sequenced, 20 major clusters were apparent by phylogenetic analyses, each of them containing individuals belonging to the same species (most with more than 95% bootstrap values, corresponding to 20 species of sharks. Additionally, Alopias pelagicus, Carcharhinus falciformis, Isurus oxyrinchus, and Prionace glauca consisted of 80% of the samples we collected, indicating that these species might be heavily consumed in Taiwan. Approximately 5% of the tissue samples used in this study were identified as species listed in CITES Appendix II, including two species of Sphyrna, C. longimanus and Carcharodon carcharias. CONCLUSION: DNA barcoding provides an alternative method for understanding shark species composition when species-specific data is unavailable. Considering the global population decline, stock assessments of Appendix II species and highly consumed species are needed to accomplish the ultimate goal of shark conservation.

22 CFR 216.5 - Endangered species.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Endangered species. 216.5 Section 216.5 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.5 Endangered species. It is A... endangered or threatened species and their critical habitats. The Initial Environmental Examination for each...

The Colletotrichum gloeosporioides species complex.

Science.gov (United States)

Weir, B S; Johnston, P R; Damm, U

2012-09-15

The limit of the Colletotrichum gloeosporioides species complex is defined genetically, based on a strongly supported clade within the Colletotrichum ITS gene tree. All taxa accepted within this clade are morphologically more or less typical of the broadly defined C. gloeosporioides, as it has been applied in the literature for the past 50 years. We accept 22 species plus one subspecies within the C. gloeosporioides complex. These include C. asianum, C. cordylinicola, C. fructicola, C. gloeosporioides, C. horii, C. kahawae subsp. kahawae, C. musae, C. nupharicola, C. psidii, C. siamense, C. theobromicola, C. tropicale, and C. xanthorrhoeae, along with the taxa described here as new, C. aenigma, C. aeschynomenes, C. alatae, C. alienum, C. aotearoa, C. clidemiae, C. kahawae subsp. ciggaro, C. salsolae, and C. ti, plus the nom. nov. C. queenslandicum (for C. gloeosporioides var. minus). All of the taxa are defined genetically on the basis of multi-gene phylogenies. Brief morphological descriptions are provided for species where no modern description is available. Many of the species are unable to be reliably distinguished using ITS, the official barcoding gene for fungi. Particularly problematic are a set of species genetically close to C. musae and another set of species genetically close to C. kahawae, referred to here as the Musae clade and the Kahawae clade, respectively. Each clade contains several species that are phylogenetically well supported in multi-gene analyses, but within the clades branch lengths are short because of the small number of phylogenetically informative characters, and in a few cases individual gene trees are incongruent. Some single genes or combinations of genes, such as glyceraldehyde-3-phosphate dehydrogenase and glutamine synthetase, can be used to reliably distinguish most taxa and will need to be developed as secondary barcodes for species level identification, which is important because many of these fungi are of biosecurity

Microbial species delineation using whole genome sequences.

Science.gov (United States)

Varghese, Neha J; Mukherjee, Supratim; Ivanova, Natalia; Konstantinidis, Konstantinos T; Mavrommatis, Kostas; Kyrpides, Nikos C; Pati, Amrita

2015-08-18

Increased sequencing of microbial genomes has revealed that prevailing prokaryotic species assignments can be inconsistent with whole genome information for a significant number of species. The long-standing need for a systematic and scalable species assignment technique can be met by the genome-wide Average Nucleotide Identity (gANI) metric, which is widely acknowledged as a robust measure of genomic relatedness. In this work, we demonstrate that the combination of gANI and the alignment fraction (AF) between two genomes accurately reflects their genomic relatedness. We introduce an efficient implementation of AF,gANI and discuss its successful application to 86.5M genome pairs between 13,151 prokaryotic genomes assigned to 3032 species. Subsequently, by comparing the genome clusters obtained from complete linkage clustering of these pairs to existing taxonomy, we observed that nearly 18% of all prokaryotic species suffer from anomalies in species definition. Our results can be used to explore central questions such as whether microorganisms form a continuum of genetic diversity or distinct species represented by distinct genetic signatures. We propose that this precise and objective AF,gANI-based species definition: the MiSI (Microbial Species Identifier) method, be used to address previous inconsistencies in species classification and as the primary guide for new taxonomic species assignment, supplemented by the traditional polyphasic approach, as required. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

Two new Paraparatrechina (Hymenoptera, Formicidae species from the Seychelles, with notes on the hypogaeic weissi species-group

Directory of Open Access Journals (Sweden)

John LaPolla

2014-06-01

Full Text Available Recent survey work in the Seychelles has revealed two new species of Paraparatrechina that are here described: P. illusio sp. n. and P. luminella sp. n. A revised key to the workers of Paraparatrechina for the Afrotropical and Malagasy regions is provided. The taxonomy of the hypogaeic weissi species-group is also reviewed in light of recent field collections. The species P. sordida is revived from synonymy and given new status (as a full species and a discussion of the morphologically peculiar species-group is provided. With the description of the two species and the removal of another species from weissi synonomy there are now 16 Paraparatrechina species known from the Afrotropical and Malagasy regions.

77 FR 19164 - Atlantic Highly Migratory Species; 2006 Consolidated Highly Migratory Species Fishery Management...

Science.gov (United States)

2012-03-30

... RIN 0648-XB121 Atlantic Highly Migratory Species; 2006 Consolidated Highly Migratory Species Fishery..., United States Virgin Islands (USVI) St. Thomas, USVI, San Juan, Puerto Rico (PR), Ponce, PR, and Mayaguez... INFORMATION CONTACT: Greg Fairclough or Randy Blankinship at 727-824-5399. SUPPLEMENTARY INFORMATION: Atlantic...

Species status and conservation issues of New Zealand's endemic Latrodectus spider species (Araneae: Theridiidae)

DEFF Research Database (Denmark)

Vink, Cor J; Sirvid, Phillip J; Malumbres-Olarte, Jagoba

2008-01-01

New Zealand has two endemic widow spiders, Latrodectus katipo Powell, 1871 and L. atritus Urquhart, 1890. Both species face many conservation threats and are actively managed. The species status of the Latrodectus spiders of New Zealand was assessed using molecular (COI, ITS1, ITS2...

The species velocity of trees in Alaska

Science.gov (United States)

Morrison, B. D.; Napier, J.; de Lafontaine, G.; Heath, K.; Li, B.; Hu, F.; Greenberg, J. A.

2017-12-01

Anthropogenic climate change has motivated interest in the paleo record to enhance our knowledge about past vegetation responses to climate change and help understand potential responses in the future. Additionally, polar regions currently experience the most rapid rates of climate change globally, prompting concern over changes in the ecological composition of high latitude ecosystems. Recent analyses have attempted to construct methods to estimate a species' ability to track climate change by computing climate velocity; a measure of the rate of climate displacement across a landscape which may indicate the speed an organism must migrate to keep pace with climate change. However, a challenge to using climate velocity in understanding range shifts is a lack of species-specificity in the velocity calculations: climate velocity does not actually use any species data in its analysis. To solve the shortcomings of climate velocity in estimating species displacement rates, we computed the "species velocity" of white spruce, green and grey alder populations across the state of Alaska from the Last Glacial Maximum (LGM) to today. Species velocity represents the rate and direction a species is required to migrate to keep pace with a changing climate following the LGM. We used a species distribution model to determine past and present white spruce and alder distributions using statistically downscaled climate data at 60m. Species velocity was then derived from the change in species distribution per year by the change in distribution over Alaska (km/yr). High velocities indicate locations where the species environmental envelope is changing drastically and must disperse rapidly to survive climate change. As a result, high velocity regions are more vulnerable to distribution shifts and higher risk of local extinction. Conversely, low species velocities indicate locations where the local climate envelope is shifting relatively slowly, reducing the stress to disperse quickly

Phytoprotective effect of arbuscular mycorrhizal fungi species against arsenic toxicity in tropical leguminous species.

Science.gov (United States)

de Melo, Rangel Wesley; Schneider, Jerusa; de Souza, Costa Enio Tarso; Sousa, Soares Cláudio Roberto Fonsêca; Guimarães, Guilherme Luiz Roberto; de Souza, Moreira Fatima Maria

2014-01-01

Arbuscular mycorrhizal fungi (AMF) improve the tolerance of hosting plants to arsenic (As) in contaminated soils. This work assessed the phytoprotective effect of Glomus etunicatum, Acaulospora morrowiae, Gigaspora gigantea, and Acaulospora sp. on four leguminous species (Acacia mangium, Crotalaria juncea, Enterolobium contortisiliquum, and Stizolobium aterrimum) in an As-contaminated soil from a gold mining area. AMF root colonization, biomass production, As and P accumulation, as well as arsenic translocation index (TI) from roots to shoots were measured. The AMF phytoprotective effect was assessed by the P/As ratio and the activity of plant antioxidant enzymes. The AMF colonization ranged from 24 to 28%. In general, all leguminous species had low As TI when inoculated with AMF species. Inoculation of C. juncea with Acaulospora sp. improved significantly As accumulation in roots, and decreased the activity of ascorbate peroxidase (APX) and superoxide dismutase (SOD), highlighting its phytoprotective effect and the potential use of this symbiosis for phytoremediation of As-contaminated soils. However, S. aterrimum has also shown a potential for phytoremediation irrespectively of AMF inoculation. APX was a good indicator of the phytoprotective effect against As contamination in C. juncea and A. mangium. In general P/As ratio in shoots was the best indicator of the phytoprotective effect of all AMF species in all plant species.

SALMONELLA SPECIES

African Journals Online (AJOL)

DR. AMINU

... of Salmonella species serotypes in relation to age and sex among children, ..... However, most antimicrobials show sufficient selective toxicity to be of value in ... salmonellosis should be given good attention (Barrow et al., 2007). To reduce ...

50 CFR 15.32 - Criteria for including species in the approved list for non-captive-bred species.

Science.gov (United States)

2010-10-01

... Management and Scientific Authorities transmitting the management plan of this species; (iii) A summary of... where the species forages (aerial feeder, tree canopy, tree trunk, midstory, understory, open water or..., disease carrier; a description of the damage the pest species causes to its ecosystem; and a description...

3 CFR - The Endangered Species Act

Science.gov (United States)

2010-01-01

... 3 The President 1 2010-01-01 2010-01-01 false The Endangered Species Act Presidential Documents Other Presidential Documents Memorandum of March 3, 2009 The Endangered Species Act Memorandum for the Heads of Executive Departments and Agencies The Endangered Species Act (ESA), 16 U.S.C. 1531 et seq...

Aquatic dance flies (Diptera, Empididae, Clinocerinae and Hemerodromiinae of Greece: species richness, distribution and description of five new species

Directory of Open Access Journals (Sweden)

Marija Ivković

2017-12-01

Full Text Available All records of aquatic dance flies (37 species in subfamily Clinocerinae and 10 species in subfamily Hemerodromiinae from the territory of Greece are summarized, including previously unpublished data and data on five newly described species (Chelifera horvati Ivković & Sinclair, sp. n., Wiedemannia iphigeniae Ivković & Sinclair, sp. n., W. ljerkae Ivković & Sinclair, sp. n., W. nebulosa Ivković & Sinclair, sp. n. and W. pseudoberthelemyi Ivković & Sinclair, sp. n.. The new species are described and illustrated, the male terminalia of Clinocera megalatlantica (Vaillant are illustrated and the distributions of all species within Greece are listed. The aquatic Empididae fauna of Greece consists of 47 species, with the following described species reported for the first time: Chelifera angusta Collin, Hemerodromia melangyna Collin, Clinocera megalatlantica, Kowarzia plectrum (Mik, Phaeobalia dimidiata (Loew, W. (Chamaedipsia beckeri (Mik, W. (Philolutra angelieri Vaillant and W. (P. chvali Joost. A key to species of aquatic Empididae of Greece is provided for the first time. Information related to the European Ecoregions in which species were found is given. Compared to the other studied countries in the Balkans, the Greek species assemblage is most similar to that of the Former Yugoslav Republic of Macedonia.

Clonal growth and plant species abundance.

Science.gov (United States)

Herben, Tomáš; Nováková, Zuzana; Klimešová, Jitka

2014-08-01

Both regional and local plant abundances are driven by species' dispersal capacities and their abilities to exploit new habitats and persist there. These processes are affected by clonal growth, which is difficult to evaluate and compare across large numbers of species. This study assessed the influence of clonal reproduction on local and regional abundances of a large set of species and compared the predictive power of morphologically defined traits of clonal growth with data on actual clonal growth from a botanical garden. The role of clonal growth was compared with the effects of seed reproduction, habitat requirements and growth, proxied both by LHS (leaf-height-seed) traits and by actual performance in the botanical garden. Morphological parameters of clonal growth, actual clonal reproduction in the garden and LHS traits (leaf-specific area - height - seed mass) were used as predictors of species abundance, both regional (number of species records in the Czech Republic) and local (mean species cover in vegetation records) for 836 perennial herbaceous species. Species differences in habitat requirements were accounted for by classifying the dataset by habitat type and also by using Ellenberg indicator values as covariates. After habitat differences were accounted for, clonal growth parameters explained an important part of variation in species abundance, both at regional and at local levels. At both levels, both greater vegetative growth in cultivation and greater lateral expansion trait values were correlated with higher abundance. Seed reproduction had weaker effects, being positive at the regional level and negative at the local level. Morphologically defined traits are predictive of species abundance, and it is concluded that simultaneous investigation of several such traits can help develop hypotheses on specific processes (e.g. avoidance of self-competition, support of offspring) potentially underlying clonal growth effects on abundance. Garden

Conservation Status of Marine Biodiversity in Oceania: An Analysis of Marine Species on the IUCN Red List of Threatened Species

Directory of Open Access Journals (Sweden)

Beth A. Polidoro

2011-01-01

Full Text Available Given the economic and cultural dependence on the marine environment in Oceania and a rapidly expanding human population, many marine species populations are in decline and may be vulnerable to extinction from a number of local and regional threats. IUCN Red List assessments, a widely used system for quantifying threats to species and assessing species extinction risk, have been completed for 1190 marine species in Oceania to date, including all known species of corals, mangroves, seagrasses, sea snakes, marine mammals, sea birds, sea turtles, sharks, and rays present in Oceania, plus all species in five important perciform fish groups. Many of the species in these groups are threatened by the modification or destruction of coastal habitats, overfishing from direct or indirect exploitation, pollution, and other ecological or environmental changes associated with climate change. Spatial analyses of threatened species highlight priority areas for both site- and species-specific conservation action. Although increased knowledge and use of newly available IUCN Red List assessments for marine species can greatly improve conservation priorities for marine species in Oceania, many important fish groups are still in urgent need of assessment.

Performances de production des cobayes ( Cavia porcellus L.) en ...

African Journals Online (AJOL)

Au Cameroun, l'élevage des cobayes se pratique encore dans les cuisines et à même le sol et leur alimentation est essentiellement à base des déchets de cuisine. Le souci d'intensifier la production nécessite la détermination des besoins réels du cobaye afin d'asseoir de façon rationnelle sa table de rationnement.

Observaciones sobre la Bartonelosis en el Cuy: Cavia Porcellus

Directory of Open Access Journals (Sweden)

N. Van Der Walle

1943-03-01

Full Text Available 1. La Haemobartonella tyzzeri ha sido observada microscópicamente en 3 cuyes machos de 10 cuyes esplenectomizados procedentes de la zona verrucógena del Rímac.,, (5 machos, 5 hembras, mientras que 3 machos y 1 hembra de Lima resultaron negativos. 2. Una vez se ha cultivado la H. tyzzeri en el medio semi-sólido de NOGUCHI a 28ºC. 3. Sangre de un cuy naturalmente infectado fué inyectado intraperitonealmente a un cuy esplenectomizado de Lima; a las 2 semanas las bartonellas eran visibles en la sangre. De esta manera fueron inoculados 6 cuyes en pasajes sucesivos, siempre con resultados positivos. El porcentaje de glóbulos infectados (± 0.05 % en el cuy original, subió durante estos pasajes, hasta un máximo de 6.25%. El período de incubación bajó en los dos últimos pasajes hasta 1 semana. Tres de los 6 animales mostraron una ligera anemia (con 3.48, 3.74, y 3,19 millones de hematíes por mm.3, respectivamente y otro (el del segundo pasaje una anemia fuerte (1.25 millón, con macrocitos, normoblastos y un alto porcentaje de reticulocitos. Está comprobado pues, que la virulencia de la H. tyzzeri puede ser aumentada. 4. Se ha estudiado el cuadro hemático con los resultados siguientes. El diámetro medio del glóbulo parasitado resulta por lo. general un poco más pequeño que el del no infectado, diferencia que por lo menos en un caso no se podría atribuir al azar. En tres cuyes se observó un aumento de los hematíes, precediendo al descenso de éstos. En algunos de los cuyes parasitados se notó una disminución del número de los leucocitos, seguido por una leucocitosis, la cual era unas veces acompañada, de un aumento del porcentaje de los granulocitos neutrófilos. Eosinofílía durante o después de la infección fué observada en tres cuyes, monocitosis en dos. Algunas veces se pudo poner de manifiesto una hipersegmentación del núcleo de los granulocitos. 5. Se realizó un estudio anátomo-patológico del hígado de algunos cuyes parasitados y del bazo de un cuy naturalmente infectado; también dé un pedazo del bazo, dejado con una esplenectomía incompleta en otro cuy experimentalmente infectado.

Novel Bartonella Species in Insectivorous Bats, Northern China.

Directory of Open Access Journals (Sweden)

Hui-Ju Han

Full Text Available Bartonella species are emerging human pathogens. Bats are known to carry diverse Bartonella species, some of which are capable of infecting humans. However, as the second largest mammalian group by a number of species, the role of bats as the reservoirs of Bartonella species is not fully explored, in term of their species diversity and worldwide distribution. China, especially Northern China, harbors a number of endemic insectivorous bat species; however, to our knowledge, there are not yet studies about Bartonella in bats in China. The aim of the study was to investigate the prevalence and genetic diversity of Bartonella species in bats in Northern China. Bartonella species were detected by PCR amplification of gltA gene in 25.2% (27/107 bats in Mengyin County, Shandong Province of China, including 1/3 Rhinolophus ferrumequinum, 2/10 Rhinolophus pusillus, 9/16 Myotis fimbriatus, 1/5 Myotis ricketti, 14/58 Myotis pequinius. Phylogenetic analysis showed that Bartonella species detected in bats in this study clustered into ten groups, and some might be novel Bartonella species. An association between Bartonella species and bat species was demonstrated and co-infection with different Bartonella species in a single bat was also observed. Our findings expanded our knowledge on the genetic diversity of Bartonella in bats, and shed light on the ecology of bat-borne Bartonella species.

32 CFR 643.32 - Policy-Endangered species.

Science.gov (United States)

2010-07-01

... ESTATE Policy § 643.32 Policy—Endangered species. The Endangered Species Act of 1973 (16 U.S.C. 1531 et seq.), declares the intention of Congress to conserve threatened and endangered species of fish... 32 National Defense 4 2010-07-01 2010-07-01 true Policy-Endangered species. 643.32 Section 643.32...

Malassezia Species and Pityriasis Versicolor

Directory of Open Access Journals (Sweden)

Gulin Rodoplu

2016-01-01

Full Text Available Malassezia species are found in part of the normal human cutaneous commensal flora, however it has been known for many years that the Malassezia yeasts are associated with a number of different human diseases ranging from pityriasis versicolor to seborrhoeic dermatitis. In addition, since the 1980s, they have been reported as causing opportunistic systemic infections. The taxonomy of Malassezia spp. has recently been modified to include 13 obligatorily lipophilic species, plus one non-obligatorily lipophilic species, which only rarely colonizes human hosts and currently the genus consist 14 species as M. furfur, M. pachydermatis, M. sympodialis, M. globosa, M. obtusa, M. slooffiae, M. restricta, M. dermatis, M. japonica, M. nana, M. yamatoensis, M. caprae, M. equina, M. cuniculi. Fastidious growth requirements of Malassezia yeasts defied the initial attempts to culture these organisms and their true identification and the relationship between different species only became apparent with the application of modern molecular techniques. The causative fungus is seen especially in such seborrheic areas as the scalp, face, trunk and upper back. Under the influence of various exogenous or endogenous predisposing factors, these yeasts change from the blastospore form to the mycelial form and become pathogenic. Diagnosis of pityriasis versicolor which is caused by Malassezia species is generally easy and lies on the basis of its clinical appearance and can be confirmed by mycological examination. The diagnosisis is mainly based on direct examination with potassium hydroxide (KOH and demonstration that represents pseudohyphae and blastoconidia as the typical %u201Cspaghetti and meatballs%u201D pattern. Characteristic features of the genus Malassezia include a distinctive morphology and an affinity for lipids in culture. Culture is necessary to recover the infecting strain, especially for epidemiologic purposes and also to test its antifungal susceptibility

77 FR 22749 - Petition To List 83 Species of Coral as Threatened or Endangered Under the Endangered Species Act...

Science.gov (United States)

2012-04-17

... threatened or endangered under the Endangered Species Act (ESA) and to notify the public about future public... Candidate Coral Species Petitioned Under the U.S. Endangered Species Act (Status Review Report) and the draft Management Report for 82 Corals Status Review under the Endangered Species Act: Assessment of...

New species in Aspergillus section Terrei

DEFF Research Database (Denmark)

Samson, R. A.; Peterson, S. W.; Frisvad, Jens Christian

2011-01-01

. clade including the type isolate of A. niveus (CBS 115.27) constitutes a lineage closely related to A. carneus. Fennellia nivea, the hypothesized teleomorph is not related to this clade. Aspergillus allahabadii, A. niveus var. indicus, and two species originally placed in section Versicolores, A......Section Terrei of Aspergillus was studied using a polyphasic approach including sequence analysis of parts of the beta-tubulin and calmodulin genes and the ITS region, macro- and micromorphological analyses and examination of extrolite profiles to describe three new species in this section. Based....... floccosus, A. terreus var. africanus, A. terreus var. aureus, while Aspergillus hortai is recognised at species level. Aspergillus terreus NRRL 4017 is described as the new species A. pseudoterreus. Also included in section Terrei are some species formerly placed in sections Flavipedes and Versicolores. A...

New species of Malaysian ferns

NARCIS (Netherlands)

Holttum, R.E.

1962-01-01

The present paper includes descriptions of several new species of ferns found among recent collections from various parts of Malaysia; also two new combinations of names of species which are of interest on account of their taxonomic history.

Phylogenetic Molecular Species Delimitations Unravel Potential New Species in the Pest Genus Spodoptera Guenée, 1852 (Lepidoptera, Noctuidae)

Science.gov (United States)

Dumas, Pascaline; Barbut, Jérôme; Le Ru, Bruno; Silvain, Jean-François; Clamens, Anne-Laure; d’Alençon, Emmanuelle; Kergoat, Gael J.

2015-01-01

Nowadays molecular species delimitation methods promote the identification of species boundaries within complex taxonomic groups by adopting innovative species concepts and theories (e.g. branching patterns, coalescence). As some of them can efficiently deal with large single-locus datasets, they could speed up the process of species discovery compared to more time consuming molecular methods, and benefit from the existence of large public datasets; these methods can also particularly favour scientific research and actions dealing with threatened or economically important taxa. In this study we aim to investigate and clarify the status of economically important moths species belonging to the genus Spodoptera (Lepidoptera, Noctuidae), a complex group in which previous phylogenetic analyses and integrative approaches already suggested the possible occurrence of cryptic species and taxonomic ambiguities. In this work, the effectiveness of innovative (and faster) species delimitation approaches to infer putative species boundaries has been successfully tested in Spodoptera, by processing the most comprehensive dataset (in terms of number of species and specimens) ever achieved; results are congruent and reliable, irrespective of the set of parameters and phylogenetic models applied. Our analyses confirm the existence of three potential new species clusters (for S. exigua (Hübner, 1808), S. frugiperda (J.E. Smith, 1797) and S. mauritia (Boisduval, 1833)) and support the synonymy of S. marima (Schaus, 1904) with S. ornithogalli (Guenée, 1852). They also highlight the ambiguity of the status of S. cosmiodes (Walker, 1858) and S. descoinsi Lalanne-Cassou & Silvain, 1994. This case study highlights the interest of molecular species delimitation methods as valuable tools for species discovery and to emphasize taxonomic ambiguities. PMID:25853412

Phylogenetic molecular species delimitations unravel potential new species in the pest genus Spodoptera Guenée, 1852 (Lepidoptera, Noctuidae.

Directory of Open Access Journals (Sweden)

Pascaline Dumas

Full Text Available Nowadays molecular species delimitation methods promote the identification of species boundaries within complex taxonomic groups by adopting innovative species concepts and theories (e.g. branching patterns, coalescence. As some of them can efficiently deal with large single-locus datasets, they could speed up the process of species discovery compared to more time consuming molecular methods, and benefit from the existence of large public datasets; these methods can also particularly favour scientific research and actions dealing with threatened or economically important taxa. In this study we aim to investigate and clarify the status of economically important moths species belonging to the genus Spodoptera (Lepidoptera, Noctuidae, a complex group in which previous phylogenetic analyses and integrative approaches already suggested the possible occurrence of cryptic species and taxonomic ambiguities. In this work, the effectiveness of innovative (and faster species delimitation approaches to infer putative species boundaries has been successfully tested in Spodoptera, by processing the most comprehensive dataset (in terms of number of species and specimens ever achieved; results are congruent and reliable, irrespective of the set of parameters and phylogenetic models applied. Our analyses confirm the existence of three potential new species clusters (for S. exigua (Hübner, 1808, S. frugiperda (J.E. Smith, 1797 and S. mauritia (Boisduval, 1833 and support the synonymy of S. marima (Schaus, 1904 with S. ornithogalli (Guenée, 1852. They also highlight the ambiguity of the status of S. cosmiodes (Walker, 1858 and S. descoinsi Lalanne-Cassou & Silvain, 1994. This case study highlights the interest of molecular species delimitation methods as valuable tools for species discovery and to emphasize taxonomic ambiguities.

The Candida Pathogenic Species Complex

Science.gov (United States)

Turner, Siobhán A.; Butler, Geraldine

2014-01-01

Candida species are the most common causes of fungal infection. Approximately 90% of infections are caused by five species: Candida albicans, Candida glabrata, Candida tropicalis, Candida parapsilosis, and Candida krusei. Three (C. albicans, C. tropicalis, and C. parapsilosis) belong to the CTG clade, in which the CTG codon is translated as serine and not leucine. C. albicans remains the most commonly isolated but is decreasing relative to the other species. The increasing incidence of C. glabrata is related to its reduced susceptibility to azole drugs. Genome analysis suggests that virulence in the CTG clade is associated with expansion of gene families, particularly of cell wall genes. Similar independent processes took place in the C. glabrata species group. Gene loss and expansion in an ancestor of C. glabrata may have resulted in preadaptations that enabled pathogenicity. PMID:25183855

Review: Allee effects in social species.

Science.gov (United States)

Angulo, Elena; Luque, Gloria M; Gregory, Stephen D; Wenzel, John W; Bessa-Gomes, Carmen; Berec, Ludek; Courchamp, Franck

2018-01-01

Allee effects have important implications for many aspects of basic and applied ecology. The benefits of aggregation of conspecific individuals are central to Allee effects, which have led to the widely held assumption that social species are more prone to Allee effects. Robust evidence for this assumption, however, remains rare. Furthermore, previous research on Allee effects has failed to adequately address the consequences of the different levels of organisation within social species' populations. Here, we review available evidence of Allee effects and model the role of demographic and behavioural factors that may combine to dampen or strengthen Allee effects in social species. We use examples across various species with contrasting social structure, including carnivores, bats, primates and eusocial insects. Building on this, we provide a conceptual framework that allows for the integration of different Allee effects in social species. Social species are characterised by nested levels of organisation. The benefits of cooperation, measured by mean individual fitness, can be observed at both the population and group levels, giving rise to "population level" and "group level" Allee effects respectively. We also speculate on the possibility of a third level, reporting per capita benefits for different individuals within a group (e.g. castes in social insects). We show that group size heterogeneity and intergroup interactions affect the strength of population-level demographic Allee effects. Populations with higher group size heterogeneity and in which individual social groups cooperate demonstrate the weakest Allee effects and may thus provide an explanation for why extinctions due to Allee effects are rare in social species. More adequately accounting for Allee effects in social species will improve our understanding of the ecological and evolutionary implications of cooperation in social species. © 2017 The Authors. Journal of Animal Ecology © 2017 British

How much variation can one ant species hold? Species delimitation in the Crematogaster kelleri-group in Madagascar.

Directory of Open Access Journals (Sweden)

Bonnie B Blaimer

Full Text Available We investigated the species-level taxonomy of the Malagasy Crematogaster (Crematogaster kelleri-group and an additional more distantly related species of the same subgenus. Morphological data from worker, queen and male ants, as well as genetic data from three nuclear genes (long wavelength rhodopsin, arginine kinase and carbomoylphosphate synthase and one mitochondrial marker (cytochrome oxidase I led to the recognition of six species. Within the C. kelleri-group, three new species are described: C. hazolava Blaimer sp. n., C. hafahafa Blaimer sp. n. and C. tavaratra Blaimer sp. n. The previously described taxa C. kelleri Forel and C. madagascariensis André are validated by our analysis. Conversely, our data suggests synonymy of C. adrepens Forel (with C. kelleri and C. gibba Emery (with C. madagascariensis. A more distantly related and phylogenetically isolated species, C. tsisitsilo Blaimer sp. n., is further described. We report high levels of morphological and molecular variation in C. kelleri and illustrate that this variation can be explained partly by geography. Species descriptions, images, distribution maps and identification keys based on worker ants, as well as on queen and male ants where available, are presented for all six species. Our work highlights the elevated species richness of Crematogaster ants throughout Madagascar's humid forests, especially in the far northern tip of the island, and the need to use multiple data sources to ensure clear demarcation of this diversity.

Species rarity: definition, causes, and classification

Science.gov (United States)

Curtis H. Flather; Carolyn Hull Sieg

2007-01-01

In virtually all ecological communities around the world, most species are represented by few individuals, and most individuals come from only a few of the most common species. Why this distribution of species abundances is so regularly observed among different taxonomic sets in geographically diverse systems is a question that has received considerable theoretical and...

77 FR 59842 - Atlantic Highly Migratory Species; 2006 Consolidated Highly Migratory Species Fishery Management...

Science.gov (United States)

2012-10-01

... vessels permitted in the Atlantic tunas General category in Puerto Rico and 10 in the U.S. Virgin Islands... [Docket No. 080603729-2454-02] RIN 0648-AW83 Atlantic Highly Migratory Species; 2006 Consolidated Highly... management plan (FMP) amendment addresses Atlantic highly migratory species (HMS) fishery management measures...

Phytochemistry and Pharmacology of Berberis Species

Science.gov (United States)

Mokhber-Dezfuli, Najmeh; Saeidnia, Soodabeh; Gohari, Ahmad Reza; Kurepaz-Mahmoodabadi, Mahdieh

2014-01-01

The genus Berberis (Berberidaceae) includes about 500 species worldwide, some of which are widely cultivated in the north-eastern regions of Iran. This genus consists of spiny deciduous evergreen shrubs, characterized by yellow wood and flowers. The cultivation of seedless barberry in South Khorasan goes back to two hundred years ago. Medicinal properties for all parts of these plants have been reported, including: Antimicrobial, antiemetic, antipyretic, antioxidant, anti-inflammatory, anti-arrhythmic, sedative, anti-cholinergic, cholagogic, anti-leishmaniasis, and anti-malaria. The main compounds found in various species of Berberis, are berberine and berbamine. Phytochemical analysis of various species of this genus revealed the presence of alkaloids, tannins, phenolic compounds, sterols and triterpenes. Although there are some review articles on Berberis vulgaris (as the most applied species), there is no review on the phytochemical and pharmacological activities of other well-known species of the genus Berberis. For this reason, the present review mainly focused on the diverse secondary metabolites of various species of this genus and the considerable pharmacological and biological activities together with a concise story of the botany and cultivation. PMID:24600191

The temporal variability of species densities

International Nuclear Information System (INIS)

Redfearn, A.; Pimm, S.L.

1993-01-01

Ecologists use the term 'stability' to mean to number of different things (Pimm 1984a). One use is to equate stability with low variability in population density over time (henceforth, temporal variability). Temporal variability varies greatly from species to species, so what effects it? There are at least three sets of factors: the variability of extrinsic abiotic factors, food web structure, and the intrinsic features of the species themselves. We can measure temporal variability using at least three statistics: the coefficient of variation of density (CV); the standard deviation of the logarithms of density (SDL); and the variance in the differences between logarithms of density for pairs of consecutive years (called annual variability, hence AV, b y Wolda 1978). There are advantages and disadvantages to each measure (Williamson 1984), though in our experience, the measures are strongly correlated across sets of taxonomically related species. The increasing availability of long-term data sets allows one to calculate these statistics for many species and so to begin to understand the various causes of species differences in temporal variability

Proactive Conservation Program: Species of Concern :: NOAA Fisheries

Science.gov (United States)

Invertebrates & Plants Species of Concern Threatened & Endangered Health & Stranding Marine Mammals : Species of Concern Species of Concern List | Grants and Technical Resources/Links bluefin tuna Bluefin Tuna (Thunnus thynnus) Photo: NOAA Species of Concern are those species about which we have some

New species of Bidessonotus Régimbart, 1895 with a review of the South American species (Coleoptera, Adephaga, Dytiscidae, Hydroporinae, Bidessini

Directory of Open Access Journals (Sweden)

Kelly Miller

2016-10-01

Full Text Available The South American species of the New World genus Bidessonotus Régimbart, 1895 are reviewed with descriptions of seven new species. This brings the total number of valid Bidessonotus species to 37, making it the largest Bidessini genus in the New World. The new species are B. annae sp. n. (Venezuela, B. josiahi sp. n. (Venezuela, B. palecephalus sp. n. (Venezuela, B. reductus sp. n. (Venezuela, B. septimus sp. n. (Venezuela, B. spinosus sp. n. (Venezuela, and B. valdezi sp. n. (Guyana, Suriname. New distribution records are provided for many other South American Bidessonotus species. The main diagnostic features of Bidessonotus species are in the male genitalia, and these are illustrated for all South American species. Diagnostic features, distributions (including distribution maps, and additional comments are provided for all South American species.

Balance of bacterial species in the gut

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. Balance of bacterial species in the gut. Protective. Lactobacillus species. Bifidobacterium species. Selected E. coli. Saccharomyces boulardii. Clostridium butyricum.

Invasive Species Science Update (No. 7)

Science.gov (United States)

Dean Pearson; Yvette Ortega; Jack Butler

2014-01-01

Invasive Species Science Updates are designed to keep managers and other users up-to-date with recently completed and ongoing research by RMRS scientists, as well as highlight breaking news related to invasive species issues. The newsletter is produced by the RMRS Invasive Species Working Group (ISWG), which is a core group of scientists who volunteer to coordinate...

Relation of chironomids with Aeromonas species

Directory of Open Access Journals (Sweden)

Sivan eLaviad

2016-05-01

Full Text Available Chironomids (Diptera: Chironomidae, also known as non-biting midges, are one of the most abundant groups of insects in aquatic habitats. They undergo a complete metamorphosis of four life stages of which three are aquatic (egg, larva, pupa, and the adult emerges into the air. Chironomids serve as a natural reservoir of Aeromonas and Vibrio cholerae species. Here we review existing knowledge about the mutual relations between Aeromonas species and chironomids. Using 454-pyrosequencing of the 16S rRNA gene, we found that the prevalence of Aeromonas species in the insects’ egg masses and larvae was 1.6% and 3.3% of the insects’ endogenous microbiota, respectively. Aeromonas abundance per egg mass remained stable during a six-month period of bacterial monitoring. Different Aeromonas species were isolated and some demonstrated the ability to degrade the insect’s egg masses and to prevent eggs hatching. Chitinase was identified as the enzyme responsible for the egg mass degradation. Different Aeromonas species isolated from chironomids demonstrated the potential to protect their host from toxic metals. Aeromonas is a causative agent of fish infections. Fish are frequently recorded as feeding on chironomids. Thus, fish might be infected with Aeromonas species via chironomid consumption. Aeromonas strains are also responsible for causing gastroenteritis and wound infections in humans. Different virulence genes were identified in Aeromonas species isolated from chironomids. Chironomids may infest drinking water reservoirs, hence be the source of pathogenic Aeromonas strains in drinking water. Chironomids and Aeromonas species have a complicated mutual relationship.

Isoprene emission from tropical tree species

International Nuclear Information System (INIS)

Padhy, P.K.; Varshney, C.K.

2005-01-01

Foliar emission of isoprene was measured in nine commonly growing tree species of Delhi, India. Dynamic flow enclosure technique was used and gas samples were collected onto Tenax-GC/Carboseive cartridges, which were then attached to the sample injection system in the gas chromatograph (GC). Eluting compounds were analysed using a flame ionisation detector (FID). Out of the nine tree species, isoprene emission was found in six species (Eucalyptus sp., Ficus benghalensis, Ficus religiosa, Mangifera indica, Melia azedarach, and Syzygium jambolanum), whereas, in the remaining three tree species (Alstonia scholaris, Azadirachta indica, and Cassia fistula) no isoprene emission was detected or the levels of emission were negligible or below the detection limit (BDL). Among six tree species, the highest hourly emission (10.2±6.8 μg g -1 leaf dry weight, average of five seasons) was observed in Ficus religiosa, while minimum emission was from Melia azedarach (2.2±4.9 μg g -1 leaf dry weight, average of five seasons). Isoprene emission (average of six species), over five seasons, was found to vary between 3.9 and 8.5 μg g -1 leaf dry weight during the rainy season. In addition, significant diurnal variation in isoprene emission was observed in each species. The preliminary estimate made in this study on the annual biogenic VOC emission from India may probably be the first of its kind from this part of the world. - Isoprene flux (diurnal and seasonal) from some tropical tree species was estimated and a regional comparison was made

Isoprene emission from tropical tree species

Energy Technology Data Exchange (ETDEWEB)

Padhy, P.K. [School of Environmental Sciences, Jawaharlal Nehru University, New Delhi 110 067 (India)]. E-mail: padhypk2003@yahoo.com; Varshney, C.K. [School of Environmental Sciences, Jawaharlal Nehru University, New Delhi 110 067 (India)

2005-05-01

Foliar emission of isoprene was measured in nine commonly growing tree species of Delhi, India. Dynamic flow enclosure technique was used and gas samples were collected onto Tenax-GC/Carboseive cartridges, which were then attached to the sample injection system in the gas chromatograph (GC). Eluting compounds were analysed using a flame ionisation detector (FID). Out of the nine tree species, isoprene emission was found in six species (Eucalyptus sp., Ficus benghalensis, Ficus religiosa, Mangifera indica, Melia azedarach, and Syzygium jambolanum), whereas, in the remaining three tree species (Alstonia scholaris, Azadirachta indica, and Cassia fistula) no isoprene emission was detected or the levels of emission were negligible or below the detection limit (BDL). Among six tree species, the highest hourly emission (10.2{+-}6.8 {mu}g g{sup -1} leaf dry weight, average of five seasons) was observed in Ficus religiosa, while minimum emission was from Melia azedarach (2.2{+-}4.9 {mu}g g{sup -1} leaf dry weight, average of five seasons). Isoprene emission (average of six species), over five seasons, was found to vary between 3.9 and 8.5 {mu}g g{sup -1} leaf dry weight during the rainy season. In addition, significant diurnal variation in isoprene emission was observed in each species. The preliminary estimate made in this study on the annual biogenic VOC emission from India may probably be the first of its kind from this part of the world. - Isoprene flux (diurnal and seasonal) from some tropical tree species was estimated and a regional comparison was made.

Priority setting for invasive species management: risk assessment of Ponto-Caspian invasive species into Great Britain.

Science.gov (United States)

Gallardo, Belinda; Aldridge, David C

2013-03-01

Invasive species drive important ecological and economic losses across wide geographies, with some regions supporting especially large numbers of nonnative species and consequently suffering relatively high impacts. For this reason, integrated risk assessments able to screen a suite of multiple invaders over large geographic areas are needed for prioritizing the allocation of limited resources. A total of 16 Ponto-Caspian aquatic species (10 gammarids, one isopod, two mysids, and three fishes) have been short-listed as recent or potential future invaders of British waters, whose introduction and spread is of high concern. In this study, we use multiple modeling techniques to assess their risk of establishment and spread into Great Britain. Climate suitability maps for these 16 species differed depending on the eastern and western distribution of species in continental Europe, which was related to their respective migration corridor: southern (Danube-Rhine rivers), and northern (Don and Volga rivers and Baltic lakes). Species whose suitability was high across large parts of Great Britain included four gammarids (Cheliorophium robustum, Dikerogammarus bispinosus, D. villosus, and Echinogammarus trichiatus) and a mysid (Hemimysis anomala). A climatic "heat map" combining the results of all 16 species together pointed to the southeast of England as the area most vulnerable to multiple invasions, particularly the Thames, Anglian, Severn, and Humber river basin districts. Regression models further suggested that alkalinity concentration > 120 mg/L in southeast England may favor the establishment of Ponto-Caspian invaders. The production of integrated risk maps for future invaders provides a means for the scientifically informed prioritization of resources toward particular species and geographic regions. Such tools have great utility in helping environmental managers focus efforts on the most effective prevention, management, and monitoring programs.

The influence of oral Veillonella species on biofilms formed by Streptococcus species.

Science.gov (United States)

Mashima, Izumi; Nakazawa, Futoshi

2014-08-01

Oral Veillonella, Veillonella atypica, Veillonella denticariosi, Veillonella dispar, Veillonella parvula, Veillonella rogosae, and Veillonella tobetsuensis are known as early colonizers in oral biofilm formation. To investigate the role of oral Veillonella, biofilms formed by the co-culture of Streptococcus gordonii, Streptococcus mutans, Streptococcus salivarius, or Streptococcus sanguinis, with oral Veillonella were examined at the species level. The amount of biofilm formed by S. mutans, S. gordonii, and S. salivarius in the presence of the six Veillonella species was greater than that formed in the control experiments, with the exception of S. mutans with V. dispar. In contrast, in the case of biofilm formation by S. sanguinis, the presence of Veillonella species reduced the amount of the biofilm, with the exception of V. parvula and V. dispar. The time-dependent changes in the amount of biofilm and the number of planktonic cells were grouped into four patterns over the 24 combinations. Only that of S. gordonii with V. tobetsuensis showed a unique pattern. These results indicate that the mode of action of this combination differed from that of the other combinations with respect to biofilm formation. It is possible that there may be several factors involved in the interaction between Streptococcus and Veillonella species. Copyright © 2014 Elsevier Ltd. All rights reserved.

Identification of Thrips Species on Garlic Fields in Hamedan Province and Determination of Dominant Species

Directory of Open Access Journals (Sweden)

Majid Mirab-balou

2016-09-01

Full Text Available Introduction: Garlic (Allium sativum (family Amaryllidaceae are one of important crops in Hamedan province. There are several insects and mites that by feeding on this plant cause to damage garlic yield. Among the insect pests, the most dangerous pests of garlic are thrips species (Insecta: Thysanoptera. In this group, onion thrips, Thrips tabaci Lindeman is widely distributed and is a dominant species. Its sap sucking causes tiny and silvery spots on the leaves that may spread all over the leaf surface with an unfavorable effect on yield production. In addition, imagoes and larvae living and feeding on this plant cause more serious damages. Due to serious damage of thrips in garlic fields of Hamedan province, it is necessary to identify thripsspecies for pest control programs. Materials and Methods: Thrips specimens were collected on leaves of garlic in Hamedan province (Maryanaj and Heydareh situated in the west of Iran, during 2012–2013. Herein, specimens were collected by shaking plants to white dish and specimens were kept in 70 % ethanol and transferred to the laboratory. All collected material was macerated in 5% KOH and subjected to dehydration in an ethanol series before being mounted onto glass slides. Subsequently, thrips specimens mounted onto slides in Hoyer’s medium form of the protocol given in Mirab-balou and Chen (2010. All descriptions, measurements and photos were made with a Leica DM IRB microscope, with a Leica Image 1000 system. Thrips specimens were identified by author in species level. Specimens are deposited in the collection of Department of Plant Protection, College of Agriculture, Ilam University, Iran (ILAMU. In addition, dominant thrips species were also determined. For this purpose, regular samplings were done in fields of two regions of Hamedan province every two weeks, and totally, 2040 specimens (adult were collected. Results and Discussion: The world fauna of Thysanoptera, are presently known to be

Land fauna composition of small mammals of a fragment of Atlantic Forest in the State of Sao Paulo, Brazil

Directory of Open Access Journals (Sweden)

Darci Moraes Barros-Battesti

2000-03-01

Full Text Available The Atlantic Forest small mammal land fauna, except bats, and the abiotic factors that might have an influence on its composition, were studied in the Itapevi County, State of Sao Paulo, a forested region, partly altered by antropic action, from January, 1995 to June, 1996. The trapping effort consisted of 2,888 trap-nights, resulting in a 4.6% trapping success and consisted of monthly trappings, for five consecutive days. During this period, 134 specimens were captured, of which 46.3% were Didelphimorphia and 53.7% were Rodentia. Eleven species were registered: two Didelphimorphia: Didelphis marsupialis (Linnaeus, 1758 and Marmosops incanus (Lund, 1841, and nine Rodentia: Akodon cursor (Winge, 1887, Bolomys lasiurus (Lund, 1841, Oxymycterus hispidus Pictet, 1843, Oxymycterus nasutus (Waterhouse, 1837, Oligoryzomys nigripes (Olfers, 1818, Oryzomys angouya (Fischer, 1814, Raltus norvegicus (Berkenhout, 1769, Euryzygomatomys spinosus (G. Fischer, 1814 and Cavia aperea Erxleben, 1777. The relative density indices were correlated with meteorological data by Spearman and Pearson coefficients. For marsupials these correlations were not significant. For rodents, the correlations were significant and directly related to lower temperature and rainfall indices (p<0.05. During the dry season the occurrence of small mammals was 50% greater than during the wet season, probably due to foraging strategies in the studied fragment of Atlantic Forest.

Species longevity in North American fossil mammals.

Science.gov (United States)

Prothero, Donald R

2014-08-01

Species longevity in the fossil record is related to many paleoecological variables and is important to macroevolutionary studies, yet there are very few reliable data on average species durations in Cenozoic fossil mammals. Many of the online databases (such as the Paleobiology Database) use only genera of North American Cenozoic mammals and there are severe problems because key groups (e.g. camels, oreodonts, pronghorns and proboscideans) have no reliable updated taxonomy, with many invalid genera and species and/or many undescribed genera and species. Most of the published datasets yield species duration estimates of approximately 2.3-4.3 Myr for larger mammals, with small mammals tending to have shorter species durations. My own compilation of all the valid species durations in families with updated taxonomy (39 families, containing 431 genera and 998 species, averaging 2.3 species per genus) yields a mean duration of 3.21 Myr for larger mammals. This breaks down to 4.10-4.39 Myr for artiodactyls, 3.14-3.31 Myr for perissodactyls and 2.63-2.95 Myr for carnivorous mammals (carnivorans plus creodonts). These averages are based on a much larger, more robust dataset than most previous estimates, so they should be more reliable for any studies that need species longevity to be accurately estimated. © 2013 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and Wiley Publishing Asia Pty Ltd.

Understanding tourists' preference for mammal species in private protected areas: is there a case for extralimital species for ecotourism?

Directory of Open Access Journals (Sweden)

Kristine Maciejewski

Full Text Available Private Protected Areas (PPAs often use wildlife-based ecotourism as their primary means of generating business. Achieving tourist satisfaction has become a strong driving goal in the management of many PPAs, often at the expense of biodiversity. Many extralimitral species, those which historically did not occur in an area, are stocked in PPAs with the intention of increasing ecotourism attractions. Even though the ecological and economic costs of stocking these species are high, the social benefits are not understood and little information exists globally on the ecotourism role of extralimital species. This study assessed the value of stocking extralimital species using questionnaire-based surveys and observing tourists in Shamwari Private Game Reserve in the Eastern Cape Province of South Africa. No difference was found between indigenous and extralimital species with regards to the tourists' weighted scoring system, average amount tourists were willing to pay, total viewing time, average viewing time or the likelihood of stopping to view species when encountered on game drives. During game drives a strong preference was found for the elephant (Loxodonta africana, lion (Panthera leo, leopard (Panthera pardus and cheetah (Acynonix jubatus. With the exception of the cheetah, these species are all members of the "big five" and are indigenous. Species availability and visibility, however, may influence the amount of time tourists spend at an animal sighting. Our analysis suggests that certain extralimital species (typically larger and charismatic species contribute to tourist satisfaction, while particularly the smaller extralimital species add little to the game viewing experience, but add to the costs and risks of the PPAs. We recommend that extralimital species introductions for ecotourism purposes should be approached with caution with regards to the risks to the sustainability of PPAs.

Understanding Tourists’ Preference for Mammal Species in Private Protected Areas: Is There a Case for Extralimital Species for Ecotourism?

Science.gov (United States)

Maciejewski, Kristine; Kerley, Graham I. H.

2014-01-01

Private Protected Areas (PPAs) often use wildlife-based ecotourism as their primary means of generating business. Achieving tourist satisfaction has become a strong driving goal in the management of many PPAs, often at the expense of biodiversity. Many extralimitral species, those which historically did not occur in an area, are stocked in PPAs with the intention of increasing ecotourism attractions. Even though the ecological and economic costs of stocking these species are high, the social benefits are not understood and little information exists globally on the ecotourism role of extralimital species. This study assessed the value of stocking extralimital species using questionnaire-based surveys and observing tourists in Shamwari Private Game Reserve in the Eastern Cape Province of South Africa. No difference was found between indigenous and extralimital species with regards to the tourists’ weighted scoring system, average amount tourists were willing to pay, total viewing time, average viewing time or the likelihood of stopping to view species when encountered on game drives. During game drives a strong preference was found for the elephant (Loxodonta africana), lion (Panthera leo), leopard (Panthera pardus) and cheetah (Acynonix jubatus). With the exception of the cheetah, these species are all members of the “big five” and are indigenous. Species availability and visibility, however, may influence the amount of time tourists spend at an animal sighting. Our analysis suggests that certain extralimital species (typically larger and charismatic species) contribute to tourist satisfaction, while particularly the smaller extralimital species add little to the game viewing experience, but add to the costs and risks of the PPAs. We recommend that extralimital species introductions for ecotourism purposes should be approached with caution with regards to the risks to the sustainability of PPAs. PMID:24505426

Understanding tourists' preference for mammal species in private protected areas: is there a case for extralimital species for ecotourism?

Science.gov (United States)

Maciejewski, Kristine; Kerley, Graham I H

2014-01-01

Private Protected Areas (PPAs) often use wildlife-based ecotourism as their primary means of generating business. Achieving tourist satisfaction has become a strong driving goal in the management of many PPAs, often at the expense of biodiversity. Many extralimitral species, those which historically did not occur in an area, are stocked in PPAs with the intention of increasing ecotourism attractions. Even though the ecological and economic costs of stocking these species are high, the social benefits are not understood and little information exists globally on the ecotourism role of extralimital species. This study assessed the value of stocking extralimital species using questionnaire-based surveys and observing tourists in Shamwari Private Game Reserve in the Eastern Cape Province of South Africa. No difference was found between indigenous and extralimital species with regards to the tourists' weighted scoring system, average amount tourists were willing to pay, total viewing time, average viewing time or the likelihood of stopping to view species when encountered on game drives. During game drives a strong preference was found for the elephant (Loxodonta africana), lion (Panthera leo), leopard (Panthera pardus) and cheetah (Acynonix jubatus). With the exception of the cheetah, these species are all members of the "big five" and are indigenous. Species availability and visibility, however, may influence the amount of time tourists spend at an animal sighting. Our analysis suggests that certain extralimital species (typically larger and charismatic species) contribute to tourist satisfaction, while particularly the smaller extralimital species add little to the game viewing experience, but add to the costs and risks of the PPAs. We recommend that extralimital species introductions for ecotourism purposes should be approached with caution with regards to the risks to the sustainability of PPAs.

Species limits within the widespread Amazonian treefrog Dendropsophus parviceps with descriptions of two new species (Anura, Hylidae

Directory of Open Access Journals (Sweden)

C. Daniel Rivadeneira

2018-01-01

Full Text Available The genus Dendropsophus is one of the most speciose among Neotropical anurans and its number of described species is increasing. Herein, molecular, morphological, and bioacoustic evidence are combined to assess species limits within D. parviceps, a widely distributed species in the Amazon Basin. Phylogenetic relationships were assessed using 3040 bp sequences of mitochondrial DNA, genes 12S, ND1, and CO1. The phylogeny shows three well-supported clades. Bioacoustic and morphological divergence is congruent with those clades demonstrating that Dendropsophus parviceps is a species complex. Dendropsophus parviceps sensu stricto occurs in the Amazon basin of Ecuador, northern Peru, southern Colombia and northwestern Brazil. It is sister to two previously undescribed species, D. kubricki sp. n. from central Peru and D. kamagarini sp. n. from southern Peru, northeastern Bolivia, and northwestern Brazil. Genetic distances (uncorrected p, gene 12S between D. parviceps and the new species is 3 to 4%. Dendropsophus kamagarini sp. n. can be distinguished from D. parviceps by having a prominent conical tubercle on the distal edge of the upper eyelid (tubercle absent in D. parviceps. Dendropsophus kubricki sp. n. differs from D. parviceps by having scattered low tubercles on the upper eyelids (smooth in D. parviceps. Dendropsophus parviceps and both new species differ from all their congeners by their small size (adult maximum SVL = 28.39 mm in females, 22.73 mm in males and by having a bright orange blotch on the hidden areas of the shanks and under arms. The advertisement call of the two new species has lower dominant frequency relative to D. parviceps. Probable speciation modes are discussed. Available evidence indicates that ecological speciation along an elevation gradient is unlikely in this species complex.

On species preservation and Non-Cooperative Exploiters

DEFF Research Database (Denmark)

Kronbak, Lone Grønbæk; Lindroos, Marko

cases where several non-cooperative exploiters are involved in mixed fisheries. This paper is targeting biodiversity preservation by setting up a two species model with the aim of ensuring both species survive harvesting of exploiters adapting a non-cooperative behaviour. The model starts out as a multi......-species model without biological dependency and is then modified to include also biological dependency. We contribute to the literature by analytically finding the limits on the number of players preserving both species including the conditions to be satisfied. For visual purposes we simulate a two species...

A comparison of brain gene expression levels in domesticated and wild animals.

Directory of Open Access Journals (Sweden)

Frank W Albert

2012-09-01

Full Text Available Domestication has led to similar changes in morphology and behavior in several animal species, raising the question whether similarities between different domestication events also exist at the molecular level. We used mRNA sequencing to analyze genome-wide gene expression patterns in brain frontal cortex in three pairs of domesticated and wild species (dogs and wolves, pigs and wild boars, and domesticated and wild rabbits. We compared the expression differences with those between domesticated guinea pigs and a distant wild relative (Cavia aperea as well as between two lines of rats selected for tameness or aggression towards humans. There were few gene expression differences between domesticated and wild dogs, pigs, and rabbits (30-75 genes (less than 1% of expressed genes were differentially expressed, while guinea pigs and C. aperea differed more strongly. Almost no overlap was found between the genes with differential expression in the different domestication events. In addition, joint analyses of all domesticated and wild samples provided only suggestive evidence for the existence of a small group of genes that changed their expression in a similar fashion in different domesticated species. The most extreme of these shared expression changes include up-regulation in domesticates of SOX6 and PROM1, two modulators of brain development. There was almost no overlap between gene expression in domesticated animals and the tame and aggressive rats. However, two of the genes with the strongest expression differences between the rats (DLL3 and DHDH were located in a genomic region associated with tameness and aggression, suggesting a role in influencing tameness. In summary, the majority of brain gene expression changes in domesticated animals are specific to the given domestication event, suggesting that the causative variants of behavioral domestication traits may likewise be different.

Systematics of the Platyrrhinus helleri species complex (Chiroptera: Phyllostomidae), with descriptions of two new species

Science.gov (United States)

Velazco, Paúl M.; Gardner, Alfred L.; Patterson, Bruce D.

2010-01-01

Platyrrhinus is a diverse genus of small to large phyllostomid bats characterized by a comparatively narrow uropatagium thickly fringed with hair, a white dorsal stripe, comparatively large inner upper incisors that are convergent at the tips, and three upper and three lower molars. Eighteen species are currently recognized, the majority occurring in the Andes. Molecular, morphological, and morphometric analyses of specimens formerly identified as Platyrrhinus helleri support recognition of Platyrrhinus incarum as a separate species and reveal the presence of two species from western and northern South America that we describe herein as new (Platyrrhinus angustirostris sp. nov. from eastern Colombia and Ecuador, north-eastern Peru, and Venezuela and Platyrrhinus fusciventris sp. nov. from Guyana, Suriname, French Guiana, Trinidad and Tobago, northern Brazil, eastern Ecuador, and southern Venezuela). These two new species are sister taxa and, in turn, sister to Platyrrhinus incarum.

Coagulase-negative Staphylococcus species in bulk milk: Prevalence, distribution, and associated subgroup- and species-specific risk factors.

Science.gov (United States)

De Visscher, A; Piepers, S; Haesebrouck, F; Supré, K; De Vliegher, S

2017-01-01

Coagulase-negative staphylococci (CNS) have become the main pathogens causing bovine mastitis in recent years. A huge variation in species distribution among herds has been observed in several studies, emphasizing the need to identify subgroup- and species-specific herd-level factors to improve our understanding of the differences in ecological and epidemiological nature between species. The use of bulk milk samples enables the inclusion of a large(r) number of herds needed to identify herd-level risk factors and increases the likelihood of recovering enough isolates per species needed for conducting subgroup- and, eventually, species-specific analyses at the same time. This study aimed to describe the prevalence and distribution of CNS species in bulk milk samples and to identify associated subgroup- and species-specific herd-level factors. Ninety percent of all bulk milk samples yielded CNS. Staphylococcus equorum was the predominant species, followed by Staphylococcus haemolyticus and Staphylococcus epidermidis. A seasonal effect was observed for several CNS species. Bulk milk samples from herds with a loose-pack or a tiestall housing system were more likely to yield CNS species compared with herds with a freestall barn, except for S. epidermidis, Staphylococcus simulans, and Staphylococcus cohnii. In September, herds in which udders were clipped had lower odds of yielding Staphylococcus chromogenes, S. simulans, and Staphylococcus xylosus, the CNS species assumed to be most relevant for udder health, in their bulk milk than herds in which udder clipping was not practiced. Bulk milk of herds participating in a monthly veterinary udder health-monitoring program was more likely to yield these 3 CNS species. Herds always receiving their milk quality premium or predisinfecting teats before attachment of the milking cluster had lower odds of having S. equorum in their bulk milk. Herds not using a single dry cotton or paper towel for each cow during premilking udder

Invasive species information networks: Collaboration at multiple scales for prevention, early detection, and rapid response to invasive alien species

Science.gov (United States)

Simpson, Annie; Jarnevich, Catherine S.; Madsen, John; Westbrooks, Randy G.; Fournier, Christine; Mehrhoff, Les; Browne, Michael; Graham, Jim; Sellers, Elizabeth A.

2009-01-01

Accurate analysis of present distributions and effective modeling of future distributions of invasive alien species (IAS) are both highly dependent on the availability and accessibility of occurrence data and natural history information about the species. Invasive alien species monitoring and detection networks (such as the Invasive Plant Atlas of New England and the Invasive Plant Atlas of the MidSouth) generate occurrence data at local and regional levels within the United States, which are shared through the US National Institute of Invasive Species Science. The Inter-American Biodiversity Information Network's Invasives Information Network (I3N), facilitates cooperation on sharing invasive species occurrence data throughout the Western Hemisphere. The I3N and other national and regional networks expose their data globally via the Global Invasive Species Information Network (GISIN). International and interdisciplinary cooperation on data sharing strengthens cooperation on strategies and responses to invasions. However, limitations to effective collaboration among invasive species networks leading to successful early detection and rapid response to invasive species include: lack of interoperability; data accessibility; funding; and technical expertise. This paper proposes various solutions to these obstacles at different geographic levels and briefly describes success stories from the invasive species information networks mentioned above. Using biological informatics to facilitate global information sharing is especially critical in invasive species science, as research has shown that one of the best indicators of the invasiveness of a species is whether it has been invasive elsewhere. Data must also be shared across disciplines because natural history information (e.g. diet, predators, habitat requirements, etc.) about a species in its native range is vital for effective prevention, detection, and rapid response to an invasion. Finally, it has been our

Identifying ambassador species for conservation marketing

Directory of Open Access Journals (Sweden)

E.A. Macdonald

2017-10-01

Full Text Available Conservation relies heavily on external funding, much of it from a supportive public. Therefore it is important to know which species are most likely to catalyse such funding. Whilst previous work has looked at the physical attributes that contribute to a species' appeal, no previous studies have tried to examine the extent to which a species' sympatriots might contribute to it's potential as flagship for wider conservation. Therefore, here we estimate ‘flexibility’ and ‘appeal’ scores for all terrestrial mammals (n = 4320 and identify which of these might serve as ambassadors (defined as both highly appealing and flexible. Relatively few mammals (between 240 and 331 emerged as ambassadors, with carnivores featuring heavily in this group (representing 5% of terrestrial mammals but 39% of ambassadors. ‘Top ambassadors’ were defined as those with both flexibility and appeal scores greater than 1 standard deviation above the mean. Less than a quarter of the 20 most endangered and evolutionary distinct species in this study were classed as ambassadors, highlighting the need for surrogate species to catalyse conservation effort in areas with such priority species. This is the first global analysis bringing together flexibility and appeal for all terrestrial mammals, and demonstrates an approach for determining how best to market species in order to achieve maximal conservation gain in a world with urgent conservation need but limited resources.

Two new species of Parapharyngodon parasites of Sceloporus pyrocephalus, with a key to the species found in Mexico (Nematoda, Pharyngodonidae).

Science.gov (United States)

Garduño-Montes de Oca, Edgar Uriel; Mata-López, Rosario; León-Règagnon, Virginia

2016-01-01

Two new species of Parapharyngodon collected from the intestine of the Mexican boulder spiny lizard Sceloporus pyrocephalus are described. This study increases to 49 the number of valid species assigned to Parapharyngodon worldwide, 11 of them distributed in Mexico. Males of the two new species share the presence of four pairs of caudal papillae, an anterior echinate cloacal lip and the presence of lateral alae; however, both differ from each other in lateral alae extension and echinate cloacal anterior lip morphology. Females of both species have a prebulbar uterus and eggs shell punctuate with pores, characteristics shared with few other species of Parapharyngodon. Both new species differ from other congeneric species in the papillar arrangement, the anterior cloacal lip morphology, the lateral alae extension and total length/spicule ratio. A taxonomic key for the species of Parapharyngodon distributed in Mexico is provided.

On the Mass Distribution of Animal Species

Science.gov (United States)

Redner, Sidney; Clauset, Aaron; Schwab, David

2009-03-01

We develop a simple diffusion-reaction model to account for the broad and asymmetric distribution of adult body masses for species within related taxonomic groups. The model assumes three basic evolutionary features that control body mass: (i) a fixed lower limit that is set by metabolic constraints, (ii) a species extinction risk that is a weakly increasing function of body mass, and (iii) cladogenetic diffusion, in which daughter species have a slight tendency toward larger mass. The steady-state solution for the distribution of species masses in this model can be expressed in terms of the Airy function. This solution gives mass distributions that are in good agreement with data on 4002 terrestrial mammal species from the late Quaternary and 8617 extant bird species.

Vulnerability of species to climate change in the Southwest: threatened, endangered, and at-risk species at Fort Huachuca, Arizona

Science.gov (United States)

Karen E. Bagne; Deborah M. Finch

2013-01-01

Future climate change is anticipated to result in ecosystem changes, and consequently, many species are expected to become increasingly vulnerable to extinction. This scenario is of particular concern for threatened, endangered, and at-risk species (TER-S) or other rare species. The response of species to climate change is uncertain and will be the outcome of complex...

The Pleurobemini (Bivalvia: Unionida) revisited: Molecular species delineation using a mitochondrial DNA gene reveals multiple conspecifics and undescribed species

Science.gov (United States)

Inoue, Kentaro; Hayes, David M.; Harris, John L.; Johnson, Nathan A.; Morrison, Cheryl L.; Eackles, Michael S.; King, Tim; Jones, Jess W.; Hallerman, Eric M.; Christian, Alan D.; Randklev, Charles R.

2018-01-01

The Pleurobemini (Bivalvia: Unionida) represent approximately one-third of freshwater mussel diversity in North America. Species identification within this group is challenging due to morphological convergence and phenotypic plasticity. Accurate species identification, including characterization of currently unrecognized taxa, is required to develop effective conservation strategies because many species in the group are imperiled. We examined 573 cox1 sequences from 110 currently recognized species (including 13 Fusconaia and 21 Pleurobema species) to understand phylogenetic relationships among pleurobemine species (mainly Fusconaia and Pleurobema) and to delineate species boundaries. The results of phylogenetic analyses showed no geographic structure within widespread species and illustrated a close relationship between Elliptio lanceolata and Parvaspina collina. Constraint tests supported monophyly of the genera Fusconaia and Pleurobema, including the subgenus P. (Sintoxia). Furthermore, results revealed multiple conspecifics, including P. hanleyianum and P. troschelianum, P. chattanoogaense and P. decisum, P. clava and P. oviforme, P. rubrum and P. sintoxia, F. askewi and F. lananensis, and F. cerina and F. flava. Species delimitation analyses identified three currently unrecognized taxa (two in Fusconaia and one in Pleurobema). Further investigation using additional genetic markers and other lines of evidence (e.g., morphology, life history, ecology) are necessary before any taxonomic changes are formalized.

Ecological impacts of non-native species: Chapter 2

Science.gov (United States)

Pilliod, David S.; Griffiths, R.A.; Kuzmin, S.L.; Heatwole, Harold; Wilkinson, John W.

2012-01-01

Non-native species are considered one of the greatest threats to freshwater biodiversity worldwide (Drake et al. 1989; Allen and Flecker 1993; Dudgeon et al. 2005). Some of the first hypotheses proposed to explain global patterns of amphibian declines included the effects of non-native species (Barinaga 1990; Blaustein and Wake 1990; Wake and Morowitz 1991). Evidence for the impact of non-native species on amphibians stems (1) from correlative research that relates the distribution or abundance of a species to that of a putative non-native species, and (2) from experimental tests of the effects of a non-native species on survival, growth, development or behaviour of a target species (Kats and Ferrer 2003). Over the past two decades, research on the effects of non-native species on amphibians has mostly focused on introduced aquatic predators, particularly fish. Recent research has shifted to more complex ecological relationships such as influences of sub-lethal stressors (e.g. contaminants) on the effects of non-native species (Linder et al. 2003; Sih et al. 2004), non-native species as vectors of disease (Daszak et al. 2004; Garner et al. 2006), hybridization between non-natives and native congeners (Riley et al. 2003; Storfer et al. 2004), and the alteration of food-webs by non-native species (Nystrom et al. 2001). Other research has examined the interaction of non-native species in terms of facilitation (i.e. one non-native enabling another to become established or spread) or the synergistic effects of multiple non-native species on native amphibians, the so-called invasional meltdown hypothesis (Simerloff and Von Holle 1999). Although there is evidence that some non-native species may interact (Ricciardi 2001), there has yet to be convincing evidence that such interactions have led to an accelerated increase in the number of non-native species and cumulative impacts are still uncertain (Simberloff 2006). Applied research on the control, eradication, and

Southern European Phyllonorycter species mining Quercus, with two new species (Lepidoptera: Gracillariidae

Directory of Open Access Journals (Sweden)

Aleš Laštůvka

2007-01-01

Full Text Available A review of 14 species of the genus Phyllonorycter Hübner, 1822, mining Quercus in southern Europe, is presented with descriptions of two new species, viz. Phyllonorycter graecus sp. n. developing on Quercus ithaburensis Decne. subsp. macrolepis (Kotschy Hedge & Yalt. from Peloponnisos, Greece, and P. gerfriedi sp. n. mining Quercus coccifera L. from Crete. Six new synonyms have been established: Phyllonorycter joviella (Constant, 1890 and P. anatolica (Deschka, 1970 of P. belotella (Staudinger, 1859, P. arkadiella Derra, 1985 of P. olympica Deschka, 1983, P. neli Buvat, 1996 of P. barbarella (Rebel, 1901, P. glaserorum (Deschka, 1969 of P. rebimbasi (Mendes, 1910, and P. sardiniensis (Amsel, 1939 of P. sublautella (Stainton, 1869. The lectotype of Lithocolletis belotella Staudinger, 1859 has been designated. Diagnostic characters with figures of all species, brief data on their biology and distribution are given with several new country records. The record of Phyllonorycter obtusifoliella Deschka, 1974 in Europe has been mentioned.

Fisheries oceanography of northern pelagic fish species

DEFF Research Database (Denmark)

Tsoukali, Stavroula

for marine organisms. One of the impacts will be the time that species start to spawn, and there is already evidence for earlier spawning in some North Sea fish species. A change like that may likely have a chain reaction, affecting larval stages and whether they will live in environments with high food...... of the species they consume now and increased availability of new species. In addition, there will likely be economic impacts on the local fishing communities. How species respond to climate change is a field of research that receives great attention because the responses will affect the management of fisheries......People are familiar with marine fish species and the great variety of different species that are available in the market, such as herring, cod and sole. What may not be well known is that every individual fish goes through a long, risky journey during its life before reaching maturity. Most...

76 FR 65700 - Atlantic Highly Migratory Species; Advisory Panel for Atlantic Highly Migratory Species Southeast...

Science.gov (United States)

2011-10-24

.... Virgin Islands and Puerto Rico, and each of the constituent interstate commissions: the Atlantic States... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XA776 Atlantic Highly Migratory Species; Advisory Panel for Atlantic Highly Migratory Species Southeast Data, Assessment...

Response of chironomid species (Diptera, Chironomidae to water temperature: effects on species distribution in specific habitats

Directory of Open Access Journals (Sweden)

L. Marziali

2013-09-01

Full Text Available The response of 443 chironomid species to water temperature was analyzed, with the aim of defining their thermal optimum, tolerance limits and thermal habitat. The database included 4442 samples mainly from Italian river catchments collected from the 1950s up to date. Thermal preferences were calculated separately for larval and pupal specimens and for different habitats: high altitude and lowland lakes in the Alpine ecoregion; lowland lakes in the Mediterranean ecoregion; heavily modified water bodies; kryal, krenal, rhithral and potamal in running waters. Optimum response was calculated as mean water temperature, weighted by species abundances; tolerance as weighted standard deviation; skewness and kurtosis as 3rd and 4th moment statistics. The responses were fitted to normal uni- or plurimodal Gaussian models. Cold stenothermal species showed: i unimodal response, ii tolerance for a narrow temperature range, iii optima closed to their minimum temperature values, iv leptokurtic response. Thermophilous species showed: i optima at different temperature values, ii wider tolerance, iii optima near their maximum temperature values, iv platikurtic response, often fitting a plurimodal model. As expected, lower optima values and narrower tolerance were obtained for kryal and krenal, than for rhithral, potamal and lakes. Thermal response curves were produced for each species and were discussed according to species distribution (i.e. altitudinal range in running water and water depth in lakes, voltinism and phylogeny. Thermal optimum and tolerance limits and the definition of the thermal habitat of species can help predicting the impact of global warming on freshwater ecosystems.

New species, redescription and taxonomic notes in the Dichotomius (Luederwaldtinia) batesi (Harold) species-group (Coleoptera: Scarabaeidae: Scarabaeinae).

Science.gov (United States)

Vaz-de-Mello, Fernando Z; Nunes, Rafael V

2016-07-20

This paper deals with taxonomic issues of the Dichotomius (Luederwaldtinia) batesi (Harold) species-group. We describe Dichotomius benesi n. sp. from Panama, and redescribe and designate a lectotype for Dichotomius ocellatopunctatus (Felsche) from Venezuela, both hemi-brachypterous species. We also do brief comments on the taxonomy of this species-group. Dichotomius joelus, previously assigned to this group, is here considered to be a new synonym of D. opacipennis and then to belong to Dichotomius geminatus species-group.

Genomic definition of species

Energy Technology Data Exchange (ETDEWEB)

Crkvenjakov, R.; Drmanac, R.

1991-07-01

The subject of this paper is the definition of species based on the assumption that genome is the fundamental level for the origin and maintenance of biological diversity. For this view to be logically consistent it is necessary to assume the existence and operation of the new law which we call genome law. For this reason the genome law is included in the explanation of species phenomenon presented here even if its precise formulation and elaboration are left for the future. The intellectual underpinnings of this definition can be traced to Goldschmidt. We wish to explore some philosophical aspects of the definition of species in terms of the genome. The point of proposing the definition on these grounds is that any real advance in evolutionary theory has to be correct in both its philosophy and its science.

Single-species versus dual-species probiotic supplementation as an emerging therapeutic strategy for obesity.

Science.gov (United States)

Karimi, G; Jamaluddin, R; Mohtarrudin, N; Ahmad, Z; Khazaai, H; Parvaneh, M

2017-10-01

Recent studies have reported beneficial effects of specific probiotics on obesity. However, the difference in the anti-obesity effects of probiotics as single species and dual species is still uncertain. Therefore, we aimed to compare the efficacy of single and dual species of bacteria on markers of obesity in high-fat diet-induced obese rats. A total of 40 male Sprague-Dawley rats were assigned to one of five groups of varying diets as follows: standard diet, high fat diet (HFD), HFD supplemented with Lactobacillus casei strain Shirota, HFD supplemented with Bifidobacterium longum and HFD supplemented with a mixture of these two bacterial species. After 15 weeks of supplementation, the animals were examined for changes in body weight, body fat, total count of bacteria in fecal, blood serum lipid profile, leptin, adiponectin and inflammatory biomarkers. Histological analysis of the liver and adipose tissue was performed and the hepatic mRNA expression levels of genes related to lipid metabolism were measured. It was found that probiotic supplementation of either B. longum or a mixture of B. longum and LcS bacteria significantly reduced weight and triglycerides in the HFD groups. Supplementation of B. longum bacteria showed better results in terms of modulating leptin level, fat mass, adipocyte size and lipoprotein lipase expression, as well as increasing adiponectin and peroxisome proliferator-activated receptors-γ expression compared to dual species of bacteria. No significant differences were observed in the total count of fecal bacteria, glucose and inflammatory biomarker levels between supplemented groups. B. longum supplementation in obesity was more beneficial in metabolic profile changes than the mixture species. Copyright © 2017 The Italian Society of Diabetology, the Italian Society for the Study of Atherosclerosis, the Italian Society of Human Nutrition, and the Department of Clinical Medicine and Surgery, Federico II University. Published by Elsevier B

Projecting future expansion of invasive species: comparing and improving methodologies for species distribution modeling.

Science.gov (United States)

Mainali, Kumar P; Warren, Dan L; Dhileepan, Kunjithapatham; McConnachie, Andrew; Strathie, Lorraine; Hassan, Gul; Karki, Debendra; Shrestha, Bharat B; Parmesan, Camille

2015-12-01

Modeling the distributions of species, especially of invasive species in non-native ranges, involves multiple challenges. Here, we developed some novel approaches to species distribution modeling aimed at reducing the influences of such challenges and improving the realism of projections. We estimated species-environment relationships for Parthenium hysterophorus L. (Asteraceae) with four modeling methods run with multiple scenarios of (i) sources of occurrences and geographically isolated background ranges for absences, (ii) approaches to drawing background (absence) points, and (iii) alternate sets of predictor variables. We further tested various quantitative metrics of model evaluation against biological insight. Model projections were very sensitive to the choice of training dataset. Model accuracy was much improved using a global dataset for model training, rather than restricting data input to the species' native range. AUC score was a poor metric for model evaluation and, if used alone, was not a useful criterion for assessing model performance. Projections away from the sampled space (i.e., into areas of potential future invasion) were very different depending on the modeling methods used, raising questions about the reliability of ensemble projections. Generalized linear models gave very unrealistic projections far away from the training region. Models that efficiently fit the dominant pattern, but exclude highly local patterns in the dataset and capture interactions as they appear in data (e.g., boosted regression trees), improved generalization of the models. Biological knowledge of the species and its distribution was important in refining choices about the best set of projections. A post hoc test conducted on a new Parthenium dataset from Nepal validated excellent predictive performance of our 'best' model. We showed that vast stretches of currently uninvaded geographic areas on multiple continents harbor highly suitable habitats for parthenium

Looking beyond rare species as umbrella species: Northern Bobwhites (Colinus virginianus) and conservation of grassland and shrubland birds

Science.gov (United States)

Crosby, Andrew D.; Elmore, R.D.; Leslie,, David M.; Will, Rodney E.

2015-01-01

Changes in land use and land cover throughout the eastern half of North America have caused substantial declines in populations of birds that rely on grassland and shrubland vegetation types, including socially and economically important game birds such as the Northern Bobwhite (Colinus virginianus; hereafter bobwhites). As much attention is focused on habitat management and restoration for bobwhites, they may act as an umbrella species for other bird species with similar habitat requirements. We quantified the relationship of bobwhites to the overall bird community and evaluated the potential for bobwhites to act as an umbrella species for grassland and shrubland birds. We monitored bobwhite presence and bird community composition within 31 sample units on selected private lands in the south-central United States from 2009 to 2011. Bobwhites were strongly associated with other grassland and shrubland birds and were a significant positive predictor for 9 species. Seven of these, including Bell's Vireo (Vireo bell), Dicksissel (Spiza americana), and Grasshopper Sparrow (Ammodramus savannarum), are listed as species of conservation concern. Species richness and occupancy probability of grassland and shrubland birds were higher relative to the overall bird community in sample units occupied by bobwhites. Our results show that bobwhites can act as an umbrella species for grassland and shrubland birds, although the specific species in any given situation will depend on region and management objectives. These results suggest that efficiency in conservation funding can be increased by using public interest in popular game species to leverage resources to meet multiple conservation objectives.

Animal species endangerment: The role of environmental pollution

Science.gov (United States)

Pattee, Oliver H.; Fellows, Valerie L.; Bounds, Dixie L.; Hoffman, David J.; Rattner, Barnett A.; Burton, G. Allen; Cairns, John

2003-01-01

Multiple factors contribute to the decline of species. Habitat destruction is the primary factor that threatens species. affecting 73 % of endangered species. The second major factor causing species decline is the introduction of nonnative species. affecting 68% of endangered species. Pollution and overharvesting were identified as impacting, respectively, 38 and 15% of endangered species. Other factors affecting species decline include hybridization, competition, disease, and other interspecific interactions. Once a species is reduced to a remnant of its former population size and distribution, its vulnerability to catastrophic pollution events increases, frequently exceeding or replacing the factors responsible for the initial decline. Small, isolated populations are particularly vulnerable to catastrophic loss by an acute event. such as a chemical spill or pesticide application. However, when it comes to surviving a single disaster, widespread subpopulations of a species are far more resilient and ensure genetic survival. Hypothesizing theoretical concerns of potential factors that could affect an endangered species could predispose the scientific and political communities to jeopardizing threats. The user of recovery plans as a data source must be aware of the bias within the data set. These data should be used with the caveat that the source of information in recovery plans is not always based on scientific research and rigorous data collection. Over 58% of the information identifying species threats is based on estimates or personal communication. while only 42% is based on peer reviewed literature, academic research. or government reports. Many recovery plans were written when a species was initially listed in the 1970s or 1980s. Politics, human disturbance, and habitat demand issues evolve over a 20- to 30-year period. leaving much of the threats facing endangered species outdated and inadequate. These data are most valuable when used to facilitate reviews

Actinomyces Species Isolated from Breast Infections

Science.gov (United States)

Loh, S. F.; Morris, T.; Hughes, H.; Dixon, J. M.

2015-01-01

Actinomycosis is a chronic infection caused by Actinomyces species characterized by abscess formation, tissue fibrosis, and draining sinuses. The spectrum of infections caused by Actinomyces species ranges from classical invasive actinomycosis to a less invasive form of superficial skin and soft tissue infection. We present a review detailing all Actinomyces species isolated from breast infections in NHS Lothian between 2005 and 2013, Actinomyces species isolated from breast infections referred to the United Kingdom Anaerobe Reference Unit between 1988 and 2014, and cases describing Actinomyces breast infections published in the medical literature since 1994. Actinomyces species are fastidious organisms which can be difficult to identify and are likely to be underascertained as a cause of breast infections. Due to improved diagnostic methods, they are increasingly associated with chronic, recurrent breast infections and may play a more significant role in these infections than has previously been appreciated. PMID:26224846

Vegetation composition and structure influences bird species ...

African Journals Online (AJOL)

Vegetation composition and structure influences bird species community ... variables on bird species diversity and richness of respective foraging guilds, and ... of the species assessed: (1) increasing closed cover due to woody plant density, ...

Predictions For New, Exotic Actinide Species

International Nuclear Information System (INIS)

Pyykko, P.

2002-01-01

The approach. New, simple chemical species can be predicted by studying isoelectronic series using ab initio quantum chemistry. We currently use in most cases relativistic pseudopotentials and handle the electron correlation using density functional theory (DFT) or wave-function-based methods, from MP2 to CCSD(T). Typical codes are Gaussian 98, Turbomole or MolCas. For full four-component Dirac-Fock calculations, the DREAMS code of K. G. Dyall has been utilized. For mapping out the possible new species, complete maps of all possibilities are made, whenever possible, and the new species typically occur along the coast-line of the 'island of stability' of already known species

76 FR 74778 - Endangered Species

Science.gov (United States)

2011-12-01

.... 16439] Endangered Species AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and... has been issued under the authority of the Endangered Species Act of 1973, as amended (ESA; 16 U.S.C. 1531 et seq.) and the regulations governing the taking, importing, and exporting of endangered and...

Four new species of Pyropia (Bangiales, Rhodophyta) from the west coast of North America: the Pyropialanceolata species complex updated.

Science.gov (United States)

Lindstrom, Sandra C; Hughey, Jeffery R; Rosas, Luis E Aguilar

2015-01-01

Recent molecular studies indicate that the Pyropialanceolata species complex on the west coast of North America is more speciose than previously thought. Based on extensive rbcL gene sequencing of representative specimens we recognize seven species in the complex, three of which are newly described: Pyropiamontereyensis sp. nov., Pyropiacolumbiensis sp. nov., and Pyropiaprotolanceolata sp. nov. The new species are all lanceolate, at least when young, and occur in the upper mid to high intertidal zone primarily in winter and early spring. Pyropiamontereyensis and Pyropiacolumbiensis are sister taxa that are distributed south and north of Cape Mendocino, respectively, and both occur slightly lower on the shore than Pyropialanceolata or Pyropiapseudolanceolata. Pyropiaprotolanceolata is known thus far only from Morro Rock and the Monterey Peninsula, California; it occurs basally to the other species in the complex in the molecular phylogeny. A fourth newly described species, Pyropiabajacaliforniensis sp. nov., is more closely related to Pyropianereocystis than to species in this complex proper. It is a thin species with undulate margins known only from Moss Landing, Monterey Bay, California, and northern Baja California; it also occurs in the high intertidal in spring. Porphyramumfordii, a high intertidal winter species that has frequently been confused with species in the Pyropialanceolata complex, has now been confirmed to occur from Calvert Island, British Columbia, to Pescadero State Park, California.

Photosynthetic response of two seaweed species along an urban pollution gradient: evidence of selection of pollution-tolerant species.

Science.gov (United States)

Scherner, F; Bonomi Barufi, J; Horta, P A

2012-11-01

Urbanization leads to the expansion of ephemeral seaweed species and the decline of important perennial, canopy-forming seaweed species. Understanding the mechanisms that lead to these changes is a current challenge. In the present study, laboratory assays and field transplantations were performed with two seaweed species: the perennial, canopy-forming seaweed Sargassum stenophyllum and the ephemeral seaweed Ulva lactuca. Photosynthetic efficiency was assessed using modulated chlorophyll fluorometry. Brief exposure to urban waters does not appear to be a major stressor to the photosynthetic efficiency of either species. However, after 26 days of transplantation in urban waters, S. stenophyllum declined, whereas U. lactuca had enhanced photosynthetic efficiency. This difference reflects their divergent abilities to regulate the energy distribution at the PSII and shows that urban stressors alter these mechanisms. Our results provide evidence of the physiological causes for the decline of Sargassum species and the expansion of Ulva species in impacted urban areas. Copyright © 2012 Elsevier Ltd. All rights reserved.

Two new species of the Pterostichus macrogenys species group (Coleoptera, Carabidae discovered in shallow subterranean habitats in northern Honshu, Japan

Directory of Open Access Journals (Sweden)

Kôji Sasakawa

2017-01-01

Full Text Available Shallow subterranean environments have recently received attention as a habitat for Carabidae beetles, and many new species have been discovered using collection techniques devised for this habitat. We report the discovery of two new species of the macrogenys species group of the Pterostichus subgenus Nialoe Tanaka, 1958, collected by subterranean baited traps in northern Honshu, Japan. Pterostichus shinbodakensis Sasakawa & Itô, sp. n. is described from Mt. Shinbodake, Niigata Prefecture, and P. tateishiyamanus Sasakawa & Itô, sp. n. is described from the southeastern foot of Mt. Tateishiyama, Fukushima Prefecture. Comparative male genital morphology shows that among the known species, the two new species are most closely related to P. falcispinus Sasakawa, 2005 and P. chokaisanus Sasakawa, 2009, respectively. In addition, sympatric occurrence of P. shinbodakensis with a smaller, unidentified species of the species group was also confirmed. The implications of these results for future studies of the macrogenys species group, as well as those of Nialoe, are discussed.

The Relations Among Threatened Species, Their Protection, and Taboos

Directory of Open Access Journals (Sweden)

Johan Colding