Noll, C.; Lee, L.; Torrence, M.
2011-01-01
The International Laser Ranging Service (ILRS) website, http://ilrs.gsfc.nasa.gov, is the central source of information for all aspects of the service. The website provides information on the organization and operation of ILRS and descriptions of ILRS components, data, and products. Furthermore, the website and provides an entry point to the archive of these data and products available through the data centers. Links are provided to extensive information on the ILRS network stations including performance assessments and data quality evaluations. Descriptions of supported satellite missions (current, future, and past) are provided to aid in station acquisition and data analysis. The current format for the ILRS website has been in use since the early years of the service. Starting in 2010, the ILRS Central Bureau began efforts to redesign the look and feel for the website. The update will allow for a review of the contents, ensuring information is current and useful. This poster will detail the proposed design including specific examples of key sections and webpages.
Husson, V. S.; Long, J. L.; Pearlman, M.
2001-12-01
By the end of 2000, 94% of ILRS stations had completed station and site information forms (i.e. site logs). These forms contain six types of information. These six categories include site identifiers, contact information, approximate coordinates, system configuration history, system ranging capabilities, and local survey ties. The ILRS Central Bureau, in conjunction with the ILRS Networks and Engineering Working Group, has developed procedures to quality control site log contents. Part of this verification entails data integrity checks of local site ties and is the primary focus of this paper. Local survey ties are critical to the combination of space geodetic network coordinate solutions (i.e. GPS, SLR, VLBI, DORIS) of the International Terrestrial Reference Frame (ITRF). Approximately 90% of active SLR sites are collocated with at least one other space geodetic technique. The process used to verify these SLR ties, at collocated sites, is identical to the approach used in ITRF2000. Local vectors (X, Y, Z) from each ILRS site log are differenced from its corresponding ITRF2000 position vectors (i.e. no transformations). These X, Y, and Z deltas are converted into North, East, and Up. Any deltas, in any component, larger than 5 millimeter is flagged for investigation. In the absence of ITRF2000 SLR positions, CSR positions were used. To further enhance this comparison and to fill gaps in information, local ties contained in site logs from the other space geodetic services (i.e. IGS, IVS, IDS) were used in addition to ITRF2000 ties. Case studies of two collocated sites (McDonald/Ft. Davis and Hartebeeshtoek) will be explored in-depth. Recommendations on how local site surveys should be conducted and how this information should be managed will also be presented.
International Laser Ranging Service (ILRS): Terms of Reference
Husson, Van; Noll, Carey
2000-01-01
The International Laser Ranging Service (ILRS) is an established Service within Section II , Advanced Space Technology, of the International Association of Geodesy (IAG). The primary objective of the ILRS is to provide a service to support, through Satellite and Lunar Laser Ranging data and related products, geodetic and geophysical research activities as well as International Earth Rotation Service (IERS) products important to the maintenance of an accurate International Terrestrial Reference Frame (ITRF). The service also develops the necessary standards/specifications and encourages international adherence to its conventions.
The ILRS Contribution to ITRF2013
Pavlis, Erricos C.; Luceri, Cinzia; Sciarretta, Cecilia; Evans, Keith
2014-05-01
Satellite Laser Ranging (SLR) data have contributed to the definition of the International Terrestrial Reference Frame (ITRF) over the past three decades. The development of ITRF2005 ushered a new era with the use of weekly or session contributions, allowing greater flexibility in the editing, relative weighting and the combination of information from the four contributing techniques. The new approach allows each Service to generate a solution based on the rigorous combination of the individual Analysis Centers' contributions that provides an opportunity to verify the intra-technique consistency and a comparison of internal procedures and adopted models. The intra- and inter-technique comparisons that the time series approach facilitates are an extremely powerful diagnostic that highlights differences and inconsistencies at the single station level. Over the past year the ILRS Analysis Working Group (AWG) worked on designing an improved ILRS contribution for the development of ITRF2013. The ILRS approach is based on the current IERS Conventions 2010 and our internal ILRS standards, with a few deviations that are documented. Since the Global Geodetic Observing System - GGOS identified the ITRF as its key project, the ILRS has taken a two-pronged approach in order to meet its stringent goals: modernizing the engineering components (ground and space segments), and revising the modeling standards taking advantage of recent improvements in system Earth modeling. The main concern in the case of SLR is monitoring systematic errors at individual stations, accounting for undocumented discontinuities, and improving the target signature models. The latter has been addressed with the adoption of mm-level models for all of our targets. As far as the station systematics, the AWG had already embarked on a major effort to improve the handling of such errors prior to the development of ITRF2008. The results of that effort formed the foundation for the re-examination of the
ILRS Activities in Monitoring Systematic Errors in SLR Data
Pavlis, E. C.; Luceri, V.; Kuzmicz-Cieslak, M.; Bianco, G.
2017-12-01
The International Laser Ranging Service (ILRS) contributes to ITRF development unique information that only Satellite Laser Ranging—SLR is sensitive to: the definition of the origin, and in equal parts with VLBI, the scale of the model. For the development of ITRF2014, the ILRS analysts adopted a revision of the internal standards and procedures in generating our contribution from the eight ILRS Analysis Centers. The improved results for the ILRS components were reflected in the resulting new time series of the ITRF origin and scale, showing insignificant trends and tighter scatter. This effort was further extended after the release of ITRF2014, with the execution of a Pilot Project (PP) in the 2016-2017 timeframe that demonstrated the robust estimation of persistent systematic errors at the millimeter level. ILRS ASC is now turning this into an operational tool to monitor station performance and to generate a history of systematics at each station, to be used with each re-analysis for future ITRF model developments. This is part of a broader ILRS effort to improve the quality control of the data collection process as well as that of our products. To this end, the ILRS has established a "Quality Control Board—QCB" that comprises of members from the analysis and engineering groups, the Central Bureau, and even user groups with special interests. The QCB meets by telecon monthly and oversees the various ongoing projects, develops ideas for new tools and future products. This presentation will focus on the main topic with an update on the results so far, the schedule for the near future and its operational implementation, along with a brief description of upcoming new ILRS products.
ITRF2014 Evaluation with ILRS Data and Products
Pavlis, E. C.; Luceri, V.; Kuzmicz-Cieslak, M.; König, D.; Bianco, G.
2015-12-01
The development and release of the new realization of the International Terrestrial Reference Frame—ITRF2014 requires elaborate testing to ensure the quality of the final product. The evaluation effort ensures that the ITRF is of the indicated quality by its error estimates and the combination has not compromised the contributing techniques' input. The International Laser Ranging Service (ILRS) contributes unique information that only Satellite Laser Ranging—SLR is sensitive to: the definition of the origin, and in equal parts with VLBI, the scale of the model. The ILRS analysts adopted a revision of the internal standards and procedures in developing our contribution to ITRF2014 from our eight Analysis Centers. Anticipating the release of ITRF2014 we worked on designing and executing tests using data and products unique to ILRS. In addition to the data contributed to ITRF2014, ILRS has several other targets, in lower and higher orbits, the SLR tracking data of which are used as independent data for the evaluation process. Since SLR data are primarily sensitive to the origin and scale definition of the TRF model, these model attributes are the best to be validated using SLR data. LAGEOS and ETALON data collected outside the span of data used in ITRF2014 can also evaluate the quality of the estimated velocity vectors. The use of independent SLR data evaluates the model throughout the period that such data are available. SLR data from low altitude missions can validate the performance of the model from the late '70s all the way to present (using e.g. STARLETTE and LARES data). This presentation will give an overview of the new model's evaluation using exclusively ILRS tracking data and other ILRS products.
ILRS: Current Status and Future Challenges
Pearlman, M. R.; Bianco, G.; Merkowitz, S.; Noll, C. E.; Pavlis, E. C.; Shargorodsky, V.; Zhongping, Z.
2016-12-01
The International Laser Ranging Service (ILRS) is expanding its ground tracking capability with new stations and upgrades to current stations. Our Russian colleagues have installed new stations in Brasilia and South Africa, and have several other sites in process or in planning. The NASA Space Geodesy Program is preparing equipment for U.S. sites (McDonald and Haleakala) and with the Norwegian National Mapping Agency in Ny Ålesund; further deployments are planned. Upgrades continue at sites in China, and new sites are underway or planned in Europe and India. Stations are moving to higher repetition rates and more efficient detection to enhance satellite interleaving capability; some stations have already implemented automated processes that could lead to around-the-clock operation to increase temporal coverage and to make more efficient use of personnel. The ILRS roster of supported satellites continues to grow with the addition of the LARES satellite to augment tracking for the improvement of the ITRF. New GNSS constellations and geosynchronous satellites now bring the total roster to over 80 satellites - so much so, that new tracking strategies and time and location multiplexing are under consideration. There continues to be strong interest in Lunar Ranging. New applications of one-way and two-way laser ranging include ps-accurate time transfer, laser transponders for interplanetary ranging, and tracking of space debris. New laser ranging data products are being developed, including satellite orbit products, satellite orientation, gravity field products, and products to characterize the quality of data and station performance. This talk will give a brief summary of recent progress, current challenges and a view of the path ahead.
Directory of Open Access Journals (Sweden)
Young-Rok Kim
2012-09-01
Full Text Available In this study, we present preliminary results of precise orbit determination (POD using satellite laser ranging (SLR observations for International Laser Ranging Service (ILRS Associate Analysis Center (AAC. Using SLR normal point observations of LAGEOS-1, LAGEOS-2, ETALON-1, and ETALON-2, the NASA/GSFC GEODYN II software are utilized for POD. Weekly-based orbit determination strategy is applied to process SLR observations and the post-fit residuals check, and external orbit comparison are performed for orbit accuracy assessment. The root mean square (RMS value of differences between observations and computations after final iteration of estimation process is used for post-fit residuals check. The result of ILRS consolidated prediction format (CPF is used for external orbit comparison. Additionally, we performed the precision analysis of each ILRS station by post-fit residuals. The post-fit residuals results show that the precisions of the orbits of LAGEOS-1 and LAGEOS-2 are 0.9 and 1.3 cm, and those of ETALON-1 and ETALON-2 are 2.5 and 1.9 cm, respectively. The orbit assessment results by ILRS CPF show that the radial accuracies of LAGEOS-1 and LAGEOS-2 are 4.0 cm and 5.3 cm, and the radial accuracies of ETALON-1 and ETALON-2 are 30.7 cm and 7.2 cm. These results of station precision analysis confirm that the result of this study is reasonable to have implications as preliminary results for administrating ILRS AAC.
The isometric log-ratio (ilr)-ion plot: A proposed alternative to the Piper diagram
Shelton, Jenna L.; Engle, Mark A.; Buccianti, Antonella; Blondes, Madalyn S.
2018-01-01
The Piper diagram has been a staple for the analysis of water chemistry data since its introduction in 1944. It was conceived to be a method for water classification, determination of potential water mixing between end-members, and to aid in the identification of chemical reactions controlling a sample set. This study uses the information gleaned over the years since the release of the Piper diagram and proposes an alternative to it, capturing the strengths of the original diagram while adding new ideas to increase its robustness. The new method uses compositional data analysis to create 4 isometric log-ratio coordinates for the 6 major chemical species analyzed in the Piper diagram and transforms the data to a 4-field bi-plot, the ilr-ion plot. This ilr-ion plot conveys all of the information in the Piper diagram (water mixing, water types, and chemical reactions) while also visualizing additional data, the ability to examine Ca2+/Mg2+ versus Cl-/SO42−. The Piper and the ilr-ion plot were also compared using multiple synthetic and real datasets in order to illustrate the caveats and the advantages of using either diagram to analyze water chemistry data. Although there are challenges with using the ilr-ion plot (e.g., missing or zero values zeros in the dataset must be imputed by positive real numbers), it appears that the use of compositional data analysis coupled with the ilr-ion plot provides a more in-depth and complete analysis of water quality data compared to the original Piper diagram.
Precise Orbital and Geodetic Parameter Estimation using SLR Observations for ILRS AAC
Directory of Open Access Journals (Sweden)
Young-Rok Kim
2013-12-01
Full Text Available In this study, we present results of precise orbital geodetic parameter estimation using satellite laser ranging (SLR observations for the International Laser Ranging Service (ILRS associate analysis center (AAC. Using normal point observations of LAGEOS-1, LAGEOS-2, ETALON-1, and ETALON-2 in SLR consolidated laser ranging data format, the NASA/ GSFC GEODYN II and SOLVE software programs were utilized for precise orbit determination (POD and finding solutions of a terrestrial reference frame (TRF and Earth orientation parameters (EOPs. For POD, a weekly-based orbit determination strategy was employed to process SLR observations taken from 20 weeks in 2013. For solutions of TRF and EOPs, loosely constrained scheme was used to integrate POD results of four geodetic SLR satellites. The coordinates of 11 ILRS core sites were determined and daily polar motion and polar motion rates were estimated. The root mean square (RMS value of post-fit residuals was used for orbit quality assessment, and both the stability of TRF and the precision of EOPs by external comparison were analyzed for verification of our solutions. Results of post-fit residuals show that the RMS of the orbits of LAGEOS-1 and LAGEOS-2 are 1.20 and 1.12 cm, and those of ETALON-1 and ETALON-2 are 1.02 and 1.11 cm, respectively. The stability analysis of TRF shows that the mean value of 3D stability of the coordinates of 11 ILRS core sites is 7.0 mm. An external comparison, with respect to International Earth rotation and Reference systems Service (IERS 08 C04 results, shows that standard deviations of polar motion Xp and Yp are 0.754 milliarcseconds (mas and 0.576 mas, respectively. Our results of precise orbital and geodetic parameter estimation are reasonable and help advance research at ILRS AAC.
Aparicio, Frederic; Pallás, Vicente
2017-02-01
During virus infection, specific viral component-host factor interaction elicits the transcriptional reprogramming of diverse cellular pathways. Alfalfa mosaic virus (AMV) can establish a compatible interaction in tobacco and Arabidopsis hosts. We show that the coat protein (CP) of AMV interacts directly with transcription factor (TF) ILR3 of both species. ILR3 is a basic helix-loop-helix (bHLH) family member of TFs, previously proposed to participate in diverse metabolic pathways. ILR3 has been shown to regulate NEET in Arabidopsis, a critical protein in plant development, senescence, iron metabolism and reactive oxygen species (ROS) homeostasis. We show that the AMV CP-ILR3 interaction causes a fraction of this TF to relocate from the nucleus to the nucleolus. ROS, pathogenesis-related protein 1 (PR1) mRNAs, salicylic acid (SA) and jasmonic acid (JA) contents are increased in healthy Arabidopsis loss-of-function ILR3 mutant (ilr3.2) plants, which implicates ILR3 in the regulation of plant defence responses. In AMV-infected wild-type (wt) plants, NEET expression is reduced slightly, but is induced significantly in ilr3.2 mutant plants. Furthermore, the accumulation of SA and JA is induced in Arabidopsis wt-infected plants. AMV infection in ilr3.2 plants increases JA by over 10-fold, and SA is reduced significantly, indicating an antagonist crosstalk effect. The accumulation levels of viral RNAs are decreased significantly in ilr3.2 mutants, but the virus can still systemically invade the plant. The AMV CP-ILR3 interaction may down-regulate a host factor, NEET, leading to the activation of plant hormone responses to obtain a hormonal equilibrium state, where infection remains at a level that does not affect plant viability. © 2016 BSPP AND JOHN WILEY & SONS LTD.
Diagnosis of the nutrient compositional space of fruit crops
Directory of Open Access Journals (Sweden)
Léon-Étienne Parent
2011-03-01
Full Text Available Tissue analysis is a useful tool for the nutrient management of fruit orchards. The mineral composition of diagnostic tissues expressed as nutrient concentration on a dry weight basis has long been used to assess the status of 'pure' nutrients. When nutrients are mixed and interact in plant tissues, their proportions or concentrations change relatively to each other as a result of synergism, antagonism, or neutrality, hence producing resonance within the closed space of tissue composition. Ternary diagrams and nutrient ratios are early representations of interacting nutrients in the compositional space. Dual and multiple interactions were integrated by the Diagnosis and Recommendation Integrated System (DRIS into nutrient indexes and by Compositional Nutrient Diagnosis into centered log ratios (CND-clr. DRIS has some computational flaws such as using a dry matter index that is not a part as well as nutrient products (e.g. NxCa instead of ratios. DRIS and CND-clr integrate all possible nutrient interactions without defining an ad hoc interactive model. They diagnose D components while D-1 could be diagnosed in the D-compositional Hilbert space. The isometric log ratio (ilr coordinates overcome these problems using orthonormal binary nutrient partitions instead of dual ratios. In this study, it is presented a nutrient interactive model as well as computation methods for DRIS and CND-clr and CND-ilr coordinates (CND-ilr using leaf analytical data from an experimental apple orchard in Southwestern Quebec, Canada. It was computed the Aitchison and Mahalanobis distances across ilr coordinates as measures of nutrient imbalance. The effect of changing nutrient concentrations on ilr coordinates are simulated to identify the ones contributing the most to nutrient imbalance.
Make Yourself At Home! Adolescents in Search of the Queer Spaces of Home
Directory of Open Access Journals (Sweden)
Kokkola, Lydia
2014-09-01
Full Text Available Home is often assumed to be a safe place, a place to which children can return after their adventures Away. For many gay and lesbian teens, both fictional and in real life, however, the space they share with their family of origin is not a place where they can feel at home. The heterosexual family home is often so hostile to queerly desiring teens that they are forced to leave in search of a place where they can feel at home. The queer spaces they enter in their search are usually considered risky spaces – public spaces, urban spaces, the bar and the street – unhomely spaces. In these temporary, in-between spaces, the queerly desiring teens in the novels examined in this paper form new family structures. Although all the Anglophone novels discussed in this article end on moments of up-lift and hope for the future, the association of the queerly desiring youngster with risky spaces suggests that the queer teens are themselves unheimlich (uncanny..
The ILRS contribution to ITRF2008
Pavlis, E. C.; Luceri, V.; Sciarretta, C.; Kelm, R.
2009-04-01
Since over two decades, Satellite Laser Ranging (SLR) data contribute to the definition of the Terrestrial Reference Frame (TRF). Until the development of ITRF2000, the contributions were submitted in the form of a set of normal equations or a covariance matrix of station coordinates and their linear rates at a standard epoch. The development of ITRF2005 ushered a new era with the use of weekly or session contributions, allowing greater flexibility in the relative weighting and the combination of information from various techniques. Moreover, the need of a unique, official, representative solution for each Technique Service, based on the rigorous combination of the various Analysis Centers' contributions, gave the opportunity to all techniques to verify, as a first step, the intra-technique solution consistency and, immediately after, to engage in discussions and comparison of the internal procedures, leading to a harmonization and validation of these procedures and the adopted models in the inter-technique context. In many occasions, the time series approach joint with the intra- and inter-technique comparison steps also highlighted differences that previously went unnoticed, and corrected incompatibilities. During the past year we have been preparing the ILRS contribution to a second TRF developed in the same way, the ITRF2008. The ILRS approach is based strictly on the current IERS Conventions 2003 and our internal standards. The Unified Analysis Workshop in 2007 stressed a number of areas where each technique needed to focus more attention in future analyses. In the case of SLR, the primary areas of concern were tracking station biases, extending the data span used in the analysis, and target characteristics. The present re-analysis extends from 1983 to 2008, covering a 25-year period, the longest for any of the contributing techniques; although the network and data quality for the 1983-1993 period are significantly poorer than for the latter years, the overall
24 CFR 982.622 - Manufactured home space rental: Rent to owner.
2010-04-01
..., DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT SECTION 8 TENANT BASED ASSISTANCE: HOUSING CHOICE VOUCHER PROGRAM Special Housing Types Manufactured Home Space Rental § 982.622 Manufactured home space rental: Rent to owner. (a) What is included. (1) Rent to owner for rental of a manufactured home space includes payment...
Maitland, Clover; Stratton, Gareth; Foster, Sarah; Braham, Rebecca; Rosenberg, Michael
2014-12-24
Recent changes in home physical environments, such as decreasing outdoor space and increasing electronic media, may negatively affect health by facilitating sedentariness and reducing physical activity. As children spend much of their time at home they are particularly vulnerable. This study qualitatively explored family perceptions of physical environmental influences on sedentary behaviour and physical activity within the home space. Home based interviews were conducted with 28 families with children aged 9-13 years (total n = 74 individuals), living in Perth, Australia. Families were stratified by socioeconomic status and selected to provide variation in housing. Qualitative methods included a family interview, observation and home tour where families guided the researcher through their home, enabling discussion while in the physical home space. Audio recordings were transcribed verbatim and thematically analysed. Emergent themes related to children's sedentariness and physical activity included overall size, space and design of the home; allocation of home space; equipment within the home space; perceived safety of the home space; and the changing nature of the home space. Families reported that children's activity options were limited when houses and yards were small. In larger homes, multiple indoor living rooms usually housed additional sedentary entertainment options, although parents reported that open plan home layouts could facilitate monitoring of children's electronic media use. Most families reported changing the allocation and contents of their home space in response to changing priorities and circumstances. The physical home environment can enhance or limit opportunities for children's sedentary behaviour and physical activity. However, the home space is a dynamic ecological setting that is amenable to change and is largely shaped by the family living within it, thus differentiating it from other settings. While size and space were considered
Built spaces and features associated with user satisfaction in maternity waiting homes in Malawi.
McIntosh, Nathalie; Gruits, Patricia; Oppel, Eva; Shao, Amie
2018-07-01
To assess satisfaction with maternity waiting home built spaces and features in women who are at risk for underutilizing maternity waiting homes (i.e. residential facilities that temporarily house near-term pregnant mothers close to healthcare facilities that provide obstetrical care). Specifically we wanted to answer the questions: (1) Are built spaces and features associated with maternity waiting home user satisfaction? (2) Can built spaces and features designed to improve hygiene, comfort, privacy and function improve maternity waiting home user satisfaction? And (3) Which built spaces and features are most important for maternity waiting home user satisfaction? A cross-sectional study comparing satisfaction with standard and non-standard maternity waiting home designs. Between December 2016 and February 2017 we surveyed expectant mothers at two maternity waiting homes that differed in their design of built spaces and features. We used bivariate analyses to assess if built spaces and features were associated with satisfaction. We compared ratings of built spaces and features between the two maternity waiting homes using chi-squares and t-tests to assess if design features to improve hygiene, comfort, privacy and function were associated with higher satisfaction. We used exploratory robust regression analysis to examine the relationship between built spaces and features and maternity waiting home satisfaction. Two maternity waiting homes in Malawi, one that incorporated non-standardized design features to improve hygiene, comfort, privacy, and function (Kasungu maternity waiting home) and the other that had a standard maternity waiting home design (Dowa maternity waiting home). 322 expectant mothers at risk for underutilizing maternity waiting homes (i.e. first-time mothers and those with no pregnancy risk factors) who had stayed at the Kasungu or Dowa maternity waiting homes. There were significant differences in ratings of built spaces and features between the
The ILRS Reanalysis 1983 - 2009 Contributed To ITRF2008
Pavlis, E. C.; Luceri, V.; Sciarretta, C.; Kelm, R.
2009-12-01
For over two decades, Satellite Laser Ranging (SLR) data contribute to the definition of the Terrestrial Reference Frame (TRF). Until the development of ITRF2000, the contributions were submitted in the form of a set of normal equations or a covariance matrix of station coordinates and their linear rates at a standard epoch. The development of ITRF2005 ushered a new era with the use of weekly or session contributions, allowing greater flexibility in the relative weighting and the combination of information from various techniques. Moreover, the need of a unique, official, representative solution for each Technique Service, based on the rigorous combination of the various Analysis Centers’ contributions, gave the opportunity to all techniques to verify, as a first step, the intra-technique solution consistency and, immediately after, to engage in discussions and comparison of the internal procedures, leading to a harmonization and validation of these procedures and the adopted models in the inter-technique context. In many occasions, the time series approach joint with the intra- and inter-technique comparison steps also highlighted differences that previously went unnoticed, and corrected incompatibilities. During the past year we have been preparing the ILRS contribution to a second TRF developed in the same way, the ITRF2008. The ILRS approach is based strictly on the current IERS Conventions 2003 and our internal standards. The Unified Analysis Workshop in 2007 stressed a number of areas where each technique needed to focus more attention in future analyses. In the case of SLR, the primary areas of concern were tracking station biases, extending the data span used in the analysis, and target characteristics. The present re-analysis extends from 1983 to 2009, covering a 25-year period, the longest for any of the contributing techniques; although the network and data quality for the 1983-1993 period are significantly poorer than for the latter years, the overall
Problematising public and private work spaces: midwives' work in hospitals and in homes.
Bourgeault, Ivy Lynn; Sutherns, Rebecca; Macdonald, Margaret; Luce, Jacquelyne
2012-10-01
as the boundaries between public and private spaces become increasingly fluid, interest is growing in exploring how those spaces are used as work environments, how professionals both construct and convey themselves in those spaces, and how the lines dividing spaces traditionally along public and private lines are blurred. This paper draws on literature from critical geography, organisational studies, and feminist sociology to interpret the work experiences of midwives in Ontario, Canada who provide maternity care both in hospitals and in clients' homes. qualitative design involving in-depth semi-structured interviews content coded thematically. Ontario, Canada. community midwives who practice at home and in hospital. the accounts of practicing midwives illustrate the ways in which hospital and home work spaces are sites of both compromise and resistance. With the intention of making birthing women feel more `at home', midwives describe how they attempt to recreate the woman's home in the hospital. Similarly, midwives also reorient women's homes to a certain degree into a more standardised work space for home birth attendance. Many midwives also described how they like `guests' in both settings. there seems to be a conscious or unconscious convergence of midwifery work spaces to accommodate Ontario midwives' unique model of practice. we link these findings of midwives' place of work on their experiences as workers to professional work experiences in both public and private spaces and offer suggestions for further exploration of the concept of professionals as guests in their places of work. Copyright © 2012. Published by Elsevier Ltd.
Spanning the Home/Work Creative Space
DEFF Research Database (Denmark)
Davis, Lee N.; Davis, Jerome; Hoisl, Karin
the employee brings to work. Based on Woodman et al.’s (1993) “interactionist perspective” on organizational creativity, supplemented by literature on search and knowledge re/combination, we explore whether and how leisure time activities can span the creative space between the employee’s home and workplace...
The psychology of home environments: a call for research on residential space.
Graham, Lindsay T; Gosling, Samuel D; Travis, Christopher K
2015-05-01
Homes are important: People devote much of their thought, time, and resources to selecting, modifying, and decorating their living spaces, and they may be devastated when their homes must be sold or are destroyed. Yet the empirical psychological literature says virtually nothing about the roles that homes might play in people's lives. We argue that homes provide an informative context for a wide variety of studies examining how social, developmental, cognitive, and other psychological processes play out in a consequential real-world setting. The topic of homes is also well suited to collaborations with a diverse array of disciplines ranging from architecture and engineering to sociology and law. We illustrate the potential insights to be gained from studying homes with an exploratory study that maps the psychological ambiances (e.g., romance, comfort, togetherness) that people desire in their homes; we identify six broad ambiance dimensions (restoration, kinship, storage, stimulation, intimacy, productivity) that show mean differences across rooms. We connect these findings to existing work on situation selection in emotion regulation. These ideas provide only an initial foray into the domain of residential space, but they hint at the productive roles that homes and other spaces could play in psychological theorizing and research. © The Author(s) 2015.
Variability in Measured Space Temperatures in 60 Homes
Energy Technology Data Exchange (ETDEWEB)
Roberts, D.; Lay, K.
2013-03-01
This report discusses the observed variability in indoor space temperature in a set of 60 homes located in Florida, New York, Oregon, and Washington. Temperature data were collected at 15-minute intervals for an entire year, including living room, master bedroom, and outdoor air temperature (Arena, et. al). The data were examined to establish the average living room temperature for the set of homes for the heating and cooling seasons, the variability of living room temperature depending on climate, and the variability of indoor space temperature within the homes. The accuracy of software-based energy analysis depends on the accuracy of input values. Thermostat set point is one of the most influential inputs for building energy simulation. Several industry standards exist that recommend differing default thermostat settings for heating and cooling seasons. These standards were compared to the values calculated for this analysis. The data examined for this report show that there is a definite difference between the climates and that the data do not agree well with any particular standard.
Development of small solid rocket boosters for the ILR-33 sounding rocket
Nowakowski, Pawel; Okninski, Adam; Pakosz, Michal; Cieslinski, Dawid; Bartkowiak, Bartosz; Wolanski, Piotr
2017-09-01
This paper gives an overview of the development of a 6000 Newton-class solid rocket motor for suborbital applications. The design configuration and results of interior ballistics calculations are given. The initial use of the motor as the main propulsion system of the H1 experimental in-flight test platform, within the Polish Small Sounding Rocket Program, is presented. Comparisons of theoretical and experimental performance are shown. Both on-ground and in-flight tests are discussed. A novel composite-case manufacturing technology, which enabled to reach high propellant mass fractions, was validated and significant cost-reductions were achieved. This paper focuses on the process of adapting the design for use as the booster stage of the ILR-33 sounding rocket, under development at the Institute of Aviation in Warsaw, Poland. Parallel use of two of the flight-proven rocket motors along with the main stage is planned. The process of adapting the rocket motor for booster application consists of stage integration, aerothermodynamics and reliability analyses. The separation mechanism and environmental impact are also discussed within this paper. Detailed performance analysis with focus on propellant grain geometry is provided. The evolution of the design since the first flights of the H1 rocket is covered and modifications of the manufacturing process are described. Issues of simultaneous ignition of two motors and their non-identical performance are discussed. Further applications and potential for future development are outlined. The presented results are based on the initial work done by the Rocketry Group of the Warsaw University of Technology Students' Space Association. The continuation of the Polish Small Sounding Rocket Program on a larger scale at the Institute of Aviation proves the value of the outcomes of the initial educational project.
Assessment of private homes as spaces for the dying elderly
Directory of Open Access Journals (Sweden)
Tulika Bhattacharyya
2017-01-01
Full Text Available Aim: This study makes an assessment of end-of-life care of the elderly in private homes in Kolkata, West Bengal, India. Participants and Methods: Primary data were collected from private homes which supported elder care through observation and semi-structured interviews with primary family caregivers of the elderly. Results: The study finds that the major factors preventing private homes from providing adequate care to the elderly were architecturally inadequate housing conditions, paucity of financial support, and scarcity of skilled caregivers. Besides, considerable neglect and domestic abuse of the elderly was also found in some private homes. In addition, the peripheral location of private homes within public health framework and inadequate state palliative policy, including stringent narcotic regulations, accentuated the problems of home care. Conclusion: The study concludes by questioning the rhetoric of private homes as spaces for the dying elderly in Kolkata and suggests remedial measures to improve their capacity to deliver care.
Spanning the Creative Space between Home and Work
DEFF Research Database (Denmark)
Davis, Lee N.; Hoisl, Karin; Davis, Jerome
the employee brings to work. Based on Woodman et al.’s (1993) “interactionist perspective” on organizational creativity, supplemented by literature on search and knowledge/combination, we explore whether leisure time activities can span the creative space between the employee’s home and workplace – given...
24 CFR 982.623 - Manufactured home space rental: Housing assistance payment.
2010-04-01
... amortization cost may include debt service to amortize cost (other than furniture costs) included in the... amortize the cost of furniture, unless the PHA determines that furniture was not included in the purchase...) There is a separate fair market rent for a manufactured home space. The FMR for a manufactured home...
Play as Third Space between Home and School: Bridging Cultural Discourses
Yahya, Raudhah; Wood, Elizabeth Ann
2017-01-01
This article examines play as a conceptual third space that serves as a bridge between home and school discourses. Using sociocultural theories and an interpretivist framework, 19 immigrant mothers and their children in Canada were interviewed about their play experiences at home and in preschools. The findings reveal that children and teachers…
Travellers and Home Education: Safe Spaces and Inequality
D'Arcy, Kate
2014-01-01
Elective home education (EHE) is a legal alternative to school in England but the statutory requirements for provision are remarkably vague. This book explores the use of EHE by Gypsy and Traveller families. The accounts of their experiences and their views about education spaces reveal the racism and discrimination their children encounter in…
Projecting Homes: Domestic Spaces in Three Filipino Films
Directory of Open Access Journals (Sweden)
Tito R. Quiling Jr.
2013-12-01
Full Text Available The house is a fundamental space for a character’s consciousness, and this structure is a familiar image in Filipino f ilms. This particular space as a setting in which the narrative and the characters are able to move in, is essential. This paper analyzes the influence of domestic spaces and the characteristics of home, which correspond to the characters’ consciousness and the narrative. These are presented in the selected films: Oro, Plata, Mata (1982 by Peque Gallaga, “Hellow, Soldier,” the second episode in Lino Brocka’s Tatlo, Dalawa, Isa (1975, and Kisapmata (1981 by Mike De Leon. The method for assessment consists of three parts: (1 the background in which the films are set, (2 the influence of the house using Gaston Bachelard’s notion of the house in The Poetics of Space (1994 as a framework, (3 and the behavior of the characters as portrayed in the films. The significance of domestic spaces to a character’s experience is illustrated in the selected texts.
Development of space technologies and problems of “home medicine”
Directory of Open Access Journals (Sweden)
Roman M. Baevsky
2015-05-01
Full Text Available Experience of cosmonauts’ health monitoring shows that in the study of healthy subjects clinical approach to the evaluation of various medical and physiological data is almost less effective than the evaluation of organism adaptive abilities. The idea of prenosological diagnosis and the concept of adaptive risks develop in space medicine last years. These new space technologies are being actively tested in terrestrial studies in systems as "home medicine". The report presents three variants of systems, respectively, designed to work with a home PC ("Ecosan-2007" and "Ecosan-TM", b Internet connections ("Delta 2013", c mobile communication channels ("Traffic Lights of Health". The main method of functional conditions evaluation in all these systems is the heart rate variability (HRV analysis. HRV indices allow us to construct a mathematical model and to compute the stress degree of regulatory systems, their functional reserve and adaptive risk.
At Home in Space The Late Seventies into the Eighties
Evans, Ben
2012-01-01
April 12, 2011, is the 50th anniversary of Yuri Gagarin's pioneering journey into space. To commemorate this momentous achievement, Springer-Praxis is producing a mini series of books that reveals how humanity's knowledge of flying, working, and living in space has grown in the last half century. At Home in Space, the third book in the series, continues the story throughout the later Seventies and into the Eighties. It was a period of time characterised by great promise. Regular Soviet missions demonstrated that humanity could not only survive, but thrive, in a weightless environment, and the arrival of the Space Shuttle seemed to offer a more economical and routine means of accessing the heavens. Living in space became truly international as astronauts from many nations lived and worked together on Soviet space stations and aboard the Shuttle. At the same time, however, relations between two key players in this drive to conquer the high ground of space - the United States and the Soviet Union - steadily decl...
A state-space model for estimating detailed movements and home range from acoustic receiver data
DEFF Research Database (Denmark)
Pedersen, Martin Wæver; Weng, Kevin
2013-01-01
We present a state-space model for acoustic receiver data to estimate detailed movement and home range of individual fish while accounting for spatial bias. An integral part of the approach is the detection function, which models the probability of logging tag transmissions as a function of dista......We present a state-space model for acoustic receiver data to estimate detailed movement and home range of individual fish while accounting for spatial bias. An integral part of the approach is the detection function, which models the probability of logging tag transmissions as a function...... that the location error scales log-linearly with detection range and movement speed. This result can be used as guideline for designing network layout when species movement capacity and acoustic environment are known or can be estimated prior to network deployment. Finally, as an example, the state-space model...... is used to estimate home range and movement of a reef fish in the Pacific Ocean....
Space use of wintering waterbirds in India: Influence of trophic ecology on home-range size
Namgail, Tsewang; Takekawa, John Y.; Balachandran, Sivananinthaperumal; Sathiyaselvam, Ponnusamy; Mundkur, Taej; Newman, Scott H.
2014-01-01
Relationship between species' home range and their other biological traits remains poorly understood, especially in migratory birds due to the difficulty associated with tracking them. Advances in satellite telemetry and remote sensing techniques have proved instrumental in overcoming such challenges. We studied the space use of migratory ducks through satellite telemetry with an objective of understanding the influence of body mass and feeding habits on their home-range sizes. We marked 26 individuals, representing five species of migratory ducks, with satellite transmitters during two consecutive winters in three Indian states. We used kernel methods to estimate home ranges and core use areas of these waterfowl, and assessed the influence of body mass and feeding habits on home-range size. Feeding habits influenced the home-range size of the migratory ducks. Carnivorous ducks had the largest home ranges, herbivorous ducks the smallest, while omnivorous species had intermediate home-ranges. Body mass did not explain variation in home-range size. To our knowledge, this is the first study of its kind on migratory ducks, and it has important implications for their conservation and management.
More Than Four Walls: The Meaning of Home in Home Birth Experiences
Directory of Open Access Journals (Sweden)
Emily Burns
2015-04-01
Full Text Available The “home versus hospital” as places of birth debate has had a long and at times vicious history. From academic literature to media coverage, the two have often been pitted against each other not only as opposing physical spaces, but also as opposing ideologies of birth. The hospital has been heavily critiqued as a site of childbirth since the 1960s, with particular focus on childbirth and medicalisation. The focus of much of the hospital and home birthing research exists on a continuum of medicalisation, safety, risk, agency, and maternal and neonatal health and wellbeing. While the hospital birthing space has been interrogated, a critique of home birthing space has remained largely absent from the social sciences. The research presented in this article unpacks the complex relationship between home birthing women and the spaces in which they birth. Using qualitative data collected with 59 home birthing women in Australia in 2010, between childbearing and the home should not be considered as merely an alternative to hospital births, but rather as an experience that completely renegotiates the home space. Home, for the participants in this study, is a dynamic, changing, and even spiritual element in the childbirth experience, and not simply the building in which it occurs.
Jones, Malia; Pebley, Anne R
2014-06-01
Research on neighborhood effects has focused largely on residential neighborhoods, but people are exposed to many other places in the course of their daily lives-at school, at work, when shopping, and so on. Thus, studies of residential neighborhoods consider only a subset of the social-spatial environment affecting individuals. In this article, we examine the characteristics of adults' "activity spaces"-spaces defined by locations that individuals visit regularly-in Los Angeles County, California. Using geographic information system (GIS) methods, we define activity spaces in two ways and estimate their socioeconomic characteristics. Our research has two goals. First, we determine whether residential neighborhoods represent the social conditions to which adults are exposed in the course of their regular activities. Second, we evaluate whether particular groups are exposed to a broader or narrower range of social contexts in the course of their daily activities. We find that activity spaces are substantially more heterogeneous in terms of key social characteristics, compared to residential neighborhoods. However, the characteristics of both home neighborhoods and activity spaces are closely associated with individual characteristics. Our results suggest that most people experience substantial segregation across the range of spaces in their daily lives, not just at home.
MASS OUTFLOW IN THE SEYFERT 1 GALAXY NGC 5548
International Nuclear Information System (INIS)
Crenshaw, D. M.; Kraemer, S. B.; Schmitt, H. R.; Kaastra, J. S.; Arav, N.; Gabel, J. R.; Korista, K. T.
2009-01-01
We present a study of the intrinsic UV absorption and emission lines in an historically low-state spectrum of the Seyfert 1 galaxy NGC 5548, which we obtained in 2004 February at high spatial and spectral resolution with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. We isolate a component of emission with a width of 680 km s -1 that arises from an 'intermediate-line region' (ILR), similar to that we discovered in NGC 4151, at a distance of ∼1 pc from the central continuum source. From a detailed analysis of the five intrinsic absorption components in NGC 5548 and their behavior over a span of eight years, we present evidence that most of the UV absorbers only partially cover the ILR and do not cover an extended region of UV continuum emission, most likely from hot stars in the circumnuclear region. We also find that four of the UV absorbers are at much greater distances (greater than 70 pc) than the ILR, and none have sufficient N V or C IV column densities to be the ILR in absorption. At least a portion of the UV absorption component 3, at a radial velocity of -530 km s -1 , is likely responsible for most of the X-ray absorption, at a distance less than 7 pc from the central source. The fact that we see the ILR in absorption in NGC 4151 and not in NGC 5548 suggests that the ILR is located at a relatively large polar angle (∼45 deg.) with respect to the narrow-line region outflow axis.
SpaceScience@Home: Authentic Research Projects that Use Citizen Scientists
Méndez, B. J. H.
2008-06-01
In recent years, several space science research projects have enlisted the help of large numbers of non-professional volunteers, ``citizen scientists'', to aid in performing tasks that are critical to a project, but require more person-time (or computing time) than a small professional research team can practically perform themselves. Examples of such projects include SETI@home, which uses time from volunteers computers to process radio-telescope observation looking for signals originating from extra-terrestrial intelligences; Clickworkers, which asks volunteers to review images of the surface of Mars to identify craters; Spacewatch, which used volunteers to review astronomical telescopic images of the sky to identify streaks made by possible Near Earth Asteroids; and Stardust@home, which asks volunteers to review ``focus movies'' taken of the Stardust interstellar dust aerogel collector to search for possible impacts from interstellar dust particles. We shall describe these and other similar projects and discuss lessons learned from carrying out such projects, including the educational opportunities they create.
Graham, Megan E; Fabricius, Andréa
2017-11-01
This study examined the benefits of expanding upon the "home-like" design by introducing an immersive creative space for residents, staff, and visitors to explore in a long-term care facility in Eastern Ontario, Canada. Data were collected through guestbook comments ( N = 93) and coded for themes according to guidelines for thematic analysis. Selected themes included visitors' enjoyment of the winter aesthetic, expressions of gratitude to the artists, time spent socializing with family and visitors in a creative milieu, and the experience of remembering in an evocative space. The results indicate that residents and visitors benefited from the experience of a creative space that was neither institutional, nor "home-like." Implications for future research are discussed.
Tolley, D. G., III; Foglia, L.; Harter, T.
2017-12-01
Late summer and early fall streamflow decreases caused by climate change and agricultural pumping contribute to increased water temperatures and result in large disconnected sections during dry years in many semi-arid regions with Mediterranean climate. This negatively impacts aquatic habitat of fish species such as coho and fall-run Chinook salmon. In collaboration with local stakeholders, the Scott Valley Integrated Hydrologic Model (SVIHMv3) was developed to assess future water management scenarios with the goal of improving aquatic species habitat while maintaining agricultural production in the valley. The Null Space Monte Carlo (NSMC) method available in PEST was used to quantify the range of predicted streamflow changes for three conjunctive use scenarios: 1) managed aquifer recharge (MAR), 2) in lieu recharge (ILR, substituting surface-water irrigation for irrigation with groundwater while flows are available), and 3) MAR + ILR. Random parameter sets were generated using the calibrated covariance matrix of the model, which were then recalibrated if the sum of squared residuals was greater than 10% of the original sum of squared weighted residuals. These calibration-constrained stochastic parameter sets were then used to obtain a distribution of streamflow changes resulting from implementing the conjunctive use scenarios. Preliminary results show that while the range of streamflow increases using managed aquifer recharge is much narrower (i.e., greater degree of certainty) than in lieu recharge, there are potentially much greater benefits to streamflow by implementing in lieu recharge (although also greater costs). Combining the two scenarios provides the greatest benefit for increasing late summer and early fall streamflow, as most of the MAR streamflow increases are during the spring and early summer which ILR is able to take advantage of. Incorporation of uncertainty into model predictions is critical for establishing and maintaining stakeholder trust
A phylogenetic transform enhances analysis of compositional microbiota data.
Silverman, Justin D; Washburne, Alex D; Mukherjee, Sayan; David, Lawrence A
2017-02-15
Surveys of microbial communities (microbiota), typically measured as relative abundance of species, have illustrated the importance of these communities in human health and disease. Yet, statistical artifacts commonly plague the analysis of relative abundance data. Here, we introduce the PhILR transform, which incorporates microbial evolutionary models with the isometric log-ratio transform to allow off-the-shelf statistical tools to be safely applied to microbiota surveys. We demonstrate that analyses of community-level structure can be applied to PhILR transformed data with performance on benchmarks rivaling or surpassing standard tools. Additionally, by decomposing distance in the PhILR transformed space, we identified neighboring clades that may have adapted to distinct human body sites. Decomposing variance revealed that covariation of bacterial clades within human body sites increases with phylogenetic relatedness. Together, these findings illustrate how the PhILR transform combines statistical and phylogenetic models to overcome compositional data challenges and enable evolutionary insights relevant to microbial communities.
Monitoring of arrhythmia and sudden death in a hemodialysis population: The CRASH-ILR Study.
Directory of Open Access Journals (Sweden)
Paul R Roberts
Full Text Available It has been suggested that sudden cardiac death (SCD contributes around 50% of cardiovascular and 27% of all-cause mortality in hemodialysis patients. The true burden of arrhythmias and arrhythmic deaths in this population, however, remains poorly characterised. Cardio Renal Arrhythmia Study in Hemodialysis (CRASH-ILR is a prospective, implantable loop recorder single centre study of 30 established hemodialysis patients and one of the first to provide long-term ambulatory ECG monitoring.30 patients (60% male aged 68±12 years receiving hemodialysis for 45±40 months with varied etiology (diabetes 37%, hypertension 23% and left ventricular ejection fraction (LVEF 55±8% received a Reveal XT implantable loop recorder (Medtronic, USA between August 2011 and October 2014. ECG data from loop recorders were transmitted at each hemodialysis session using a remote monitoring system. Primary outcome was SCD or implantation of a (tachy or bradyarrhythmia controlling device and secondary outcome, the development of arrhythmia necessitating medical intervention.During 379,512 hours of continuous ECG monitoring (mean 12,648±9,024 hours/patient, there were 8 deaths-2 SCD and 6 due to generalised deterioration/sepsis. 5 (20% patients had a primary outcome event (2 SCD, 3 pacemaker implantations for bradyarrhythmia. 10 (33% patients reached an arrhythmic primary or secondary end point. Median event free survival for any arrhythmia was 2.6 years (95% confidence intervals 1.6-3.6 years.The findings confirm the high mortality rate seen in hemodialysis populations and contrary to initial expectations, bradyarrhythmias emerged as a common and potentially significant arrhythmic event.
Institute of Scientific and Technical Information of China (English)
Yin Pumin
2011-01-01
CHINA'S first unmanned space module Tiangong-1,or Heavenly Palace-1,successfully lifted off from the Jiuquan Satellite Launch Center in northwest China's Gansu Province on September 29."The successfullaunch of the 8.5-ton prototype space laboratory has opened the gates for China's deep space exploration program," said Qi Faren,former chief designer of China's Shenzhou spacecraft."It is a decisive leap forward for the Chinese space industry and will bring about the rapid development of space science and related technologies."
DEFF Research Database (Denmark)
Møller, Kristian; Klausen, Maja
2018-01-01
The chapter draw from critical mediatization theory, critical intimacy theory, and cultural gerontology and asks: How do elderly people practice their mediatized homes? Which roles do media play in constituting and disturbing the flows of bodies into the home? Moreover: how do dominant...... in the making of the mediatized home space. We conclude by returning to the research questions and making explicit how researching flows of bodies that in many ways inhabit homes of the in-between contributes to both gerontological and geomediatization research agendas....
HomeSpace:Maputo Dwelling Processes in ten Rapidly Expanding Peri-Urban Areas of an African City
DEFF Research Database (Denmark)
Eskemose Andersen, Jørgen; Sollien, Silje Erøy; Costa, Ana Bénard da
2013-01-01
This chapter deals with key concepts and preliminary findings of the ressearch programme "Home Space-Meanings and perceptions of the built envioment in Peri-urban Maputo, Mozambique." The Programme examines the nature of emerging forms of "urbanism as a way of Life" in a rapidly urbanizing African...
DOE Zero Energy Ready Home Case Study: Thrive Home Builders, Lowry Plan
Energy Technology Data Exchange (ETDEWEB)
Pacific Northwest National Laboratory
2017-09-01
Thrive Home Builders built this 4,119-ft2 home at the Lowry development in Denver, Colorado, to the high-performance criteria of the U.S. Department of Energy’s Zero Energy Ready Home Program. Despite the dense positioning of the homes, mono-plane roof designs afforded plenty of space for the 8.68 kW of photovoltaic panels. With the PV, the home achieves a Home Energy Rating System (HERS) score of 4 and the home owners should enjoy energy bills of about $-11 a year. Without the PV, the home would score a HERS 38 (far lower than the HERS 80 to 100 of typical new homes).
Tactics for homing in mobile life
DEFF Research Database (Denmark)
Petersen, Marianne Graves; Lynggard, Aviaja Borup; Krogh, Peter Gall
2010-01-01
For many people home making is an activity, which extends beyond a single house. We introduce the terminology of Homing as the act of home making, when in a primary home, secondary home or more temporary spaces. By point of departure in existing literature on home making and through ethnographic...
Public Support As A Center Of Gravity For National Space Power
2014-04-01
Advisors: Doctor Dale Hayden Lieutenant Colonel David Hanson Major Mark Ciesel Major Carrie Chappell Maxwell Air Force Base, Alabama...2011. Wechsler , Jill. The Role of GPS in Precise Time and Frequency Dissemination. 1990. http://ilrs.gsfc.nasa.gov/docs/timing/gpsrole.pdf
Directory of Open Access Journals (Sweden)
Daniel J. Louw
2017-04-01
Full Text Available The classical definition of theology is ‘faith-seeking understanding’ (fides quaerens intellectum. The focus is on the understanding/interpretation of the object of Christian faith: God. There is another root for the quest for understanding, namely the praxis situation of faith. People live in particular historical contexts that have their own distinctive problems and possibilities; thus, the focus on place and space in a theology of home. A praxis approach is to learn life and the gospel from below, thus the emphasis on a grassroots ecclesiology that is structured like an oikos, a familial dwelling place. This understanding of the dynamics of the fellowship of believers as oikodomein is captured by the Zulu notion for the yearning for home (home sickness: Ekhaya. It is argued that Ekhaya thinking is an alternative route for an operative ecclesiology that caters for the need of marginalised, oppressed, displaced and homeless people. Practical theology is thus described as fides quaerens domum et locum [faith-seeking home and place], namely to inhabit. An Ekhaya approach to practical theological ecclesiology is about critical reflection through the eyes of those who are weak and who don’t count for much by the standards of successful people and institutions.
Dane, Gamze; Arentze, Theo A.; Timmermans, Harry J P; Ettema, Dick
2015-01-01
Monetary budgets influence activity participation and related travel as they demarcate limits on how people organize their activities in time and space. In this paper, we are interested in money allocation to out-of-home leisure activities and how this is affected by duration, sociodemographics, and
Intramuscular leukemic relapse: clinical signs and imaging findings. A multicentric analysis
Energy Technology Data Exchange (ETDEWEB)
Surov, Alexey [Martin Luther University Halle-Wittenberg, Department of Radiology, Halle (Germany); University of Leipzig, Department of Diagnostic and Interventional Radiology, Leipzig (Germany); Kiratli, Hayyam [Hacettepe University School of Medicine, Department of Ophthalmology, Ankara (Turkey); Im, Soo Ah [Seoul St. Mary' s Hospital, Department of Radiology, Seoul (Korea, Republic of); Manabe, Yasuhiro [National Hospital Organization Okayama Medical Center, Department of Neurology, Okayama (Japan); O' Neill, Alibhe; Shinagare, Atul B. [Brigham and Women' s Hospital, Department of Radiology, Boston, MA (United States); Spielmann, Rolf Peter [Martin Luther University Halle-Wittenberg, Department of Radiology, Halle (Germany)
2014-09-26
Leukemia is a group of malignant diseases involving peripheral blood and bone marrow. Extramedullary tumor manifestation in leukemia can also occur. They more often involve lymph nodes, skin, and bones. Intramuscular leukemic relapse (ILR) is very unusual. The aim of this analysis was to summarize the reported data regarding clinical signs and radiological features of ILR. The PubMed database was searched for publications related to ILR. After an analysis of all identified articles, 20 publications matched the inclusion criteria. The authors of the 20 publications were contacted and provided imaging of their cases for review. The following were recorded: age, gender, primary diagnosis, clinical signs, pattern, localization and size of the intramuscular leukemic relapse. Images of 16 patients were provided [8 computer tomographic (CT) images and 15 magnetic resonance images, MRI]. Furthermore, one patient with ILR was identified in our institutional database. Therefore, images of 17 patients were available for further analysis. Overall, 32 cases with ILR were included in the analysis. In most cases acute myeloid leukemia was diagnosed. Most ILRs were localized in the extremities (44 %) and in the extraocular muscles (44 %). Clinically, ILR manifested as local pain, swelling and muscle weakness. Radiologically, ILR presented most frequently with diffuse muscle infiltration. On postcontrast CT/MRI, most lesions demonstrated homogeneous enhancement. ILRs were hypo-/isointense on T1w and hyperintense on T2w images. ILR manifests commonly as focal pain, swelling and muscle weakness. ILR predominantly involved the extraocular musculature and the extremities. Radiologically, diffuse muscle infiltration was the most common imaging finding. (orig.)
Getting to know patients’ lived space
DEFF Research Database (Denmark)
Norlyk, Annelise; Martinsen, Bente; Dahlberg, Karen
2013-01-01
.g. the role of the good patient and the ambiance of hospitals. Home, on the other hand, offers familiar lived space in which patients feel protected and safe. Further, the paper relates patients’ experience of lived space to a phenomenological view of lived space in order to illustrate the radical influence...... as a theoretical framework for an excursive analysis. The paper demonstrates that existential dimensions of lived space at the hospital and at home differ significantly. For the patients, the hospital space means alien territory as opposed to the familiar territory of home. To some extent the experienced...
Crutchley, Jody
2015-01-01
This article explores the experiences of teachers who participated in the League of the Empire's "Interchange of Home and Dominion Teachers" scheme through a tripartite approach to "British World" space. First, it identifies the mechanisms through which exchanges were established. It analyses the patterns of teacher mobility…
Directory of Open Access Journals (Sweden)
M. D. Rijnaard
2016-01-01
Full Text Available Purpose. To provide an overview of factors influencing the sense of home of older adults residing in the nursing home. Methods. A systematic review was conducted. Inclusion criteria were (1 original and peer-reviewed research, (2 qualitative, quantitative, or mixed methods research, (3 research about nursing home residents (or similar type of housing, and (4 research on the sense of home, meaning of home, at-homeness, or homelikeness. Results. Seventeen mainly qualitative articles were included. The sense of home of nursing home residents is influenced by 15 factors, divided into three themes: (1 psychological factors (sense of acknowledgement, preservation of one’s habits and values, autonomy and control, and coping; (2 social factors (interaction and relationship with staff, residents, family and friends, and pets and activities; and (3 the built environment (private space and (quasi-public space, personal belongings, technology, look and feel, and the outdoors and location. Conclusions. The sense of home is influenced by numerous factors related to the psychology of the residents and the social and built environmental contexts. Further research is needed to determine if and how the identified factors are interrelated, if perspectives of various stakeholders involved differ, and how the factors can be improved in practice.
Ten years of SLR production in Argentina
Pacheco, A.; Podestá, R.; Yin, Z.; Liu, W.; Actis, E.; Adarvez, S.; Quinteros, J.; Podestá, F.
2017-07-01
SLR technique is a proved astro-geodetic art with a significant power to contribute to Earth and Space Sciences. Therefore, scientific applications of SLR System are able to perform multiple tasks in the fields of Astrometry, Geodesy and Geophysics. The results we show here were obtained from satellite observations made at SLR 7406 Station of Observatorio Astronómico Félix Aguilar (OAFA) in San Juan, Argentina. The telescope was installed early on 2006, in concordance with an International Cooperation Agreement between Universidad Nacional de San Juan, Argentina and Chinese Academy of Sciences. In this abstract we show the current research being done with ILRS 7406 station: Length of day (LOD) and Angular velocity of Earth Rotation, calculated weekly; Pole Motion. ILRS7406 is daily surveying Pole coordinates x and y; Tracking SLR to GNSS constellations. SLR System contributes to the adjustment and validation of satellite GALILEO, GPS, GLONASS, and BEIDOU orbits. Our station is nowadays member of the new ITRF 2014 frame, and these past years has been one of the 3 highest producing SLR Stations on the ILRS net, composed of about 40 stations distributed all around the world. The obtained results during this first 10 years of experience are useful to enhance the traditional collaboration between OAFA and international services such as ILRS, IERS and NASA.
Braham, Melissa A.; Miller, Tricia A.; Duerr, Adam E.; Lanzone, Michael J.; Fesnock, Amy; LaPre, Larry; Driscoll, Daniel; Katzner, Todd E.
2015-01-01
Renewable energy is expanding quickly with sometimes dramatic impacts to species and ecosystems. To understand the degree to which sensitive species may be impacted by renewable energy projects, it is informative to know how much space individuals use and how that space may overlap with planned development. We used global positioning system–global system for mobile communications (GPS-GSM) telemetry to measure year-round movements of golden eagles (Aquila chrysaetos) from the Mojave Desert of California, USA. We estimated monthly space use with adaptive local convex hulls to identify the temporal and spatial scales at which eagles may encounter renewable energy projects in the Desert Renewable Energy Conservation Plan area. Mean size of home ranges was lowest and least variable from November through January and greatest in February–March and May–August. These monthly home range patterns coincided with seasonal variation in breeding ecology, habitat associations, and temperature. The expanded home ranges in hot summer months included movements to cooler, prey-dense, mountainous areas characterized by forest, grasslands, and scrublands. Breeding-season home ranges (October–May) included more lowland semi-desert and rock vegetation. Overlap of eagle home ranges and focus areas for renewable energy development was greatest when eagle home ranges were smallest, during the breeding season. Golden eagles in the Mojave Desert used more space and a wider range of habitat types than expected and renewable energy projects could affect a larger section of the regional population than was previously thought.
Meanings of the Home and Living
Directory of Open Access Journals (Sweden)
Verônica Gonçalves Azeredo
2016-10-01
Full Text Available This study aims at making considerations about what homes mean to their residents, an an approach related to the socio-cultural processes underlying its spatiality. The article is essentially theoretical and based on the literature. Following this methodology, the research was conducted in order to explore ethnographic sources focused on the anthropology of space. Reflections were guided by the notion of homes as well as the relations established in them, with emphasis on the intersection between the territorial, architectural, cultural, sociodemographic and psychological aspects. In addition to conceptual abstractions, the investigation aims to understand the meaning of and in space, the importance of homes, and the relationships established between them and their residents.
Integration of space geodesy: A US National Geodetic Observatory
Yunck, Thomas P.; Neilan, Ruth E.
2005-11-01
In the interest of improving the performance and efficiency of space geodesy a diverse group in the US, in collaboration with IGGOS, has begun to establish a unified National Geodetic Observatory (NGO). To launch this effort an international team will conduct a multi-year program of research into the technical issues of integrating SLR, VLBI, and GPS geodesy to produce a unified set of global geodetic products. The goal is to improve measurement accuracy by up to an order of magnitude while lowering the cost to current sponsors. A secondary goal is to expand and diversify international sponsorship of space geodesy. Principal benefits will be to open new vistas of research in geodynamics and surface change while freeing scarce NASA funds for scientific studies. NGO will proceed in partnership with, and under the auspices of, the International Association of Geodesy (IAG) as an element of the Integrated Global Geodetic Observation System project. The collaboration will be conducted within, and will make full use of, the IAG's existing international services: the IGS, IVS, ILRS, and IERS. Seed funding for organizational activities and technical analysis will come from NASA's Solid Earth and Natural Hazards Program. Additional funds to develop an integrated geodetic data system known as Inter-service Data Integration for Geodetic Operations (INDIGO), will come from a separate NASA program in Earth science information technology. INDIGO will offer ready access to the full variety of NASA's space geodetic data and will extend the GPS Seamless Archive (GSAC) philosophy to all space geodetic data types.
Study Of Lampungnese Traditional Home Garden Design
Pratiwi, R. A.; Gunawan
2017-10-01
Lampung is one area in Indonesia which has a traditional culture that comes from two groups of descents, they are ulun Lampung Pepadun and ulun Lampung Saibatin. Lampungnese traditional culture has been well-known by Indonesian people for its traditional dances, traditional clothing, or traditional home architecture. However, Lampungnese traditional home garden recently may not yet been described. Information related to Lampungnese traditional home garden is still very limited and it does not yet represented the culture based design concept. This research was directed to identify the elements of the home garden and map it into design concept of the Lampungnese traditional home garden based on information of Lampungnese traditional culture. The study was conducted by using descriptive approach through literature review, interviews and cultural exploration, as well as field observation. The study was able to identify the elements forming the Lampungnese traditional home garden, namely gakhang hadap, walai, outdoor kitchenette, firewood place, outdoor kitchen, livestock barns, as well as plants. Space layout of the home garden comprises front yard (tengahbah/terambah/beruan), side yard (kebik/kakebik), and backyard (kudan/juyu/kebon). Each element of the garden is located in the right place of the space layout.
HOMES - Holographic Optical Method for Exoplanet Spectroscopy
National Aeronautics and Space Administration — HOMES (Holographic Optical Method for Exoplanet Spectroscopy) is a space telescope that employs a double dispersion architecture, using a holographic optical element...
Directory of Open Access Journals (Sweden)
Rowland Atkinson
2008-12-01
Full Text Available The home is not only a place of physical refuge from the elements and unwanted intruders. It is also a refuge from unwanted sound, a place where we can enjoy calm spaces that permit quiet reflection. Our homes, as discrete and personally modifiable micro-soundscapes, offer a kind of environmental nourishment to us as social beings. Noise in the home – from neighbours, roads, airports, air conditioners, parties – unsettles our sense of control, autonomy and authorship over what is our primary territorial domain.
First laser measurements to space debris in Poland
Lejba, Paweł; Suchodolski, Tomasz; Michałek, Piotr; Bartoszak, Jacek; Schillak, Stanisław; Zapaśnik, Stanisław
2018-05-01
The Borowiec Satellite Laser Ranging station (BORL 7811, Borowiec) being a part of the Space Research Centre of the Polish Academy of Sciences (SRC PAS) went through modernization in 2014-2015. One of the main tasks of the modernization was the installation of a high-energy laser module dedicated to space debris tracking. Surelite III by Continuum is a Nd:YAG pulse laser with 10 Hz repetition rate, a pulse width of 3-5 ns and a pulse energy of 450 mJ for green (532 nm). This new laser unit was integrated with the SLR system at Borowiec performing standard satellite tracking. In 2016 BORL 7811 participated actively to the observational campaigns related to the space debris targets from LEO region managed by the Space Debris Study Group (SDSG) of the International Laser Ranging Service (ILRS). Currently, Borowiec station regularly tracks 36 space debris from the LEO regime, including typical rocket bodies (Russian/Chinese) and cooperative targets like the inactive TOPEX/Poseidon, ENVISAT, OICETS and others. In this paper the first results of space debris laser measurements obtained by the Borowiec station in period August 2016 - January 2017 are presented. The results gained by the SRC PAS Borowiec station confirm the rotation of the defunct TOPEX/Poseidon satellite which spins with a period of approximately 10 s. The novelty of this work is the presentation of the sample results of the Chinese CZ-2C R/B target (NORAD catalogue number 31114) which is equipped (probably) with retroreflectors. Laser measurements to space debris is a very desirable topic for the next years, especially in the context of the Space Surveillance and Tracking (SST) activity. Some targets are very easy to track like defunct ENVISAT or TOPEX/Poseidon. On the other hand, there is a big population of different LEO targets with different orbital and physical parameters, which are challenging for laser ranging like small irregular debris and rocket boosters.
Movement is the glue connecting home ranges and habitat selection.
Van Moorter, Bram; Rolandsen, Christer M; Basille, Mathieu; Gaillard, Jean-Michel
2016-01-01
Animal space use has been studied by focusing either on geographic (e.g. home ranges, species' distribution) or on environmental (e.g. habitat use and selection) space. However, all patterns of space use emerge from individual movements, which are the primary means by which animals change their environment. Individuals increase their use of a given area by adjusting two key movement components: the duration of their visit and/or the frequency of revisits. Thus, in spatially heterogeneous environments, animals exploit known, high-quality resource areas by increasing their residence time (RT) in and/or decreasing their time to return (TtoR) to these areas. We expected that spatial variation in these two movement properties should lead to observed patterns of space use in both geographic and environmental spaces. We derived a set of nine predictions linking spatial distribution of movement properties to emerging space-use patterns. We predicted that, at a given scale, high variation in RT and TtoR among habitats leads to strong habitat selection and that long RT and short TtoR result in a small home range size. We tested these predictions using moose (Alces alces) GPS tracking data. We first modelled the relationship between landscape characteristics and movement properties. Then, we investigated how the spatial distribution of predicted movement properties (i.e. spatial autocorrelation, mean, and variance of RT and TtoR) influences home range size and hierarchical habitat selection. In landscapes with high spatial autocorrelation of RT and TtoR, a high variation in both RT and TtoR occurred in home ranges. As expected, home range location was highly selective in such landscapes (i.e. second-order habitat selection); RT was higher and TtoR lower within the selected home range than outside, and moose home ranges were small. Within home ranges, a higher variation in both RT and TtoR was associated with higher selectivity among habitat types (i.e. third-order habitat
Home Air Purifiers Eradicate Harmful Pathogens
2014-01-01
Marshall Space Flight Center funded the University of Madison-Wisconsin to develop ethylene scrubbers to keep produce fresh in space. Akida Holdings of Jacksonville, Florida, licensed the technology and developed Airocide, an air purifier that can kill airborne pathogens. Previously designed for industrial spaces, there is now a specially designed unit for home use.
More Than Four Walls: The Meaning of Home in Home Birth Experiences
Emily Burns
2015-01-01
The "home versus hospital" as places of birth debate has had a long and at times vicious history. From academic literature to media coverage, the two have often been pitted against each other not only as opposing physical spaces, but also as opposing ideologies of birth. The hospital has been heavily critiqued as a site of childbirth since the 1960s, with particular focus on childbirth and medicalisation. The focus of much of the hospital and home birthing research exists on a continuum of me...
Space The New Medical Frontier / NASA Spinoffs Milestones in Space Research
Skip Navigation Bar Home Current Issue Past Issues Space The New Medical Frontier Past Issues / Fall 2007 ... the occasion. Photo courtesy of NIH Long-Term Space Research Until the advent of the ISS, research ...
Use of implantable and external loop recorders in syncope with unknown causes
Directory of Open Access Journals (Sweden)
Kaoru Tanno
2017-12-01
Full Text Available The gold standard for diagnosing syncope is to elucidate the symptom-electrocardiogram (ECG correlation. The ECG recordings during syncope allow physicians to either confirm or exclude an arrhythmia as the mechanism of syncope. Many studies have investigated the use of internal loop recorder (ILR, while few studies have used external loop recorder (ELR for patients with unexplained syncope. The aim of this review is to clarify the clinical usefulness of ILR and ELR in the diagnosis and management of patients with unexplained syncope. Many observational and four randomized control studies have shown that ILR for patients with unknown syncope is a useful tool for early diagnosis and improving diagnosis rate. ILR also provides important information on the mechanism of syncope and treatment strategy. However, there is no evidence of total mortality or quality of life improvements with ILR. The diagnostic yield of ELR in patients with syncope was similar to that with ILR within the same timeframe. Therefore, ELR could be considered for long-term ECG monitoring before a patient switches to using ILR. A systematic approach and selection of ECG monitoring tools reduces health care costs and improves the selection of patients for optimal treatment possibilities. Keywords: Internal loop recorder, External loop recorder, Unknown Syncope
Privacy, modesty, hospitality, and the design of Muslim homes: A literature review
Directory of Open Access Journals (Sweden)
Zulkeplee Othman
2015-03-01
Full Text Available Traditional Islamic teachings and traditions involve guidelines that have direct applications in the domestic sphere. The principles of privacy, modesty, and hospitality are central to these guidelines; each principle has a significant effect on the design of Muslim homes, as well as on the organization of space and domestic behaviors within each home. This paper reviews literature on the privacy, modesty, and hospitality within Muslim homes. Nineteen publications from 1986 to 2013 were selected and analyzed for content related to the meaning of privacy, modesty, and hospitality in Islam and the design of Muslim homes. Despite the commonly shared guidelines for observing privacy, modesty, and hospitality within each home, Muslims living in different countries are influenced by cultural factors that operate within their country of residence. These factors help to shape the architectural styles and use of space within Muslim homes in different ways. Awareness of the multifactorial nature of the influences on the Muslim perception of home and the use of space is necessary for architects, building designers, engineers, and builders to be properly equipped to meet the needs of clients.
Ideas of home in palliative care research: A concept analysis.
Tryselius, Kristina; Benzein, Eva; Persson, Carina
2018-04-23
To explore the concept of home and its' expressed spatialities in current palliative care research. Home is a central environment for living, caring, and dying. However, pure investigations of the sets of ideas linked to the concept seemed missing. Although identified as an important location, spatial perspectives expressed through the concept of home appeared unexplored. Rodgers' evolutionary concept analysis. Scientific articles published between January 2009 and September 2015. Rodgers' evolutionary concept analysis. Resulting attributes were explored from two geographically informed spatial perspectives. As main results, six attributes were identified and explored: Home as actor-capable of acting; emotional environment-something people have feelings for; place-a part of personal identity and a location; space-complex and relational spatial connections and a site for care; setting-passive background and absolute space; becoming-a fluid spatiality constantly folded. Examples of attributes and suggestions for further concept development were identified. The concept reflects various sets of ideas as well as expressing both relational and absolute perspectives of space. The most challenging for nursing research and practice seems to be investigation, operationalization, and testing the implementation of sets of ideas reflecting a relational thinking of space. © 2018 Wiley Periodicals, Inc.
Levy, Rachael
2008-01-01
Based on Moje et al.'s (2004) conceptions of "third space theory", this article describes how five nursery-aged children created a "third space" between home and school, in order to find continuity between home and school constructions of reading. This article describes how the children used various aspects of their home…
Groot, Vincent P; van Santvoort, Hjalmar C; Rombouts, Steffi J E; Hagendoorn, Jeroen; Borel Rinkes, Inne H M; van Vulpen, Marco; Herman, Joseph M; Wolfgang, Christopher L; Besselink, Marc G; Molenaar, I Quintus
2017-02-01
The majority of patients who have undergone a pancreatic resection for pancreatic cancer develop disease recurrence within two years. In around 30% of these patients, isolated local recurrence (ILR) is found. The aim of this study was to systematically review treatment options for this subgroup of patients. A systematic search was performed in PubMed, Embase and the Cochrane Library. Studies reporting on the treatment of ILR after initial curative-intent resection of primary pancreatic cancer were included. Primary endpoints were morbidity, mortality and survival after ILR treatment. After screening 1152 studies, 18 studies reporting on 313 patients undergoing treatment for ILR were included. Treatment options for ILR included surgical re-resection (8 studies, 100 patients), chemoradiotherapy (7 studies, 153 patients) and stereotactic body radiation therapy (SBRT) (4 studies, 60 patients). Morbidity and mortality were reported for re-resection (29% and 1%, respectively), chemoradiotherapy (54% and 0%) and SBRT (3% and 1%). Most patients had a prolonged disease-free interval before recurrence. Median survival after treatment of ILR of up to 32, 19 and 16 months was reported for re-resection, chemoradiotherapy and SBRT, respectively. In selected patients, treatment of ILR following pancreatic resection for pancreatic cancer seems safe, feasible and associated with relatively good survival. Copyright © 2016 International Hepato-Pancreato-Biliary Association Inc. Published by Elsevier Ltd. All rights reserved.
Fuzzy Spatiotemporal Data Mining to Activity Recognition in Smart Homes
National Aeronautics and Space Administration — A primary goal to design smart homes is to provide automatic assistance for the residents to make them able to live independently at home. Activity recognition is...
Linking seasonal home range size with habitat selection and movement in a mountain ungulate.
Viana, Duarte S; Granados, José Enrique; Fandos, Paulino; Pérez, Jesús M; Cano-Manuel, Francisco Javier; Burón, Daniel; Fandos, Guillermo; Aguado, María Ángeles Párraga; Figuerola, Jordi; Soriguer, Ramón C
2018-01-01
Space use by animals is determined by the interplay between movement and the environment, and is thus mediated by habitat selection, biotic interactions and intrinsic factors of moving individuals. These processes ultimately determine home range size, but their relative contributions and dynamic nature remain less explored. We investigated the role of habitat selection, movement unrelated to habitat selection and intrinsic factors related to sex in driving space use and home range size in Iberian ibex, Capra pyrenaica . We used GPS collars to track ibex across the year in two different geographical areas of Sierra Nevada, Spain, and measured habitat variables related to forage and roost availability. By using integrated step selection analysis (iSSA), we show that habitat selection was important to explain space use by ibex. As a consequence, movement was constrained by habitat selection, as observed displacement rate was shorter than expected under null selection. Selection-independent movement, selection strength and resource availability were important drivers of seasonal home range size. Both displacement rate and directional persistence had a positive relationship with home range size while accounting for habitat selection, suggesting that individual characteristics and state may also affect home range size. Ibex living at higher altitudes, where resource availability shows stronger altitudinal gradients across the year, had larger home ranges. Home range size was larger in spring and autumn, when ibex ascend and descend back, and smaller in summer and winter, when resources are more stable. Therefore, home range size decreased with resource availability. Finally, males had larger home ranges than females, which might be explained by differences in body size and reproductive behaviour. Movement, selection strength, resource availability and intrinsic factors related to sex determined home range size of Iberian ibex. Our results highlight the need to integrate
A home away from home. [life support system design for Space Station
Powell, L. E.; Hager, R. W.; Mccown, J. W.
1985-01-01
The role of the NASA-Marshall center in the development of the Space Station is discussed. The tasks of the center include the development of the life-support system; the design of the common module, which will form the basis for all pressurized Space Station modules; the design and outfit of a common module for the Material and Technology Laboratory (MTL) and logistics use; accommodations for operations of the Orbit Maneuvering Vehicle (OMV) and the Orbit Transfer Vehicle (OTV); and the Space Station propulsion system. A description of functions and design is given for each system, with particular emphasis on the goals of safety, efficiency, automation, and cost effectiveness.
The Home of the Tiger: Economic Speculation and the Ethics of Habitation
Directory of Open Access Journals (Sweden)
Jason Matthew Buchanan
2014-01-01
Full Text Available In Ireland, the "home" has a long tradition as a powerful spatial signifier, capable of expressing a range of social, aesthetic, and political interactions. Historically, home ownership in Ireland was not only a measure of working-and-middle-class respectability, but also a symbol of national independence that stood in opposition to a colonial history of dispossession. Throughout the Celtic Tiger, however, the ideas of what constituted the "home" were transformed by a speculative form of capitalism that recreated domestic space as a fluctuating (and valuable commodity. By centralizing the connection of urban space to capitalism, speculation opens the domestic spaces of the home to the processes of speculation and devaluation.Essentially, my argument analyzes how changing the economic parameters of domestic space creates a concomitant change in how homes are figured in the Irish cultural lexicon. This change represents a cognitive speculation where the speculative value of a home, as a commodity is what confers an authentic social status on the homeowner. Any ethical concerns related to domestic space, both its use and value, are superseded by its ability to generate capital via a speculative evaluation. Through the connection of spatial and cultural transformation, my paper furthers current discussions in Irish studies that analyze the dramatic impact, and aftermath, of the Tiger. The literary response to speculation, found in analyses of Deidre Madden and Anne Haverty, frame speculation as a parody of communal life that eliminates any real interpersonal relationships in a wave of postmodern alienation. Finally, my paper articulates how the lasting damage that followed the collapse of the Tiger altered the way the Irish understood the concepts and realities of the "home".
Family socioeconomic status and the provision of motor affordances in the home
Directory of Open Access Journals (Sweden)
Teresa C. B. Freitas
2013-08-01
Full Text Available BACKGROUND: Socioeconomic status (SES and stimulation provided in the home environment are influential factors in aspects of child well-being including motor development. Little is known regarding the influence of SES on specific aspects of the home environment. OBJECTIVE: To evaluate the availability of affordances in the home to promote infant motor development and family SES. METHOD : The sample consisted of 300 families with infants aged 3 to 18 months. SES was assessed according to family socioeconomic class, income and parental level of education. To evaluate motor affordances found at home, the Affordances in the Home Environment for Motor Development-Infant Scale (AHEMD-IS was used. The AHEMD-IS was designed to assess dimensions of the home environment including Physical Space (outside and inside space, Daily Activities and Play Materials (fine-motor and gross-motor toys. RESULTS: SES indicators significantly influenced the availability of Physical Space and Play Materials. The Physical Space dimension was influenced by family economic class and income. The Play Materials dimension was influenced by all SES indicators. Daily Activities were not influenced by any of the SES indicators. Daily activities and play material were influenced by the infant's age. CONCLUSIONS: This study suggests that SES indicators are influential with regard to the provision of motor affordances in the home environment for infants. However, daily activities, which represent an aspect of the environment that is highly dependent on parental generation of situations that are conducive to motor skill development, are independent of family SES.
Networking Technologies for Future Home Networks Using 60 GHz Radio
Wang, J.
2010-01-01
Networking technologies have been changing the life of people in their private residential space. With the arrival of high definition (HD) multimedia services and broadband communications into the living space, future home networks are expected to support high speed device-to-device connectivity with Quality-of-Service (QoS) provisioning. There is no prize for guessing that it has to be wireless communication which creates maximal freedom. Nevertheless, it is doubtful that today's home networ...
Taneyan Lanjhang, Study of Home Garden Design Based Local Culture of Madura
Maningtyas, R. T.; Gunawan, A.
2017-10-01
This research aims to study the arrangement of landscape elements in Madura home garden and the underlying philosophy of the existence of these elements to formulate a concept of Madura home garden in accordance with the culture. Data about traditional culture, the character of the community, and the arrangement of the landscape around the home garden obtained through library research, field observation, and interviews of certain resource persons through purposive sampling techniques. The results showed that the Madura developed a pattern of home garden arrangement called taneyan lanjhang. Each taneyan lanjhang at least consist of several elements, namely langghar, roma, dapor, kandhang, taneyan, and organic fences. The elements are placed in a certain position in the direction of east-west and north-south by the Madura concept of life bappa-babbhu-guru-rato (father-mother-teacher-queen). The concept proposed residential garden is a garden house that is functional and aesthetic. This concept taneyan lanjhang split into five space, which is a public space, private space, semi-public spaces, room service, and a buffer space. The concept of circulation in taneyan lanjhang made according to the axis pattern that directs entrance to the langghar (prayer room) as a focal point.
Using EnergyPlus to Perform Dehumidification Analysis on Building America Homes
Energy Technology Data Exchange (ETDEWEB)
Fang, Xia [National Renewable Energy Lab. (NREL), Golden, CO (United States); Winkler, Jon [National Renewable Energy Lab. (NREL), Golden, CO (United States); Christensen, Dane [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2011-03-01
This study used EnergyPlus to investigate humidity issues on a typical mid-1990s reference home, a 2006 International Energy Conservation Code home, and a high-performance home in a hot-humid climate; the study confirmed that supplemental dehumidification should be provided to maintain space relative humidity below 60% in a hot-humid climate.
“I’m Just Really Comfortable:” Learning at Home, Learning in Libraries
Directory of Open Access Journals (Sweden)
Mariana Regalado
2015-05-01
Full Text Available In Brief: While commuter students may use their college or university libraries, student centers, or other campus locations for academic work, as commuters they will likely also create and negotiate learning spaces in their homes. Our research with urban commuter undergraduates revealed that finding space for their academic work at home was difficult for many […
Productive Urban Landscape In Developing Home Garden In Yogyakarta City
Irwan, S. N. R.; Sarwadi, A.
2017-10-01
Home garden is one type of agroecosystem that supports ecosystem services even in the urban settlement. The studies involved literature references and field survey along with a framework of the productive urban landscape that support ecosystem services in home garden. Productive urban landscape provided environmentally, socially and economically benefits that contained in ecosystem services. Problems on limited space in the urban settlement have to be managed by modified home garden system in order to work for ecosystem service in developing productive landscape. This study aimed to assess home garden (Pekarangan) system in a cluster of high density settlement in Yogyakarta City. Structured interview and vegetation identification of home garden have been conducted on 80 samples in Rejowinangun Kotagede District, Yogyakarta City. People showed enthusiasm in ecosystem services provided by home garden “Pekarangan Produktif” through developing productive urban landscape. Some benefits on ecosystem services of home garden were revealed on this study consisted of food production for sale (4.7%), home industry (7.69%), aesthetics (22.65%), food (14.10%), biodiversity (10.68%), ecosystem (12.82%), education (2.56), social interaction (11.54%), recreation (4.70%), and others (8.55%). Nevertheless, vegetation and other elements of home gardens have been managed irregularly and in particularly, the planned home gardens were only 17.07%. Actually, home gardens provided a large set of ecosystem services including being cultural services those are the category most valued. The urban people almost hided the understanding of the cultural benefit of ecosystem services of home garden, even though Yogyakarta has known the cultural city. Thus, urban home garden, as way as “Pekarangan Produktif” in the limited space that managed and planned sustainably, provide many benefits of ecosystem services in a productive urban landscape.
Ferguson, Harry
2018-01-01
Although the home is the most common place where social work goes on, research has largely ignored the home visit. Drawing on a participant observation study of child protection work, this article reveals the complex hidden practices of social work on home visits. It is argued that home visits do not simply involve an extension of the social work organisation, policies and procedures into the domestic domain but the home constitutes a distinct sphere of practice and experience in its own right. Home visiting is shown to be a deeply embodied practice in which all the senses and emotions come into play and movement is central. Through the use of creativity, craft and improvisation practitioners 'make' home visits by skilfully enacting a series of transitions from the office to the doorstep, and into the house, where complex interactions with service users and their domestic space and other objects occur. Looking around houses and working with children alone in their bedrooms were common. Drawing upon sensory and mobile methods and a material culture studies approach, the article shows how effective practice was sometimes blocked and also how the home was skilfully negotiated, moved around and creatively used by social workers to ensure parents were engaged with and children seen, held and kept safe.
Heating homes and water with the sun. Solar thermal solutions adapted to individual homes
International Nuclear Information System (INIS)
Bareau, Helene; Juniere, Olivier; Leplay, Camille
2016-09-01
This brochure, edited by ADEME, the French office for energy management and sustainable development, gives a basic outlook of the way to complete the installation of a solar space and hot water heating system in an individual home. After some recall of the key points to be considered before taking the decision to invest in a solar heating system (minimum surface, orientation, etc.) and the main administrative procedures to be respected (in France), this document presents the common individual solar water heating system (which is now reliable and robust), its various equipment and operating principles, the dimensioning of the system, gives recommendations on points such as the panel position and orientation, the risk of overheating and the way to avoid it, etc. It also presents combined solar heating solutions that simultaneously heat water and space, their operating principles and the way to complete their installation for a home. Informations on financing, selection of the equipment and the installer, and installation maintenance are also proposed
CDDIS: NASA's Archive of Space Geodesy Data and Products Supporting GGOS
Noll, Carey; Michael, Patrick
2016-01-01
The Crustal Dynamics Data Information System (CDDIS) supports data archiving and distribution activities for the space geodesy and geodynamics community. The main objectives of the system are to store space geodesy and geodynamics related data and products in a central archive, to maintain information about the archival of these data,to disseminate these data and information in a timely manner to a global scientific research community, and provide user based tools for the exploration and use of the archive. The CDDIS data system and its archive is a key component in several of the geometric services within the International Association of Geodesy (IAG) and its observing systemthe Global Geodetic Observing System (GGOS), including the IGS, the International DORIS Service (IDS), the International Laser Ranging Service (ILRS), the International VLBI Service for Geodesy and Astrometry (IVS), and the International Earth Rotation and Reference Systems Service (IERS). The CDDIS provides on-line access to over 17 Tbytes of dataand derived products in support of the IAG services and GGOS. The systems archive continues to grow and improve as new activities are supported and enhancements are implemented. Recently, the CDDIS has established a real-time streaming capability for GNSS data and products. Furthermore, enhancements to metadata describing the contents ofthe archive have been developed to facilitate data discovery. This poster will provide a review of the improvements in the system infrastructure that CDDIS has made over the past year for the geodetic community and describe future plans for the system.
Nordin, Nik Muhammad Faris Bin Nik; Hasbollah, Hasif Rafidee bin; Ibrahim, Mohd Asrul Hery Bin; Marican, Nor Dalila bin; Halim, Muhd Hafzal bin Abdul; Rashid, Ahmad Faezi Bin Ab.; Yasin, Nurul Hafizah Binti Mohd
2017-10-01
The numbers of elderly in Malaysia are increased every year. The request towards elderly care services necessitated by the Nursing Home are in demand. However, Nursing Home in Malaysia is lack of standard of facilities in order to cater the care services for the elderly. This paper intends review the minimum standard facilities for the Nursing Homes in globally. The paper also offered insights in developing standard Nursing Home facilities in Malaysia.
Fields, Deborah Anne
This is a theory-building study taking a wide-angled perspective on youths' development of trajectories of identification across social settings of their everyday lives. I investigated the relationships within and between trajectories of identification across the everyday lives of four youth, studying the conflicts, cohesion, and gaps in their trajectories of identification as they moved across and participated in multiple social settings. I asked how trajectories of identification were built across social settings (i.e. relationships within a trajectory of identification); what kinds of relationships existed between youths' trajectories of identification; and what facilitated the building of trajectories of identification across social settings. To study these questions, I argued for three interrelated lenses on identity: local acting and positioning in practice, the ways one thinks of oneself (self-narratives), and the ways that others think of one (others'-narratives). Using these lenses I shaped a connective ethnography studying four 11-12 year old youth across everyday settings including school, home, hobbies like sports and music, community organizations, and peer groups, following two youth for six months and two youth for one year. I analyzed findings across the four youth. The cases presented in this thesis demonstrate the ways that youth form identities through their travel and not just in a single setting. First, I found that youth build trajectories of identification across social settings and not just in a single setting. As learning is not just within a single mind, so is identity developed beyond a single space. Second, I demonstrated how multiple interacting trajectories of identification within a youth's life may shape each other in inclusive and exclusive ways. Third, throughout the cases I highlighted how traveling artifacts can support building trajectories of identification across social settings, including boundary objects, artifacts created
Directory of Open Access Journals (Sweden)
Zulkeplee Othman
2014-12-01
Full Text Available A home embodies a sensorial space that is layered with personal memories and traces of history. The success of a home in providing a strong sense of place depends on various factors such as geographical location, climatic conditions, and occupants’ world-views and perceptions. This paper explores Muslims’ perceptions of privacy, modesty and hospitality within their homes through their lived experiences. This case study focuses on three Muslim families living in Australian designed homes within the same suburb of Brisbane, Australia. The study provides prefatory insight into the ways in which these families perform their daily activities and entertain their guests without jeopardizing their privacy needs. The study examines the significance of modesty in the design of Muslim homes as a means by which family members are able to achieve optimum privacy while simultaneously extending hospitality to guests inside and outside their homes. The findings of this study provide opportunities too, for expanding research into culturally adaptable housing systems to help meet the changing needs of Australian multicultural society.
A Lightweight, User-controlled System For The Home
Directory of Open Access Journals (Sweden)
Lynne Baillie
2006-01-01
Full Text Available This paper explores how we designed, with input from some elderly persons, a multi-agent user-controlled network for the home. The system was designed to support the elderly in living longer at home with minimal support. We describe how our work attempts to tackle issues such as privacy, control of personal space, and enjoyment within the home. As the number of elderly individuals’ increases, a certain amount of information gathering or support may be required to assist the elderly in their homes. However, we strongly believe that we should preserve people’s privacy in their homes and ensure that any artifact we propose is seen as enjoyable, aesthetically pleasing and, most importantly, not stigmatizing. We describe in this paper how a lightweight setup, using a multimodal mobile robot, a PDA, and an interactive television, can assist the elderly in the home in an enjoyable and unobtrusive way.
The Home, the Family and the Energy Advisor
DEFF Research Database (Denmark)
Tjørring, Lise
within. The empirical focus is on the households' potential to perform energy renovations of their homes and adopt flexible electricity use. Four papers investigate what characterises the social and gendered engagements among the home, the family and the energy advisor and the implications...... events, social relations, historical conditions and social status. These findings call for new methods to increase the number of energy renovations and the likelihood of adopting flexible electricity use. We must focus on the home not only as a technical issue that can be improved but also as a dwelling...... space that contains gendered practices, cultural norms and social engagements among the home, the family and the energy advisor....
14 CFR 1204.1600 - Issuance of motor vehicle for home-to-work.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Issuance of motor vehicle for home-to-work... ADMINISTRATIVE AUTHORITY AND POLICY Temporary Duty Travel-Issuance of Motor Vehicle for Home-to-Work Transportation § 1204.1600 Issuance of motor vehicle for home-to-work. When a NASA employee on temporary duty...
DEFF Research Database (Denmark)
2005-01-01
Digital technologies and media are becoming increasingly embodied and entangled in the spaces and places at work and at home. However, our material environment is more than a geometric abstractions of space: it contains familiar places, social arenas for human action. For designers, the integration...... of digital technology with space poses new challenges that call for new approaches. Creative alternatives to traditional systems methodologies are called for when designers use digital media to create new possibilities for action in space. Design Spaces explores how design and media art can provide creative...... alternatives for integrating digital technology with space. Connecting practical design work with conceptual development and theorizing, art with technology, and usesr-centered methods with social sciences, Design Spaces provides a useful research paradigm for designing ubiquitous computing. This book...
Using EnergyPlus to Perform Dehumidification Analysis on Building America Homes: Preprint
Energy Technology Data Exchange (ETDEWEB)
Fang, X.; Winkler, J.; Christensen, D.
2011-03-01
A parametric study was conducted using EnergyPlus version 6.0 to investigate humidity issues on a typical mid-1990s reference home, a 2006 International Energy Conservation Code home, and a high-performance home in a hot-humid climate. The impacts of various dehumidification equipment and controls are analyzed on the high performance home. The study examined the combined effects of infiltration and mechanical ventilation with balanced and unbalanced mechanical ventilation systems. Indoor relative humidity excursions were examined; specifically, the number of excursions, average excursion length, and maximum excursion length. Space relative humidity, thermal comfort, and whole-house source energy consumption were analyzed for indoor relative humidity set points of 50%, 55%, and 60%. The study showed and explained why similar trends of high humidity were observed in all three homes regardless of energy efficiency, and why humidity problems are not necessarily unique in high-performance homes. Thermal comfort analysis indicated that occupants are unlikely to notice indoor humidity problems. The study confirmed that supplemental dehumidification should be provided to maintain space relative humidity below 60% in a hot-humid climate.
Grall, Kristi H; Panchal, Ashish R; Chuffe, Eliud; Stoneking, Lisa R
2016-01-01
Language and cultural barriers are detriments to quality health care. In acute medical settings, these barriers are more pronounced, which can lead to poor patient outcomes. We implemented a longitudinal Spanish-language immersion curriculum for emergency medicine (EM) resident physicians. This curriculum includes language and cultural instruction, and is integrated into the weekly EM didactic conference, longitudinal over the entire 3-year residency program. Language proficiency was assessed at baseline and annually on the Interagency Language Roundtable (ILR) scale, via an oral exam conducted by the same trained examiner each time. The objective of the curriculum was improvement of resident language skills to ILR level 1+ by year 3. Significance was evaluated through repeated-measures analysis of variance. The curriculum was launched in July 2010 and followed through June 2012 (n=16). After 1 year, 38% had improved over one ILR level, with 50% achieving ILR 1+ or above. After year 2, 100% had improved over one level, with 90% achieving the objective level of ILR 1+. Mean ILR improved significantly from baseline, year 1, and year 2 (F=55, df =1; Planguage skills in EM residents. The curriculum improved EM-resident language proficiency above the goal in just 2 years. Further studies will focus on the effect of language acquisition on patient care in acute settings.
Performing Home in Barcelona: A Practice-Based Photo Essay
Pons, Esther Belvis
2018-01-01
During the winter of 2016, I carried out an artistic project in Barcelona entitled 'Performing Home' that aimed to explore the affective and social challenges that artists in political asylum or refuge cope with. The project began with a simple question: "where in public spaces do artists in asylum feel 'at home'?" It explored how public…
Gilbertson, Jan; Stevens, Maryjane; Stiell, Bernadette; Thorogood, Nicki
2006-08-01
This paper reports the results of research carried out as part of the national health impact evaluation of the Warm Front Scheme, a government initiative aimed at alleviating fuel poverty in England. Semi-structured interviews were carried out in a purposive sample of 49 households which received home energy improvements under the Scheme from five urban areas (Birmingham, Liverpool, Manchester, Newcastle, Southampton). Each household had received installation, replacement or refurbishment of the heating system and, in some cases, also insulation of the cavity wall or loft or both, and draught-proofing measures. Most householders reported improved and more controllable warmth and hot water. Many also reported perceptions of improved physical health and comfort, especially of mental health and emotional well-being and, in several cases, the easing of symptoms of chronic illness. There were reports of improved family relations, an expansion of the domestic space used during cold months, greater use of kitchens and improved nutrition, increased privacy, improved social interaction, and an increase in comfort and atmosphere within the home. Greater warmth and comfort also enhanced emotional security, and recipients were more content and at ease in their homes. However there was little evidence of substantially lower heating bills. These results provide evidence that Warm Front home energy improvements are accompanied by appreciable benefits in terms of use of living space, comfort and quality of life, physical and mental well-being, although there is only limited evidence of change in health behaviour.
Time biases in laser ranging observations: A concerning issue of Space Geodesy
Exertier, Pierre; Belli, A.; Lemoine, J. M.
2017-09-01
Time transfer by Laser Ranging (LR) recently demonstrated a remarkable stability (a few ps over ∼1000 s) and accuracy (synchronizing both space and ground clocks over distances from a few thousands to tens of thousands kilometers. Given its potential role in navigation, fundamental physics and metrology, it is crucial that synergy between laser ranging and Time&Frequency (T/F) technologies improves to meet the present and future space geodesy requirements. In this article, we examine the behavior of T/F systems that are used in LR tracking stations of the international laser ranging service. The approach we investigate is to compute time synchronization between clocks used at LR stations using accurate data of the Time Transfer by Laser Link (T2L2) experiment onboard the satellite Jason-2 (Samain et al., 2014). Systematic time biases are estimated against the UTC time scale for a set of 22 observing stations in 2013, in the range of zero to a few μ s. Our results suggest that the ILRS network suffers from accuracy issues, due to time biases in the laser ranging observations. We discuss how these systematic effects impact the precise orbit determination of LAGEOS geodetic satellites over a 1-year analysis, and additionally give a measure of the local effect into station coordinates, regarding in particular the effect in the east-west component that is of 2-6 mm for a typical systematic time bias of one μ s.
Factors affecting death at home in Japan.
Sauvaget, C; Tsuji, I; Li, J H; Hosokawa, T; Fukao, A; Hisamichi, S
1996-10-01
Despite the wish of the Japanese people to spend their final moments at home, the percentage of deaths at home among elderly is decreasing. Moreover, large variations in this rate were observed over the country. The present ecological study analyzed the relationship between the percentage of deaths at home for decedents aged 70 and over, and demographic, medical and socioeconomic characteristics. The data published in 1990 by the Japanese National Government were analyzed by correlation, principal-component, and multiple linear regression analyses. The results showed that the percentage of deaths at home for decedents aged 70 and over was positively associated with the number of persons per household, and the area of floor space per house. The divorce rate, the national tax per capita, and the mean length of hospitalization for stroke showed a negative association with the percentage of deaths at home. In the prefectures where the crude death rates of stroke and senility were high, elderly were more likely to die at home. These results suggested the importance of the number of family caregivers, and the housing conditions for terminal care at home. This research may lead to improve home medical assistance which is still underdeveloped in Japan.
2000-01-01
The Space Odyssey Gift Shop located in StenniSphere at the John C. Stennis Space Center in Hancock County, Miss., offers every visitor the opportunity to go home with 'the right stuff' from his or her StenniSphere visit. The gift shop is located just inside the front doors to StenniSphere and offers a wide range of space-related apparel, memorabilia, toys, books, mission patches and more.
Potter, Rachel; Sheehan, Bart; Cain, Rebecca; Griffin, James; Jennings, Paul A
2018-05-08
Forty percent of residents living in care homes in the United Kingdom have significant depressive symptoms. Care homes can appear to be depressing places, but whether the physical environment of homes directly affects depression in care home residents is unknown. This study explores the relationship between the physical environment and depressive symptoms of older people living in care homes. In a prospective cohort study the physical environment of 50 care homes were measured using the Sheffield Care Environment Assessment Matrix (SCEAM) and depressive symptoms of 510 residents measured using the Geriatric Depression Scale (GDS-15). The study was supplemented with semi-structured interviews with residents living in the care homes. Quantitative data were analyzed using multi-level modeling, and qualitative data analyzed using a thematic framework approach. The overall physical environment of care homes (overall SCEAM score) did not predict depressive symptoms. Controlling for dependency, social engagement, and home type, having access to outdoor space was the only environmental variable to significantly predict depressive symptoms. Residents interviewed reported that access to outdoor space was restricted in many ways: locked doors, uneven foot paths, steep steps, and needing permission or assistance to go outside. We provide new evidence to suggest that access to outdoor space predicts depressive symptoms in older people living in care home. Interventions aimed at increasing access to outdoor spaces could positively affect depressive symptoms in older people.
Networking Technologies for Future Home Networks Using 60 GHz Radio
Wang, J.
2010-01-01
Networking technologies have been changing the life of people in their private residential space. With the arrival of high definition (HD) multimedia services and broadband communications into the living space, future home networks are expected to support high speed device-to-device connectivity
Kodu käsitlused Jaan Kaplinski luules / The Concept of Home in Jaan Kaplinski’s Poetry
Directory of Open Access Journals (Sweden)
Ene-Reet Soovik
2013-12-01
Full Text Available The article focuses on the evolution of the concept of home in the poetry of Jaan Kaplinski, one of the internationally most acclaimed Estonian poets. The discussion draws on the understanding of the notion of home emerging in the classic works of the phenomenologically inclined human geographers Edward Relph and Yi-Fu Tuan, as well as the influential French philosopher Gaston Bachelard. Kaplinski’s early poetry features lonely wanderers who have been cast into the world; their being on the road is eternal with no points of security or attachment. Such poetry tends to be a poetry of homelessness that accepts the lack of the feeling of being at home. If the concept of home does appear, it is an abstract rather than a denoted space that can be experienced with the senses in an unmediated way.* This is connected with the human condition – being cast into the world in a state of existentialist alienation, the acknowledgement of which is the only way of creating a certain sense of belonging and fellow feeling with other people. It is difficult to differentiate between the feelings of being at home or in non-home in Kaplinski’s early poetry, which thus often features what might be termed as existentialist homes. For Bachelard, a home provides one with a sense of security, which the phenomenologist sees as being connected with one’s childhood home. When homes related to particular buildings appear in Kaplinski’s verse, these do not guarantee such security. They are perishable, crumbling houses that may disappear, particularly in a fire like that which consumed the centre of Tartu, the poet’s childhood home town, during WWII. Yet the texts that feature such an understanding of home become more dependent on bodily memory, on an actual reliving of space. The home that is retrospectively connected with the past may replace the more abstract existentialist home, but is no source of security, serving as an ephemeral home. However, Kaplinski
A. Steenbekkers; C. Simon; V. Veldheer
2006-01-01
The Dutch countryside is in a state of flux. The decline of agriculture and the altered use of space are being studied extensively in research and in the media. But what about the people living in the countryside? How are they doing? In the report Thuis op het platteland (At Home in the
Spying on the Smart Home: Privacy Attacks and Defenses on Encrypted IoT Traffic
Apthorpe, Noah; Reisman, Dillon; Sundaresan, Srikanth; Narayanan, Arvind; Feamster, Nick
2017-01-01
The growing market for smart home IoT devices promises new conveniences for consumers while presenting new challenges for preserving privacy within the home. Many smart home devices have always-on sensors that capture users' offline activities in their living spaces and transmit information about these activities on the Internet. In this paper, we demonstrate that an ISP or other network observer can infer privacy sensitive in-home activities by analyzing Internet traffic from smart homes con...
Photon Pressure Force on Space Debris TOPEX/Poseidon Measured by Satellite Laser Ranging
Kucharski, D.; Kirchner, G.; Bennett, J. C.; Lachut, M.; Sośnica, K.; Koshkin, N.; Shakun, L.; Koidl, F.; Steindorfer, M.; Wang, P.; Fan, C.; Han, X.; Grunwaldt, L.; Wilkinson, M.; Rodríguez, J.; Bianco, G.; Vespe, F.; Catalán, M.; Salmins, K.; del Pino, J. R.; Lim, H.-C.; Park, E.; Moore, C.; Lejba, P.; Suchodolski, T.
2017-10-01
The (TOPography EXperiment) TOPEX/Poseidon (T/P) altimetry mission operated for 13 years before the satellite was decommissioned in January 2006, becoming a large space debris object at an altitude of 1,340 km. Since the end of the mission, the interaction of T/P with the space environment has driven the satellite's spin dynamics. Satellite laser ranging (SLR) measurements collected from June 2014 to October 2016 allow for the satellite spin axis orientation to be determined with an accuracy of 1.7°. The spin axis coincides with the platform yaw axis (formerly pointing in the nadir direction) about which the body rotates in a counterclockwise direction. The combined photometric and SLR data collected over the 11 year time span indicates that T/P has continuously gained rotational energy at an average rate of 2.87 J/d and spins with a period of 10.73 s as of 19 October 2016. The satellite attitude model shows a variation of the cross-sectional area in the Sun direction between 8.2 m2 and 34 m2. The direct solar radiation pressure is the main factor responsible for the spin-up of the body, and the exerted photon force varies from 65 μN to 228 μN around the mean value of 138.6 μN. Including realistic surface force modeling in orbit propagation algorithms will improve the prediction accuracy, giving better conjunction warnings for scenarios like the recent close approach reported by the ILRS Space Debris Study Group—an approximate 400 m flyby between T/P and Jason-2 on 20 June 2017.
Kipp, Ryan; Young, Natasha; Barnett, Anne; Kopp, Douglas; Leal, Miguel A; Eckhardt, Lee L; Teelin, Thomas; Hoffmayer, Kurt S; Wright, Jennifer; Field, Michael
2017-09-01
Implantable loop recorder (ILR) insertion has historically been performed in a surgical environment such as the electrophysiology (EP) lab. The newest generation loop recorder (Medtronic Reveal LINQ™, Minneapolis, MN, USA) is injectable with potential for implantation in a non-EP lab setting by advanced practice providers (APPs) facilitating improved workflow and resource utilization. We report the safety and efficacy of injectable ILR placement in the ambulatory care setting by APPs. A retrospective review was performed including all patients referred for injectable ILR placement from March 2014 to November 2015. All device placement procedures were performed in an ambulatory care setting using the standard manufacturer deployment kit with sterile technique and local anesthetic following a single dose of intravenous antibiotics. Acute procedural success and complication rates following injectable ILR placement in the ambulatory setting were reviewed. During the study period, 125 injectable ILRs were implanted. Acute procedural success with adequate sensing (R-waves ≥ 0.2 mV) occurred in 100% of patients. There were no acute procedural complications. Subacute complications occurred in two patients (1.6% of implantations), including one possible infection treated with oral antibiotics and one device removal due to pain at the implant site. In this retrospective single-center study, implantation of injectable ILR in an ambulatory care setting by APPs following a single dose of intravenous antibiotics and standard manufacturer technique yielded a low complication rate with high acute procedural success. Use of this implantation strategy may improve EP lab workflow while providing a safe and effective technique for device placement. © 2017 Wiley Periodicals, Inc.
Brignole, M.; Sutton, R.; Menozzi, C.; Moya, A.; Garcia-Civera, R.; Benditt, D.; Vardas, P.; Wieling, W.; Andresen, D.; Migliorini, R.; Hollinworth, D.
2003-01-01
Study design Multi-centre, prospective observational study Objectives Main objective is to verify the value of implantable loop recorder (ILR) in assessing the mechanism of syncope and the efficacy of the ILR-guided therapy after syncope recurrence. Inclusion criteria Patients who met the following
DEFF Research Database (Denmark)
Unterrainer, Walter
2014-01-01
art and architectural space museums and other exhibition spaces or how artists learn to love architects Over the last two decades, innumerable new museums, art galleries and other exhibition spaces have been built and opened all over the globe. The most extreme growth happened in China, where...... purpose of ´uniqueness´ often fail to be a ´home´, a large scale ´picture frame´ or a productive space for communicating art and even do not fulfil basic technical aspects in terms of a consistent indoor climate, optimized lighting or safety. The lecture will focus on inspiring examples of spaces for art...
Ronald, R.
2009-01-01
The space and place of the Japanese home holds an iconic status in both foreign and indigenous understandings of Japanese life. The architectural forms and bounded spaces of Japanese houses have historically been embedded in social practices that integrate individuals with hierarchical orders of
Giada, Franco; Gulizia, Michele; Francese, Maura; Croci, Francesco; Santangelo, Lucio; Santomauro, Maurizio; Occhetta, Eraldo; Menozzi, Carlo; Raviele, Antonio
2007-05-15
The aim of the study was to compare the diagnostic yield and the costs of implantable loop recorder (ILR) with those of the conventional strategy in patients with unexplained palpitations. In patients with unexplained palpitations, especially in those with infrequent symptoms, the conventional strategy, including short-term ambulatory electrocardiogram (ECG) monitoring and electrophysiological study, sometimes fails to establish a diagnosis. We studied 50 patients with infrequent (1 min) palpitations. Before enrollment, patients had a negative initial evaluation, including history, physical examination, and ECG. Patients were randomized either to conventional strategy (24-h Holter recording, a 4-week period of ambulatory ECG monitoring with an external recorder, and electrophysiological study) (n = 24) or to ILR implantation with 1-year monitoring (n = 26). Hospital costs of the 2 strategies were calculated. A diagnosis was obtained in 5 patients in the conventional strategy group, and in 19 subjects in the ILR group (21% vs. 73%, p < 0.001). Despite the higher initial cost, the cost per diagnosis in the ILR group was lower than in the conventional strategy group (euro 3,056 +/- euro 363 vs. euro 6,768 +/- euro 6,672, p = 0.012). In subjects without severe heart disease and with infrequent palpitations, ILR is a safe and more cost-effective diagnostic approach than conventional strategy.
Air-to-Water Heat Pumps With Radiant Delivery in Low-Load Homes
Energy Technology Data Exchange (ETDEWEB)
Backman, C. [Alliance for Residential Building Innovation (ARBI), Davis, CA (United States); German, A. [Alliance for Residential Building Innovation (ARBI), Davis, CA (United States); Dakin, B. [Alliance for Residential Building Innovation (ARBI), Davis, CA (United States); Springer, D. [Alliance for Residential Building Innovation (ARBI), Davis, CA (United States)
2013-12-01
Space conditioning represents nearly 50% of average residential household energy consumption, highlighting the need to identify alternative cost-effective, energy-efficient cooling and heating strategies. As homes are better built, there is an increasing need for strategies that are particularly well suited for high performance, low load homes. ARBI researchers worked with two test homes in hot-dry climates to evaluate the in-situ performance of air-to-water heat pump systems, an energy efficient space conditioning solution designed to cost-effectively provide comfort in homes with efficient, safe, and durable operation. Two monitoring projects of test houses in hot-dry climates were initiated in 2010 to test this system. Both systems were fully instrumented and have been monitored over one year to capture complete performance data over the cooling and heating seasons. Results are used to quantify energy savings, cost-effectiveness, and system performance using different operating modes and strategies. A calibrated TRNSYS model was developed and used to evaluate performance in various climate regions. This strategy is most effective in tight, insulated homes with high levels of thermal mass (i.e. exposed slab floors).
Air-to-Water Heat Pumps With Radiant Delivery in Low-Load Homes
Energy Technology Data Exchange (ETDEWEB)
Backman, C. [Alliance for Residential Building Innovation, Davis, CA (United States). Davis Energy Group; German, A. [Alliance for Residential Building Innovation, Davis, CA (United States). Davis Energy Group; Dakin, B. [Alliance for Residential Building Innovation, Davis, CA (United States). Davis Energy Group; Springer, D. [Alliance for Residential Building Innovation, Davis, CA (United States). Davis Energy Group
2013-12-01
Space conditioning represents nearly 50% of average residential household energy consumption, highlighting the need to identify alternative cost-effective, energy-efficient cooling and heating strategies. As homes are better built, there is an increasing need for strategies that are particularly well suited for high performance, low load homes. ARBI researchers worked with two test homes in hot-dry climates to evaluate the in-situ performance of air-to-water heat pump (AWHP) systems, an energy efficient space conditioning solution designed to cost-effectively provide comfort in homes with efficient, safe, and durable operation. Two monitoring projects of test houses in hot-dry climates were initiated in 2010 to test this system. Both systems were fully instrumented and have been monitored over one year to capture complete performance data over the cooling and heating seasons. Results are used to quantify energy savings, cost-effectiveness, and system performance using different operating modes and strategies. A calibrated TRNSYS model was developed and used to evaluate performance in various climate regions. This strategy is most effective in tight, insulated homes with high levels of thermal mass (i.e. exposed slab floors).
Directory of Open Access Journals (Sweden)
L Max Tarjan
Full Text Available Parametric and nonparametric kernel methods dominate studies of animal home ranges and space use. Most existing methods are unable to incorporate information about the underlying physical environment, leading to poor performance in excluding areas that are not used. Using radio-telemetry data from sea otters, we developed and evaluated a new algorithm for estimating home ranges (hereafter Permissible Home Range Estimation, or "PHRE" that reflects habitat suitability. We began by transforming sighting locations into relevant landscape features (for sea otters, coastal position and distance from shore. Then, we generated a bivariate kernel probability density function in landscape space and back-transformed this to geographic space in order to define a permissible home range. Compared to two commonly used home range estimation methods, kernel densities and local convex hulls, PHRE better excluded unused areas and required a smaller sample size. Our PHRE method is applicable to species whose ranges are restricted by complex physical boundaries or environmental gradients and will improve understanding of habitat-use requirements and, ultimately, aid in conservation efforts.
New Whole-House Solutions Case Study: Quadrant Homes
Energy Technology Data Exchange (ETDEWEB)
none,
2013-02-01
Quadrant moved ducts and high efficiency furnace inside conditioned space on nearly all 300 customizable house plans. The builder uses dry, true factory-assembled walls, extensive air sealing, and just in time delivery for pre-sold homes.
Predicting Days on Market: The Influence of Environmental and Home Attributes
Robert P. Culp
2008-01-01
This paper estimates the difference in the number of days a home will remain on the market based upon its environmental attributes. Using on-site inspections of 3088 home sites, the results, using two-stage least squares, show that time on market is reduced and price increased by a variety of green features such as trees, landscaping, open spaces and parks, while time on market is increased and/or price decreased by man-made obstructions such as power lines, roads near the home, train tracks,...
Vega-Barbas, Mario; Pau, Iván; Martín-Ruiz, María Luisa; Seoane, Fernando
2015-03-25
Smart spaces foster the development of natural and appropriate forms of human-computer interaction by taking advantage of home customization. The interaction potential of the Smart Home, which is a special type of smart space, is of particular interest in fields in which the acceptance of new technologies is limited and restrictive. The integration of smart home design patterns with sensitive solutions can increase user acceptance. In this paper, we present the main challenges that have been identified in the literature for the successful deployment of sensitive services (e.g., telemedicine and assistive services) in smart spaces and a software architecture that models the functionalities of a Smart Home platform that are required to maintain and support such sensitive services. This architecture emphasizes user interaction as a key concept to facilitate the acceptance of sensitive services by end-users and utilizes activity theory to support its innovative design. The application of activity theory to the architecture eases the handling of novel concepts, such as understanding of the system by patients at home or the affordability of assistive services. Finally, we provide a proof-of-concept implementation of the architecture and compare the results with other architectures from the literature.
Archiving Space Geodesy Data for 20+ Years at the CDDIS
Noll, Carey E.; Dube, M. P.
2004-01-01
Since 1982, the Crustal Dynamics Data Information System (CDDIS) has supported the archive and distribution of geodetic data products acquired by NASA programs. These data include GPS (Global Positioning System), GLONASS (GLObal NAvigation Satellite System), SLR (Satellite Laser Ranging), VLBI (Very Long Baseline Interferometry), and DORIS (Doppler Orbitography and Radiolocation Integrated by Satellite). The data archive supports NASA's space geodesy activities through the Solid Earth and Natural Hazards (SENH) program. The CDDIS data system and its archive have become increasingly important to many national and international programs, particularly several of the operational services within the International Association of Geodesy (IAG), including the International GPS Service (IGS), the International Laser Ranging Service (ILRS), the International VLBI Service for Geodesy and Astrometry (IVS), the International DORIS Service (IDS), and the International Earth Rotation Service (IERS). The CDDIS provides easy and ready access to a variety of data sets, products, and information about these data. The specialized nature of the CDDIS lends itself well to enhancement and thus can accommodate diverse data sets and user requirements. All data sets and metadata extracted from these data sets are accessible to scientists through ftp and the web; general information about each data set is accessible via the web. The CDDIS, including background information about the system and its user communities, the computer architecture, archive contents, available metadata, and future plans will be discussed.
‘Praise to the Emptiness’ Locating Home in the Arab Diaspora
Directory of Open Access Journals (Sweden)
Sandhya Rao Mehta
2014-01-01
Full Text Available This paper explores the continuing negotiations which occur among the diasporic communities to arrive at definitions of home within the new geographical spaces occupied by them. Using the liminal and hybrid theories of Avtar Brah, Stuart Hall and their literary manifestations in Salman Rushdie and Meena Alexander, it explores the notion of home among the Arab diaspora in The United States, particularly as expressed by women writers. Using the specific example of Mohja Kahf’s the girl in the tangerine scarf, this study examines the way in which Muslim women in the diaspora struggle to find multiple possibilities of ‘home’. It presents the possibility that the inability to establish a final home could be a literary tool for the creative artist to examine multiple identities and inhabit marginal spaces in ways which are imaginative and hopeful rather than being zones of loss and longing.
Home safe home: Evaluation of a childhood home safety program.
Stewart, Tanya Charyk; Clark, Andrew; Gilliland, Jason; Miller, Michael R; Edwards, Jane; Haidar, Tania; Batey, Brandon; Vogt, Kelly N; Parry, Neil G; Fraser, Douglas D; Merritt, Neil
2016-09-01
The London Health Sciences Centre Home Safety Program (HSP) provides safety devices, education, a safety video, and home safety checklist to all first-time parents for the reduction of childhood home injuries. The objective of this study was to evaluate the HSP for the prevention of home injuries in children up to 2 years of age. A program evaluation was performed with follow-up survey, along with an interrupted time series analysis of emergency department (ED) visits for home injuries 5 years before (2007-2013) and 2 years after (2013-2015) implementation. Spatial analysis of ED visits was undertaken to assess differences in home injury rates by dissemination areas controlling differences in socioeconomic status (i.e., income, education, and lone-parent status) at the neighborhood level. A total of 3,458 first-time parents participated in the HSP (a 74% compliance rate). Of these, 20% (n = 696) of parents responded to our questionnaire, with 94% reporting the program to be useful (median, 6; interquartile range, 2 on a 7-point Likert scale) and 81% learning new strategies for preventing home injuries. The median age of the respondent's babies were 12 months (interquartile range, 1). The home safety check list was used by 87% of respondents to identify hazards in their home, with 95% taking action to minimize the risk. The time series analysis demonstrated a significant decline in ED visits for home injuries in toddlers younger than2 years of age after HSP implementation. The declines in ED visits for home injuries remained significant over and above each socioeconomic status covariate. Removing hazards, supervision, and installing safety devices are key facilitators in the reduction of home injuries. Parents found the HSP useful to identify hazards, learn new strategies, build confidence, and provide safety products. Initial finding suggests that the program is effective in reducing home injuries in children up to 2 years of age. Therapeutic/care management study
The birth of a multicultural funeral home.
van der Pijl, Yvon
2017-01-01
In 2014, the Dutch Funeral Organization Yarden started with the participatory preparations for a multicultural funeral home. The project aims at a 24/7 service for the super-diverse population of Amsterdam and beyond. This article gives an ethnographic account of Yarden's efforts to capture cultural diversity. It explores how a multicultural gaze creates a power/knowledge dynamic producing new discourses and shaping new layers of significance. The study then turns into arguing that the birth of the multicultural home is, above all, a cultural, collaborative search leaving (counter-discursive) space for creativity, change, and cultural renewal of all actors involved.
Designing for Active Place Presence at Home
DEFF Research Database (Denmark)
Ylirisku, Salu; Jylhä, Antti; Lehtiö, Anu
2016-01-01
Technological support for augmenting the relationship that people establish with remote places has been studied fairly little as the primary focus in telepresence studies is the connection between people. This paper addresses the design challenge for supporting ‘active place presence’ at home...... to be considered when designing for active place presence at home........ A prototype, Hole in Space, was created to explore the design challenge. A longitudinal study of how an urban couple appropriated the prototype was conducted over the duration of seven months. The paper elaborates on how the Web-mediated design influenced place presence and outlines several aspects that need...
Women at Home and Women in the Workplace in Matthew Weiner´s "Mad Men"
Directory of Open Access Journals (Sweden)
Susana Sánchez Renieblas
2013-01-01
Full Text Available Matthew Weiner´s successful American TV series, Mad Men (2007, set in the 1960s in New York, unmasks the private and the public spaces of the home and the office. In these spaces, not only do the masculine protagonists interact, but also several feminine characters do as well. The three female characters (Betty, Peggy and Joan, who will be analyzed, represent the female stereotypes of this period: the idyllic housewife, the Sandra Dee prototype and the bombshell Marilyn Monroe archetype. In comparing the private and public spaces of the home and the office, these women´s sexuality and submission will be affected and influenced by the spaces they inhabit.
Space station astronauts discuss life in space during AGU interview
Showstack, Randy
2012-07-01
Just one day after China's Shenzhou-9 capsule, carrying three Chinese astronauts, docked with the Tiangong-1 space lab on 18 June, Donald Pettit, a NASA astronaut on the International Space Station (ISS), said it is “a step in the right direction” that more people are in space. “Before they launched, there were six people in space,” he said, referring to those on ISS, “and there are 7 billion people on Earth.” The astronauts were “like one in a billion. Now there are nine people in space,” Pettit said during a 19 June interview that he and two other astronauts onboard ISS had with AGU. Pettit continued, “So the gradient of human beings going into space is moving in the right direction. We need to change these numbers so that more and more human beings can call space their home so we can expand off of planet Earth and move out into our solar system.”
Providência, Rui; Candeias, Rui; Morais, Carlos; Reis, Hipólito; Elvas, Luís; Sanfins, Vitor; Farinha, Sara; Eggington, Simon; Tsintzos, Stelios
2014-05-06
To estimate the short- and long-term financial impact of early referral for implantable loop recorder diagnostic (ILR) versus conventional diagnostic pathway (CDP) in the management of unexplained syncope (US) in the Portuguese National Health Service (PNHS). A Markov model was developed to estimate the expected number of hospital admissions due to US and its respective financial impact in patients implanted with ILR versus CDP. The average cost of a syncope episode admission was estimated based on Portuguese cost data and landmark papers. The financial impact of ILR adoption was estimated for a total of 197 patients with US, based on the number of syncope admissions per year in the PNHS. Sensitivity analysis was performed to take into account the effect of uncertainty in the input parameters (hazard ratio of death; number of syncope events per year; probabilities and unit costs of each diagnostic test; probability of trauma and yield of diagnosis) over three-year and lifetime horizons. The average cost of a syncope event was estimated to be between 1,760€ and 2,800€. Over a lifetime horizon, the total discounted costs of hospital admissions and syncope diagnosis for the entire cohort were 23% lower amongst patients in the ILR group compared with the CDP group (1,204,621€ for ILR, versus 1,571,332€ for CDP). The utilization of ILR leads to an earlier diagnosis and lower number of syncope hospital admissions and investigations, thus allowing significant cost offsets in the Portuguese setting. The result is robust to changes in the input parameter values, and cost savings become more pronounced over time.
The moral geography of home care.
Liaschenko, J
1994-12-01
One result of the historical division of labor between nurses and physicians is that nurses became the eyes and ears of the physician, extending their perceptual capabilities across space and time. This "gaze of medicine" has evolved with the rise of technology, hospitals, and the medical profession to a sort of scientific totalitarianism. Protecting and enhancing patient agency, which is part of the moral work of nursing practice, can be difficult under such circumstances. Yet the geography of sickness is changing as patients move from the hospital back to the home. Because home is thought of as private, as the patient's domain, nurses may think that supporting patient agency will be easier with this transformation of health care. But that assumption may not be warranted since the gaze of medicine will follow patients and change the landscape of the home. The challenge for nursing will be to sharpen the "gaze of nursing," which is an antidote to the strictly biomedical understanding of disease.
Designing for Collective Interaction: Toward Desirable Spaces in Homes and Libraries
DEFF Research Database (Denmark)
Petersen, Marianne Graves; Krogh, Peter
2010-01-01
that there are two people working together when dealing with nuclear explosives. For a number of years we have researched in collaborative systems for libraries, museums, and homes and as such we are part of the move of CSCW systems out of the workplace and into new domains investigating the charac...
Future home hemodialysis - advantages of the NxStage System One.
Takahashi, Susumu
2012-01-01
To improve the quality of life (QOL) of patients with renal failure who are on dialysis, we have been working to promote home hemodialysis (HHD), but it has not come into widespread use at present because of various problems, including limitations of the equipment, the large proportion of elderly patients, and difficulty performing self-care. With regard to problems with the equipment, dialysis equipment for home use has not yet been approved in Japan, so equipment designed for medical facilities has to be used for home dialysis. Such equipment is bulky and occupies living space, as well as involving the cost of home renovation and the need for a caregiver. The NxStage System One (NSO) artificial kidney has served advantages for HHD compared with conventional equipment, since it is compact, portable, and easy to operate (especially for preparation and cleaning), does not require a water supply, occupies less living space, and reduces the need for renovation of the home. Other advantages of the NSO include improvement of QOL by saving time travelling to hospitals and helping patients to participate in social activities. In addition, HHD with the NSO can improve sleep disorders, the restless legs syndrome, and depressive symptoms, resulting in a good outcome. Moreover, HHD with the NSO reduces the need for drugs, such as antihypertensive medications and erythropoietin, possibly leading to saving of healthcare costs. Copyright © 2012 S. Karger AG, Basel.
A Study on Home Based Enterprises in Kampoeng Pandean as Supporting Sustainable Architecture
Directory of Open Access Journals (Sweden)
Safeyah Muchlisiniyati
2016-01-01
Full Text Available Home Based Enterprises (HBEs provide an enormous impact on the lives of the citizens and the environment. The impacts include: increase income and welfare of the family, provide job opportunities, improve the quality of homes and the environment, and ensure life sustainability. The existence of the business leads changes to the house. Those changes that made to the house are often ignore the comfort of home space and the environment as living space. This study aims to look at the development of HBEs performed by community in Kampoeng Pandean. The measurement items used are architectural sustainability factors, ie economical sustainability, social sustainability, and enviromental sustainability. The study is located in Kampoeng Pandean Sidoarjo. The method used is a combination of qualitative and quantitative method. The results show that HBEs in Kampoeng Pandean have not fully supported the sustainable architecture. Environmental sustainability has not been met, due to the density of the environment, the high percentage of building area to land area, and the construction of business space does not consider the comfort factor.
An exploration of occupation in nursing home residents with dementia
LENUS (Irish Health Repository)
Morgan-Brown, Mark
2011-05-01
Objectives: This study evaluated the sitting room environment of two nursing homes in Ireland, using interactive occupation and social engagement as outcome measures and defining these rooms as occupational spaces.\\r\
Vega-Barbas, Mario; Pau, Iván; Martín-Ruiz, María Luisa; Seoane, Fernando
2015-01-01
Smart spaces foster the development of natural and appropriate forms of human-computer interaction by taking advantage of home customization. The interaction potential of the Smart Home, which is a special type of smart space, is of particular interest in fields in which the acceptance of new technologies is limited and restrictive. The integration of smart home design patterns with sensitive solutions can increase user acceptance. In this paper, we present the main challenges that have been identified in the literature for the successful deployment of sensitive services (e.g., telemedicine and assistive services) in smart spaces and a software architecture that models the functionalities of a Smart Home platform that are required to maintain and support such sensitive services. This architecture emphasizes user interaction as a key concept to facilitate the acceptance of sensitive services by end-users and utilizes activity theory to support its innovative design. The application of activity theory to the architecture eases the handling of novel concepts, such as understanding of the system by patients at home or the affordability of assistive services. Finally, we provide a proof-of-concept implementation of the architecture and compare the results with other architectures from the literature. PMID:25815449
Building a design community for sustainable homes through configuration and open innovation
DEFF Research Database (Denmark)
Thuesen, Christian Langhoff; Jespersen, Kristina Risom
2009-01-01
. Furthermore will an idea space collect and rate ideas from the users. Through a combination of technical and user driven innovation the design community will act as a learning tool for the users and producers and thereby facilitate the development of a market for sustainable homes.......This paper presents a development project which aims to create a market place for sustainable homes – around a design community where the uses and producers collectively can develop new energy efficient solutions and thereby reduce the emmisson of CO2. The core functionality of the design community...... is a configurator where the users based on the produceres templates can design their own home at a selected address visualizing and estimating the energy consumption, total cost, CO2 emission etc. All the designs will be collected and rated in a design space creating transparency over the market and technologies...
Regularity and predictability of human mobility in personal space.
Directory of Open Access Journals (Sweden)
Daniel Austin
Full Text Available Fundamental laws governing human mobility have many important applications such as forecasting and controlling epidemics or optimizing transportation systems. These mobility patterns, studied in the context of out of home activity during travel or social interactions with observations recorded from cell phone use or diffusion of money, suggest that in extra-personal space humans follow a high degree of temporal and spatial regularity - most often in the form of time-independent universal scaling laws. Here we show that mobility patterns of older individuals in their home also show a high degree of predictability and regularity, although in a different way than has been reported for out-of-home mobility. Studying a data set of almost 15 million observations from 19 adults spanning up to 5 years of unobtrusive longitudinal home activity monitoring, we find that in-home mobility is not well represented by a universal scaling law, but that significant structure (predictability and regularity is uncovered when explicitly accounting for contextual data in a model of in-home mobility. These results suggest that human mobility in personal space is highly stereotyped, and that monitoring discontinuities in routine room-level mobility patterns may provide an opportunity to predict individual human health and functional status or detect adverse events and trends.
Brennan, Patricia Flatley; Ponto, Kevin; Casper, Gail; Tredinnick, Ross; Broecker, Markus
2015-10-01
The physical spaces within which the work of health occurs - the home, the intensive care unit, the emergency room, even the bedroom - influence the manner in which behaviors unfold, and may contribute to efficacy and effectiveness of health interventions. Yet the study of such complex workspaces is difficult. Health care environments are complex, chaotic workspaces that do not lend themselves to the typical assessment approaches used in other industrial settings. This paper provides two methodological advances for studying internal health care environments: a strategy to capture salient aspects of the physical environment and a suite of approaches to visualize and analyze that physical environment. We used a Faro™ laser scanner to obtain point cloud data sets of the internal aspects of home environments. The point cloud enables precise measurement, including the location of physical boundaries and object perimeters, color, and light, in an interior space that can be translated later for visualization on a variety of platforms. The work was motivated by vizHOME, a multi-year program to intensively examine the home context of personal health information management in a way that minimizes repeated, intrusive, and potentially disruptive in vivo assessments. Thus, we illustrate how to capture, process, display, and analyze point clouds using the home as a specific example of a health care environment. Our work presages a time when emerging technologies facilitate inexpensive capture and efficient management of point cloud data, thus enabling visual and analytical tools for enhanced discharge planning, new insights for designers of consumer-facing clinical informatics solutions, and a robust approach to context-based studies of health-related work environments. Copyright © 2015 Elsevier Inc. All rights reserved.
Home birth after hospital birth: women's choices and reflections.
Bernhard, Casey; Zielinski, Ruth; Ackerson, Kelly; English, Jessica
2014-01-01
The number of US women choosing home birth is increasing. Little is known about women who choose home birth after having experienced hospital birth; therefore, the purpose of this research was to explore reasons why these women choose home birth and their perceptions regarding their birth experiences. Qualitative description was the research design, whereby focus groups were conducted with women who had hospital births and subsequently chose home birth. Five focus groups were conducted (N = 20), recorded, and transcribed verbatim. Qualitative content analysis was undertaken allowing themes to emerge. Five themes emerged from the women's narratives: 1) choices and empowerment: with home birth, women felt they were given real choices rather than perceived choices, giving them feelings of empowerment; 2) interventions and interruptions: women believed things were done that were not helpful to the birth process, and there were interruptions associated with their hospital births; 3) disrespect and dismissal: participants believed that during hospital birth, providers were more focused on the laboring woman's uterus, with some experiencing dismissal from their hospital provider when choosing to birth at home; 4) birth space: giving birth in their own home, surrounded by people they chose, created a peaceful and calm environment; and 5) connection: women felt connected to their providers, families, newborns, and bodies during their home birth. For most participants, dissatisfaction with hospital birth influenced their subsequent decision to choose home birth. Despite experiencing challenges associated with this decision, women expressed satisfaction with their home birth. © 2014 by the American College of Nurse-Midwives.
Pure random search for ambient sensor distribution optimisation in a smart home environment.
Poland, Michael P; Nugent, Chris D; Wang, Hui; Chen, Liming
2011-01-01
Smart homes are living spaces facilitated with technology to allow individuals to remain in their own homes for longer, rather than be institutionalised. Sensors are the fundamental physical layer with any smart home, as the data they generate is used to inform decision support systems, facilitating appropriate actuator actions. Positioning of sensors is therefore a fundamental characteristic of a smart home. Contemporary smart home sensor distribution is aligned to either a) a total coverage approach; b) a human assessment approach. These methods for sensor arrangement are not data driven strategies, are unempirical and frequently irrational. This Study hypothesised that sensor deployment directed by an optimisation method that utilises inhabitants' spatial frequency data as the search space, would produce more optimal sensor distributions vs. the current method of sensor deployment by engineers. Seven human engineers were tasked to create sensor distributions based on perceived utility for 9 deployment scenarios. A Pure Random Search (PRS) algorithm was then tasked to create matched sensor distributions. The PRS method produced superior distributions in 98.4% of test cases (n=64) against human engineer instructed deployments when the engineers had no access to the spatial frequency data, and in 92.0% of test cases (n=64) when engineers had full access to these data. These results thus confirmed the hypothesis.
Home range size and breeding dispersal of a common buzzard (Buteo buteo
Directory of Open Access Journals (Sweden)
Väli Ülo
2017-12-01
Full Text Available Telemetric studies have provided ample information on threatened raptors, but still little is known about space use and dispersal of common species. Here I describe the home range and breeding dispersal of a GPS-tracked adult male common buzzard, studied in south-eastern Estonia in 2014–16. This buzzard’s home range covered 8.3 km2 (kernel 95% estimate with the core range being 2.1 km2 (kernel 50%. The home range increased in the course of the breeding season but decreased again before migration. Surprisingly, the nests in the two successive breeding years were located in the opposite margins of the home range, 1.7 km from each other.
Field Evaluation of Advances in Energy-Efficiency Practices for Manufactured Homes
Energy Technology Data Exchange (ETDEWEB)
Levy, E. [Advanced Residential Integrated Energy Solutions (ARIES) Collaborative, New York, NY (United States); Dentz, J. [Advanced Residential Integrated Energy Solutions (ARIES) Collaborative, New York, NY (United States); Ansanelli, E. [Advanced Residential Integrated Energy Solutions (ARIES) Collaborative, New York, NY (United States); Barker, G. [Advanced Residential Integrated Energy Solutions (ARIES) Collaborative, New York, NY (United States); Rath, P. [Advanced Residential Integrated Energy Solutions (ARIES) Collaborative, New York, NY (United States); Dadia, D. [Advanced Residential Integrated Energy Solutions (ARIES) Collaborative, New York, NY (United States)
2016-03-01
Through field-testing and analysis, this project evaluated whole-building approaches and estimated the relative contributions of select technologies toward reducing energy use related to space conditioning in new manufactured homes. Three lab houses of varying designs were built and tested side-by-side under controlled conditions in Russellville, Alabama. The tests provided a valuable indicator of how changes in the construction of manufactured homes can contribute to significant reductions in energy use.
DEFF Research Database (Denmark)
Petersen, Marianne Graves; Grønbæk, Kaj
2004-01-01
collaborative structuring and ubiquitous presentation of materials in private homes. With DoHM we propose establishing new relationship between digital and physical hyperspaces, folding hyperspaces into the physical space of the household. Thus we strive to combine the qualities of physical domestic materials...... and spaces with the flexibility and dynamics of digital hyperspaces. We propose a variety of new ubiquitous home appliances called MediaWall, MediaTable, MediaTray and MediaPort, which address these issues....
DEFF Research Database (Denmark)
Petersen, Marianne Graves; Grønbæk, Kaj
2004-01-01
collaborative structuring and ubiquitous presentation of materials in private homes. With DoHM we propose establishing new relationship between digital and physical hyperspaces, folding hyperspaces into the physical space of the household. Thus we strive to combine the qualities of physical domestic materials...... and spaces with the flexibility and dynamics of digital hyperspaces. We propose a variety of new ubiquitous home appliances called MediaWall, MediaTable, MediaTray and MediaPort, which address these issues....
Information Cyberspace and Future Cyber Homes
Directory of Open Access Journals (Sweden)
Eduard Babulak
2006-04-01
Full Text Available The current Internet combines very complex communications infrastructures, while connecting users globally and at the same time creating information cyberspace systems. Large companies such as Philips are working on communications technologies that will facilitate fully automated households (i.e., Cyber Homes. Today, people are using are using small digital pagers and phones with embedded computers and displays, palm-size computers such as Palm Pilot, notebook-size panel computers and wall-size displays. Current research and development trends in the field of Telecommunications and computing industries continues towards a human centric computing, smart spaces, smart devices, clothing, fully automated houses etc. This new technology creates environment where computers are everywhere and provide online access to information at any time to anyone. In this paper, the author discusses new technological trends directions in the Internet, E-commerce and Automation Industries, while presenting his own vision on application of ubiquitous computing in the future cyber home automation. In support of creating future fully automated cyber homes, the author promotes creation of interdisciplinary and multinational research and development teams world-wide.
Solar Energy: Uses for Your Home. The CIRcular: Consumer Information Report 15.
Bank of America NT & SA, San Francisco, CA.
This report defines active and passive solar energy systems, describes home uses for solar energy, and offers guidelines for choosing and installing a system. Much of the information is specific to the state of California. Uses for solar energy which are presented include passive space heating, passive cooling, active space heating, household…
Investigating Solutions to Wind Washing Issues in Two-Story Florida Homes, Phase 2
Energy Technology Data Exchange (ETDEWEB)
Withers, Charles R. [Florida Solar Energy Center, Cocoa, FL (United States); Kono, Jamie [Florida Solar Energy Center, Cocoa, FL (United States)
2015-04-13
With U.S. Department of Energy goals of reducing existing home energy use by 30% and new home energy use by 50%, it is imperative to focus on several energy efficiency measures, including the quality of air and thermal barriers. This report provides results from a second-phase research study of a phenomenon generally referred to as wind washing. Wind washing is the movement of unconditioned air around or through building thermal barriers in such a way as to diminish or nullify the intended thermal performance. In some cases, thermal and air barriers are installed very poorly or not at all, and air can readily move from unconditioned attic spaces into quasi-conditioned interstitial spaces. This study focused on the impact of poorly sealed and insulated floor cavities adjacent to attic spaces in Florida homes. In these cases, unconditioned attic air can be transferred into floor cavities through pathways driven by natural factors such as wind, or by thermal differences between the floor cavity and the attic. Air can also be driven into a floor cavity through mechanical forces imposed by return duct leakage in the floor cavity.
Innes, Anthea; Kelly, Fiona; Dincarslan, Ozlem
2011-07-01
To report on the views of people with dementia who live in care homes and their family carers on aspects of design that are important to them, and discuss these in relation to developing physical care environments that respond to the wishes of people with dementia and their family carers. Six focus groups were held: two in Northern Ireland and four in Scotland. A total of 40 people participated in the focus groups. Twenty nine people were with dementia (24 female and five male), and 11 were family carers (10 female and one male). Carers discussed the features of a building they took into account when selecting a care home, and discussed this in relation to 'bricks and mortar versus people'. Key themes reported by people with dementia and their family carers included how the space in the environment is used, for example, what happens in the building and the presence or absence of certain design features. Outside space and wayfinding aids were identified as positive features of the home, along with a general lack of concern about ensuite provision. The results demonstrate the complexity of building design as it must provide living space acceptable to people with dementia living there and family members who visit, as well as provide a workable environment for staff. The findings highlight areas that should be considered by care home teams involved in the build of a new home or the redevelopment of an existing care home.
From Energy Audits to Home Performance: 30 Years of Articles in Home Energy Magazine
Energy Technology Data Exchange (ETDEWEB)
Meier, Alan
2014-08-11
Home Energy Magazine has been publishing articles about residential energy efficiency for 30 years. Its goal has been to disseminate technically reliable and neutral information to the practitioners, that is, professionals in the business of home energy efficiency. The articles, editorials, letters, and advertisements are a kind of window on the evolution of energy conservation technologies, policies, and organizations. Initially, the focus was on audits and simple retrofits, such as weatherstripping and insulation. Instrumentation was sparse sometimes limited to a ruler to measure depth of attic insulation and a blower door was exotic. CFLs were heavy, awkward bulbs which might, or might not, fit in a fixture. Saving air conditioning energy was not a priority. Solar energy was only for the most adventurous. Thirty years on, the technologies and business have moved beyond just insulating attics to the larger challenge of delivering home performance and achieving zero net energy. This shift reflects the success in reducing space heating energy and the need to create a profitable industry by providing more services. The leading edge of the residential energy services market is becoming much more sophisticated, offering both efficiency and solar systems. The challenge is to continue providing relevant and reliable information in a transformed industry and a revolutionized media landscape.
DEFF Research Database (Denmark)
Christian, Hayley; Maitland, Clover; Enkel, Stephanie
2016-01-01
to determine outdoor location of physical activity around the home and neighbourhood for a subsample (n=310). The day care environment will be objectively measured using a validated audit tool. Other potential individual, social and physical environmental influences on preschoolers' physical activity...... such as long day care. Research is required to determine how the design of day care outdoor (and indoor) spaces provides opportunities or constraints for physical activity. A significant evidence gap surrounds what objectively measured attributes of the home and neighbourhood environment influence preschoolers......' physical activity. The PLAY Spaces & Environments for Children's Physical Activity (PLAYCE) study will empirically investigate the relative and cumulative influence of the day care, home and neighbourhood environment on preschoolers' physical activity. METHODS AND ANALYSIS: The PLAYCE study is a cross...
Getting Sloshed in Outer Space
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 12. Getting Sloshed in Outer Space - Liquid Behavior in Microgravity. N Ananthkrishnan. General Article Volume 12 Issue 12 December 2007 pp 40-45. Fulltext. Click here to view fulltext PDF. Permanent link:
Yiu, Sze-Wing; Parrini, Francesca; Karczmarski, Leszek; Keith, Mark
2017-07-01
Understanding of animal spatial behavior is essential for informed management decisions. In southern Africa, reintroduction of lions (Panthera leo) to small reserves (lions reintroduced to Dinokeng Game Reserve, South Africa, during 2011 through 2014. Lions established home ranges close to their release sites and during the following 3 years their home range sizes continued to increase, but in each individual case the size remained smaller than half of the reserve area (60 separate visits) around the largest dam and along rivers suggest the importance of water and its surrounding vegetation in the lions' space utilization pattern. The home range size did not differ with season or sex of the individuals, whereas shifts in locations of home ranges revealed differences in the response of the 2 sexes to territorial conflicts and management interventions. Our study shows a dynamic home range utilization pattern and highlights the importance of both fine-scale space use patterns (frequency and duration of visits) and broad-scale home range changes in understanding the ranging behavior of reintroduced animals. © 2016 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and John Wiley & Sons Australia, Ltd.
Phased Retrofits in Existing Homes in Florida Phase II: Shallow Plus Retrofits
Energy Technology Data Exchange (ETDEWEB)
Sutherland, K. [Building America Partnership for Improved Residential Construction, Cocoa, FL (United States); Parker, D. [Building America Partnership for Improved Residential Construction, Cocoa, FL (United States); Martin, E. [Building America Partnership for Improved Residential Construction, Cocoa, FL (United States); Chasar, D. [Building America Partnership for Improved Residential Construction, Cocoa, FL (United States); Amos, B. [Building America Partnership for Improved Residential Construction, Cocoa, FL (United States)
2016-02-03
The BAPIRC team and Florida Power and Light (FPL) electric utility pursued a pilot phased energy-efficiency retrofit program in Florida by creating detailed data on the energy and economic performance of two levels of retrofit - simple and deep. For this Phased Deep Retrofit (PDR) project, a total of 56 homes spread across the utility partner's territory in east central Florida, southeast Florida, and southwest Florida were instrumented between August 2012 and January 2013, and received simple pass-through retrofit measures during the period of March 2013 - June 2013. Ten of these homes received a deeper package of retrofits during August 2013 - December 2013. A full account of Phase I of this project, including detailed home details and characterization, is found in Parker et al, 2015 (currently in draft). Phase II of this project, which is the focus of this report, applied the following additional retrofit measures to select homes that received a shallow retrofit in Phase I: a) Supplemental mini-split heat pump (MSHP) (6 homes); b) Ducted and space coupled Heat Pump Water Heater (8 homes); c) Exterior insulation finish system (EIFS) (1 homes); d) Window retrofit (3 homes); e) Smart thermostat (21 homes: 19 NESTs; 2 Lyrics); f) Heat pump clothes dryer (8 homes); g) Variable speed pool pump (5 homes).
Heat Pump Water Heaters and American Homes: A Good Fit?
Energy Technology Data Exchange (ETDEWEB)
Franco, Victor; Lekov, Alex; Meyers, Steve; Letschert, Virginie
2010-05-14
Heat pump water heaters (HPWHs) are over twice as energy-efficient as conventional electric resistance water heaters, with the potential to save substantial amounts of electricity. Drawing on analysis conducted for the U.S. Department of Energy's recently-concluded rulemaking on amended standards for water heaters, this paper evaluates key issues that will determine how well, and to what extent, this technology will fit in American homes. The key issues include: 1) equipment cost of HPWHs; 2) cooling of the indoor environment by HPWHs; 3) size and air flow requirements of HPWHs; 4) performance of HPWH under different climate conditions and varying hot water use patterns; and 5) operating cost savings under different electricity prices and hot water use. The paper presents the results of a life-cycle cost analysis of the adoption of HPWHs in a representative sample of American homes, as well as national impact analysis for different market share scenarios. Assuming equipment costs that would result from high production volume, the results show that HPWHs can be cost effective in all regions for most single family homes, especially when the water heater is not installed in a conditioned space. HPWHs are not cost effective for most manufactured home and multi-family installations, due to lower average hot water use and the water heater in the majority of cases being installed in conditioned space, where cooling of the indoor environment and size and air flow requirements of HPWHs increase installation costs.
Modern Architecture, Spatial Precarity and the Female Body in the Domestic Spaces in Iran
Directory of Open Access Journals (Sweden)
Ladan Rahbari
2016-12-01
Full Text Available Iranian home is used as private, semi-private and public spaces. It has kept its traditional functions despite alterations in its structure and is a space for women to engage in caretaking and housekeeping activities. In this paper, I will discuss how modern architecture and its consequences such as the deletion of women-only spaces called Andarooni, has not acknowledged women's appropriation of the domestic space as it is not conformed to the Iranian lifestyle and patterns of social relations. Using ethnography, participant observation and informal conversations with Iranian women, I investigate the characteristics of the contemporary home which reveal how disappearing privateness of the domestic space has contributed to women's precarious bodily freedom in domestic spaces.
Categories of space in music and lifestyles
Directory of Open Access Journals (Sweden)
Milenković Pavle
2015-01-01
Full Text Available This paper discusses the connection between categories of space in music, music production and lifestyles. The relations between the symbolic space of social connections and musical contents in the social space of various status interactions is complex and contradictory. Category of space in the music exists in four forms. Categories of space in the description of the experience of the musical works, as well as in the way of music production (spacing are the integral part of the special way of consumption of these works (home Hi-Fi, and represent the social status, ways of cultural consumption and habitus in general.
Activity modeling under uncertainty by trace of objects in smart homes
National Aeronautics and Space Administration — A typical resident of a smart home can be an Alzheimer patient that forgets sometimes to complete the activities that he begins. The key point to assist the smart...
Quality of Public Open Spaces and Recreational Walking.
Sugiyama, Takemi; Gunn, Lucy D; Christian, Hayley; Francis, Jacinta; Foster, Sarah; Hooper, Paula; Owen, Neville; Giles-Corti, Billie
2015-12-01
We examined associations between specific public open space (POS) attributes and recreational walking to local POS. Between October 2004 and December 2006, 1465 adults of the RESIDential Environments Project, conducted in Perth, Australia, reported whether they walk to a POS for recreation. For each participant, we identified all open spaces larger than 0.8 hectares within 1.6 kilometers from home. On the basis of field audit data, we created 3 scores (presence, count, size-weighted presence) for 19 specific open space attributes. With logistic regression analyses, we found that walking to a POS was associated with the presence of gardens, grassed areas, walking paths, water features, wildlife, amenities, dog-related facilities, and off-leash areas for dogs. It was also associated with the highest number of these attributes in a single open space, but not with the total number of attributes in all POSs within 1.6 kilometers of home. Building 1 high-quality local park may be more effective in promoting recreational walking than is providing many average-quality parks.
Mini-Split Heat Pump Evaluation and Zero Energy Ready Home Support
Energy Technology Data Exchange (ETDEWEB)
Herk, Anastasia [IBACOS, Inc., Pittsburgh, PA (United States)
2017-01-01
This project was created from a partnership between the U.S. Department of Energy’s (DOE’s) Building America research team IBACOS, Inc. and Imagine Homes, a production homebuilder of high-performance homes in San Antonio, Texas—a hot-humid climate. The primary purpose was to evaluate the performance of a multihead mini-split heat pump (MSHP) space-conditioning system, which consists of ducted and ductless indoor units, in maintaining uniform comfort in an occupied test house. The research team evaluated the MSHP space-conditioning strategy for its effectiveness in achieving uniform temperature and relative humidity (RH) levels throughout the test house and for overall constructability and cost. This evaluation was based on data that were collected from short-term tests and monitoring during 1 year of occupancy, as well as from builder and occupant feedback. Design considerations for integrating an MSHP system into the builder’s full range of production home designs were also explored, with a focus on minimizing the cost and complexity of the system design while meeting the thermal loads of the house and providing occupant comfort according to ANSI/ASHRAE Standard 55-2010 (ASHRAE 2010a).
Home range and movements of Feral cats on Mauna Kea, Hawai'i
Goltz, Dan M.; Hess, S.C.; Brinck, K.W.; Banko, P.C.; Danner, R.M.
2008-01-01
Feral cats Felis catus in dry subalpine woodland of Mauna Kea, Hawai'i, live in low density and exhibit some of the largest reported home ranges in the literature. While 95% fixed kemel home range estimates for three females averaged 772 ha, four males averaged 1 418 ha, and one male maintained a home range of 2 050 ha. Mean daily movement rates between sexes overlapped widely and did not differ significantly (P = 0.083). Log-transformed 95% kernel home ranges for males were significantly larger than those of females (P = 0.024), but 25% kernel home ranges for females were larger than those of males (P = 0.017). Moreover, log-transformed home ranges of males were also significantly larger than those of females in this and seven other studies from the Pacific region (P = 0.044). Feral cats present a major threat to endangered Hawaiian birds, but knowledge of their ecology can be used for management by optimizing trap spacing and creating buffer zones around conservation areas.
Programming iSpaces - A Tale of Two Paradigms
Callaghan, V.; Colley, M.; Hagras, H.; Chin, J.; Doctor, F.; Clarke, G.
'iSpace, the final frontier' - this parody of Star Trek encapsulates many of our aspirations for this area as, in the longer term, iSpaces are likely to be the key to mankind's successful exploration of deep space. In outer space, or hostile planetary habitats, it is inevitable that people will survive in wholly technologically supported artificial environments [1]. Such environments will contain numerous communicating computers embedded into a myriad of devices, sensing, acting, delivering media, processing data, and providing services that enhance the life-style and effectiveness of the occupant and, in outer space, preserving human life. Such environments will also include robots [2]. In today's iSpaces, while human life will not normally be at stake, the underlying principles and technology are much the same. Today our homes are rapidly being filled with diverse types of products ranging from simple lighting systems to sophisticated entertainment systems, all adding to the functionality and convenience available to the home user. The iSpace approach envisages that, one day soon, most artefacts will contain embedded computers and network connections, opening up the possibility for hundreds of communicating devices, co-operating in communities serving the occupant(s). The seeds of this revolution have already been sown in that pervasive technologies such as the Internet and mobile telephones already boast over 200 and 680 million users, respectively [3].
DOE Zero Energy Ready Home Case Study: United Way of Long Island, United Veterans Beacon House
Energy Technology Data Exchange (ETDEWEB)
Pacific Northwest National Laboratory
2017-09-01
United Way of Long Island’s Housing Development Corporation built this 3,719-ft2 two–story, 5-bedroom home in Huntington Station, New York, to the rigorous performance requirements of the U.S. Department of Energy’s Zero Energy Ready Home Program. The home is packed with high-performance features like LED lighting and ENERGY STAR appliances. The asymmetrical, optimally angled roof provides plenty of space for roof-mounted solar panels for electric generation and hot water.
Short-Term Space-Use Patterns of Translocated Mojave Desert Tortoise in Southern California.
Directory of Open Access Journals (Sweden)
Matthew L Farnsworth
Full Text Available Increasingly, renewable energy comprises a larger share of global energy production. Across the western United States, public lands are being developed to support renewable energy production. Where there are conflicts with threatened or endangered species, translocation can be used in an attempt to mitigate negative effects. For the threatened Mojave desert tortoise (Gopherus agassizii, we sought to compare habitat- and space-use patterns between short-distance translocated, resident, and control groups. We tested for differences in home range size based on utilization distributions and used linear mixed-effects models to compare space-use intensity, while controlling for demographic and environmental variables. In addition, we examined mean movement distances as well as home range overlap between years and for male and female tortoises in each study group. During the first active season post-translocation, home range size was greater and space-use intensity was lower for translocated tortoises than resident and control groups. These patterns were not present in the second season. In both years, there was no difference in home range size or space-use intensity between control and resident groups. Translocation typically resulted in one active season of questing followed by a second active season characterized by space-use patterns that were indistinguishable from control tortoises. Across both years, the number of times a tortoise was found in a burrow was positively related to greater space-use intensity. Minimizing the time required for translocated tortoises to exhibit patterns similar to non-translocated individuals may have strong implications for conservation by reducing exposure to adverse environmental conditions and predation. With ongoing development, our results can be used to guide future efforts aimed at understanding how translocation strategies influence patterns of animal space use.
Stardust@home: An Interactive Internet-based Search for Interstellar Dust
Mendez, B. J.; Westphal, A. J.; Butterworth, A. L.; Craig, N.
2006-12-01
On January 15, 2006, NASA's Stardust mission returned to Earth after nearly seven years in interplanetary space. During its journey, Stardust encountered comet Wild 2, collecting dust particles from it in a special material called aerogel. At two other times in the mission, aerogel collectors were also opened to collect interstellar dust. The Stardust Interstellar Dust Collector is being scanned by an automated microscope at the Johnson Space Center. There are approximately 700,000 fields of view needed to cover the entire collector, but we expect only a few dozen total grains of interstellar dust were captured within it. Finding these particles is a daunting task. We have recruited many thousands of volunteers from the public to aid in the search for these precious pieces of space dust trapped in the collectors. We call the project Stardust@home. Through Stardust@home, volunteers from the public search fields of view from the Stardust aerogel collector using a web-based Virtual Microscope. Volunteers who discover interstellar dust particles have the privilege of naming them. The interest and response to this project has been extraordinary. Many people from all walks of life are very excited about space science and eager to volunteer their time to contribute to a real research project such as this. We will discuss the progress of the project and the education and outreach activities being carried out for it.
Poss, Jeffrey W; Sinn, Chi-Ling Joanna; Grinchenko, Galina; Blums, Jane; Peirce, Tom; Hirdes, John
2017-02-01
We examine recipients of publicly funded ongoing care in a single Ontario jurisdiction who reside in three different settings: long-stay home care patients in private homes and apartments, other patients in retirement homes and residents of long-term care homes, using interRAI assessment instruments. Among home care patients, those in retirement homes have higher proportions of dementia and moderate cognitive impairment, less supportive informal care systems as well as more personal care and nursing services above those provided by the public home care system, more frequent but shorter home support visits and lower than expected public home care expenditures. These lower expenditures may be because of efficiency of care delivery or by retirement homes providing some services otherwise provided by the public home care system. Although persons in each setting are mostly older adults with high degrees of frailty and medical complexity, long-term care home residents show distinctly higher needs. We estimate that 40% of retirement home residents are long-stay home care patients, and they comprise about one in six of this Community Care Access Centre's long-stay patients. Copyright © 2017 Longwoods Publishing.
Near zero energy homes – What do users think?
International Nuclear Information System (INIS)
Berry, Stephen; Whaley, David; Davidson, Kathryn; Saman, Wasim
2014-01-01
With policy directions firmly moving towards net zero energy homes, what do we know about the perceptions and experiences of households who already live in homes at or near that standard? The research sets out to determine whether householders believe these buildings are thermally comfortable, and if they feel confident operating the smart technologies that help achieve the net zero energy outcome? Combining interviews from 25 households and monitored energy data from over 50 near zero energy homes, this paper examines the validity of this policy goal from the building user perspective. The evidence shows households attain high levels of thermal comfort, enjoy lower energy bills, and believe their behaviour has been influenced by the building and its energy systems. Yet many remain concerned that the building industry is unable to produce homes that maintain thermal comfort in all spaces and all seasons. The residents have also identified significant issues in the reliability and usability of the energy technologies. Whilst the policy appears valid from the end-user perspective, the case study highlights the substantial task ahead for policy makers to establish suitable commissioning and compliance processes, and develop effective energy rating tools on the path to zero energy homes. - Highlights: • The policy concept of zero energy homes is examined from the user perspective. • Evidence is collected from a near net zero energy housing estate. • Results show that the homes are highly comfortable and valued by households. • Seasonal differences in the delivery of thermal comfort are found. • Significant design problems and technology reliability issues are identified
DEFF Research Database (Denmark)
Winther, Ida Wentzel
2009-01-01
What is home? A building, a physical and mental phenomenon, or a concept? There are many homes and ways `to home oneself´. Many of us quite often dwell in other places than at home (as professional commuters between two places, as travellers staying in hotels, as children of divorced parents...
Directory of Open Access Journals (Sweden)
Zulkeplee Othman
2014-12-01
Full Text Available Despite a significant increase in enrolments of postgraduate international Muslim students within Australian universities, little is known about their perceptions of life within Australian homes while undertaking their studies. The aim of this study is to investigate the ways in which students’ cultural and religious traditions affect their use of domestic spaces within the homes in which they reside. The research found that participants faced some minor difficulties in achieving privacy, maintaining modesty and extending hospitality while able to perform their daily activities in Australian designed homes. The findings suggest that greater research attention needs to be given to the development of Australian home designs that are adaptable to the needs of a multicultural society. Australian society encompasses diverse cultural customs and requirements with respect to home design, and these are yet to be explored.
Space-time and Local Gauge Symmetries
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 2. Symmetries of Particle Physics: Space-time and Local Gauge Symmetries. Sourendu Gupta. General Article Volume 6 Issue 2 February 2001 pp 29-38. Fulltext. Click here to view fulltext PDF. Permanent link:
Care home manager attitudes to balancing risk and autonomy for residents with dementia.
Evans, Elizabeth A; Perkins, Elizabeth; Clarke, Pam; Haines, Alina; Baldwin, Ashley; Whittington, Richard
2018-02-01
To determine how care home managers negotiate the conflict between maintaining a safe environment while enabling the autonomy of residents with dementia. This is important because there is limited research with care home managers; yet, they are key agents in the implementation of national policies. Semi-structured interviews were conducted with 18 managers from care homes offering dementia care in the Northwest of England. Data were analysed using a thematic analysis approach. There were three areas in which care home staff reported balancing safety and risk against the individual needs of residents. First, the physical environment created a tension between safety and accessibility to the outside world, which meant that care homes provided highly structured or limited access to outdoor space. Second, care home managers reflected a balancing act between an individual's autonomy and the need to protect their residents' dignity. Finally, care home managers highlighted the ways in which an individual's needs were framed by the needs of other residents to the extent that on some occasions an individual's needs were subjugated to the needs of the general population of a home. There was a strong, even dominant, ethos of risk management and keeping people safe. Managing individual needs while maintaining a safe care home environment clearly is a constant dynamic interpersonal process of negotiating and balancing competing interests for care home managers.
Family and home characteristics correlate with mold in homes.
Reponen, Tiina; Levin, Linda; Zheng, Shu; Vesper, Stephen; Ryan, Patrick; Grinshpun, Sergey A; LeMasters, Grace
2013-07-01
Previously, we demonstrated that infants residing in homes with higher Environmental Relative Moldiness Index were at greater risk for developing asthma by age seven. The purpose of this analysis was to identify the family and home characteristics associated with higher moldiness index values in infants' homes at age one. Univariate linear regression of each characteristic determined that family factors associated with moldiness index were race and income. Home characteristics associated with the moldiness index values were: air conditioning, carpet, age of the home, season of home assessment, and house dust mite allergen. Parental history of asthma, use of dehumidifier, visible mold, dog and cat allergen levels were not associated with moldiness index. Results of multiple linear regression showed that older homes had 2.9 units higher moldiness index (95% confidence interval [CI]=0.4, 5.4), whereas homes with central air conditioning had 2.5 units lower moldiness index (95% CI=-4.7, -0.4). In addition, higher dust mite allergen levels and carpeting were positively and negatively associated with higher moldiness index, respectively. Because older homes and lack of air conditioning were also correlated with race and lower income, whereas carpeting was associated with newer homes, the multivariate analyses suggests that lower overall socioeconomic position is associated with higher moldiness index values. This may lead to increased asthma risk in homes inhabited by susceptible, vulnerable population subgroups. Further, age of the home was a surrogate of income, race and carpeting in our population; thus the use of these factors should carefully be evaluated in future studies. Copyright © 2013 Elsevier Inc. All rights reserved.
Situative Space Tracking within Smart Environments
DEFF Research Database (Denmark)
Surie, Dipak; Jäckel, Florian; Janlert, Lars-Erik
2010-01-01
This paper describes our efforts in modeling and tracking a human agent’s situation based on his/her possibilities to perceive and act upon objects (both physical and virtual) within smart environments. A Situative Space Model is proposed. WLAN signal-strength-based situative space tracking syste......-laboratory smart home environment where a global precision of 83.4% and a global recall of 88.6% were obtained.......This paper describes our efforts in modeling and tracking a human agent’s situation based on his/her possibilities to perceive and act upon objects (both physical and virtual) within smart environments. A Situative Space Model is proposed. WLAN signal-strength-based situative space tracking system...
Naik, Ashish K; Rupani, Mihir P; Bansal, R K
2013-12-01
The success of immunization depends highly on the level of cold chain maintenance. The aim of the study was to assess the condition of cold chain equipment, practices adopted for cold chain maintenance and knowledge of the vaccinators. It was a cross-sectional study conducted in 20 UHCs of Surat Municipal Corporation (SMC). Cold chain equipment were observed with regards to their condition, along with the practices adopted by vaccinators for cold chain maintenance. A pre-designed and pre-tested questionnaire was used to interview the vaccinators regarding their knowledge and awareness regarding cold chain practices, management and handling. Data were entered and analyzed using Epi Info v 3.5.1. Simple proportions were calculated. Absence of separate stabilizer for deep freezers and ILRs (85%), ill-maintained temperature-record register, lack of criss-cross pattern of ice packs in deep freezer (65%), presence of things other than ice packs in deep freezer (10%) and things other than vaccines in ILR (10%) indicate poor cold chain maintenance. In addition to this, expired vaccines in ILR (5%), vaccines in the "unusable" stages of VVM (15%), lack of emergency contact number nearby in case of cold chain failure (85%), lack of inverter (85%), lack of generator (85%) and failure to note time of reconstitution on the vaccine vial at the time of vaccination (25%) indicate poor cold chain practices. Lack of knowledge of defrosting of ILR and deep freezer (45%), lack of knowledge about Shake test (40%), lack of knowledge of temperature range to be maintained in deep freezer (70%) and in ILR (15%) indicate poor knowledge of vaccinators. Cold chain maintenance and practices need improvement. Knowledge of vaccinators was overall unsatisfactory.
Dream Home: a multiview stereoscopic interior design system
Hsiao, Fu-Jen; Teng, Chih-Jen; Lin, Chung-Wei; Luo, An-Chun; Yang, Jinn-Cherng
2010-01-01
In this paper, a novel multi-view stereoscopic interior design system, "Dream Home", has been developed to bring users new interior design experience. Different than other interior design system before, we put emphasis on its intuitive manipulation and multi-view stereoscopic visualization in real time. Users can do their own interior design just using their hands and eyes without any difficulty. They manipulate furniture cards directly as they wish to setup their living room in the model house task space, get the multi-view 3D visual feedback instantly, and re-adjust cards until they are satisfied. No special skills are required, and you can explore your design talent arbitrarily. We hope that "Dream Home" will make interior design more user-friendly, more intuitive, and more vivid.
Footwear Matters: Influence of Footwear and Foot Strike on Load Rates during Running.
Rice, Hannah M; Jamison, Steve T; Davis, Irene S
2016-12-01
Running with a forefoot strike (FFS) pattern has been suggested to reduce the risk of overuse running injuries, due to a reduced vertical load rate compared with rearfoot strike (RFS) running. However, resultant load rate has been reported to be similar between foot strikes when running in traditional shoes, leading to questions regarding the value of running with a FFS. The influence of minimal footwear on the resultant load rate has not been considered. This study aimed to compare component and resultant instantaneous loading rate (ILR) between runners with different foot strike patterns in their habitual footwear conditions. Twenty-nine injury-free participants (22 men, seven women) ran at 3.13 m·s along a 30-m runway, with their habitual foot strike and footwear condition. Ground reaction force data were collected. Peak ILR values were compared between three conditions; those who habitually run with an RFS in standard shoes, with an FFS in standard shoes, and with an FFS in minimal shoes. Peak resultant, vertical, lateral, and medial ILR were lower (P strike. When running with an FFS, peak posterior ILR were lower (P strike. Therefore, it appears that footwear alters the load rates during running, even with similar foot strike patterns.
Directory of Open Access Journals (Sweden)
Amanda E Holland
Full Text Available Knowledge of black vulture (Coragyps atratus and turkey vulture (Cathartes aura spatial ecology is surprisingly limited despite their vital ecological roles. Fine-scale assessments of space use patterns and resource selection are particularly lacking, although development of tracking technologies has allowed data collection at finer temporal and spatial resolution. Objectives of this study were to conduct the first assessment of monthly home range and core area sizes of resident black and turkey vultures with consideration to sex, as well as elucidate differences in monthly, seasonal, and annual activity patterns based on fine-scale movement data analyses. We collected 2.8-million locations for 9 black and 9 turkey vultures from June 2013 -August 2015 using solar-powered GSM/GPS transmitters. We quantified home ranges and core areas using the dynamic Brownian bridge movement model and evaluated differences as a function of species, sex, and month. Mean monthly home ranges for turkey vultures were ~50% larger than those of black vultures, although mean core area sizes did not differ between species. Turkey vulture home ranges varied little across months, with exception to a notable reduction in space-use in May, which corresponds with timing of chick-rearing activities. Black vulture home ranges and core areas as well as turkey vulture core areas were larger in breeding season months (January-April. Comparison of space use between male and female vultures was only possible for black vultures, and space use was only slightly larger for females during breeding months (February-May. Analysis of activity patterns revealed turkey vultures spend more time in flight and switch motion states (between flight and stationary more frequently than black vultures across temporal scales. This study reveals substantive variability in space use and activity rates between sympatric black and turkey vultures, providing insights into potential behavioral mechanisms
Heart rhythm at the time of death documented by an implantable loop recorder
DEFF Research Database (Denmark)
Gang, Uffe Jakob Ortved; Jøns, Christian; Jørgensen, Rikke Mørch
2009-01-01
Aims The aims of this study were to describe arrhythmias documented with an implantable loop recorder (ILR) in post-acute myocardial infarction (AMI) patients with left ventricular dysfunction at the time of death and to establish the correlation to mode of death. Methods and results Post......-mortem ILR device interrogations were analysed from patients dying in the CARISMA study. Mode of death was classified by a modified CAST classification. Twenty-six patients died with an implanted ILR. Of these, 16 had an electrocardiogram recorded at the time of death. Ventricular tachycardia (VT......)/ventricular fibrillation (VF) was terminal rhythm in eight patients and bradyarrhythmias were observed in another eight patients. Of the deaths with peri-mortem recordings, seven were classified as sudden cardiac death (SCD). In six of these, VF was documented at the time of death. Six monitored deaths were classified...
24 CFR 982.612 - Group home: State approval of group home.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Group home: State approval of group... Types Group Home § 982.612 Group home: State approval of group home. A group home must be licensed..., Retardation, or Social Services) as a group home for elderly persons or persons with disabilities. ...
ThinkHome Energy Efficiency in Future Smart Homes
Christian Reinisch; Mario J. Kofler; Félix Iglesias; Wolfgang Kastner
2011-01-01
Abstract Smart homes have been viewed with increasing interest by both home owners and the research community in the past few years. One reason for this development is that the use of modern automation technology in the home or building promises considerable savings of energy, therefore, simultaneously reducing the operational costs of the building over its whole lifecycle. However, the full potential of smart homes still lies fallow, due to the complexity and diversity of the systems, badly ...
Organization aesthetics in nursing homes.
Hujala, Anneli; Rissanen, Sari
2011-05-01
The aim of this study was to make visible the material dimensions of nursing management. Management theories have mainly ignored the material dimensions, namely the physical spaces in which management actually takes place as well as the physical bodies of organization members. The perspective of organization aesthetics enhances our understanding of the role of materiality in nursing management. The data were collected in 2009 using observation and interviews in eight nursing homes. Qualitative content analysis with critical interpretations was used. Three main issues of organizational aesthetics related to nursing management were identified: (1) the functionality of working spaces and equipment; (2) the relevance of 'organizational' space; and (3) the emotional-aesthetic dimension of daily work. Materiality is closely related to management topics, such as decision-making, values and identity formation of organizational members. Aesthetic dimensions of care are constructed by management practices which, in their turn, influence the nature of management. Implications for nursing management Nurse managers need to be aware of the unintended and unnoticed consequences of materiality and aesthetics. Space and body issues may have considerable effects, for example, on the identity of care workers and on the attractiveness of the care branch. © 2011 The Authors. Journal compilation © 2011 Blackwell Publishing Ltd.
Kent in space: Cosmic dust to space debris
McDonnell, J. A. M.
1994-10-01
The dusty heritage of the University of Kent's Space Group commenced at Jodrell Bank, Cheshire, U.K., the home of the largest steerable radio telescope. While Professor Bernard Lovell's 250 ft. diameter telescope was used to command the U.S. deep space Pioneer spacecraft, Professor Tony McDonnell, as a research student in 1960, was developing a space dust detector for the US-UK Ariel program. It was successful. With a Ph.D. safely under the belt, it seemed an inevitable step to go for the next higher degree, a B.T.A.] Two years with NASA at Goddard Space Flight Center, Greenbelt, provided excellent qualifications for such a graduation ('Been to America'). A spirited return to the University of Kent at Canterbury followed, to one of the green field UK University sites springing from the Robbins Report on Higher Education. Swimming against the current of the brain drain, and taking a very considerable reduction in salary, it was with some disappointment that he found that the UK Premier Harold Wilson's 'white-hot technological revolution' never quite seemed to materialize in terms of research funding] Research expertise, centered initially on cosmic dust, enlarged to encompass planetology during the Apollo program, and rightly acquired international acclaim, notching up a history of space missions over 25 years. The group now comprises 38 people supported by four sources: the government's Research Councils, the University, the Space Agencies and Industry. This paper describes the thrust of the group's Research Plan in Space Science and Planetology; not so much based on existing international space missions, but more helping to shape the direction and selection of space missions ahead.
Scopes and horizons of the home world
Kolinko, Maryna
2015-01-01
The paper deals with spatial interconnection of home world and political worlds. Тhe author pays special attention to the methodological and theoretical approach of such thinkers as E. Husserl, which has a heuristic value for the research of the phenomenon of life-word. Semantics of dividing the social space into "my" and "somebody else's" employs Husserl phenomenological historicity type interpretation. Differences in domestic and alien world formation are analyzed. The correlation of the dy...
Home-based radiology transcription and a productivity pay plan.
Kerr, K
1997-01-01
Shands Hospital in Gainesville, Fla., decided to evaluate the way it provided transcription services in its radiology department. It identified four goals: increased productivity, decreased operating expense, finding much needed space in the radiology department and increasing employee morale. The department performs 165,000 procedures annually, with 66 radiologists, 29 faculty, and 37 residents and fellows on staff. Six FTEs comprised the transcription pool in the radiology department, with transcription their only duty. Transcriptionists were paid an hourly rate based on their years of service, not their productivity. Evaluation and measurement studies were undertaken by the hospital's management systems engineering department. The transcriptionists' hours were then changed to provide coverage during the periods of heaviest dictation. The productivity level of the transcription staff was also measured and various methods of measurement reviewed. The goal was a pure incentive pay plan that would reward employees for every increase in productivity. The incentive pay plan was phased in over a three-month period. Transcriptionists were paid for work performed, with no base pay beyond minimum wage. The move to home-based transcription was planned. The necessary equipment was identified and various issues specific to working at home were addressed. Approximately six months later, the transcriptionists were set up to work at home. The astounding results achieved are presented: 28% increase in productivity, operational cost savings exceeding $25,000 and a space savings of 238 square feet.
Analytical solutions of time–space fractional, advection–dispersion
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 83; Issue 6 ... In this article, we study time–space fractional advection–dispersion (FADE) equation and ... Lahore University of Management Sciences, Lahore Cantt 54792, Pakistan ...
DEFF Research Database (Denmark)
Andresen, Mette; Frändin, Kerstin; Grönstedt, Helena
2010-01-01
Background. The purpose of this study is to investigate the feasibility of measurements of muscle strength, balance, cognitive function, mobility, activities of daily living (ADL), and physical activity for use in a Scandinavian nursing home population and to examine intercorrelations between the......, functional independence measure, physiotherapy clinical outcome variables, and the Nursing Home Life Space...
Sociocultural determinants of home delivery in Ethiopia: a qualitative study.
Kaba, Mirgissa; Bulto, Tesfaye; Tafesse, Zergu; Lingerh, Wassie; Ali, Ismael
2016-01-01
Maternal health remains a major public health problem in Ethiopia. Despite the government's measures to ensure institutional delivery assisted by skilled attendants, home delivery remains high, estimated at over 80% of all pregnant women. The study aims to identify determinants that sustain home delivery in Ethiopia. A total of 48 women who delivered their most recent child at home, 56 women who delivered their most recent child in a health facility, 55 husbands of women who delivered within 1 year preceding the study, and 23 opinion leaders in selected districts of Amhara, Oromia, Southern Nations, Nationalities, and Peoples' Region, and Tigray regions were involved in the study. Key informant interview, in-depth interviews, and focus group discussions were conducted to collect data using checklists developed for this purpose. Data reduction and analysis were facilitated by Maxqda qualitative data analysis software version 11. Findings show that pregnancy and delivery is a normal and natural life event. Research participants unanimously argue that such a life event should not be linked with health problems. Home is considered a natural space for delivery and most women aspire to deliver at home where rituals during labor and after delivery are considered enjoyable. Even those who delivered in health facilities appreciate events in connection to home delivery. Efforts are underway to create home-like environments in health facilities, but health facilities are not yet recognized as a natural place of delivery. The positive tendency to deliver at home is further facilitated by poor service delivery at the facility level. Perceived poor competence of providers and limited availability of supplies and equipment were found to maintain the preference to deliver at home. The government's endeavor to improve maternal health has generated positive results with more women now attending antenatal care. Yet over 80% of women deliver at home and this was found to be the
Creating Spaces to Support Transgender Youth
McGuire, Jenifer K.; Conover-Williams, Meredith
2010-01-01
This article explores the opportunity to create spaces within the family, school, and community that specifically promote the well-being of transgender adolescents and young adults. When social contexts are supportive, transgender youth report significantly less risk. Supportive home and school environments have been linked to better outcomes…
... Home › Aging & Health A to Z › Nursing Homes Font size A A A Print Share Glossary Basic ... Reason For Living in A Nursing Home Some type of disability with activities of daily living (ADLs) ...
Counting Subspaces of a Finite Vector Space
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 11. Counting Subspaces of a Finite Vector Space – 1. Amritanshu Prasad. General Article Volume 15 Issue 11 November 2010 pp 977-987. Fulltext. Click here to view fulltext PDF. Permanent link:
Geboy, Nicholas J.; Engle, Mark A.; Hower, James C.
2013-01-01
Several standard methods require coal to be ashed prior to geochemical analysis. Researchers, however, are commonly interested in the compositional nature of the whole-coal, not its ash. Coal geochemical data for any given sample can, therefore, be reported in the ash basis on which it is analyzed or the whole-coal basis to which the ash basis data are back calculated. Basic univariate (mean, variance, distribution, etc.) and bivariate (correlation coefficients, etc.) measures of the same suite of samples can be very different depending which reporting basis the researcher uses. These differences are not real, but an artifact resulting from the compositional nature of most geochemical data. The technical term for this artifact is subcompositional incoherence. Since compositional data are forced to a constant sum, such as 100% or 1,000,000 ppm, they possess curvilinear properties which make the Euclidean principles on which most statistical tests rely inappropriate, leading to erroneous results. Applying the isometric logratio (ilr) transformation to compositional data allows them to be represented in Euclidean space and evaluated using traditional tests without fear of producing mathematically inconsistent results. When applied to coal geochemical data, the issues related to differences between the two reporting bases are resolved as demonstrated in this paper using major oxide and trace metal data from the Pennsylvanian-age Pond Creek coal of eastern Kentucky, USA. Following ilr transformation, univariate statistics, such as mean and variance, still differ between the ash basis and whole-coal basis, but in predictable and calculated manners. Further, the stability between two different components, a bivariate measure, is identical, regardless of the reporting basis. The application of ilr transformations addresses both the erroneous results of Euclidean-based measurements on compositional data as well as the inconsistencies observed on coal geochemical data
... are part of home healthcare agencies. You may benefit from home care if you are dealing with ... it will trigger an emergency response or checkup phone call. Newer technologies ... or mobile testing technology (home diagnostics), including x-rays and ...
Dikkers, J.S.E.; Geurts, S.A.E.; Dulk, L. den; Peper, A.B.; Kompier, M.A.J.
2004-01-01
In the present study, we examined the associations among work-home culture (WHC), the utilization of work-home arrangements (WHAs), and work-home interference (WHI) among 638 workers from a Dutch financial consultancy firm. We (a) developed a typology of WHC, (b) examined whether the utilization of
Associations Between Home Death and the Use and Type of Care at Home.
McEwen, Rebecca; Asada, Yukiko; Burge, Frederick; Lawson, Beverley
2018-01-01
Despite wishes for and benefits of home deaths, a discrepancy between preferred and actual location of death persists. Provision of home care may be an effective policy response to support home deaths. Using the population-based mortality follow-back study conducted in Nova Scotia, we investigated the associations between home death and formal care at home and between home death and the type of formal care at home. We found (1) the use of formal care at home at the end of life was associated with home death and (2) the use of formal home support services at home was associated with home death among those whose symptoms were well managed.
Architectural style and green spaces predict older adults' evaluations of residential facilities.
Cerina, Veronica; Fornara, Ferdinando; Manca, Sara
2017-09-01
The purpose of this study was to analyse the effects of residential facilities' design features on older adults' psychosocial responses. Participants ( N = 192) were over 65-year-old residents who were randomly exposed to different experimental scenarios concerning a hypothetical residential facility for older adults, using a 3 × 2 between-subjects design (i.e. home-like vs. hotel-like vs. usual-standard architectural style; presence vs. absence of green spaces). After the experimental session, participants were asked to fill in a questionnaire that measured their attitudes towards short- and long-term relocation, anticipated residential satisfaction with the facility, and feelings of broken home attachment. The results showed (1) more positive responses to "home-like" and "hotel-like" architectural styles than the usual-standard type and (2) the positive impact of green spaces on the assessment of the facilities. These design features should thus play a role in both reducing the stressful impact of leaving home and promoting beneficial patterns, hence fostering "successful ageing".
Military Commission Seal VWAP Login Home Go ABOUT US Organization Overview Organizational Chart Families VWAP Login CCTV Sites Travel Media MC News CCTV Sites Travel Today at OMC Home Today at OMC Daily
DEFF Research Database (Denmark)
Agar, John W; Perkins, Anthony; Heaf, James G
2015-01-01
We describe the infrastructure that is necessary for hemodialysis in the home focusing on physical requirements, the organization of plumbing and water, and the key features that should guide the selection of machines that are suitable for home use.......We describe the infrastructure that is necessary for hemodialysis in the home focusing on physical requirements, the organization of plumbing and water, and the key features that should guide the selection of machines that are suitable for home use....
DEFF Research Database (Denmark)
Madsen, Per Printz
2009-01-01
In the last couple of year's computer based home control systems are getting more and more common in modern homes. For instance these systems take care of light control, heat control and security systems. The latest trend is to use wireless communication like Z-Wave and ZigBee to interconnect...... different components in these systems. One of the characteristics is that each system, like for instance heat and light, has their own specific way of using the communication system. This paper describes a way to connect different home control systems through an intelligent gateway, called a Home......Port. The HomePort consists of a number of Subsystem communication drivers, a virtual communication layer, an interpreter and a PC- based compiler for a high level control language, called GIL (Gateway intelligence language). The focus in this paper will be on the upper two layers in the Home...
Multidisciplinary nutritional support for undernutrition in nursing home and home-care
DEFF Research Database (Denmark)
Beck, Anne Marie; Gøgsig Christensen, Annette; Stenbæk Hansen, Birthe
2016-01-01
Objective To assess the effect of multidisciplinary nutritional support for undernutrition in older adults in nursing home and home-care identified with the validated Eating Validation Scheme (EVS). Methods An 11 wk cluster randomized trial with a home-care (3 clusters) or nursing home (3 clusters.......3] versus 1.3 [0.5], P = 0.021) was observed. There was a almost significant difference in mortality (2% versus 13%, P = 0.079). Conclusions Multidisciplinary nutritional support in older adults in nursing home and home-care could have a positive effect on quality of life, muscle strength, and oral care....... means of EuroQol-5D-3L), physical performance (30-seconds chair stand), nutritional status (weight and hand-grip strength), oral care, fall incidents, hospital admissions, rehabilitation stay, moving to nursing homes (participants from home-care), and mortality. Results Respectively, 55 (46 from 2 home...
Rovetto, R.
2016-09-01
The orbital space environment is home to natural and artificial satellites, debris, and space weather phenomena. As the population of orbital objects grows so do the potential hazards to astronauts, space infrastructure and spaceflight capability. Orbital debris, in particular, is a universal concern. This and other hazards can be minimized by improving global space situational awareness (SSA). By sharing more data and increasing observational coverage of the space environment we stand to achieve that goal, thereby making spaceflight safer and expanding our knowledge of near-Earth space. To facilitate data-sharing interoperability among distinct orbital debris and space object catalogs, and SSA information systems, I proposed ontology in (Rovetto, 2015) and (Rovetto and Kelso, 2016). I continue this effort toward formal representations and models of the overall domain that may serve to improve peaceful SSA and increase our scientific knowledge. This paper explains the project concept introduced in those publications, summarizing efforts to date as well as the research field of ontology development and engineering. I describe concepts for an ontological framework for the orbital space environment, near-Earth space environment and SSA domain. An ontological framework is conceived as a part of a potential international information system. The purpose of such a system is to consolidate, analyze and reason over various sources and types of orbital and SSA data toward the mutually beneficial goals of safer space navigation and scientific research. Recent internationals findings on the limitations of orbital data, in addition to existing publications on collaborative SSA, demonstrate both the overlap with this project and the need for datasharing and integration.
38 CFR 59.130 - General requirements for all State home facilities.
2010-07-01
... design and construct the project to provide sufficient space and equipment in dining, health services... safety of participants, personnel and the public. (b) A State home must meet the general conditions of..., including the Uniform Federal Accessibility Standards (UFAS) (24 CFR part 40, appendix A), during the design...
Space Use and Habitat Selection by Resident and Transient Coyotes (Canis latrans.
Directory of Open Access Journals (Sweden)
Joseph W Hinton
Full Text Available Little information exists on coyote (Canis latrans space use and habitat selection in the southeastern United States and most studies conducted in the Southeast have been carried out within small study areas (e.g., ≤1,000 km2. Therefore, studying the placement, size, and habitat composition of coyote home ranges over broad geographic areas could provide relevant insights regarding how coyote populations adjust to regionally varying ecological conditions. Despite an increasing number of studies of coyote ecology, few studies have assessed the role of transiency as a life-history strategy among coyotes. During 2009-2011, we used GPS radio-telemetry to study coyote space use and habitat selection on the Albemarle Peninsula of northeastern North Carolina. We quantified space use and 2nd- and 3rd-order habitat selection for resident and transient coyotes to describe space use patterns in a predominantly agricultural landscape. The upper limit of coyote home-range size was approximately 47 km2 and coyotes exhibiting shifting patterns of space use of areas >65 km2 were transients. Transients exhibited localized space use patterns for short durations prior to establishing home ranges, which we defined as "biding" areas. Resident and transient coyotes demonstrated similar habitat selection, notably selection of agricultural over forested habitats. However, transients exhibited stronger selection for roads than resident coyotes. Although transient coyotes are less likely to contribute reproductively to their population, transiency may be an important life history trait that facilitates metapopulation dynamics through dispersal and the eventual replacement of breeding residents lost to mortality.
Space use and habitat selection by resident and transient coyotes (Canis latrans)
Hinton, Joseph W; van Manen, Frank T.; Chamberlain, Michael J
2015-01-01
Little information exists on coyote (Canis latrans) space use and habitat selection in the southeastern United States and most studies conducted in the Southeast have been carried out within small study areas (e.g., ≤1,000 km2). Therefore, studying the placement, size, and habitat composition of coyote home ranges over broad geographic areas could provide relevant insights regarding how coyote populations adjust to regionally varying ecological conditions. Despite an increasing number of studies of coyote ecology, few studies have assessed the role of transiency as a life-history strategy among coyotes. During 2009–2011, we used GPS radio-telemetry to study coyote space use and habitat selection on the Albemarle Peninsula of northeastern North Carolina. We quantified space use and 2nd- and 3rd-order habitat selection for resident and transient coyotes to describe space use patterns in a predominantly agricultural landscape. The upper limit of coyote home-range size was approximately 47 km2 and coyotes exhibiting shifting patterns of space use of areas >65 km2 were transients. Transients exhibited localized space use patterns for short durations prior to establishing home ranges, which we defined as “biding” areas. Resident and transient coyotes demonstrated similar habitat selection, notably selection of agricultural over forested habitats. However, transients exhibited stronger selection for roads than resident coyotes. Although transient coyotes are less likely to contribute reproductively to their population, transiency may be an important life history trait that facilitates metapopulation dynamics through dispersal and the eventual replacement of breeding residents lost to mortality.
... Videos for Educators Search English Español The Medical Home KidsHealth / For Parents / The Medical Home What's in ... for your child. What Does the Term "Medical Home" Mean? A medical home isn't a place ...
Congruence of Home, Social and Sex Neighborhoods among Men Who Have Sex with Men, NYCM2M Study.
Koblin, Beryl A; Egan, James E; Nandi, Vijay; Sang, Jordan M; Cerdá, Magdalena; Tieu, Hong-Van; Ompad, Danielle C; Hoover, Donald R; Frye, Victoria
2017-06-01
Substantial literature demonstrates the influence of the neighborhood environment on health behaviors and outcomes. But limited research examines on how gay and bisexual men experience and exist in various geographic and virtual spaces and how this relates to their sexual behavior. New York City Men 2 Men (NYCM2M) was a cross-sectional study designed to identify neighborhood-level characteristics within the urban environment that influence sexual risk behaviors, substance use, and depression among men who have sex with men (MSM) living in NYC. The sample was recruited using a modified venue-based time-space sampling methodology and through select websites and mobile applications. Whether key neighborhoods of human activity, where a participant resided (termed home), socialized (termed social), or had sex most often (termed sex), were the same or different was evaluated. "Congruence" (or the sameness) of home, social, and most often sex neighborhood was reported by 17 % of men, while 30 % reported that none of their neighborhoods were the same. The largest group of men (39 %) reported that their home and sex neighborhoods were the same but their social neighborhood was different while 10 % reported that their home neighborhood was different than their social and sex neighborhood; 5 % men reported same home and social neighborhoods with a different sex neighborhood. Complete neighborhood incongruence was highest among men who were Black and/or Latino, had lower education and personal income levels, and had greater financial insecurity. In adjusted analysis, serodiscordant condomless anal intercourse and condomless anal intercourse with partners from the Internet or mobile applications were significantly associated with having the same social and sex (but not home) neighborhoods. Understanding the complexity of how different spaces and places relate to the health and sexual behavior of MSM is essential for focusing interventions to best reach various populations
Home Rx: The Health Benefits of Home Performance
Energy Technology Data Exchange (ETDEWEB)
Wilson, Jonathan [National Center for Healthy Housing (NCHH), Columbia, MD (United States); Jacobs, David [National Center for Healthy Housing (NCHH), Columbia, MD (United States); Reddy, Amanda [National Center for Healthy Housing (NCHH), Columbia, MD (United States); Tohn, Ellen [Tohn Environmental Strategies, Wayland, MA (United States); Cohen, Jonathan [Dept. of Energy (DOE), Washington DC (United States); Jacobsohn, Ely [Dept. of Energy (DOE), Washington DC (United States)
2016-12-01
Evidence in a new, groundbreaking U.S. Department of Energy report, Home Rx: The Health Benefits of Home Performance, shows that home performance upgrades can improve the quality of a home’s indoor environment by reducing the prevalence of harmful indoor air pollutants and contaminants. Until recently, no systematic review of this evidence had been conducted, limiting full understanding of the link between home performance and health. This new report summarizes current knowledge and identifies research gaps. The design characteristics and results of each of the 40 studies considered in the report are summarized in a searchable matrix.
Effect of home construction on soil carbon storage-A chronosequence case study.
Majidzadeh, Hamed; Lockaby, B Graeme; Governo, Robin
2017-07-01
Urbanization results in the rapid expansion of impervious surfaces, therefore a better understanding of biogeochemical consequences of soil sealing is crucial. Previous research documents a significant reduction in soil carbon and nitrogen content, however, it is unclear if this decrease is a result of top soil removal or long-term soil sealing. In this study, soil biogeochemical properties were quantified beneath homes built on a crawl space at two depths (0-10 cm, and 10-20 cm). All homes, 11-114 years in age, were sampled in the Piedmont region of Alabama and Georgia, USA. This age range enabled the use of a chronosequence approach to estimate carbon loss or gain under the sampled homes. The difference in soil carbon content beneath homes and adjoining urban lawns showed a quadratic relation with age. Maximum C loss occurred at approximately fifty years. The same pattern was observed for MBC: C ratio suggesting that the soil carbon content was decreasing beneath the homes for first fifty years, then increased afterward. The average soil C and N content in the top 10 cm were respectively 61.86% (±4.42%), and 65.77% (±5.65%) lower underneath the homes in comparison to urban lawns. Microbial biomass carbon (MBC), and nitrogen (MBN) were significantly lower below the homes compared to the urban lawns, while bulk density and phosphorus content were higher beneath the homes. Copyright © 2017 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
None, None
2013-11-01
Space conditioning represents nearly 50% of average residential household energy consumption, highlighting the need to identify alternative cost-effective, energy-efficient cooling and heating strategies. As homes are better built, there is an increasing need for strategies that are particularly well suited for high performance, low load homes. ARBI researchers worked with two test homes in hot-dry climates to evaluate the in-situ performance of air-to-water heat pump (AWHP) systems, an energy efficient space conditioning solution designed to cost-effectively provide comfort in homes with efficient, safe, and durable operation. Two monitoring projects of test houses in hot-dry climates were initiated in 2010 to test this system. Both systems were fully instrumented and have been monitored over one year to capture complete performance data over the cooling and heating seasons. Results are used to quantify energy savings, cost-effectiveness, and system performance using different operating modes and strategies. A calibrated TRNSYS model was developed and used to evaluate performance in various climate regions. This strategy is most effective in tight, insulated homes with high levels of thermal mass (i.e. exposed slab floors).
ThinkHome Energy Efficiency in Future Smart Homes
Directory of Open Access Journals (Sweden)
Reinisch Christian
2011-01-01
Full Text Available Abstract Smart homes have been viewed with increasing interest by both home owners and the research community in the past few years. One reason for this development is that the use of modern automation technology in the home or building promises considerable savings of energy, therefore, simultaneously reducing the operational costs of the building over its whole lifecycle. However, the full potential of smart homes still lies fallow, due to the complexity and diversity of the systems, badly engineered and configured installations, as well as the frequent problem of suboptimal control strategies. Summarized, these problems converge to two undesirable conditions in the "not-so-smart" home: energy consumption is still higher than actually necessary and users are unable to yield full comfort in their automated homes. This work puts its focus on alleviating the current problems by proposing a comprehensive system concept, that shall ensure that smart homes can keep their promise in the future. The system operates on an extensive knowledge base that stores all information needed to fulfill the goals of energy efficiency and user comfort. Its intelligence is implemented as and within a multiagent system that also caters for the system's openness to the outside world. As a first evaluation, a profile-based control strategy for thermal comfort is developed and verified by means of simulation.
Home and away: Area socioeconomic disadvantage and obesity risk.
Kimbro, Rachel Tolbert; Sharp, Gregory; Denney, Justin T
2017-03-01
Although residential context is linked to obesity risk, less is known about how the additional places where we work, shop, play, and worship may influence that risk. We employ longitudinal data from the Los Angeles Family and Neighborhood Survey (LAFANS) to derive time-weighted measures of exposure to home and activity space contexts to ascertain the impacts of each on obesity risk for adults. Results show that increased exposure to socioeconomic disadvantage in the residential neighborhood significantly increases obesity risk, and although activity space disadvantage does not directly influence obesity, it reduces the association between residential disadvantage and obesity. We further explore the ways in which residential and activity space disadvantages may interact to influence obesity and discuss the value of integrating personal exposure and activity space contexts to better understand how places contribute to individual health risks. Copyright © 2017 Elsevier Ltd. All rights reserved.
Our winters of discontent : addressing the problem of rising home heating costs
International Nuclear Information System (INIS)
Hughes, L.; Wysocki, A.
2006-03-01
The cost of space heating may soon increase due to rising fuel prices in international energy markets and the absence of federal and provincial energy security policies. This report examined the benefits and disadvantages of 2 approaches to assist those with limited incomes to meet heating requirements: (1) offering Low Income Fuel Assistance (LIFA) as a one-time payment during the heating season; and (2) the elimination of taxes for home heating fuels. The cost of home heating fuels and their impacts on consumers and governments were considered. A review of the Nova Scotia government's Keep the Heat program noted that the program was not responsive to increases in the price of home heating fuel, particularly if increases in a year exceeded the level of assistance. It was suggested that the removal of heating sales taxes could provide unnecessary windfalls to households with large homes, as well as windfall profits for landlords if savings were not passed on to tenants. Using Nova Scotia as a case study, an alternative support system was considered that guaranteed a set price for heating fuel for those in need. It was suggested that this approach could cost less than a lump-sum payment or the elimination of taxes on home-heating fuel. In addition, the approach would provide low-income consumers with predictable and affordable prices. It was concluded that as space heating energy costs continue to rise, all government fuel assistance programs run the risk of becoming larger and more costly. Other solutions included reducing Canada's dependence on fossil fuels through the use of solar energy; the reduction of residential energy demand; and the promotion of district heating. 26 refs., 9 tabs., 3 figs
Stroke and Nursing Home care: a national survey of nursing homes.
LENUS (Irish Health Repository)
Cowman, Seamus
2010-01-01
BACKGROUND: Although stroke is recognised as a major factor in admission to nursing home care, data is lacking on the extent and nature of the disabilities and dependency in nursing homes arising from stroke. A national study conducted in nursing homes can quantify the number of residents with stroke in nursing homes, their disability and levels of dependency. METHODS: A cross-sectional survey research design was used. A total of 572 public and private nursing homes were identified nationally and a stratified random selection of 60 nursing homes with 3,239 residents was made. In half of the nursing homes (n = 30) efforts were made to interview all residents with stroke Survey instruments were used to collect data from residents with stroke and nursing home managers on demography, patient disability, and treatment. RESULTS: Across all nursing homes (n = 60), 18% (n = 570) of the residents had previously had a stroke. In homes (n = 30), where interviews with residents with stroke (n = 257), only 7% (n = 18) residents were capable of answering for themselves and were interviewed. Data on the remaining 93% (n = 239) residents were provided by the nursing home manager. Nurse Managers reported that 73% of residents with stroke had a high level of dependency. One in two residents with stroke was prescribed antidepressants or sedative medication. Only 21% of stroke residents were prescribed anticoagulants, 42% antiplatelets, and 36% cholesterol lowering medications. Stroke rehabilitation guidelines were lacking and 68% reported that there was no formal review process in place. CONCLUSIONS: This study provides seminal findings on stroke and nursing home services in Ireland. We now know that one in six nursing home residents in a national survey are residents with a stroke, and have a wide range of disabilities. There is currently little or no structured care (beyond generic care) for stroke survivors who reside in nursing homes in Ireland.
Hatton, Nicola
2014-01-01
This paper considers some of the spatial challenges of doing arts projects with older people in care homes, including those living with dementia. It reflects on the author's own experience of running a performance project with residents with at a care home in North London. Drawing on Lefebvre's concept of socially produced space, it argues that…
Home Automation : Smart home technology and template house design
Zheng, Zeya
2013-01-01
In this thesis, home automation’s general knowledge, technology information and each component will be introduced to the reader in the first half of the whole thesis. In the second half, thesis includes the Home Automation template design and market competitiveness analysis. The author assumes that the reader is going to spend lots of money to have a smart home. In this situation, the author introduces the home automation to the reader at each component. So the reader in this thesis actu...
Howell, Doris M.; Abernathy, Tom; Cockerill, Rhonda; Brazil, Kevin; Wagner, Frank; Librach, Larry
2011-01-01
Purpose: Empirical understanding of predictors for home care service use and death at home is important for healthcare planning. Few studies have examined these predictors in the context of the publicly funded Canadian home care system. This study examined predictors for home care use and home death in the context of a “gold standard” comprehensive palliative home care program pilot in Ontario where patients had equal access to home care services. Methods: Secondary clinical and administrative data sources were linked using a unique identifier to examine multivariate factors (predisposing, enabling, need) on total home care expenditures and home death for a cohort of cancer patients enrolled in the HPCNet pilot. Results: Subjects with gastrointestinal symptoms (OR: 1.64; p=0.03) and those with higher income had increased odds of dying at home (OR: 1.14; phome care expenditures. Conclusions: Predictors of home death found in earlier studies appeared less important in this comprehensive palliative home care pilot. An income effect for home death observed in this study requires examination in future controlled studies. Relevance: Access to palliative home care that is adequately resourced and organized to address the multiple domains of issues that patients/families experience at the end of life has the potential to enable home death and shift care appropriately from limited acute care resources. PMID:22294993
Directory of Open Access Journals (Sweden)
A. Folkers
2018-02-01
Full Text Available This paper links two strands of Peter Sloterdijk's sphere project – his theory of the environment and his theory of dwelling – and mobilizes them for an analysis of entanglements between spaces of the environment and the space of the home in contemporary sustainability policies and smart home experiments. First, we retrace how Sloterdijk's topology of the environment combines a historical phenomenological methodology with ecological thinking. In the next step, we discuss Sloterdijk's theory of dwelling, which is closely linked to his thinking of the environment and is central to his conception of a plural spherology, yet has so far largely been overlooked in the reception. Sloterdijk's emphasis on the importance of dwelling in the world's inner space (Weltinnenraum under conditions of a no longer externalizable environment helps to theorize how humans dwell on this earth in the 21st century. In the third part of the paper, we bring together both themes – environment and dwelling – to analyze contemporary ecological and digital home experiments from the perspective of a plural spherology. By showing how recent digital experiments in smart homes entangle spaces of dwelling with environmental concerns we build on Sloterdijk's analysis but also extend it with insights from STS and governmentality studies to better capture the power effects inherent to digitalized dwelling.
Maitland, Clover; Stratton, Gareth; Foster, Sarah; Braham, Rebecca; Rosenberg, Michael
2013-08-17
The home environment is an important influence on the sedentary behaviour and physical activity of children, who have limited independent mobility and spend much of their time at home. This article reviews the current evidence regarding the influence of the home physical environment on the sedentary behaviour and physical activity of children aged 8-14 years. A literature search of peer reviewed articles published between 2005 and 2011 resulted in 38 observational studies (21 with activity outcomes, 23 with sedentary outcomes) and 11 experimental studies included in the review. The most commonly investigated behavioural outcomes were television watching and moderate to vigorous physical activity. Media equipment in the home and to a lesser extent the bedroom were positively associated with children's sedentary behaviour. Physical activity equipment and the house and yard were not associated with physical activity, although environmental measures were exclusively self-reported. On the other hand, physical activity equipment was inversely associated with sedentary behaviours in half of studies. Observational studies that investigated the influence of the physical and social environment within the home space, found that the social environment, particularly the role of parents, was important. Experimental studies that changed the home physical environment by introducing a television limiting device successfully decreased television viewing, whereas the influence of introducing an active video game on activity outcomes was inconsistent. Results highlight that the home environment is an important influence on children's sedentary behaviour and physical activity, about which much is still unknown. While changing or controlling the home physical environment shows promise for reducing screen based sedentary behaviour, further interventions are needed to understand the broader impact of these changes. Future studies should prioritise investigating the influence of the home
Eldercare at Home: Choosing a Nursing Home
... required, these services can be provided by a separate home health agency as directed by a doctor or ... complaints made by or on behalf of nursing home residents and work to resolve the problems. If they are unable ...
Kodra, Suela
2016-01-01
Smart Home is an intelligent home equipped with devices and communications systems that enables the residents to connect and control their home appliances and systems. This technology has changed the way a consumer interacts with his home, enabling more control and convenience. Another advantage of this technology is the positive impact it has on savings on energy and other resources. However, despite the consumer's excitement about smart home, security and privacy have shown to be the strong...
The relationship of the elderly toward their home and living environment
Directory of Open Access Journals (Sweden)
Boštjan Kerbler
2017-12-01
Full Text Available Housing is a basic human good and right. It plays a versatile role, allowing people to fulfil a number of needs, and it is not limited only to one’s immediate living space, but also includes an individual’s wider living environment. People’s relationship toward housing and their living environment changes over the course of their lives. Especially in old age, housing becomes more important. Research shows that the elderly want to remain in their home environments as long as possible because they are closely attached to them. In order to determine whether these findings also apply to Slovenia, this article analyses how attached the elderly in Slovenia are to their homes and wider living environment and how satisfied they are with living there. The elderly’s views were obtained with a survey, and a statistical analysis was carried out using SPSS software, based on the calculation of various statistical correlation tests. The analysis confirmed the assumption that the Slovenian elderly are also very attached to their homes or home environments and are satisfied with living there. In addition, the analysis showed some differences among the elderly in this regard depending on their age, where they live and how long they have been living in their current homes.
Heart rhythm at the time of death documented by an implantable loop recorder
DEFF Research Database (Denmark)
Gang, Uffe Jakob Ortved; Jøns, Christian; Jørgensen, Rikke Mørch
2010-01-01
The aims of this study were to describe arrhythmias documented with an implantable loop recorder (ILR) in post-acute myocardial infarction (AMI) patients with left ventricular dysfunction at the time of death and to establish the correlation to mode of death.......The aims of this study were to describe arrhythmias documented with an implantable loop recorder (ILR) in post-acute myocardial infarction (AMI) patients with left ventricular dysfunction at the time of death and to establish the correlation to mode of death....
Philpott, Michael; Doran, Jonathan
2016-03-01
The connected home is a critical part of the network-but one that has seen little in the way of true investment in recent years. With customer loyalty and churn directly linked to quality of experience, this is a part of the network that no players in the supply chain can afford to ignore any longer. Beyond broadband experience, the addition of smart technology to the connected home also represents one of the biggest revenue growth areas in the consumer telecoms market for some time. From both a churn-reduction and a revenue-growth perspective, investment in the connected home network must accelerate. This article outlines the key trends identified by Ovum in the connected home space for 2016 and beyond.
Internet of Things Framework for Home Care Systems
Directory of Open Access Journals (Sweden)
Biljana Risteska Stojkoska
2017-01-01
Full Text Available The increasing average age of the population in most industrialized countries imposes a necessity for developing advanced and practical services using state-of-the-art technologies, dedicated to personal living spaces. In this paper, we introduce a hierarchical distributed approach for home care systems based on a new paradigm known as Internet of Things (IoT. The proposed generic framework is supported by a three-level data management model composed of dew computing, fog computing, and cloud computing for efficient data flow in IoT based home care systems. We examine the proposed model through a real case scenario of an early fire detection system using a distributed fuzzy logic approach. The obtained results prove that such implementation of dew and fog computing provides high accuracy in fire detection IoT systems, while achieving minimum data latency.
Expanding horizons with Chameleon: team Missouri's innovative home automation system
Energy Technology Data Exchange (ETDEWEB)
Glass, B. [Department of Computer Engineering, Missouri University of Science and Technology, 1401 Pine Street, Rolla, MO 65409 (United States); Brannon, B. [Department of Electrical Engineering, Missouri University of Science and Technology, 1401 Pine Street, Rolla, MO 65409 (United States); Grantham, K. [Department of Engineering Management, Missouri University of Science and Technology, 1401 Pine Street, Rolla, MO 65409 (United States); Baur, S. [Department of Civil, Architectural and Environmental Engineering, Missouri University of Science and Technology, 1401 Pine Street, Rolla, MO 65409 (United States)
2010-06-15
Team Missouri's 2009 Solar Decathlon entry featured a revolutionary home automation system, Chameleon, promoting both convenience and energy savings. This was accomplished using the typical controls of a convenience based automation system, while maintaining user set points, such as a home's ambient temperature, in the most energy efficient manner. Environmental features of the system include controls for space heating, ventilation and air conditioning, lighting, windows, shades, appliances, indoor air quality, as well as indoor and outdoor irrigation. Further analysis and refinement to the prototype system displayed at the competition is also presented in this paper. (authors)
Stroke and Nursing Home care: a national survey of nursing homes
Directory of Open Access Journals (Sweden)
McGee Hannah
2010-01-01
Full Text Available Abstract Background Although stroke is recognised as a major factor in admission to nursing home care, data is lacking on the extent and nature of the disabilities and dependency in nursing homes arising from stroke. A national study conducted in nursing homes can quantify the number of residents with stroke in nursing homes, their disability and levels of dependency. Methods A cross-sectional survey research design was used. A total of 572 public and private nursing homes were identified nationally and a stratified random selection of 60 nursing homes with 3,239 residents was made. In half of the nursing homes (n = 30 efforts were made to interview all residents with stroke Survey instruments were used to collect data from residents with stroke and nursing home managers on demography, patient disability, and treatment. Results Across all nursing homes (n = 60, 18% (n = 570 of the residents had previously had a stroke. In homes (n = 30, where interviews with residents with stroke (n = 257, only 7% (n = 18 residents were capable of answering for themselves and were interviewed. Data on the remaining 93% (n = 239 residents were provided by the nursing home manager. Nurse Managers reported that 73% of residents with stroke had a high level of dependency. One in two residents with stroke was prescribed antidepressants or sedative medication. Only 21% of stroke residents were prescribed anticoagulants, 42% antiplatelets, and 36% cholesterol lowering medications. Stroke rehabilitation guidelines were lacking and 68% reported that there was no formal review process in place. Conclusions This study provides seminal findings on stroke and nursing home services in Ireland. We now know that one in six nursing home residents in a national survey are residents with a stroke, and have a wide range of disabilities. There is currently little or no structured care (beyond generic care for stroke survivors who reside in nursing homes in Ireland.
DEFF Research Database (Denmark)
Sæteren, Berit; Tolo Heggestad, Anne Kari; Høy, B.
2016-01-01
The aim of this study was to answer the question "What do nursing home residents do themselves in order to maintain their dignity?" Twenty-eight residents, 8 men and 20 women, aged 62 to 103 years, from 6 different nursing homes in Scandinavia were interviewed. The results showed that the residents...
Medicare home health utilization as a function of nursing home market factors.
Swan, J H; Benjamin, A E
1990-01-01
Rapid increases in the size and costs of the home health market, unknown impacts of Medicare's DRG hospital reimbursement on the posthospital market, and general lack of knowledge about factors that explain interstate variation in home health utilization all suggest the importance of developing and testing models of Medicare home health use. This article proposes and tests a model of state home health utilization as a function of the nursing home market. This model proposes that home health u...
A home for science: The life and times of Tropical and Polar field stations.
Geissler, P Wenzel; Kelly, Ann H
2016-12-01
A 'halfway house' between the generic, purified space of the laboratory and the varied and particular spaces of the field, the field station is a controlled yet uncontained setting from which nature can be accessed and anchored. As living quarters for visiting scientists, field stations are also enmeshed in the routine and rhythms of everyday domestic life, and in longer cycles of habitation, wear, and repair. This introduction considers the empirical and conceptual significance of Polar and Tropical field stations as homes for scientific work and scientific lives. The field station's extra-territorial yet intimate character affects the credibility and circulation of knowledge along science's frontiers. The challenge of making a home in the (non-temperate) field and the mundane experiences of expatriation and appropriation establish particular political dynamics of knowledge-making in these locations. They bring into focus the imaginaries of nature and science that drive transnational research and put into relief the aesthetic and affective dimensions of work and life in these distant homes for science. All these themes are pursued and amplified in a different medium by the artists who contributed to our research and are also featured in this special issue.
No way home: silence, slowness and the problem of authenticity in the cinema of Lisandro Alonso
Directory of Open Access Journals (Sweden)
Roberto Cavallini
2015-07-01
Full Text Available In his trilogy, comprising La Libertad (2001, Los Muertos (2004 and Liverpool (2008, Argentinian director Lisandro Alonso employs a distinctive narrative motif, namely the journey of solitary individuals through desolated landscapes in rural Argentina. From a comparative view, the key to understanding these introverted trajectories is to consider Alonso’s construction of narrative space around the misery of a stark void, namely the absence of home. For Alonso, home is not a peaceful destination, connoting the intimacy of a family, serenity or simply a place where one is allowed to dream in peace (Bachelard. The absence of home becomes the blind spot of these journeys: home turns out to be a broken horizon. In this essay I will mainly focus on the film Los Muertos and the way in which it radicalizes narrative space through the combination of cinematic silence (absence of words and dialogues and cinematic slowness (static long-takes while formulating a void which coincides with the protagonist’s homelessness. Moreover, this essay tries to consider how Alonso’s radical cinematic realism problematizes the concept of authenticity in its modern formation, and also in the context of Rancière’s notion of documentary fiction and the relationship between aesthetics and politics.
Resorts, second home owners and distance: a case study in northern Finland
Directory of Open Access Journals (Sweden)
Pekka Kauppila
2010-11-01
Full Text Available One of the most important factors for the site selection of a second home is the space-time dimension. For example, the popularity of second home tourism in the hinterland of population centres is based on the short distance between second homes and the permanent residence of second home owners. In the case of peripheral resorts, however, the main reason for a large number of second homes is the attractiveness of the area associated with a high level of touristic elements. The study examines the municipalities of residence of the second home owners in four large resorts – Levi, Ruka, Saariselkä and Ylläs – in northern Finland. After analysing the geographical distribution of the owners with maps and diagrams the aim of the paper is to present a distance model for the resorts located in a northern periphery from the viewpoint of the regions of destination. Generally speaking, the model resembles a U-letter. In this respect, the resorts have three zones – day trip, weekend and vacation – and each of them has their own characteristics based on accessibility and regional structure, the number and structure of population (potential owners and land ownership. In the planning context, the proposed model can be utilised as a tool for the marketing of resorts as a second home environment as well as for analysing and comparing the overall attractiveness of resorts.
The Sweet-Home speech and multimodal corpus for home automation interaction
Vacher , Michel; Lecouteux , Benjamin; Chahuara , Pedro; Portet , François; Meillon , Brigitte; Bonnefond , Nicolas
2014-01-01
International audience; Ambient Assisted Living aims at enhancing the quality of life of older and disabled people at home thanks to Smart Homes and Home Automation. However, many studies do not include tests in real settings, because data collection in this domain is very expensive and challenging and because of the few available data sets. The SWEET-H OME multimodal corpus is a dataset recorded in realistic conditions in D OMUS, a fully equipped Smart Home with microphones and home automati...
Ground Zero(3: Inside the New American Home
Directory of Open Access Journals (Sweden)
Louise LACHAPELLE
2011-09-01
Full Text Available Cet article poursuit l’étude de la reconstruction sur le site du World Trade Center. Pour produire le lieu de la catastrophe comme site où la construction est possible, il aura fallu exclure rapidement la réalité des restes, débris et autres ruines. Il s’agit maintenant de prendrepour objet la constitution de ces collections liées aux événements du 11 septembre 2001 par différentes institutions muséales (dont les collections impliquant la conservation/conversion muséologique des restes, ainsi qu’un corpus d’expositions par lesquelles s’opère une mise à distance qui lève l’interdiction de voir ou de montrer les ruines et les restes afin de recréer de la frontière, aussi bien que rétablir un espace familier, « the space of [safe] viewing » (d’après Chouliaraki 2004, au centre d’une périphérie nationale et symbolique qu’on voudrait, à nouveau, croire « sécurisée » : the space of safe living, « Inside the New American Home ».Ground Zero : Inside the New American Home continue ainsi à développer cette critique de la culture et du sens rituel de l’art (Walter Benjamin 1940 en montrant que si le secours cherché auprès de l’autorité du musée et son expertise à traiter et à disséminer « la vérité » (Azoulay 2001 suggèrent une troublante collusion des pouvoirs (Klein 2007, c’est moins parce qu’elles conservent la mémoire d’un événement que parce qu’elles entretiennent le souvenir d’un art qui sauve, autrement dit, le souvenir d’une stratégie culturelle fondée sur le sacrifice. Le rôle d’un corpus de collections et d’expositions est donc considéré en relation avec d’autres mécanismes de cohésion et de contrôle post-9/11, par exemple le Homeland Security Department, la Security Fence et la Secure border initiative, afin de mettre en évidence le rôle des musées et d’une « muséologie de guerre » au sein de ces dispositifs culturels de clôture et
Energy Technology Data Exchange (ETDEWEB)
Eric Martin, Chuck Withers, Janet McIlvaine, Dave Chasar, and David Beal
2018-03-29
Low-load homes can present a challenge when selecting appropriate space-conditioning equipment. Conventional, fixed-capacity heating and cooling equipment is often oversized for small homes, causing increased first costs and operating costs. This report evaluates the performance of variable-capacity comfort systems, with a focus on inverter-driven, variable-capacity systems, as well as proposed system enhancements.
Directory of Open Access Journals (Sweden)
Lihuan Guo
2018-04-01
Full Text Available As the information communication and investment of crowdfunding campaigns are usually accomplished online, online crowdfunding theoretically breaks the limitation of space. However, investors’ behaviors still show significant home bias; furthermore, from a dynamic view, the changes in home bias during the funding duration reflect the investment preference. This paper studies the dynamics of home bias in crowdfunding investment as well as the distance diffusion of home bias in the crowdfunding market through data mining and econometric models. The distance between investors and founders gradually increases from 3605 km to 4229 km as the funding progresses, and home bias shows different diffusion patterns between categories. For most of the campaigns, the distance between backers and founders of the successful campaigns is always greater than that of the failed ones; thus, the distance diffusion impacts the pledge results. However, the study also finds that for some categories, home bias does not play a positive role in investment or that it even shows negative impacts, among which food and technology are two extreme categories. The study provides a theoretical basis from the perspective of user behavior to analyze online investment and to improve the promotion of crowdfunding campaigns.
Smoke-Free Homes and Home Exposure to Secondhand Smoke in Shanghai, China
Directory of Open Access Journals (Sweden)
Pinpin Zheng
2014-11-01
Full Text Available Few studies have examined home exposure to secondhand smoke (SHS in China. This study aimed to document: (1 the prevalence and correlates of exposure to SHS in homes (in adult non-smokers in Shanghai, and (2 enforcement of rules, harm reduction behaviors, and self-efficacy for maintaining smoke-free homes in Shanghai. A total of 500 participants were recruited using a multistage proportional random sampling design in an urban and suburban district to complete a survey. Among the total 355 nonsmokers, 127 (35.8% participants reported being exposed to SHS in the past 7 days. Participants living with smokers in the home, with no smoking restriction at home, and having children younger than 18 were more likely to be exposed to SHS at home. Higher self-efficacy in maintaining a smoke-free home was negatively associated with home SHS exposure. Having visitors who smoke was the greatest policy enforcement challenge. Ineffective measures such as opening windows were more commonly used in homes with partial bans. Educational initiatives to protect against SHS exposure in the home should promote smoke-free homes, address challenges to implementing such policies, and address misconceptions regarding the effectiveness of supposed harm reduction behaviors.
Creative Arts Therapies as Temporary Home for Refugees: Insights from Literature and Practice
Directory of Open Access Journals (Sweden)
Rebekka Dieterich-Hartwell
2017-10-01
Full Text Available One of the frequently overlooked psychosocial problems of refugees is the phenomenon of homesickness. Being forced into exile and unable to return home may cause natural feelings of nostalgia but may also result in emotional, cognitive, behavioral and physical adversities. According to the literature, the creative arts therapies with their attention to preverbal language—music, imagery, dance, role play, and movement—are able to reach individuals through the senses and promote successive integration, which can lead to transformation and therapeutic change. These forms of therapy can be a temporary home for refugees in the acculturation process, by serving as a safe and enactive transitional space. More specifically, working with dance and movement can foster the experience of the body as a home and thus provide a safe starting place, from which to regulate arousal, increase interoception, and symbolize trauma- and resource-related processes. Hearing, playing, and singing music from the home culture may assist individuals in maintaining their cultural and personal individuality. Creating drawings, paintings, or sculpturing around the topics of houses and environments from the past can help refugees to retain their identity through art, creating safe spaces for the future helps to look ahead, retain resources, and regain control. This article provides a literature review related to home and homesickness, and the role the arts therapies can play for refugees in transition. It further reports selected interview data on adverse life events and burdens in the host country from a German study. We propose that the creative arts therapies are not only a container that offers a temporary home, but can also serve as a bridge that gently guides refugees to a stepwise integration in the host country. Several clinical and research examples are presented suggesting that the support and affirmation through the creative arts can strengthen individuals in
Energy Technology Data Exchange (ETDEWEB)
none,
2014-09-01
This builder won a Custom Builder honor in the 2014 Housing Innovation Awards for this showcase home that serves as an energy-efficient model home for the custom home builder: 1,300 visitors toured the home, thousands more learned about the home’s advanced construction via the webpage, YouTube, Twitter, Facebook, Instagram, and Pinterest.
Department of Housing and Urban Development — The HOME Investment Partnership Program (HOME) is authorized under Title II of the Cranston-Gonzalez National Affordable Housing Act. HOME provides formula grants to...
Healthy ageing and home: the perspectives of very old people in five European countries.
Sixsmith, J; Sixsmith, A; Fänge, A Malmgren; Naumann, D; Kucsera, C; Tomsone, S; Haak, M; Dahlin-Ivanoff, S; Woolrych, R
2014-04-01
This paper reports on in-depth research, using a grounded theory approach, to examine the ways in which very old people perceive healthy ageing in the context of living alone at home within urban settings in five European countries. This qualitative study was part of a cross-national project entitled ENABLE-AGE which examined the relationship between home and healthy ageing. Interviews explored the notion of healthy ageing, the meaning and importance of home, conceptualisations of independence and autonomy and links between healthy ageing and home. Data analysis identified five ways in which older people constructed healthy ageing: home and keeping active; managing lifestyles, health and illness; balancing social life; and balancing material and financial circumstances. Older people reflected on their everyday lives at home in terms of being engaged in purposeful, meaningful action and evaluated healthy ageing in relation to the symbolic and practical affordances of the home, contextualised within constructions of their national context. The research suggests that older people perceive healthy ageing as an active achievement, created through individual, personal effort and supported through social ties despite the health, financial and social decline associated with growing older. The physicality and spatiality of home provided the context for establishing and evaluating the notion of healthy ageing, whilst the experienced relationship between home, life history and identity created a meaningful space within which healthy ageing was negotiated. Copyright © 2014 Elsevier Ltd. All rights reserved.
SVM to detect the presence of visitors in a smart home environment.
Petersen, Johanna; Larimer, Nicole; Kaye, Jeffrey A; Pavel, Misha; Hayes, Tamara L
2012-01-01
With the rising age of the population, there is increased need to help elderly maintain their independence. Smart homes, employing passive sensor networks and pervasive computing techniques, enable the unobtrusive assessment of activities and behaviors of the elderly which can be useful for health state assessment and intervention. Due to the multiple health benefits associated with socializing, accurately tracking whether an individual has visitors to their home is one of the more important aspects of elders' behaviors that could be assessed with smart home technology. With this goal, we have developed a preliminary SVM model to identify periods where untagged visitors are present in the home. Using the dwell time, number of sensor firings, and number of transitions between major living spaces (living room, dining room, kitchen and bathroom) as features in the model, and self report from two subjects as ground truth, we were able to accurately detect the presence of visitors in the home with a sensitivity and specificity of 0.90 and 0.89 for subject 1, and of 0.67 and 0.78 for subject 2, respectively. These preliminary data demonstrate the feasibility of detecting visitors with in-home sensor data, but highlight the need for more advanced modeling techniques so the model performs well for all subjects and all types of visitors.
2013-01-01
The home environment is an important influence on the sedentary behaviour and physical activity of children, who have limited independent mobility and spend much of their time at home. This article reviews the current evidence regarding the influence of the home physical environment on the sedentary behaviour and physical activity of children aged 8–14 years. A literature search of peer reviewed articles published between 2005 and 2011 resulted in 38 observational studies (21 with activity outcomes, 23 with sedentary outcomes) and 11 experimental studies included in the review. The most commonly investigated behavioural outcomes were television watching and moderate to vigorous physical activity. Media equipment in the home and to a lesser extent the bedroom were positively associated with children’s sedentary behaviour. Physical activity equipment and the house and yard were not associated with physical activity, although environmental measures were exclusively self-reported. On the other hand, physical activity equipment was inversely associated with sedentary behaviours in half of studies. Observational studies that investigated the influence of the physical and social environment within the home space, found that the social environment, particularly the role of parents, was important. Experimental studies that changed the home physical environment by introducing a television limiting device successfully decreased television viewing, whereas the influence of introducing an active video game on activity outcomes was inconsistent. Results highlight that the home environment is an important influence on children’s sedentary behaviour and physical activity, about which much is still unknown. While changing or controlling the home physical environment shows promise for reducing screen based sedentary behaviour, further interventions are needed to understand the broader impact of these changes. Future studies should prioritise investigating the influence of the
The dwelling space of postnatal care.
Smythe, Elizabeth A; Payne, Deborah; Wilson, Sally; Wynyard, Sue
2013-06-01
This paper considers the dwelling space of postnatal care, how being-there feels for the woman going through the experience of matrescence. The research takes a hermeneutic approach and draws on philosophical notions from Heidegger. 'What is the nature of the dwelling space of valued postnatal care?'. Appropriate ethics approval was gained. Participants were midwives, nurses, women, and other relevant stakeholders. There were 4 focus groups involving 11 participants and 19 individual interviews. Data collection was conducted over a one week period by a team of three researchers. An interview schedule had been organised by the administrator at the Centre. Participants chose whether to come to the centre to be interviewed, or be interviewed in their own homes. Most interviews were an hour. All interviews were tape recorded and transcribed, with the participant's permission. Data was analysed through a hermeneutic process set in the context of related literature. When women are invited into a dwelling space that strengthens them they feel 'mothered': being listened to, have their needs anticipated, and are cared for in a loving manner. In such a way they grow confidence. A child health nurse reported the difference such care made to on-going mothering at home. All women deserve a dwelling space in their early days of matrescence. Small birthing centres perhaps achieve such care and ambience more easily than large institutional units. Nevertheless, wherever the place, practices need to be enabled that foster the spirit of dwelling. Copyright © 2012 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.
Quantum stochastic calculus in Fock space: A review
International Nuclear Information System (INIS)
Hudson, R.L.
1986-01-01
This paper presents a survey of the recently developed theory of quantum stochastic calculus in Boson Fock space, together with its applications. The work focuses on a non-commutative generalization of the classical Ito stochastic calculus of Brownian motion, which exploits to the full the Wiener-Segal duality transformation identifying the L 2 space of Wiener measure with a Boson Fock space. This Fock space emerges as the natural home of not only Brownian motion but also classical Poisson processes, and even of Fermionic processes of the type developed by Barnett et al. The principle physical application of the theory to the construction and characterization of unitary dilations of quantum dynamical semigroups is also described
Effects of Birth Order and Spacing on Mother-Infant Interactions.
Lewis, Michael; Kreitzberg, Valerie S.
1979-01-01
Examines early differences in mother-infant interaction as a function of infant birth order and birth spacing. Mother and infant behaviors were observed and recorded in the home for a two-hour period. (SS)
Smart Cities - Smart Homes and Smart Home Technology
Faanes, Erlend Kydland
2014-01-01
This master’s thesis consists of two articles where the first article is theoretical and the second is the empirical study. Article I The purpose with this paper is to explore and illuminate how smart home and smart home technology can contribute to enhance health and Quality of Life in elderly citizens and allow them to live longer in their home. The paper provides a brief introduction to health promotion and highlights the thesis theoretical framework and foundation of Aaron Antonov...
Nursing perception of patient transitions from hospitals to home with home health.
Smith, Shannon Bright; Alexander, Judith W
2012-01-01
The study's purpose was to determine nurses' opinions of sending patients from the hospital to home with home health services. The study occurred in the Charleston, South Carolina, Tricounty area (Berkeley, Charleston, and Dorchester counties). Home health agencies and hospitals were invited to participate. The study used a survey design to gather information on nursing perceptions of current practices and needed changes to improve transition of patients. The population was nurses (licensed practical nurses (LPNs) and registered nurses (RNs)) employed at inpatient hospitals or home health agencies in the area. Thirty-four RNs responded with no LPNs respondents. Agency administrators/chief nursing officers agreed for their agencies to participate and distributed the survey using a Research Electronic Data Capture (REDCap) Internet-based survey tool. Using the survey results and information from a literature review, the study developed a list of propositions, which participating administrators reviewed, for improving transitions to home. Both home health and hospital nurses reported a need to improve the process of sending patients from hospital to home with home health services. This study provides hospitals and home health agencies with propositions to facilitate the establishment of a process to communicate effectively patients care needs and streamline the discharging patients from the hospital to home health care; thus, improving patient transition. Case managers and discharge planners will need interagency collaboration along with evidence-based interventions to transition patients from the hospital to home with home health services with various populations. Direct patient care nurses in both hospital and home health settings should share the same accountability as case managers to ensure successful transitions.
Representing in-home and out-of-home energy consumption behavior in Beijing
International Nuclear Information System (INIS)
Yu Biying; Zhang Junyi; Fujiwara, Akimasa
2011-01-01
It is expected that in-home and out-of-home energy consumption behavior in a household might be correlated with each other, probably due to the existence of household budget constraints. Ownership and usage of energy-saving technologies for in-home appliances (or vehicles) might lead to the increase in out-of-home (or in-home) energy consumption. It is therefore necessary to jointly represent in-home and out-of-home energy consumption in the same modeling framework. With this consideration, we first build a new type of energy consumption model based on the Multiple Discrete-Continuous Extreme Value (MDCEV) modeling framework. Next, we conducted a questionnaire survey in Beijing in 2009 and successfully collected the information about households' energy consumption, ownership/usage of in-home appliances and vehicles, and households' and their members' attributes from 1014 households. Throughout an empirical analysis, it is confirmed that the MDCEV model is effective to simultaneously describe the in-home and out-of-home energy consumption behavior. In addition, it is revealed that a set of household and personal attributes affect the ownership and usage of in-home appliances and vehicles. Furthermore, it is shown that the unobserved factors play a much more important role in explaining energy consumption behavior than the observed attributes of households and their members. - Highlights: → Representing in-home and out-of-home energy consumption behavior jointly. → MDCEV model is built to describe household energy consumption behavior. → Log-linear competitive relationships are found among expenditures of end-uses. → Model results provide some insights about the influence of varied observed factors. → Unobserved factors are more important in explaining energy consumption behavior.
Home Health Compare: Find a Home Health Agency
... page could not be loaded. The Medicare.gov Home page currently does not fully support browsers with " ... widget - Select to show Back to top Footer Home A federal government website managed and paid for ...
... Home Health Insights Exercise & Weight Exercise at Home Exercise at Home Make an Appointment Ask a Question ... with the movement and contact your provider. Posture Exercises Better posture means better breathing and movement. Axial ...
DEFF Research Database (Denmark)
Hansen, Ellen Kathrine; Olesen, Gitte Gylling Hammershøj; Mullins, Michael
2013-01-01
The article places focus on how smart technologies integrated in a one family- home and particular the window offer unique challenges and opportunities for designing buildings with the best possible environments for people and nature. Toward an interdisciplinary approach, we address the interaction...... between daylight defined in technical terms and daylight defined in aesthetic, architectural terms. Through field-tests of a Danish carbon-neutral home and an analysis of five key design parameters, we explore the contradictions and potentials in smart buildings, using the smart window as example of how...... to the energy design is central. The study illuminates an approach of the design of smart houses as living organisms by connecting technology with the needs of the occupants with the power and beauty of daylight....
IASM: Individualized activity space modeler
Hasanzadeh, Kamyar
2018-01-01
Researchers from various disciplines have long been interested in analyzing and describing human mobility patterns. Activity space (AS), defined as an area encapsulating daily human mobility and activities, has been at the center of this interest. However, given the applied nature of research in this field and the complexity that advanced geographical modeling can pose to its users, the proposed models remain simplistic and inaccurate in many cases. Individualized Activity Space Modeler (IASM) is a geographic information system (GIS) toolbox, written in Python programming language using ESRI's Arcpy module, comprising four tools aiming to facilitate the use of advanced activity space models in empirical research. IASM provides individual-based and context-sensitive tools to estimate home range distances, delineate activity spaces, and model place exposures using individualized geographical data. In this paper, we describe the design and functionality of IASM, and provide an example of how it performs on a spatial dataset collected through an online map-based survey.
Bringing Work Home: Take-Home Pesticide Exposure Among Farm Families
Curwin, B.D.
2006-01-01
In this thesis take-home pesticide exposure among farm families, with an emphasis on herbicides, was investigated. Take-home exposure occurs when a worker unwittingly brings home a substance on his or her clothing or shoes, thereby potentially exposing his or her family. The pesticides investigated
Preliminary experiences with 222Rn gas in Arizona homes
International Nuclear Information System (INIS)
Kearfott, K.J.
1989-01-01
Results of a survey of 222Rn gas using four-day charcoal canister tests in 759 Arizona homes are reported. Although the study was not random with respect to population or land area, it was useful in identifying areas at risk and locating several homes having elevated indoor 222Rn air concentrations. Approximately 18% of the homes tested exceeded 150 Bq m-3 (4 pCi L-1), with 7% exceeding 300 Bq m-3 (8 pCi L-1). Several Arizona cities had larger fractions of homes exceeding 150 Bq m-3 (4 pCi L-1), such as Carefree and Cave Creek (23%), Paradise Valley (30%), Payson (33%), and Prescott (31%). The Granite Dells and Groom Creek areas of Prescott had in excess of 40-60% of the houses tested exceeding 150 Bq m-3 (4 pCi L-1). Elevated 222Rn concentrations were measured for a variety of home types having different construction materials. Private well water was identified as a potentially significant source of 222Rn gas in Prescott homes, with water from one well testing over 3.5 MBq m-3 (94,000 pCi L-1). A 222Rn concentration in air exceeding 410,000 Bq m-3 (11,000 pCi L-1) was measured using a four-day charcoal canister test in a house in Prescott which had a well opening into a living space. Additional measurements in this 150-m3 dwelling revealed a strikingly heterogeneous 222Rn concentration. The excessive 222Rn level in the dwelling was reduced to less than 190 Bq m-3 (5.2 pCi L-1) by sealing the well head with caulking and providing passive ventilation through a pipe
Burns, Suzanne Perea; Pickens, Noralyn Davel; Dawson, Deirdre R; Perea, Jaimee D; Vas, Asha K; Marquez de la Plata, Carlos; Neville, Marsha
2018-02-06
Adults with stroke frequently experience executive dysfunction. Despite the range of assessments that examine the effects of executive dysfunction on daily tasks, there remains a paucity of literature that examines the influence of the environment on performance in the community. The MET-Home is an ecologically valid assessment for examining post-stroke executive dysfunction in the home environment. This qualitative study explores the relationship between the environment and MET-Home performance among home-dwelling adults with stroke and matched controls. Using a descriptive qualitative approach, we analysed video, interview, and observation notes from a MET-Home validation study. An overarching theme of interplay between everyday task performance and the home environment produced further themes: naturalistically emerging supports and barriers and environment as strategy. Within naturalistically emerging supports and barriers, five contextual sub-themes were discovered: physical environment, social environment, temporal context, virtual context, and personal context. Within environment as strategy, we identified four sub-themes: reducing distractions, using everyday technologies, planning in context, and seeking social support. These findings extend the conceptualisation of how we evaluate executive dysfunction in the context of the community to also consider the inherent influence of the environment.
Smart homes and home health monitoring technologies for older adults: A systematic review.
Liu, Lili; Stroulia, Eleni; Nikolaidis, Ioanis; Miguel-Cruz, Antonio; Rios Rincon, Adriana
2016-07-01
Around the world, populations are aging and there is a growing concern about ways that older adults can maintain their health and well-being while living in their homes. The aim of this paper was to conduct a systematic literature review to determine: (1) the levels of technology readiness among older adults and, (2) evidence for smart homes and home-based health-monitoring technologies that support aging in place for older adults who have complex needs. We identified and analyzed 48 of 1863 relevant papers. Our analyses found that: (1) technology-readiness level for smart homes and home health monitoring technologies is low; (2) the highest level of evidence is 1b (i.e., one randomized controlled trial with a PEDro score ≥6); smart homes and home health monitoring technologies are used to monitor activities of daily living, cognitive decline and mental health, and heart conditions in older adults with complex needs; (3) there is no evidence that smart homes and home health monitoring technologies help address disability prediction and health-related quality of life, or fall prevention; and (4) there is conflicting evidence that smart homes and home health monitoring technologies help address chronic obstructive pulmonary disease. The level of technology readiness for smart homes and home health monitoring technologies is still low. The highest level of evidence found was in a study that supported home health technologies for use in monitoring activities of daily living, cognitive decline, mental health, and heart conditions in older adults with complex needs. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Space Applications of Mass Spectrometry. Chapter 31
Hoffman, John H.; Griffin, Timothy P.; Limero, Thomas; Arkin, C. Richard
2010-01-01
Mass spectrometers have been involved in essentially all aspects of space exploration. This chapter outlines some of these many uses. Mass spectrometers have not only helped to expand our knowledge and understanding of the world and solar system around us, they have helped to put man safely in space and expand our frontier. Mass spectrometry continues to prove to be a very reliable, robust, and flexible analytical instrument, ensuring that its use will continue to help aid our investigation of the universe and this small planet that we call home.
SETH: A Hierarchical, Agent-based Architecture for Smart Spaces
Marsá Maestre, Iván
2008-01-01
The ultimate goal of any smart environment is to release users from the tasks they usually perform to achieve comfort, efficiency, and service personalization. To achieve this goal, we propose to use multiagent systems. In this report we describe the SETH architectur: a hierarchical, agent-based solution intended to be applicable to different smart space scenarios, ranging from small environments, like smart homes or smart offices, to large smart spaces like cities.
DOE ZERH Case Study: Addison Homes, Cobbler Lane, Simpsonville, SC
Energy Technology Data Exchange (ETDEWEB)
none,
2015-09-01
Case study of a DOE 2015 Housing Innovation Award winning custom home in the mixed humid climate that got a HERS 41 without PV, with 2x4 16” on-center walls with 1 inch rigid foam, a sealed conditioned crawl space insulated on inside with 2 inches poly iso, a vented attic with R-38 blown fiberglass, a central heat pump with fresh air intake.
DEFF Research Database (Denmark)
Kofod, Jens Erik; Birkemose, A.
2004-01-01
Undernutrition is present among 33% of nursing home residents in Denmark. Hence, it is relevant to examine the meal situation at nursing homes to single out factors that may increase or reduce the residents' food intake. in the ongoing Danish nursing home debate it is claimed that a new type...... of nursing home improves the residents' meal situation with a positive effect on nutrition. The aim of this work is to test the general hypothesis that (i) residents appreciate the meal situation in these nursing homes and (ii) nutritional status of the residents is improved in this type of nursing home....... This study was carried out in four Danish nursing homes at various locations in Denmark. The methods used are qualitative interviews and observations at four nursing homes in combination with measurement of body mass index (BMI) at two of the four nursing homes. Undernutrition is defined as a BMI below 20...
Home care is care that allows a person with special needs stay in their home. It might be for people who are getting ... are chronically ill, recovering from surgery, or disabled. Home care services include Personal care, such as help ...
DEFF Research Database (Denmark)
Kajubi, Phoebe; Bagger, Stine; Katahoire, Anne
2014-01-01
for communication. At the club meetings, where children were in control of the activities, the communication was more egalitarian and child centered. At the treatment centers, there were elements of both hierarchical and egalitarian communication practices. The health workers tended to be rather authoritarian......, speaking mostly to adult caregivers. Efforts to control information about HIV/AIDS were evident in all the three places but were more pronounced in homes. Children were active in using the different spaces, and in seeking information about their health and treatment. The Convention on the Rights...
Attitudes of palliative home care physicians towards palliative sedation at home in Italy.
Mercadante, Sebastiano; Masedu, Francesco; Mercadante, Alessandro; Marinangeli, Franco; Aielli, Federica
2017-05-01
Information about the attitudes towards palliative sedation (PS) at home is limited. The aim of this survey was to assess the attitudes of palliative care physicians in Italy regarding PS at home. A questionnaire was submitted to a sample of palliative care physicians, asking information about their activity and attitudes towards PS at home. This is a survey of home care physicians in Italy who were involved in end-of-life care decisions at home. One hundred and fifty participants responded. A large heterogeneity of home care organizations that generate some problems was found. Indications, intention and monitoring of PS seem to be appropriate, although some cultural and logistic conditions were limiting the use of PS. Specialized home care physicians are almost involved to start PS at home. Midazolam was seldom available at home and opioids were more frequently used. These data should prompt health care agencies to make a minimal set of drugs easily available for home care. Further research is necessary to compare attitudes in countries with different sociocultural profiles.
Effect of home construction on soil carbon storage-A chronosequence case study
International Nuclear Information System (INIS)
Majidzadeh, Hamed; Lockaby, B. Graeme; Governo, Robin
2017-01-01
Urbanization results in the rapid expansion of impervious surfaces, therefore a better understanding of biogeochemical consequences of soil sealing is crucial. Previous research documents a significant reduction in soil carbon and nitrogen content, however, it is unclear if this decrease is a result of top soil removal or long-term soil sealing. In this study, soil biogeochemical properties were quantified beneath homes built on a crawl space at two depths (0–10 cm, and 10–20 cm). All homes, 11–114 years in age, were sampled in the Piedmont region of Alabama and Georgia, USA. This age range enabled the use of a chronosequence approach to estimate carbon loss or gain under the sampled homes. The difference in soil carbon content beneath homes and adjoining urban lawns showed a quadratic relation with age. Maximum C loss occurred at approximately fifty years. The same pattern was observed for MBC: C ratio suggesting that the soil carbon content was decreasing beneath the homes for first fifty years, then increased afterward. The average soil C and N content in the top 10 cm were respectively 61.86% (±4.42%), and 65.77% (±5.65%) lower underneath the homes in comparison to urban lawns. Microbial biomass carbon (MBC), and nitrogen (MBN) were significantly lower below the homes compared to the urban lawns, while bulk density and phosphorus content were higher beneath the homes. - Highlights: • The average soil carbon and nitrogen content decreased by 61.86 %, and 65.77 % underneath the homes in top 10 cm. • Soils beneath the homes are a source of carbon loss for approximately first fifty years. • After age fifty carbon sequestration becomes the dominant process underneath the homes. • Top soil removal and initial disturbance account for a major portion of carbon loss beneath the impervious surfaces. • Average microbial biomass carbon and nitrogen in top 10 cm decreased 65.14 % and 80.51 % respectively beneath the homes. - Soil carbon content in top
Correspondence: comment on “Green Space, health inequality, and pregnancy.”
Geoffrey H. Donovan; Yvonne L. Michael; David T. Butry; Amy D. Sullivan; John M. Chase
2012-01-01
We read with great interest a recent Environment International articleâGreen Space, health inequality, and pregnancyâwhich explores the relationship between greenness around a mother's home, proximity to green space, and pregnancy outcomes in Barcelona (Dadvand et aI., in press). The authors were clearly unaware of a similar study that we recently published on...
... for Educators Search English Español Bringing Your Baby Home KidsHealth / For Parents / Bringing Your Baby Home What's ... recall your baby's seemingly endless crying episodes. The Home Front Introducing your baby to others at home ...
Sociocultural determinants of home delivery in Ethiopia: a qualitative study
Directory of Open Access Journals (Sweden)
Kaba M
2016-04-01
Full Text Available Mirgissa Kaba,1 Tesfaye Bulto,2 Zergu Tafesse,2 Wassie Lingerh,2 Ismael Ali2 1Department of Preventive Medicine, School of Public Health, Addis Ababa University, 2Integrated Family Health Program, John Snow, Inc., Addis Ababa, Ethiopia Background: Maternal health remains a major public health problem in Ethiopia. Despite the government’s measures to ensure institutional delivery assisted by skilled attendants, home delivery remains high, estimated at over 80% of all pregnant women.Objective: The study aims to identify determinants that sustain home delivery in Ethiopia.Methods: A total of 48 women who delivered their most recent child at home, 56 women who delivered their most recent child in a health facility, 55 husbands of women who delivered within 1 year preceding the study, and 23 opinion leaders in selected districts of Amhara, Oromia, Southern Nations, Nationalities, and Peoples’ Region, and Tigray regions were involved in the study. Key informant interview, in-depth interviews, and focus group discussions were conducted to collect data using checklists developed for this purpose. Data reduction and analysis were facilitated by Maxqda qualitative data analysis software version 11.Results: Findings show that pregnancy and delivery is a normal and natural life event. Research participants unanimously argue that such a life event should not be linked with health problems. Home is considered a natural space for delivery and most women aspire to deliver at home where rituals during labor and after delivery are considered enjoyable. Even those who delivered in health facilities appreciate events in connection to home delivery. Efforts are underway to create home-like environments in health facilities, but health facilities are not yet recognized as a natural place of delivery. The positive tendency to deliver at home is further facilitated by poor service delivery at the facility level. Perceived poor competence of providers and limited
24 CFR 982.610 - Group home: Who may reside in a group home.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Group home: Who may reside in a group home. 982.610 Section 982.610 Housing and Urban Development Regulations Relating to Housing and... Housing Types Group Home § 982.610 Group home: Who may reside in a group home. (a) An elderly person or a...
Koonen, A.M.J.
2013-01-01
This article consists of a collection of slides from the author's conference presentation. Some of the specific areas/topics discussed include: Convergence in home networks, home service scenarios; Home wired network architectures, CapEx and OpEx; Residential Gateway; Optical fiber types;
Finigan, Valerie; Chadderton, Diane
2015-06-01
The birth of a baby is a family experience. However, in the United Kingdom birth often occurs outside the family environment, in hospital. Both home and hospital births have risks and benefits, but research shows that, for most women, it is as safe to give birth at home as it is in hospital. Women report home-birth to be satisfying with lowered risks of intervention and less likelihood of being separated from their family. It is also more cost effective for the National Health Service. Yet, whilst midwives are working hard to promote home birth as an option, it remains controversial. The aim of this paper is to raise awareness of the safety of home birth and the needs of women and midwives when a home birth is chosen. It provides an overview of care required and the role of the midwife in the ensuring care is woman-centred and personalised.
Energy Technology Data Exchange (ETDEWEB)
Inoue, Y.; Otaki, K.; Ohara, K. [Yokohama National Univ. (Japan)] Toyama, T. [Tohoku Univ., Sendai (Japan)
1998-06-30
This study pays attention to the relation between individual care and residents` activities in the social welfare institutions for the elderly (nursing homes) and aims to clarify the influence of building environment (nursing home as dwelling place) on individual care. Behaviors of care staffs and residents are surveyed in four nursing homes. The results of the analysis of the survey are as follows: The care staff`s activities are influenced not only by physical environment and also by the residents` activities. A single bed room is more effective than a multi-bed room for individual care. The small care unit is effective in building plan if the number of staffs is enough. The personal care activities which constitute the greater part of the care activities depend on the location of the residents. It is important to pay attention not only to arrange the common space but also how to use the common space. Spatial structure is required the consideration of the relative position of not only care rooms and resident rooms but also of care rooms and the space used by residents. 7 refs., 14 figs., 7 tabs.
Use of Implantable Loop Recorders to Unravel the Cause of Unexplained Syncope
Directory of Open Access Journals (Sweden)
Dr. Aniket Puri, DM, FACC, FAPSIC, FSCAI
2013-03-01
Full Text Available Syncope is a symptom of many underlying disease states, which range from the relatively benign to the life threatening. There are numerous investigations done for patients with recurrent unexplained syncope which may have very low yield when it comes to making a definitive diagnosis. Recently, the implantable loop recorder (ILR for continuous monitoring of the cardiac rhythm has been launched in India. This review will briefly discuss these current availabel strategies and focus on the usefulness of an ILR in the definitive diagnosis and treatment of patients with a recurrent unexplained syncope.
Stickel, L.F.; King, John A.
1968-01-01
The concept of home range was expressed by Seton (1909) in the term 'home region,' which Burr (1940, 1943) clarified with a definition of home range and exemplified in a definitive study of Peromyscus in the field. Burt pointed out the ever-changing characteristics of home-range area and the consequent absence of boundaries in the usual sense--a finding verified by investigators thereafter. In the studies summarized in this paper, sizes of home ranges of Peromyscus varied within two magnitudes, approximately from 0.1 acre to ten acres, in 34 studies conducted in a variety of habitats from the seaside dunes of Florida to the Alaskan forests. Variation in sizes of home ranges was correlated with both environmental and physiological factors; with habitat it was conspicuous, both in the same and different regions. Food supply also was related to size of home range, both seasonally and in relation to habitat. Home ranges generally were smallest in winter and largest in spring, at the onset of the breeding season. Activity and size also were affected by changes in weather. Activity was least when temperatures were low and nights were bright. Effects of rainfall were variable. Sizes varied according to sex and age; young mice remained in the parents' range until they approached maturity, when they began to travel more widely. Adult males commonly had larger home ranges than females, although there were a number of exceptions. An inverse relationship between population density and size of home range was shown in several studies and probably is the usual relationship. A basic need for activity and exploration also appeared to influence size of home range. Behavior within the home range was discussed in terms of travel patterns, travels in relation to home sites and refuges, territory, and stability of size of home range. Travels within the home range consisted of repeated use of well-worn trails to sites of food, shelter, and refuge, plus more random exploratory travels
DOE Challenge Home Case Study: e2 Homes – Winter Park, Florida
Energy Technology Data Exchange (ETDEWEB)
none,
2013-01-01
This Challenge Home case study describes the first certified DOE Challenge Home as constructed by e2 Homes. Completed in May 2012, the “Wilson Residence” in Winter Park, Florida, is a 4,305-ft2 custom home that scores a HERS 57 without solar and a better than zero net-energy HERS -7 with solar.
Energy Technology Data Exchange (ETDEWEB)
T. Schirber, C. Ojczyk, and R. Jacobson
2016-05-01
Single family homes in urban areas that are available for renovation by nonprofit developers are often in rough shape (1MM to 2MM nationally). Budgeting has historically focused on improving homes to meet basic housing standards. A rising interest in the long-term impact of homeownership has introduced the need to balance basic needs with home performance. This demonstration project aims to help nonprofit affordable housing developers become familiar with three Building America performance measures, the installation processes, and impacts and benefits of each. A story and a half home in North Minneapolis, MN was presented by Urban Homeworks our local nonprofit partner. The team helped them install three researched upgrade measures: exterior roof insulation or 'overcoat,' exterior foundation insulation, or 'excavationless', and a combined space and water heating HVAC system or 'combi.'
Bridging the Worlds of Entertainment and Space - One Element of the Space Generation Foundation
Hildago, L.
2002-01-01
Programme on Space Applications, SGSabstracts@unsgac.org/fax +1(281)244-7478 The Space Generation Foundation, founder of ISU, is the current home for Space Rocks!, Yuri's Night, and other space projects focused on education, outreach, and sustainable development worldwide. One particular area of success in 2001/2002 has been the involvement of the entertainment community in space events. Yuri's Night brought together musicians, DJs, artists, and the public to celebrate space. Space Rocks will do the same on a much larger scale, employing film, theatre, poetry, music, art, advertising firms, and other unconventional media to communicate space to the public. We will present about the aims and future plans of the Foundation. The Space Generation Advisory Council in support of the United Nations Programme on Space Applications has as its main focus Space education and outreach. Since the Space Generation Forum in 1999, successful global education and outreach projects have been implemented by young people around the world. These and new ideas are being further developed at the Space Generation Summit (SGS), an event at World Space Congress (WSC) that will unite international students and young professionals to develop a youth vision and strategy for the peaceful uses of space. SGS, endorsed by the United Nations, will take place from October 11-13th, during which the 200 delegates will discuss ongoing youth space activities, particularly those stemming from the UNISPACE- III/SGF and taken forward by the Space Generation Advisory Council. Delegates will address a variety of topics with the goal of devising new recommendations according to the theme, 'Accelerating Our Pace in Space'. The material presented here and in other technical sessions throughout WSC includes the results of these discussions.
ConductHome: Gesture Interface Control of Home Automation Boxes
J. Branstett; V. Gagneux; A. Leleu; B. Levadoux; J. Pascale
2015-01-01
This paper presents the interface ConductHome which controls home automation systems with a Leap Motion using "invariant gesture protocols". This interface is meant to simplify the interaction of the user with its environment. A hardware part allows the Leap Motion to be carried around the house. A software part interacts with the home automation box and displays the useful information for the user. An objective of this work is the development of a natural/invariant/simpl...
Cost-effectiveness implications based on a comparison of nursing home and home health case mix.
Kramer, A M; Shaughnessy, P W; Pettigrew, M L
1985-01-01
Case-mix differences between 653 home health care patients and 650 nursing home patients, and between 455 Medicare home health patients and 447 Medicare nursing home patients were assessed using random samples selected from 20 home health agencies and 46 nursing homes in 12 states in 1982 and 1983. Home health patients were younger, had shorter lengths of stay, and were less functionally disabled than nursing home patients. Traditional long-term care problems requiring personal care were more...
Simon, Matthew A.; Toups, Larry
2014-01-01
Increased public awareness of carbon footprints, crowding in urban areas, and rising housing costs have spawned a 'small house movement' in the housing industry. Members of this movement desire small, yet highly functional residences which are both affordable and sensitive to consumer comfort standards. In order to create comfortable, minimum-volume interiors, recent advances have been made in furniture design and approaches to interior layout that improve both space utilization and encourage multi-functional design for small homes, apartments, naval, and recreational vehicles. Design efforts in this evolving niche of terrestrial architecture can provide useful insights leading to innovation and efficiency in the design of space habitats for future human space exploration missions. This paper highlights many of the cross-cutting architectural solutions used in small space design which are applicable to the spacecraft interior design problem. Specific solutions discussed include reconfigurable, multi-purpose spaces; collapsible or transformable furniture; multi-purpose accommodations; efficient, space saving appliances; stowable and mobile workstations; and the miniaturization of electronics and computing hardware. For each of these design features, descriptions of how they save interior volume or mitigate other small space issues such as confinement stress or crowding are discussed. Finally, recommendations are provided to provide guidance for future designs and identify potential collaborations with the small spaces design community.
Solar Energy for Space Heating & Hot Water.
Energy Research and Development Administration, Washington, DC. Div. of Solar Energy.
This pamphlet reviews the direct transfer of solar energy into heat, particularly for the purpose of providing space and hot water heating needs. Owners of buildings and homes are provided with a basic understanding of solar heating and hot water systems: what they are, how they perform, the energy savings possible, and the cost factors involved.…
Huh, Youn Jung
2017-01-01
This study explores young children's digital game play outside of the home as a means of surviving and thriving in modern spaces that limit young children's participation by looking at four digital game-playing three-year-old children. In this ethnographic study, critical theory is used to examine how modern public spaces (e.g., a grocery market,…
Human Resources Division
2002-01-01
Administrative procedures for : Travel to the home station and home leave (hl) Additional travel to the home station (at) Travel to the home station and home leave for family reasons (hlf) As part of the process of simplifying administrative procedures, HR and AS Divisions have devised a new, virtually automatic procedure for payment of travel expenses to the home station. The changes are aimed at rationalising administrative procedures and not at reducing benefits. The conditions of eligibility are unchanged. The new procedure, which will be operational with effect from 1st June 2002, will greatly simplify the administrative processing of claims for travel expenses and the recording of home leaves. Currently, requests for payment are introduced manually into the Advances and Claims system (AVCL) by divisional secretariats. All travel to the home station starting prior to 1st June 2002 will be processed according to the existing system whereas that starting on 1st June and after will be processed accordi...
Dikkers, J.S.E.; Geurts, S.A.E.; Dulk, L. den; Peper, A.B.; Taris, T.W.; Kompier, M.A.J.
2007-01-01
This study examined the associations of work–home culture with (a) demographic and organizational characteristics, (b) the use of work–home arrangements, and (c) negative and positive work–home interaction, among 1,179 employees from one public and two private organizations. Substantial support was
Dikkers, J.S.E.; Geurts, S.A.E.; den Dulk, L.; Peper, B.; Taris, T.W.; Kompier, M.A.J.
2007-01-01
This study examined the associations of work-home culture with (a) demographic and organizational characteristics, (b) the use of work-home arrangements, and (c) negative and positive work-home interaction, among 1,179 employees from one public and two private organizations. Substantial support was
African Journals Online (AJOL)
Sitwala
determine factors associated with home deliveries. Main outcome ... deliver at home than a health facility compared to those who .... regression analysis, women who had four years of schooling or .... by report bias, the burden of home deliveries is a real challenge .... Journal of Econometrics 1987; 36: 185-204. 14. Michelo ...
release announcing Home Energy Saver and a Q-and-A. The "About" page should tell you everything you need to know about using Home Energy Saver. If you have any questions, please email the project leader, Dr. Evan Mills. News Releases Microsoft Licenses Berkeley Lab's Home Energy Saver Code for Its
DOE Zero Energy Ready Home Case Study: Garbett Homes, Herriman, Utah
Energy Technology Data Exchange (ETDEWEB)
none,
2013-09-01
As the first net zero-energy production home certified in Utah, this house incorporates two 94% efficient tankless water heaters and two roof-mounted solar panels that preheat the home's water supply. This home won a 2013 Housing Innovation Award in the production builder category.
Work-home interference in relation to work, organizational, and home characteristics
Dikkers, J.S.E.
2008-01-01
In this thesis we examine work-home interference in relation to work, organizational, and home characteristics. The study is guided by the following three research questions: i) how are workload and negative WHI temporally related? (research question 1); ii) is work-home culture related to the use
Interior design for passive solar homes
Breen, J. C.
1981-07-01
The increasing emphasis on refinement of passive solar systems brought recognition to interior design as an integral part of passive solar architecture. Interior design can be used as a finetuning tool minimizing many of the problems associated with passive solar energy use in residential buildings. In addition, treatment of interior space in solar model homes may be a prime factor in determining sales success. A new style of interior design is evolving in response to changes in building from incorporating passive solar design features. The psychology behind passive solar architecture is reflected in interiors, and selection of interior components increasingly depends on the functional suitably of various interior elements.
Interior design for passive solar homes
Energy Technology Data Exchange (ETDEWEB)
Breen, J. C.
1981-07-01
The increasing emphasis on refinement of passive solar systems has brought recognition to interior design as an integral part of passive solar architecture. Interior design can be used as a finetuning tool minimizing many of the problems associated with passive solar energy use in residential buildings. In addition, treatment of interior space in solar model homes may be a prime factor in determining sales success. A new style of interior design is evolving in response to changes in building form incorporating passive solar design features. The psychology behind passive solar architecture is reflected in interiors, and selection of interior components increasingly depends on the functional suitability of various interior elements.
Closed Crawl Space Performance: Proof of Concept in the Production Builder Marketplace
Energy Technology Data Exchange (ETDEWEB)
Malkin-Weber, Melissa; Dastur, Cyrus; Mauceri, Maria; Hannas, Benjamin
2008-10-30
This overview is intended to be a very concise, limited summary of the key project activities discussed in the detailed report that follows. Due to the large scope of this project, the detailed report is broken into three individually titled sections. Each section repeats key background information, with the goal that the sections will eventually stand alone as complete reports on the major activities of the project. The information presented herein comes from ongoing research, so please note that all observations, findings and recommendations presented are preliminary and subject to change in the future. We invite and welcome your comments and suggestions for improving the project. Advanced Energy completed its first jointly-funded crawl space research project with the Department of Energy in 2005. That project, funded under award number DE-FC26-00NT40995 and titled 'A Field Study Comparison of the Energy and Moisture Performance Characteristics of Ventilated Versus Sealed Crawl Spaces in the South' demonstrated the substantial energy efficiency and moisture management benefits that result from using properly closed crawl space foundations for residential construction instead of traditional wall vented crawl space foundations. Two activities of this first project included (1) an assessment of ten existing homes to document commonly observed energy and moisture failures associated with wall-vented crawl space foundations and (2) a detailed literature review that documented both the history of closed crawl space research and the historical lack of scientific justification for building code requirements for crawl space ventilation. The most valuable activity of the 2005 project proved to be the field demonstration of various closed crawl space techniques, which were implemented in a set of twelve small (1040 square feet), simply designed homes in eastern North Carolina. These homes had matched envelope, mechanical and architectural designs, and comparable
Does hospital at home for palliative care facilitate death at home? Randomised controlled trial
Grande, Gunn E; Todd, Chris J; Barclay, Stephen I G; Farquhar, Morag C
1999-01-01
Objective To evaluate the impact on place of death of a hospital at home service for palliative care. Design Pragmatic randomised controlled trial. Setting Former Cambridge health district. Participants 229 patients referred to the hospital at home service; 43 randomised to control group (standard care), 186 randomised to hospital at home. Intervention Hospital at home versus standard care. Main outcome measures Place of death. Results Twenty five (58%) control patients died at home compared with 124 (67%) patients allocated to hospital at home. This difference was not significant; intention to treat analysis did not show that hospital at home increased the number of deaths at home. Seventy three patients randomised to hospital at home were not admitted to the service. Patients admitted to hospital at home were significantly more likely to die at home (88/113; 78%) than control patients. It is not possible to determine whether this was due to hospital at home itself or other characteristics of the patients admitted to the service. The study attained less statistical power than initially planned. Conclusion In a locality with good provision of standard community care we could not show that hospital at home allowed more patients to die at home, although neither does the study refute this. Problems relating to recruitment, attrition, and the vulnerability of the patient group make randomised controlled trials in palliative care difficult. While these difficulties have to be recognised they are not insurmountable with the appropriate resourcing and setting. Key messagesTerminally ill patients allocated to hospital at home were no more likely to die at home than patients receiving standard careAlthough the subsample of patients actually admitted to hospital at home did show a significant increase in likelihood of dying at home, whether this was due to the service itself or the characteristics of patients admitted to hospital at home could not be determinedThe need to
ORF Alignment: NC_003552 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available FSVARGETLGLFGKSGSGKTTIGRCIVGLEKPTGGEILVQ 60 ... Query: 126 ELAELTGLRPEHLARYPGHLSGGEIQRIVLARIMALSPDFIVADEPTSMLDV...SVQAQILR 185 ... ELAELTGLRPEHLARYPGHLSGGEIQRIVLARIMALSPDFIVADEPTSMLDVSVQAQ...ILR Sbjct: 121 ELAELTGLRPEHLARYPGHLSGGEIQRIVLARIMALSPDFIVADEPTSMLDVSVQAQILR 180 ...
Expressions of Prayer in Residential Care Homes.
Reimer-Kirkham, Sheryl; Sharma, Sonya; Smith, Brenda; Schutt, Kelly; Janzen, Kyla
2018-01-01
Although the value of spiritual care in the care of older adults is supported by research, few studies have focused specifically on prayer in residential care settings. This ethnographic study with fifteen chaplains and administrators in eleven residential care homes involved analyses of walking interviews and research diaries. Findings revealed the spaces in which prayer happens and the forms it takes. The identities of chaplains-their own spiritual practices, religious beliefs, and positioning within the facility-shaped their dis/comfort with prayer and how they located prayer within public and private spaces. Where organizational leadership endorsed the legitimacy of chaplaincy services, prayer was more likely to be offered. Even in these circumstances, however, religious diversity and questions about secularism left chaplains ambivalent about the appropriateness of prayer. The results demonstrate the relevance of religion and spirituality to residential care, and illustrate how prayer functions as an opportunity for connection and understanding.
Safe medication management in specialized home healthcare - an observational study.
Lindblad, Marléne; Flink, Maria; Ekstedt, Mirjam
2017-08-24
Medication management is a complex, error-prone process. The aim of this study was to explore what constitutes the complexity of the medication management process (MMP) in specialized home healthcare and how healthcare professionals handle this complexity. The study is theoretically based in resilience engineering. Data were collected during the MMP at three specialized home healthcare units in Sweden using two strategies: observation of workplaces and shadowing RNs in everyday work, including interviews. Transcribed material was analysed using grounded theory. The MMP in home healthcare was dynamic and complex with unclear boundaries of responsibilities, inadequate information systems and fluctuating work conditions. Healthcare professionals adapted their everyday clinical work by sharing responsibility and simultaneously being authoritative and preserving patients' active participation, autonomy and integrity. To promote a safe MMP, healthcare professionals constantly re-prioritized goals, handled gaps in communication and information transmission at a distance by creating new bridging solutions. Trade-offs and workarounds were necessary elements, but also posed a threat to patient safety, as these interim solutions were not systematically evaluated or devised learning strategies. To manage a safe medication process in home healthcare, healthcare professionals need to adapt to fluctuating conditions and create bridging strategies through multiple parallel activities distributed over time, space and actors. The healthcare professionals' strategies could be integrated in continuous learning, while preserving boundaries of safety, instead of being more or less interim solutions. Patients' and family caregivers' as active partners in the MMP may be an underestimated resource for a resilient home healthcare.
Cosmopolitanism and Subversion of 'Home' in Caryl Phillips's A Distant Shore
Directory of Open Access Journals (Sweden)
Alan McCluskey
2013-11-01
Full Text Available The novels of Caryl Phillips have most commonly been approached from post-colonial theoretical perspectives, a trend which appears entirely appropriate given their recurrent themes of immigration, ethnic discrimination and the legacy of the trans-Atlantic slave trade. However, the analysis below contends that the publication of A Distant Shore marked a change of direction in Phillips's oeuvre towards a less formally experimental but thematically more cosmopolitan form of writing that conspicuously sets out to subvert and redefine the idea of 'home'. Using the critical frameworks of Avtar Brah, Paul Gilroy and Jacques Derrida, the discussion will illustrate how Phillips critically re-imagines the notion 'home' in order to signify an inclusive space of cosmopolitan conviviality and openness.
Second-home electricity consumption
International Nuclear Information System (INIS)
Andersen, Frits M.; Christensen, Morten S.; Jensen, Ole Michael; Kofoed, Niels-Ulrik; Morthorst, Poul Erik
2008-01-01
In Denmark, electricity consumption in first and second homes has developed quite differently. Since 1990, electricity consumption in ordinary residences has grown moderately, while consumption in weekend and second homes has increased considerably. In turn, this development has been blamed on a growing number of luxury cottages, new legislation permitting senior citizens to have their permanent address in their second home and a growing number of electric appliances. In order to examine the growing electricity consumption in second homes and to estimate future demand, a multidisciplinary study combining top-down and bottom-up analyses was conducted, i.e., combining models using aggregated economic parameters and feasibility studies using technical parameters, respectively. The top-down estimation showed that changes in electricity consumption in second homes correlate to changes in income. The bottom-up estimation showed that consumption was mainly affected by the frequency with which second homes were used in the winter time. This indicates that additional second homes, increased full-time use and intensified use of electric appliances are the main reasons for the observed increases in electricity consumption. Luxury tourism use and senior citizens' that use a few per cent of the second homes as their home contribute to a minor degree to the overall increase of electricity consumption. Scenarios show that this development may accelerate with increased leisure time, increased use and more permanent settlement in second homes
DEFF Research Database (Denmark)
Nielsen, Rikke Skovgaard
2015-01-01
The paper focuses on ethnic differences in the timing and patterns of leaving the parental home. Leaving home is a key transition in the life course of the individual, and extensive research has been conducted on the timing and patterns of leaving it. However, ethnic differences in these patterns...... of leaving home. Results showed that while some differences disappeared when controlling for covariates, others persisted, thus indicating ethnic differences in home-leaving patterns. A strong link between leaving home and marriage was substantiated for Turks, but not for Somalis. The home-leaving patterns...... of Somalis were much more similar to those of Danes. Overall, Turkish descendants were similar to Turkish immigrants but with some differentiation. The analyses identified the existence of ethnic differences in home-leaving patterns but also found evidence of a shift towards less traditional patterns, i...
Beyond Home Automation: Designing More Effective Smart Home Systems
Carner, Paolo
2009-01-01
This paper outlines a Smart Home Proof-of-Concept system that uses a Bayesian Network to predict the likelihood of a monitored event to occur. Firstly, this paper will provide an introduction to the concept of a smart home system; then it will outline how Artificial Intelligence concepts can be used to make such systems more effective. Finally, it will detail the implementation of a smart home system, which uses an inference engine to determine the likelihood of a fire. The system prototype h...
Energy Technology Data Exchange (ETDEWEB)
Mallay, D. [Partnership for Home Innovation, Upper Marlboro, MD (United States); Wiehagen, J. [Partnership for Home Innovation, Upper Marlboro, MD (United States); Del Bianco, M. [Partnership for Home Innovation, Upper Marlboro, MD (United States)
2014-10-01
This research high performance home analyzes how a set of advanced technologies can be integrated into a durable and energy-efficient house in the mixed-humid climate while remaining affordable to homeowners. The technical solutions documented in this report are the cornerstone of the builder's entire business model based on delivering high-performance homes on a production basis as a standard product offering to all price segments of the residential market. Home Innovation Research Labs partnered with production builder Nexus EnergyHomes (CZ 4) and they plan to adopt the successful components of the energy solution package for all 55 homes in the community. The research objective was to optimize the builder's energy solution package based on energy performance and construction costs. All of the major construction features, including envelope upgrades, space conditioning system, hot water system, and solar electric system were analyzed.
Ventricular Tachycardia Detected by Implantable Loop Recorder in a Child with Recurrent Syncope
Directory of Open Access Journals (Sweden)
İsa Özyılmaz
2014-06-01
Full Text Available In this article, we present a 10-year-old boy who was admitted to the hospital with recurrent syncope. There was no remarkable finding in patient’s physical examination, family history, and the diagnostic 12-lead electrocardiogram (ECG, chest x-ray, ECG Holter monitoring, event recording, echocardiography, coronary computed tomography (CT angiography, Ajmaline test for the diagnosis of Brugada syndrome, brain magnetic resonance imaging, and sleep/wake electroencephalogram. We started beta-blocker therapy because the patient had exercise-induced syncope. An Implantable loop recorder (ILR was inserted to the patient. Three years later, polymorphic ventricular tachycardia called torsades de pointes was detected by the ILR during syncope occurred with exercise. The patient had been taking high-dose betablocker treatment, an implantable cardioverter defibrillator was implanted into the patient. ILR can play an important role in the diagnosis of life-threatening arrhythmia in children with unexplained syncope. (The Medical Bulletin of Haseki 2014; 52: 123-5
Birchley, Giles; Huxtable, Richard; Murtagh, Madeleine; ter Meulen, Ruud; Flach, Peter; Gooberman-Hill, Rachael
2017-01-01
Background Smart-home technologies, comprising environmental sensors, wearables and video are attracting interest in home healthcare delivery. Development of such technology is usually justified on the basis of the technology?s potential to increase the autonomy of people living with long-term conditions. Studies of the ethics of smart-homes raise concerns about privacy, consent, social isolation and equity of access. Few studies have investigated the ethical perspectives of smart-home engine...
At Home in the Office. A Guide for the Home Worker.
Thomas, Neil; And Others
This guide provides information to persons interested in establishing a work-at-home program, specifically those in clerical or support staff positions who use modern automated office equipment. The text is divided into two sections. The Home Worker section provides a summary of the At Home in the Office Project, personality characteristics…
Evolution of Home Automation Technology
Mohd. Rihan; M. Salim Beg
2009-01-01
In modern society home and office automation has becomeincreasingly important, providing ways to interconnectvarious home appliances. This interconnection results infaster transfer of information within home/offices leading tobetter home management and improved user experience.Home Automation, in essence, is a technology thatintegrates various electrical systems of a home to provideenhanced comfort and security. Users are grantedconvenient and complete control over all the electrical homeappl...
Second-home electricity consumption
Energy Technology Data Exchange (ETDEWEB)
Andersen, Frits M.; Morthorst, Poul Erik [Risoe, Systems Analysis Department, Technical University of Denmark, P.O. Box 49, DK-4000 Roskilde (Denmark); Christensen, Morten S.; Kofoed, Niels-Ulrik [Esbensen Consulting Engineers, Carl Jacobsens Vej 25D, DK-2500 Valby (Denmark); Jensen, Ole Michael [Danish Building Research Institute, Department of Energy and Environment, University of Aalborg, P.O. Box 119, DK-2970 Horsholm (Denmark)
2008-01-15
In Denmark, electricity consumption in first and second homes has developed quite differently. Since 1990, electricity consumption in ordinary residences has grown moderately, while consumption in weekend and second homes has increased considerably. In turn, this development has been blamed on a growing number of luxury cottages, new legislation permitting senior citizens to have their permanent address in their second home and a growing number of electric appliances. In order to examine the growing electricity consumption in second homes and to estimate future demand, a multidisciplinary study combining top-down and bottom-up analyses was conducted, i.e., combining models using aggregated economic parameters and feasibility studies using technical parameters, respectively. The top-down estimation showed that changes in electricity consumption in second homes correlate to changes in income. The bottom-up estimation showed that consumption was mainly affected by the frequency with which second homes were used in the winter time. This indicates that additional second homes, increased full-time use and intensified use of electric appliances are the main reasons for the observed increases in electricity consumption. Luxury tourism use and senior citizens' that use a few per cent of the second homes as their home contribute to a minor degree to the overall increase of electricity consumption. Scenarios show that this development may accelerate with increased leisure time, increased use and more permanent settlement in second homes. (author)
Home ranges of lions in the Kalahari, Botswana exhibit vast sizes and high temporal variability.
Zehnder, André; Henley, Stephen; Weibel, Robert
2018-06-01
The central Kalahari region in Botswana is one of the few remaining ecosystems with a stable lion population. Yet, relatively little is known about the ecology of the lions there. As an entry point, home range estimations provide information about the space utilization of the studied animals. The home ranges of eight lions in this region were determined to investigate their spatial overlaps and spatiotemporal variations. We found that, except for MCP, all home range estimators yielded comparable results regarding size and shape. The home ranges of all individuals were located predominantly inside the protected reserves. Their areas were among the largest known for lions with 1131 - 4314km 2 (95%), with no significant differences between males and females. Numerous overlaps between lions of different sexes were detected, although these originate from different groups. A distance chart confirmed that most of these lions directly encountered each other once or several times. Strong temporal variations of the home ranges were observed that did not match a seasonal pattern. The exceptionally large home ranges are likely to be caused by the sparse and dynamic prey populations. Since the ungulates in the study area move in an opportunistic way, too, strong spatiotemporal home range variations emerge. This can lead to misleading home ranges. We therefore recommend clarifying the stability of the home ranges by applying several levels of temporal aggregation. The lack of strict territoriality is likely an adaptation to the variable prey base and the high energetic costs associated with defending a large area. Copyright © 2018 Elsevier GmbH. All rights reserved.
DOE Zero Energy Ready Home Case Study: Amaris Homes, Afton Model
Energy Technology Data Exchange (ETDEWEB)
Pacific Northwest National Laboratory
2017-09-01
Amaris Homes built this 3,734-ft2 home in Afton, Minnesota, to the performance criteria of the DOE Zero Energy Ready Home (ZERH) program. A high-efficiency gas boiler provides hot water for the zoned radiant floor system as well as for faucets and showers. A high-efficiency heat pump provides zoned cooling.
Strategy Guideline: Demonstration Home
Energy Technology Data Exchange (ETDEWEB)
Savage, C.; Hunt, A.
2012-12-01
This guideline will provide a general overview of the different kinds of demonstration home projects, a basic understanding of the different roles and responsibilities involved in the successful completion of a demonstration home, and an introduction into some of the lessons learned from actual demonstration home projects. Also, this guideline will specifically look at the communication methods employed during demonstration home projects. And lastly, we will focus on how to best create a communication plan for including an energy efficient message in a demonstration home project and carry that message to successful completion.
Strategy Guideline. Demonstration Home
Energy Technology Data Exchange (ETDEWEB)
Hunt, A.; Savage, C.
2012-12-01
This guideline will provide a general overview of the different kinds of demonstration home projects, a basic understanding of the different roles and responsibilities involved in the successful completion of a demonstration home, and an introduction into some of the lessons learned from actual demonstration home projects. Also, this guideline will specifically look at the communication methods employed during demonstration home projects. And lastly, we will focus on how to best create a communication plan for including an energy efficient message in a demonstration home project and carry that message to successful completion.
Mini-Split Heat Pump Evaluation and Zero Energy Ready Home Support
Energy Technology Data Exchange (ETDEWEB)
Herk, Anastasia [IBACOS, Inc., Pittsburgh, PA (United States)
2017-01-01
IBACOS worked with builder Imagine Homes to evaluate the performance of an occupied new construction test house following construction of the house in the hot, humid climate of San Antonio, Texas. The project measures the effectiveness of a space conditioning strategy using a multihead mini-split heat pump (MSHP) system in a reduced-load home to achieve acceptable comfort levels (temperature and humidity) and energy performance. IBACOS collected long-term data and analyzed the energy consumption and comfort conditions of the occupied house after one year of operation. Although measured results indicate that the test system provides comfort both inside and outside the ASHRAE Standard 55-2010 range, the occupants of the house claimed both adequate comfort and appreciation of the ease of use and flexibility of the installed MSHP system. IBACOS also assisted the builder to evaluate design and specification changes necessary to comply with Zero Energy Ready Home, but the builder chose to not move forward with it because of concerns about the 'solar ready' requirements of the program.
Shugarman, L R; Fries, B E; James, M
1999-01-01
Admission cohorts from the Michigan Medicaid Home and Community-Based Waiver program and Ohio nursing homes were compared on measures of resource utilization including a modified Resource Utilization Groups (RUG-III) system, Activities of Daily Living (ADLs), and overall case mix. We found that, contrary to previous research, the two samples were remarkably similar across RUG-III categories. However, the nursing home sample was more functionally impaired on measures of ADL functioning and overall case mix. Results of this study may inform policymakers and providers of the potential for maintaining the appropriate population in the home with government-funded home care.
At-home and away-from-home dietary patterns and BMI z-scores in Brazilian adolescents.
Cunha, Diana Barbosa; Bezerra, Ilana Nogueira; Pereira, Rosangela Alves; Sichieri, Rosely
2018-01-01
Away-from-home food intake has been associated with high rates of overweight among children and adolescents. However, there are no studies comparing at-home and away-from-home eating patterns among adolescents. The objective of this paper was to identify at-home and away-from-home dietary patterns among adolescents in Brazil, and to evaluate the relationship between these patterns and body mass index (BMI) z-scores. Data from the Brazilian National Dietary Survey 2008-2009 were analyzed in this cross-sectional study. Dietary intake was assessed by completion of written food records on two non-consecutive days. Five thousand two hundred sixty-six adolescents 10-19 years of age living in urban areas of Brazil were included in the analysis. Thirty-two food groups were examined by factor analysis, stratified by at-home and away-from-home eating. The associations between the food patterns and BMI z-scores were ascertained using linear regression analysis. In general, mean at-home food intake was greater than away-from-home food intake, but the ratio of away-from-home/at-home was greater than 30% for baked and deep-fried snacks, soft drinks, sandwiches, pizza, and desserts, and was lower than 10% for rice and beans. Three main similar dietary patterns were identified both at-home and away-from-home: the "Traditional pattern", the "Bread and Butter pattern" and the "Western pattern"; however, away-from-home patterns encompassed more overall food items. Only the at-home "Western pattern" was positively associated with BMI z-scores (β = 0.0006; p away-from-home food consumption is not associated. Copyright © 2017 Elsevier Ltd. All rights reserved.
Alert management for home healthcare based on home automation analysis.
Truong, T T; de Lamotte, F; Diguet, J-Ph; Said-Hocine, F
2010-01-01
Rising healthcare for elder and disabled people can be controlled by offering people autonomy at home by means of information technology. In this paper, we present an original and sensorless alert management solution which performs multimedia and home automation service discrimination and extracts highly regular home activities as sensors for alert management. The results of simulation data, based on real context, allow us to evaluate our approach before application to real data.
Home-Grown Politics: The Politicization of the Parlour Room in Contemporary Northern Irish Drama
Directory of Open Access Journals (Sweden)
Megan W. Minogue
2014-01-01
Full Text Available In Stewart Parker’s Pentecost (1987, Christina Reid’s Tea in a China Cup (1983 and The Belle of the Belfast City (1989, and Gary Mitchell’s Loyal Women (2003, the home and nation become inextricably linked, as one serves as a microcosm for the other. Within the volatile political landscape of Northern Ireland, the private space of the home becomes a public forum for the characters in these plays, almost all of whom are women. Often unheard by the predominantly male presence in Northern Irish politics, these women find their voice in the domestic comfort of their homes, with the support and encouragement of other women. Yet despite this reign over the domestic sphere, the women’s perceived power and dominance is continually subverted, through economic, sexual, and political means.
Polivka, Barbara J; Wills, Celia E; Darragh, Amy; Lavender, Steven; Sommerich, Carolyn; Stredney, Donald
2015-11-01
The number of personnel providing in-home health care services is increasing substantially. The unique configuration of environmental hazards in individual client homes has a significant impact on the safety and health of home health care providers (HHPs). This mixed-methods study used data from a standardized questionnaire, focus groups, and individual interviews to explore environmental health and safety hazards encountered by HHPs in client homes. The participant sample (N = 68) included nurses, aides, therapists, and owners/managers from a variety of geographic locations. The most often-reported hazards were trip/slip/lift hazards, biohazards, and hazards from poor air quality, allergens, pests and rodents, and fire and burns. Frequency of identified key hazards varied by room, that is, kitchen (e.g., throw rugs, water on floor), bathroom (e.g., tight spaces for client handling), bedroom (e.g., bed too low), living room (e.g., animal waste), and hallway (e.g., clutter). Findings indicate the need for broader training to enable HHPs to identify and address hazards they encounter in client homes. © 2015 The Author(s).
16 CFR 460.16 - What new home sellers must tell new home buyers.
2010-01-01
... LABELING AND ADVERTISING OF HOME INSULATION § 460.16 What new home sellers must tell new home buyers. If you are a new home seller, you must put the following information in every sales contract: The type... exception to this rule. If the buyer signs a sales contract before you know what type of insulation will be...
Green space as a buffer between stressful life events and health.
van den Berg, Agnes E; Maas, Jolanda; Verheij, Robert A; Groenewegen, Peter P
2010-04-01
This study investigates whether the presence of green space can attenuate negative health impacts of stressful life events. Individual-level data on health and socio-demographic characteristics were drawn from a representative two-stage sample of 4529 Dutch respondents to the second Dutch National Survey of General Practice (DNSGP-2), conducted in 2000-2002. Health measures included: (1) the number of health complaints in the last 14 days; (2) perceived mental health (measured by the GHQ-12); and (3) a single item measure of perceived general health ranging from 'excellent' to 'poor'. Percentages of green space in a 1-km and 3-km radius around the home were derived from the 2001 National Land cover Classification database (LGN4). Data were analysed using multilevel regression analysis, with GP practices as the group-level units. All analyses were controlled for age, gender, income, education level, and level of urbanity. The results show that the relationships of stressful life events with number of health complaints and perceived general health were significantly moderated by amount of green space in a 3-km radius. Respondents with a high amount of green space in a 3-km radius were less affected by experiencing a stressful life event than respondents with a low amount of green space in this radius. The same pattern was observed for perceived mental health, although it was marginally significant. The moderating effects of green space were found only for green space within 3 km, and not for green space within 1 km of residents' homes, presumably because the 3-km indicator is more affected by the presence of larger areas of green space, that are supposed to sustain deeper forms of restoration. These results support the notion that green space can provide a buffer against the negative health impact of stressful life events. Copyright 2010 Elsevier Ltd. All rights reserved.
Welffens, K; Kirkpatrick, C; Daelemans, C; Derisbourg, S
In Belgium, very few women give birth outside the delivery room. In the United Kingdom and in the Netherlands, they are more numerous. Several studies evaluated obstetric and neonatal outcomes of home births compared with hospital births. We selected seven recent and large studies (with cohorts of more than 5.000 women) using PubMed, Science Direct and Cochrane Database of Systematic Reviews. Several questions were examined. Is there any difference in maternal and neonatal outcomes depending on the intended place of birth? Does parity affect outcomes ? What are the characteristics of women who choose to deliver at home ? We conclude that giving birth at home improves obstetric outcomes but is riskier for the baby, especially for the first one. The women delivering at home are mainly white Europeans, between 25 and 35 years old, in a relationship, multiparous and wealthier. In order to avoid this increased risk for the baby while preserving the obstetric advantages, alongside birth centers offer an intermediate solution. They combine the reassuring home-like atmosphere with the safety of the hospital. In Belgium, the first alongside birth center " Le Cocon " (a low technicity unit distinct from the delivery room) offers now this type of alternative place of birth for women in Hôpital Erasme in Brussels.
Social Work Home Visits to Children and Families in the UK: A Foucauldian Perspective.
Winter, Karen; Cree, Viviene E
2016-07-01
The home visit is at the heart of social work practice with children and families; it is what children and families' social workers do more than any other single activity (except for recording), and it is through the home visit that assessments are made on a daily basis about risk, protection and welfare of children. And yet it is, more than any other activity, an example of what Pithouse has called an 'invisible trade': it happens behind closed doors, in the most secret and intimate spaces of family life. Drawing on conceptual tools associated with the work of Foucault, this article sets out to provide a critical, chronological review of research, policy and practice on home visiting. We aim to explain how and in what ways changing discourses have shaped the emergence, legitimacy, research and practice of the social work home visit to children and families at significant time periods and in a UK context. We end by highlighting the importance for the social work profession of engagement and critical reflection on the identified themes as part of their daily practice.
Project Help Donate Porting Graphics Add-ons Science About SETI@home About Astropulse Science Community Message boards Questions and Answers Teams Profiles User search Web sites Pictures and music User University of California SETI@home and Astropulse are funded by grants from the National Science Foundation
Schmitz, Oliver; Soenario, Ivan; Vaartjes, Ilonca; Strak, Maciek; Hoek, Gerard; Brunekreef, Bert; Dijst, Martin; Karssenberg, Derek
2016-04-01
Air pollution is one of the major concerns for human health. Associations between air pollution and health are often calculated using long-term (i.e. years to decades) information on personal exposure for each individual in a cohort. Personal exposure is the air pollution aggregated along the space-time path visited by an individual. As air pollution may vary considerably in space and time, for instance due to motorised traffic, the estimation of the spatio-temporal location of a persons' space-time path is important to identify the personal exposure. However, long term exposure is mostly calculated using the air pollution concentration at the x, y location of someone's home which does not consider that individuals are mobile (commuting, recreation, relocation). This assumption is often made as it is a major challenge to estimate space-time paths for all individuals in large cohorts, mostly because limited information on mobility of individuals is available. We address this issue by evaluating multiple approaches for the calculation of space-time paths, thereby estimating the personal exposure along these space-time paths with hyper resolution air pollution maps at national scale. This allows us to evaluate the effect of the space-time path and resulting personal exposure. Air pollution (e.g. NO2, PM10) was mapped for the entire Netherlands at a resolution of 5×5 m2 using the land use regression models developed in the European Study of Cohorts for Air Pollution Effects (ESCAPE, http://escapeproject.eu/) and the open source software PCRaster (http://www.pcraster.eu). The models use predictor variables like population density, land use, and traffic related data sets, and are able to model spatial variation and within-city variability of annual average concentration values. We approximated space-time paths for all individuals in a cohort using various aggregations, including those representing space-time paths as the outline of a persons' home or associated parcel
Paramedic-Initiated Home Care Referrals and Use of Home Care and Emergency Medical Services.
Verma, Amol A; Klich, John; Thurston, Adam; Scantlebury, Jordan; Kiss, Alex; Seddon, Gayle; Sinha, Samir K
2018-01-01
We examined the association between paramedic-initiated home care referrals and utilization of home care, 9-1-1, and Emergency Department (ED) services. This was a retrospective cohort study of individuals who received a paramedic-initiated home care referral after a 9-1-1 call between January 1, 2011 and December 31, 2012 in Toronto, Ontario, Canada. Home care, 9-1-1, and ED utilization were compared in the 6 months before and after home care referral. Nonparametric longitudinal regression was performed to assess changes in hours of home care service use and zero-inflated Poisson regression was performed to assess changes in the number of 9-1-1 calls and ambulance transports to ED. During the 24-month study period, 2,382 individuals received a paramedic-initiated home care referral. After excluding individuals who died, were hospitalized, or were admitted to a nursing home, the final study cohort was 1,851. The proportion of the study population receiving home care services increased from 18.2% to 42.5% after referral, representing 450 additional people receiving services. In longitudinal regression analysis, there was an increase of 17.4 hours in total services per person in the six months after referral (95% CI: 1.7-33.1, p = 0.03). The mean number of 9-1-1 calls per person was 1.44 (SD 9.58) before home care referral and 1.20 (SD 7.04) after home care referral in the overall study cohort. This represented a 10% reduction in 9-1-1 calls (95% CI: 7-13%, p home care referral and 0.79 (SD 6.27) after home care referral, representing a 7% reduction (95% CI: 3-11%, p home care records were included in the analysis, the reductions in 9-1-1 calls and ambulance transports to ED were attenuated but remained statistically significant. Paramedic-initiated home care referrals in Toronto were associated with improved access to and use of home care services and may have been associated with reduced 9-1-1 calls and ambulance transports to ED.
Recommended Ventilation Strategies for Energy-Efficient Production Homes
Energy Technology Data Exchange (ETDEWEB)
Roberson, J.; Brown, R.; Koomey, J.; Warner, J.; Greenberg, S.
1998-12-01
This report evaluates residential ventilation systems for the U.S. Environmental Protection Agency's (EPA's) ENERGY STAR{reg_sign} Homes program and recommends mechanical ventilation strategies for new, low-infiltration, energy-efficient, single-family, ENERGY STAR production (site-built tract) homes in four climates: cold, mixed (cold and hot), hot humid, and hot arid. Our group in the Energy Analysis Department at Lawrence Berkeley National Lab compared residential ventilation strategies in four climates according to three criteria: total annualized costs (the sum of annualized capital cost and annual operating cost), predominant indoor pressure induced by the ventilation system, and distribution of ventilation air within the home. The mechanical ventilation systems modeled deliver 0.35 air changes per hour continuously, regardless of actual infiltration or occupant window-opening behavior. Based on the assumptions and analysis described in this report, we recommend independently ducted multi-port supply ventilation in all climates except cold because this strategy provides the safety and health benefits of positive indoor pressure as well as the ability to dehumidify and filter ventilation air. In cold climates, we recommend that multi-port supply ventilation be balanced by a single-port exhaust ventilation fan, and that builders offer balanced heat-recovery ventilation to buyers as an optional upgrade. For builders who continue to install forced-air integrated supply ventilation, we recommend ensuring ducts are airtight or in conditioned space, installing a control that automatically operates the forced-air fan 15-20 minutes during each hour that the fan does not operate for heating or cooling, and offering ICM forced-air fans to home buyers as an upgrade.
New American Home(regsign): Atlanta, Georgia - 2001; Building America--The New American Home
International Nuclear Information System (INIS)
IBACOS; Anderson, R.
2001-01-01
The New American Home(reg s ign) is an annual showcase project designed by committee and co-sponsored by the National Association of Home Builders' National Council of the Housing Industry, BUILDERS Magazine, and Ladies Home Journal. Hedgewood Properties teamed with Building America's IBACOS Consortium and Southface Energy Institute to build a house with a Home Energy Rating Systems (HERS) level of 90
DEFF Research Database (Denmark)
Andersen, Pernille Viktoria Kathja; Christiansen, Ellen Tove
2013-01-01
of these user voices has directed us towards a ‘home-keeping’ design discourse, which opens new horizons for design of digital home control systems by allowing users to perform as self-determined controllers and groomers of their habitat. The paper concludes by outlining the implications of a ‘home......Does living with digital technology inevitably lead to digital living? Users talking about a digital home control system, they have had in their homes for eight years, indicate that there is more to living with digital technology than a functional-operational grip on regulation. Our analysis......-keeping’ design discourse....
... Us Home > Healthy Living > Living With Lung Disease > Respiratory Home Health Care Font: Aerosol Delivery Oxygen Resources ... Teenagers Living With Lung Disease Articles written by Respiratory Experts Respiratory Home Health Care Respiratory care at ...
Asthma Home Environment Checklist
This checklist guides home care visitors in identifying environmental asthma triggers most commonly found in homes. It includes sections on the building, home interior and room interior and provides low-cost action steps for remediation.
Designing and Securing an Event Processing System for Smart Spaces
Li, Zang
2011-01-01
Smart spaces, or smart environments, represent the next evolutionary development in buildings, banking, homes, hospitals, transportation systems, industries, cities, and government automation. By riding the tide of sensor and event processing technologies, the smart environment captures and processes information about its surroundings as well as…
DOE Zero Energy Ready Home Case Study: One Sky Homes — Cottle Zero Net Energy Home, San Jose, CA
Energy Technology Data Exchange (ETDEWEB)
none,
2014-09-01
This builder took home the Grand Winner prize in the Custom Builder category in the 2014 Housing Innovation Awards for its high performance building science approach. The builder used insulated concrete form blocks to create the insulated crawlspace foundation for its first DOE Zero Energy Ready Home, the first net zero energy new home certified in the state of California.
Mendez, Bryan J.; Westphal, A. J.; Butterworth, A. L.; Craig, N.
2006-12-01
On January 15, 2006, NASA’s Stardust mission returned to Earth after nearly seven years in interplanetary space. During its journey, Stardust encountered comet Wild 2, collecting dust particles from it in a special material called aerogel. At two other times in the mission, aerogel collectors were also opened to collect interstellar dust. The Stardust Interstellar Dust Collector is being scanned by an automated microscope at the Johnson Space Center. There are approximately 700,000 fields of view needed to cover the entire collector, but we expect only a few dozen total grains of interstellar dust were captured within it. Finding these particles is a daunting task. We have recruited many thousands of volunteers from the public to aid in the search for these precious pieces of space dust trapped in the collectors. We call the project Stardust@home. Through Stardust@home, volunteers from the public search fields of view from the Stardust aerogel collector using a web-based Virtual Microscope. Volunteers who discover interstellar dust particles have the privilege of naming them. The interest and response to this project has been extraordinary. Many people from all walks of life are very excited about space science and eager to volunteer their time to contribute to a real research project such as this. We will discuss the progress of the project and the education and outreach activities being carried out for it.
Hendriks, T.D.
2016-01-01
For many Malawians the concept of home is strongly associated with the rural areas and one's (supposedly rural) place of birth. This 'grand narrative about home', though often reiterated, doesn't necessarily depict lived reality. Malawi's history of movement and labor migration coupled with
Hendriks, T.D.
2017-01-01
For many Malawians the concept of home is strongly associated with the rural areas and one's (supposedly rural) place of birth. This 'grand narrative about home', though often reiterated, doesn't necessarily depict lived reality. Malawi's history of movement and labor migration coupled with
S-Denying of the Signature Conditions Expands General Relativity's Space
Directory of Open Access Journals (Sweden)
Rabounski D.
2006-07-01
Full Text Available We apply the S-denying procedure to signature conditions in a four-dimensional pseudo-Riemannian space — i. e. we change one (or even all of the conditions to be partially true and partially false. We obtain five kinds of expanded space-time for General Relativity. Kind I permits the space-time to be in collapse. Kind II permits the space-time to change its own signature. Kind III has peculiarities, linked to the third signature condition. Kind IV permits regions where the metric fully degenerates: there may be non-quantum teleportation, and a home for virtual photons. Kind V is common for kinds I, II, III, and IV.
Birchley, Giles; Huxtable, Richard; Murtagh, Madeleine; Ter Meulen, Ruud; Flach, Peter; Gooberman-Hill, Rachael
2017-04-04
Smart-home technologies, comprising environmental sensors, wearables and video are attracting interest in home healthcare delivery. Development of such technology is usually justified on the basis of the technology's potential to increase the autonomy of people living with long-term conditions. Studies of the ethics of smart-homes raise concerns about privacy, consent, social isolation and equity of access. Few studies have investigated the ethical perspectives of smart-home engineers themselves. By exploring the views of engineering researchers in a large smart-home project, we sought to contribute to dialogue between ethics and the engineering community. Either face-to-face or using Skype, we conducted in-depth qualitative interviews with 20 early- and mid-career smart-home researchers from a multi-centre smart-home project, who were asked to describe their own experience and to reflect more broadly about ethical considerations that relate to smart-home design. With participants' consent, interviews were audio-recorded, transcribed and analysed using a thematic approach. Two overarching themes emerged: in 'Privacy', researchers indicated that they paid close attention to negative consequences of potential unauthorised information sharing in their current work. However, when discussing broader issues in smart-home design beyond the confines of their immediate project, researchers considered physical privacy to a lesser extent, even though physical privacy may manifest in emotive concerns about being watched or monitored. In 'Choice', researchers indicated they often saw provision of choice to end-users as a solution to ethical dilemmas. While researchers indicated that choices of end-users may need to be restricted for technological reasons, ethical standpoints that restrict choice were usually assumed and embedded in design. The tractability of informational privacy may explain the greater attention that is paid to it. However, concerns about physical privacy may
Telemedicine in Neonatal Home Care
DEFF Research Database (Denmark)
Holm, Kristina Garne; Brødsgaard, Anne; Zachariassen, Gitte
2016-01-01
participatory design and qualitative methods. Data were collected from observational studies, individual interviews, and focus group interviews. Two neonatal units participated. One unit was experienced in providing neonatal home care with home visits, and the other planned to offer neonatal home care......BACKGROUND: For the majority of preterm infants, the last weeks of hospital admission mainly concerns tube feeding and establishment of breastfeeding. Neonatal home care (NH) was developed to allow infants to remain at home for tube feeding and establishment of breastfeeding with regular home...... visits from neonatal nurses. For hospitals covering large regions, home visits may be challenging, time consuming, and expensive and alternative approaches must be explored. OBJECTIVE: To identify parental needs when wanting to provide neonatal home care supported by telemedicine. METHODS: The study used...
Reducing Human Radiation Risks on Deep Space Missions
2017-09-01
101 Figure 49. Human Health, Life Support, and Habitation System...2013). These same studies reveal that for astronauts returning home, this may result in significant loss of lifespan and quality of life due to...warnings to the satellites in orbit at either planet , or to spacecraft in transit (Phys.org 2010). C. IMPROVEMENTS TO MEASUREMENTS OF SPACE RADIATION
Directory of Open Access Journals (Sweden)
Nor Nur Safwati Mohd
2014-07-01
Full Text Available One important issue in robotic services is the construction of the robotic system in the actual environment. In other words, robots must perform environment sensing or have information on real objects, such as location and 3D dimensions, in order to live together with humans. It is crucial to have a mechanism to create an actual robotic system (intelligent space such that there is no initialization framework for the objects in the environment, or we have to perform SLAM and object recognition as well as mapping to generate a useful environmental database. In intelligent space research, normally the objects are attached to various sensors in order to extract the necessary information. However, that approach will highly depend on sensor accuracy and the robotic system will be burdened if there are too many sensors in an environment. Therefore, in this paper we present a system in which a robot can obtain information about an object and even create the furniture layout map for an unknown environment. Our approach is intended to improve home-based robotic services by taking into account the user or individual preferences for the Intelligent Space (IS. With this information, we can create an informational map of the home-based environment for the realization of robot assistance of humans in their daily activities at home, especially for disabled people. The result shows the system design and development in our approach by using model-based system engineering.
MANAJEMEN SARANA PRASARANA DI DAY CARE BABY’S HOME SALATIGA
Directory of Open Access Journals (Sweden)
Desi Kusumawati
2017-01-01
Full Text Available Day Care is one form of early childhood education in non formal education program that organize nurturing and social welfare of children from birth up to the age of 6 years. This study aimed to identify the suitability of existing infrastructure in Baby's Home day care with the ACT of Minister of Education and Culture No. 137 of 2014 Article 32 Paragraph 3; and to provide an overview why the planning, maintenance and inventory in Baby's Home day care were not optimal. This study was qualitative research. The subject was Baby's Home day care Salatiga. Technique of collecting data using interviews, observation and documents. Data were analyzed using Miles and Huberman Model. Data validation using triangulation technique of data. Facilities and infrastructure in Baby's Home day care which conform with ACT of Minister of Education and Culture No. 137 of 2014 Article 32 Paragraph 3 of were the area of land, space of activities inside and outside, hand washing facilities, showers and latrines, and access to health facilities. While things were not conform included the bedroom, dining room, and covered trash. The cause of the planning, maintenance and inventory of facilities and infrastructure have not optimally done because the plan was not carried out continuously, the lack of personnel to assist in the maintenance, and did not have the administrative staff specifically for inventory. Advice can be given to Baby's Home day care is to conduct procurement planning infrastructure on sleeping room, dining room and trash. In addition, the maintenance to existing infrastructure must be made as well as the inventory of infrastructure in order to facilitate the planning purchasing.
Making the Transition from Traditional to Home Schooling: Home School Family Motivations
Anthony, Kenneth Vance; Burroughs, Susie
2010-01-01
This study examined the motivations of families that operate home schools. Four intact, religiously conservative families were interviewed and observed over one year. Findings showed that families were motivated by multiple factors to leave traditional schooling and begin home schooling. Additionally, the motivations to home school influenced the…
Directory of Open Access Journals (Sweden)
Susan Algert
2016-04-01
Full Text Available As of 2013, 42 million American households were involved in growing their own food either at home or in a community garden plot. The purpose of this pilot study was to document the extent to which gardeners, particularly less affluent ones, increase their vegetable intake when eating from either home or community garden spaces. Eighty-five community gardeners and 50 home gardeners from San Jose, California, completed a survey providing information on demographic background, self-rated health, vegetable intake and the benefits of gardening. The gardeners surveyed were generally low income and came from a variety of ethnic and educational backgrounds. Participants in this study reported doubling their vegetable intake to a level that met the number of daily servings recommended by the U.S. Dietary Guidelines. Growing food in community and home gardens can contribute to food security by helping provide access to fresh vegetables and increasing consumption of vegetables by gardeners and their families.
Byrd, Mary E
2006-01-01
The purpose of this paper was to develop a nursing-focused use of social exchange theory within the context of maternal-child home visiting. The nature of social exchange theory, its application to client-nurse interaction, and its fit with an existing data set from a field research investigation were examined. Resources exchanged between the nurse and clients were categorized and compared across the patterns of home visiting, nursing strategies based on exchange notions were identified, and variations in exchange were linked with client outcomes. The nurse provided resources within the categories of information, status, service, and goods. Clients provided time, access to the home, space within the home to conduct the visit, opportunities to observe maternal-child interaction, access to the infant, and information. The ease and breadth of resource exchange varied across the patterns of home visiting. The social exchange perspective was useful in categorizing resources, specifying and uncovering new resource categories, understanding nursing strategies to initiate and maintain the client-nurse relationship, and linking client-nurse interactive phenomena with client outcomes. Social exchange theory is potentially useful for understanding client-nurse interaction in the context of maternal-child home visits.
Full Text Available ... Ostomy Home Skills Program Ostomy Home Skills Program Adult Ostomy Pediatric Ostomy Programa de Destrezas para manejo Doméstico de Ostomía Ostomy Home Skills Program Adult Ostomy Pediatric Ostomy Programa de Destrezas para manejo ...
Tsevat, Rebecca K; Sinha, Anoushka A; Gutierrez, Kevin J; DasGupta, Sayantani
2015-11-01
As health humanities programs grow and thrive across the country, encouraging medical students to read, write, and become more reflective about their professional roles, educators must bring a sense of self-reflexivity to the discipline itself. In the health humanities, novels, patient histories, and pieces of reflective writing are often treated as architectural spaces or "homes" that one can enter and examine. Yet, narrative-based learning in health care settings does not always allow its participants to feel "at home"; when not taught with a critical attention to power and pedagogy, the health humanities can be unsettling and even dangerous. Educators can mitigate these risks by considering not only what they teach but also how they teach it.In this essay, the authors present three pedagogical pillars that educators can use to invite learners to engage more fully, develop critical awareness of medical narratives, and feel "at home" in the health humanities. These pedagogical pillars are narrative humility (an awareness of one's prejudices, expectations, and frames of listening), structural competency (attention to sources of power and privilege), and engaged pedagogy (the protection of students' security and well-being). Incorporating these concepts into pedagogical practices can create safe and productive classroom spaces for all, including those most vulnerable and at risk of being "unhomed" by conventional hierarchies and oppressive social structures. This model then can be translated through a parallel process from classroom to clinic, such that empowered, engaged, and cared-for learners become empowering, engaging, and caring clinicians.
Interpersonal relationships of elderly in selected old age homes in urban India
Directory of Open Access Journals (Sweden)
Duvvuru Jamuna
2008-12-01
Full Text Available Never before have there been so many old people in India. According the 2001 Census of India data, the projected figure for 2031 is 179 million seniors. Dual-career families, changing values, and nuclear family dynamics have altered the social landscape of India. An emerging phenomenon in urban India is the emergence of “pay and stay” homes as a late life living arrangement for middle and higher-income groups. This study focused on selected ‘pay and stay’ homes in the four cities of Hyderabad, Bangalore, Chennai, and Tiruvananthapuram. Personal interviews were conducted with 150 seniors to understand the relocation experience, the extent and nature of self-reported social networks, and evaluation by seniors of this late life arrangement. Majority of respondents were female (65%. More than half of the respondents (58% reported being currently widowed. Results show that childlessness and strained intergenerational relationships were important considerations in the decision to relocate. Majority of the seniors had never conceived that they would be spending their autumn years away from family. Occupants frequently conceived of their living space as their “home.” Living amidst non-family members, the reported network sizes were small. The absence of family members was frequently cited as a source of dissatisfaction when evaluating these homes.
Kerger, Brent D; Suder, David R; Schmidt, Chuck E; Paustenbach, Dennis J
2005-03-26
This study evaluates airborne concentrations of common trihalomethane compounds (THM) in selected living spaces of homes supplied with chlorinated tap water containing >85 ppb total THM. Three small homes in an arid urban area were selected, each having three bedrooms, a full bath, and approximately 1000 square feet; two homes had standard (refrigeration-type) central air conditioning and the third had a central evaporative cooling system ("swamp cooler"). A high-end water-use pattern was used at each home in this exposure simulation. THM were concurrently measured on 4 separate test days in tap water and air in the bathroom, living room, the bedroom closest to the bathroom, and outside using Summa canisters. Chloroform (trichloromethane, TCM), bromodichloromethane (BDCM), and dibromochloromethane (DBCM) concentrations were quantified using U.S. EPA Method TO-14. The apparent volatilization fraction consistently followed the order: TCM > BDCM > DBCM. Relatively low airborne THM concentrations (similar to outdoors) were found in the living room and bedroom samples for the home with evaporative cooling, while the refrigeration-cooled homes showed significantly higher THM levels (three- to fourfold). This differential remained after normalizing the air concentrations based on estimated THM throughput or water concentrations. These findings indicate that, despite higher throughput of THM-containing water in homes using evaporative coolers, the higher air exchange rates associated with these systems rapidly clears THM to levels similar to ambient outdoor concentrations.
Advancing Replicable Solutions for High-Performance Homes in the Southeast
Energy Technology Data Exchange (ETDEWEB)
Roberts, S. G. [Southface Energy Inst., Upper Marlboro, MD (United States); Sweet, M. L. [Southface Energy Inst., Upper Marlboro, MD (United States); Francisco, A. [Southface Energy Inst., Upper Marlboro, MD (United States)
2016-03-01
Southface Energy Institute (Southface) partnered with owners and/or builders with various market constraints and ultimate goals for three projects in different climate zones: Savannah, GA (CZ 2), Clemson, SC (CZ 3), and LaFayette, GA (CZ 4). This report documents the design process, computational energy modeling, construction, envelope performance metrics, long-term monitoring results, and successes and failures of the design and execution of these high performance homes. The three bedroom/two bathroom test home in Savannah Gardens on an elevated slab foundation has a semi-conditioned, encapsulated attic. A neighboring home built to EarthCraft specifications was also monitored as a control for exterior foam insulation and a heat pump water heater (HPWH). For the JMC Patrick Square, a single-story project in Clemson, the small-scale production builder wanted to increase their level of energy efficiency beyond their current green building practices, including bringing ducts into conditioned space. Through a combination of upgrade measures the team met this goal and achieved many Zero Energy Ready Home requirements. LaFayette Housing Authority undertook a development of 30 affordable rental housing units in 15 duplexes in LaFayette, GA. Because they would be long-term owners, their priorities were low utility bills for the residents and durable, maintainable buildings. The team employed BEopt to optimize buildling envelope and systems choices, including 2x6 advanced framed walls, insulated slab, and heat pump water heater in a utility closet which was ducted to/from an encapsulated attic.
Breed, Greg A; Golson, Emily A; Tinker, M Tim
2017-01-01
The home-range concept is central in animal ecology and behavior, and numerous mechanistic models have been developed to understand home range formation and maintenance. These mechanistic models usually assume a single, contiguous home range. Here we describe and implement a simple home-range model that can accommodate multiple home-range centers, form complex shapes, allow discontinuities in use patterns, and infer how external and internal variables affect movement and use patterns. The model assumes individuals associate with two or more home-range centers and move among them with some estimable probability. Movement in and around home-range centers is governed by a two-dimensional Ornstein-Uhlenbeck process, while transitions between centers are modeled as a stochastic state-switching process. We augmented this base model by introducing environmental and demographic covariates that modify transition probabilities between home-range centers and can be estimated to provide insight into the movement process. We demonstrate the model using telemetry data from sea otters (Enhydra lutris) in California. The model was fit using a Bayesian Markov Chain Monte Carlo method, which estimated transition probabilities, as well as unique Ornstein-Uhlenbeck diffusion and centralizing tendency parameters. Estimated parameters could then be used to simulate movement and space use that was virtually indistinguishable from real data. We used Deviance Information Criterion (DIC) scores to assess model fit and determined that both wind and reproductive status were predictive of transitions between home-range centers. Females were less likely to move between home-range centers on windy days, less likely to move between centers when tending pups, and much more likely to move between centers just after weaning a pup. These tendencies are predicted by theoretical movement rules but were not previously known and show that our model can extract meaningful behavioral insight from complex
Energy Technology Data Exchange (ETDEWEB)
Schmid, W.
2006-09-15
Home automation commonly applies to control of lighting, shading, heating, safety etc., i.e. a purely functional concept. Recently, many systems have come to integrate home entertainment as well: Bang and Olufsen and Revox meets heating, light, and ventilation. (orig.)
There is no place like @home!: The value of home consultations in paediatric rehabilitation.
van Maren-Suir, I; Ketelaar, M; Brouns, B; van der Sanden, K; Verhoef, M
2018-07-01
Family-centred services (FCS) is widely regarded as the best practice approach in early interventions. Creating a therapeutic environment, which also stimulates collaboration between parents and service professionals, is a way to conform to the principles of FCS. The present paper describes the project entitled @home, involving the implementation of home consultations by a specialized team working with children aged 0-5 years at our rehabilitation centre in the Netherlands. The objectives of this article are to (a) describe the development and implementation of home consultations as part of regular care and (b) share the experiences of parents and service providers with home consultations. The implementation process was divided into 3 steps: (1) interviewing experts, (2) adjusting current rehabilitation trajectories, and (3) service providers offering consultations to children at home. The experiences with the home consultations were immediately incorporated in the system, making the implementation an iterative process. In 82% of the 133 home conducted consultations, the service professionals reported that it was more valuable to offer home consultations than seeing the child at the rehabilitation centre. The semistructured interviews revealed that parents and service providers found that they received and provided more tailored advice, perceived a more equal partnership between service professionals and parents, and reported that the home consultations provided a good natural therapeutic environment where a child can be itself and where the child performs best. By using the @home system based on the 3 service models, home consultations are now part of the regular paediatric rehabilitation system at our rehabilitation centre. © 2018 John Wiley & Sons Ltd.
Retrofitting Combined Space and Water Heating Systems: Laboratory Tests
Energy Technology Data Exchange (ETDEWEB)
Schoenbauer, B.; Bohac, D.; Huelman, P.; Olson, R.; Hewitt, M.
2012-10-01
Better insulated and tighter homes can often use a single heating plant for both space and domestic water heating. These systems, called dual integrated appliances (DIA) or combination systems, can operate at high efficiency and eliminate combustion safety issues associated by using a condensing, sealed combustion heating plant. Funds were received to install 400 DIAs in Minnesota low-income homes. The NorthernSTAR DIA laboratory was created to identify proper system components, designs, operating parameters, and installation procedures to assure high efficiency of field installed systems. Tests verified that heating loads up to 57,000 Btu/hr can be achieved with acceptable return water temperatures and supply air temperatures.
Retrofitting Combined Space and Water Heating Systems. Laboratory Tests
Energy Technology Data Exchange (ETDEWEB)
Schoenbauer, B. [NorthernStar Building America Partnership, St. Paul, MN (United States); Bohac, D. [NorthernStar Building America Partnership, St. Paul, MN (United States); Huelman, P. [NorthernStar Building America Partnership, St. Paul, MN (United States); Olsen, R. [NorthernStar Building America Partnership, St. Paul, MN (United States); Hewett, M. [NorthernStar Building America Partnership, St. Paul, MN (United States)
2012-10-01
Better insulated and tighter homes can often use a single heating plant for both space and domestic water heating. These systems, called dual integrated appliances (DIA) or combination systems, can operate at high efficiency and eliminate combustion safety issues associated by using a condensing, sealed combustion heating plant. Funds were received to install 400 DIAs in Minnesota low-income homes. The NorthernSTAR DIA laboratory was created to identify proper system components, designs, operating parameters, and installation procedures to assure high efficiency of field installed systems. Tests verified that heating loads up to 57,000 Btu/hr can be achieved with acceptable return water temperatures and supply air temperatures.
Pervasive Home Care - Technological support for treatment of diabetic foot ulcers at home
DEFF Research Database (Denmark)
Larsen, Simon Bo
2006-01-01
of the patient in collaboration with patient and home care clinicians. My main research method has been qualitative analysis of the empirical results generated during an experimental project using Participatory Design (PD) to investigate potential futures in the treatment of patients with diabetic foot ulcers...... the need arises for moving treatment and care involving specialised knowledge from the hospital to the home. In this dissertation I use the term Home Care" for the multidisciplinary investigation of how this movement can be supported with technology enabling the expert to carry on a treatment in the home...... approach that I outline in this dissertation. Furthermore I describe the results of the project contributing to three related scientific fields: home care technologies, telemedicine and computer supported cooperative work (CSCW). The main conclusion towards home care technologies is that the many visionary...
Energy Technology Data Exchange (ETDEWEB)
Matzke, D.J.; Osowski, D.M.; Radtke, M.L.
1976-01-01
This progress report describes the objectives and results of the intercollegiate Energy Resource Alternatives competition. The one-year program concluded in August 1975, with a final testing program of forty student-built alternative energy projects at the Sandia Laboratories in Albuquerque, New Mexico. The goal of the competition was to design and build prototype hardware which could provide space heating and cooling, hot water, and electricity at a level appropriate to the needs of homes, farms, and light industry. The hardware projects were powered by such nonconventional energy sources as solar energy, wind, biologically produced gas, coal, and ocean waves. The competition rules emphasized design innovation, economic feasibility, practicality, and marketability. (auth)
Chahed, Salma; Marcon, Eric; Sahin, Evren; Feillet, Dominique; Dallery, Yves
2009-06-01
Home Care (HC) services provide complex and coordinated medical and paramedical care to patients at their homes. As health care services move into the home setting, the need for developing innovative approaches that improve the efficiency of home care organizations increases. We first conduct a literature review of investigations dealing with operation planning within the area of home care management. We then address a particular issue dealing with the planning of operations related to chemotherapy at home as it is an emergent problem in the French context. Our interest is focused on issues specific to the anti-cancer drug supply chain. We identify various models that can be developed and analyze one of them.
Funk, M.; Chen, L.; Chen, Y.-K.; Yang, S.-W.
2018-01-01
The Internet of Things (IoT) and connected products have become ubiquitous technological advances into personal and professional living spaces, such as the smart home. What connectivity and distributed computing have made possible, is still programmed only in more or less simplified rule systems (or
The Science of Home Automation
Thomas, Brian Louis
Smart home technologies and the concept of home automation have become more popular in recent years. This popularity has been accompanied by social acceptance of passive sensors installed throughout the home. The subsequent increase in smart homes facilitates the creation of home automation strategies. We believe that home automation strategies can be generated intelligently by utilizing smart home sensors and activity learning. In this dissertation, we hypothesize that home automation can benefit from activity awareness. To test this, we develop our activity-aware smart automation system, CARL (CASAS Activity-aware Resource Learning). CARL learns the associations between activities and device usage from historical data and utilizes the activity-aware capabilities to control the devices. To help validate CARL we deploy and test three different versions of the automation system in a real-world smart environment. To provide a foundation of activity learning, we integrate existing activity recognition and activity forecasting into CARL home automation. We also explore two alternatives to using human-labeled data to train the activity learning models. The first unsupervised method is Activity Detection, and the second is a modified DBSCAN algorithm that utilizes Dynamic Time Warping (DTW) as a distance metric. We compare the performance of activity learning with human-defined labels and with automatically-discovered activity categories. To provide evidence in support of our hypothesis, we evaluate CARL automation in a smart home testbed. Our results indicate that home automation can be boosted through activity awareness. We also find that the resulting automation has a high degree of usability and comfort for the smart home resident.
Halvorsen, Kjell H; Granas, Anne Gerd; Engeland, Anders; Ruths, Sabine
2012-09-01
To examine and compare the quality of drug prescribing for older patients in nursing homes and home nursing services. Cross-sectional study comprising 11,254 patients aged ≥ 65 years in nursing homes (n = 2986) and home nursing services (n = 8268). Potentially inappropriate medications were identified by using the Norwegian General Practice criteria and drug-drug interactions through a Norwegian Web-based tool. The impact of care setting on exposure to selected drug groups, potentially inappropriate medications, and drug interactions was calculated, adjusting for patients' age, gender, and number of drugs used. Patients in nursing homes and home nursing services used on average 5.7 (SD = 2.6) multidose dispensed regular drugs. Twenty-six percent used at least one potentially inappropriate medication, 31% in nursing homes and 25% in home nursing services, p nursing homes (18%) and home nursing services (9%), p nursing homes, more patients in home nursing services used cardiovascular drugs and fewer patients used psychotropic drugs. Altogether, 8615 drug-drug interactions were identified in 55% of patients, 48% in nursing homes and 57% in home nursing services, p quality of drug prescribing in nursing homes compared with home nursing services. Explanations as to why these differences exist need to be further explored. Copyright © 2011 John Wiley & Sons, Ltd.
Windows Home Server users guide
Edney, Andrew
2008-01-01
Windows Home Server brings the idea of centralized storage, backup and computer management out of the enterprise and into the home. Windows Home Server is built for people with multiple computers at home and helps to synchronize them, keep them updated, stream media between them, and back them up centrally. Built on a similar foundation as the Microsoft server operating products, it's essentially Small Business Server for the home.This book details how to install, configure, and use Windows Home Server and explains how to connect to and manage different clients such as Windows XP, Windows Vist
Comparison of Long-term Care in Nursing Homes Versus Home Health: Costs and Outcomes in Alabama.
Blackburn, Justin; Locher, Julie L; Kilgore, Meredith L
2016-04-01
To compare acute care outcomes and costs among nursing home residents with community-dwelling home health recipients. A matched retrospective cohort study of Alabamians aged more than or equal to 65 years admitted to a nursing home or home health between March 31, 2007 and December 31, 2008 (N = 1,291 pairs). Medicare claims were compared up to one year after admission into either setting. Death, emergency department and inpatient visits, inpatient length of stay, and acute care costs were compared using t tests. Medicaid long-term care costs were compared for a subset of matched beneficiaries. After one year, 77.7% of home health beneficiaries were alive compared with 76.2% of nursing home beneficiaries (p Home health beneficiaries averaged 0.2 hospital visits and 0.1 emergency department visits more than nursing home beneficiaries, differences that were statistically significant. Overall acute care costs were not statistically different; home health beneficiaries' costs averaged $31,423, nursing home beneficiaries' $32,239 (p = .5032). Among 426 dual-eligible pairs, Medicaid long-term care costs averaged $4,582 greater for nursing home residents (p nursing home or home health care. Additional research controlling for exogenous factors relating to long-term care decisions is needed. © The Author 2014. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Smart Home Test Bed: Examining How Smart Homes Interact with the Power Grid
Energy Technology Data Exchange (ETDEWEB)
2016-11-01
This fact sheet highlights the Smart Home Test Bed capability at the Energy Systems Integration Facility. The National Renewable Energy Laboratory (NREL) is working on one of the new frontiers of smart home research: finding ways for smart home technologies and systems to enhance grid operations in the presence of distributed, clean energy technologies such as photovoltaics (PV). To help advance this research, NREL has developed a controllable, flexible, and fully integrated Smart Home Test Bed.
DEFF Research Database (Denmark)
Kreuzer, Maria; von Wallpach, Sylvia; Muehlbacher, Hans
2016-01-01
In a context of unprecedented migration home reaches high relevance. This study aims at understanding the (re-)construction of home by first generation consumer migrants. The findings provide insights into consumers’ (re-)construction of various dimensions of home and identify “inner home” as a n...
Smart assistants for smart homes
Rasch, Katharina
2013-01-01
The smarter homes of tomorrow promise to increase comfort, aid elderly and disabled people, and help inhabitants save energy. Unfortunately, smart homes today are far from this vision – people who already live in such a home struggle with complicated user interfaces, inflexible home configurations, and difficult installation procedures. Under these circumstances, smart homes are not ready for mass adoption. This dissertation addresses these issues by proposing two smart assistants for smart h...
DOE Zero Energy Ready Home Case Study: TC Legend Homes, Seattle, Washington
Energy Technology Data Exchange (ETDEWEB)
none,
2013-09-01
This house incorporates slab-on-grade, EPS roof, and radiant heating with an air-to-water heat pump that also preheats domestic hot water. Without counting in the solar panels, the home earns a home energy rating system (HERS) score of 37, with projected utility bills of about $740 a year. With the 6.4-kW photovoltaic power system installed on the roof, the home’s HERS scores drops to -1 and utility bills for the all-electric home drop to zero. This home was awarded a 2013 Housing Innovation Award in the affordable builder category.
Research on the model of home networking
Yun, Xiang; Feng, Xiancheng
2007-11-01
It is the research hotspot of current broadband network to combine voice service, data service and broadband audio-video service by IP protocol to transport various real time and mutual services to terminal users (home). Home Networking is a new kind of network and application technology which can provide various services. Home networking is called as Digital Home Network. It means that PC, home entertainment equipment, home appliances, Home wirings, security, illumination system were communicated with each other by some composing network technology, constitute a networking internal home, and connect with WAN by home gateway. It is a new network technology and application technology, and can provide many kinds of services inside home or between homes. Currently, home networking can be divided into three kinds: Information equipment, Home appliances, Communication equipment. Equipment inside home networking can exchange information with outer networking by home gateway, this information communication is bidirectional, user can get information and service which provided by public networking by using home networking internal equipment through home gateway connecting public network, meantime, also can get information and resource to control the internal equipment which provided by home networking internal equipment. Based on the general network model of home networking, there are four functional entities inside home networking: HA, HB, HC, and HD. (1) HA (Home Access) - home networking connects function entity; (2) HB (Home Bridge) Home networking bridge connects function entity; (3) HC (Home Client) - Home networking client function entity; (4) HD (Home Device) - decoder function entity. There are many physical ways to implement four function entities. Based on theses four functional entities, there are reference model of physical layer, reference model of link layer, reference model of IP layer and application reference model of high layer. In the future home network
U.S. Department of Health & Human Services — Home Health Compare has information about the quality of care provided by Medicare-certified home health agencies throughout the nation. Medicare-certified means the...
Directory of Open Access Journals (Sweden)
Tamara Serdinšek
2016-05-01
Full Text Available Background: Home birth is as old as humanity, but still most middle- and high-income countries consider hospitals as the safest birth settings, as complications regarding birth are highly unpredictable. Despite this there are a few countries in which home birth in integrated into official healthcare system (the Netherlands, United Kingdom, Canada etc.. Home births can be divided into unplanned and planned, and the latter can be further categorized by the presence of the birth attendants. This review focuses on planned home births, which are differently represented throughout the world. In the United States 0.6-1.0% of all children are born at home, in the United Kingdom 2-3%, in Canada 1.6% and in the Netherlands 20-30%. For Slovenia, the number of planned home births is unknown; however, in 2010 0.1% of children were born outside medical facilities.Conclusions: The safety of home birth in still under the debate. While research confirms smaller number of obstetric interventions and some complications in mothers who give birth at home, the data regarding the neonatal and perinatal mortality and morbidity is still conflicting. This confirms the need for large multicentric trials in this field. Current home birth guidelines emphasize that women should be well informed regarding the possible advantages and disadvantages of home births. In addition, the emphasis is on definition of selection criteria for home birth, indications for intrapartal transfer to the hospital and appropriate education of birth attendants.
DOE Zero Energy Ready Home Case Study: Amaris Custom Homes, St. Paul, Minnesota
Energy Technology Data Exchange (ETDEWEB)
None
2015-06-01
For this project, Amaris worked with U.S. Department of Energy (DOE) team, NorthernSTAR Building America Partnership, to develop the first Zero Energy Ready Home (ZERH) in Minnesota's cold climate using reasonable, cost-effective, and replicable construction materials and practices. The result is a passive solar, super-efficient 3542-ft2 walkout ranch-style home with all the creature comforts. Along with meeting ZERH standards, Amaris also achieved certifications for Leadership in Energy & Environmental Design for Homes v4, MN Green Path Emerald, and a Builders Association of the Twin Cities Reggie Award of Excellence. The home achieves a HERS score of 41 without photovoltaics; with PV, the home achieves a HERS score of 5.
National Aeronautics and Space Administration — Abstract — A possible resident of smart home is an old person or an Alzheimer patient that should be assisted continuously for the rest of his life; however,...
The NASA GOLD Mission: Exploring the Interface between Earth and Space
Mason, T.; Costanza, B.
2017-12-01
NASA's Global-scale Observations of the Limb and Disk, or GOLD, mission will explore a little understood area close to home, but historically hard to observe: the interface between Earth and space, a dynamic area of near-Earth space that responds both to space weather above, and the lower atmosphere below. GOLD, scheduled to launch into geostationary orbit in early 2018, will collect observations with a 30-minute cadence, much higher than any mission that has come before it. This will enable GOLD to be the first mission to study the day-to-day weather of a region of space—the thermosphere and ionosphere—rather than its long-term climate. GOLD will explore the near-Earth space environment, which is home to astronauts, radio signals used to guide airplanes and ships, and satellites that provide our communications and GPS systems. GOLD's unprecedented images and data will enable research that can improve situational awareness to help protect astronauts, spacecraft, and humans on the ground. As part of the GOLD communications and outreach program, the Office of Communications & Outreach at the Laboratory for Atmospheric and Space Physics (LASP) is developing a suite of products and programs to introduce the science of the GOLD mission to a broad range of public audiences, including students, teachers, journalists, social media practitioners, and the wider planetary and Earth science communities. We plan to showcase with this poster some of the tools we are developing to achieve this goal.
Home financing for new and existing energy efficient homes
International Nuclear Information System (INIS)
1994-01-01
The video describes how the home federal savings and loan association in Rockford, IL, has developed lending standards for new conventional and solar homes. The nine standards are illustrated. The video follows the customer through the loan process, including an appraisal of energy efficient items, loan closing, and continuing education. The primary audience is savings and loan management personnel
On the Design of Smart Homes: A Framework for Activity Recognition in Home Environment.
Cicirelli, Franco; Fortino, Giancarlo; Giordano, Andrea; Guerrieri, Antonio; Spezzano, Giandomenico; Vinci, Andrea
2016-09-01
A smart home is a home environment enriched with sensing, actuation, communication and computation capabilities which permits to adapt it to inhabitants preferences and requirements. Establishing a proper strategy of actuation on the home environment can require complex computational tasks on the sensed data. This is the case of activity recognition, which consists in retrieving high-level knowledge about what occurs in the home environment and about the behaviour of the inhabitants. The inherent complexity of this application domain asks for tools able to properly support the design and implementation phases. This paper proposes a framework for the design and implementation of smart home applications focused on activity recognition in home environments. The framework mainly relies on the Cloud-assisted Agent-based Smart home Environment (CASE) architecture offering basic abstraction entities which easily allow to design and implement Smart Home applications. CASE is a three layered architecture which exploits the distributed multi-agent paradigm and the cloud technology for offering analytics services. Details about how to implement activity recognition onto the CASE architecture are supplied focusing on the low-level technological issues as well as the algorithms and the methodologies useful for the activity recognition. The effectiveness of the framework is shown through a case study consisting of a daily activity recognition of a person in a home environment.
Prediction of Advisability of Returning Home Using the Home Care Score
Directory of Open Access Journals (Sweden)
Akiyoshi Matsugi
2015-01-01
Full Text Available Purpose. The aim of this study was to assess whether the home care score (HCS, which was developed by the Ministry of Health and Welfare in Japan in 1992, is useful for the prediction of advisability of home care. Methods. Subjects living at home and in assisted-living facilities were analyzed. Binominal logistic regression analyses, using age, sex, the functional independence measure score, and the HCS, along with receiver operating characteristic curve analyses, were conducted. Findings/Conclusions. Only HCS was selected for the regression equation. Receiver operating characteristic curve analysis revealed that the area under the curve (0.9, sensitivity (0.82, specificity (0.83, and positive predictive value (0.84 for HCS were higher than those for the functional independence measure, indicating that the HCS is a powerful predictor for advisability of home care. Clinical Relevance. Comprehensive measurements of the condition of provided care and the activities of daily living of the subjects, which are included in the HCS, are required for the prediction of advisability of home care.
Prediction of Advisability of Returning Home Using the Home Care Score
Matsugi, Akiyoshi; Tani, Keisuke; Tamaru, Yoshiki; Yoshioka, Nami; Yamashita, Akira; Mori, Nobuhiko; Oku, Kosuke; Ikeda, Masashi; Nagano, Kiyoshi
2015-01-01
Purpose. The aim of this study was to assess whether the home care score (HCS), which was developed by the Ministry of Health and Welfare in Japan in 1992, is useful for the prediction of advisability of home care. Methods. Subjects living at home and in assisted-living facilities were analyzed. Binominal logistic regression analyses, using age, sex, the functional independence measure score, and the HCS, along with receiver operating characteristic curve analyses, were conducted. Findings/Conclusions. Only HCS was selected for the regression equation. Receiver operating characteristic curve analysis revealed that the area under the curve (0.9), sensitivity (0.82), specificity (0.83), and positive predictive value (0.84) for HCS were higher than those for the functional independence measure, indicating that the HCS is a powerful predictor for advisability of home care. Clinical Relevance. Comprehensive measurements of the condition of provided care and the activities of daily living of the subjects, which are included in the HCS, are required for the prediction of advisability of home care. PMID:26491568
The Impact of Certificate-of-Need Laws on Nursing Home and Home Health Care Expenditures.
Rahman, Momotazur; Galarraga, Omar; Zinn, Jacqueline S; Grabowski, David C; Mor, Vincent
2016-02-01
Over the past two decades, nursing homes and home health care agencies have been influenced by several Medicare and Medicaid policy changes including the adoption of prospective payment for Medicare-paid postacute care and Medicaid-paid long-term home and community-based care reforms. This article examines how spending growth in these sectors was affected by state certificate-of-need (CON) laws, which were designed to limit the growth of providers and have remained unchanged for several decades. Compared with states without CON laws, Medicare and Medicaid spending in states with CON laws grew faster for nursing home care and more slowly for home health care. In particular, we observed the slowest growth in community-based care in states with CON for both the nursing home and home health industries. Thus, controlling for other factors, public postacute and long-term care expenditures in CON states have become dominated by nursing homes. © The Author(s) 2015.
Validating Savings Claims of Cold Climate Zero Energy Ready Homes
Energy Technology Data Exchange (ETDEWEB)
Williamson, J. [Consortium for Advanced Residential Buildings, Norwalk, CT (United States); Puttagunta, S. [Consortium for Advanced Residential Buildings, Norwalk, CT (United States)
2015-06-01
This report details the validation methods used to analyze consumption at each of these homes. It includes a detailed end-use examination of consumptions from the following categories: 1) Heating, 2) Cooling, 3) Lights, Appliances, and Miscellaneous Electric Loads (LAMELS) along with Domestic Hot Water Use, 4) Ventilation, and 5) PV generation. A utility bill disaggregation method, which allows a crude estimation of space conditioning loads based on outdoor air temperature, was also performed and the results compared to the actual measured data.
Home-based Healthcare Technology
DEFF Research Database (Denmark)
Verdezoto, Nervo
of these systems target a specific treatment or condition and might not be sufficient to support the care management work at home. Based on a case study approach, my research investigates home-based healthcare practices and how they can inform future design of home-based healthcare technology that better account......Sustaining daily, unsupervised healthcare activities in non-clinical settings such as the private home can challenge, among others, older adults. To support such unsupervised care activities, an increasingly number of reminders and monitoring systems are being designed. However, most...
Ritchie, Christine S; Leff, Bruce
2018-03-01
With the growth of value-based care, payers and health systems have begun to appreciate the need to provide enhanced services to homebound adults. Recent studies have shown that home-based medical services for this high-cost, high-need population reduce costs and improve outcomes. Home-based medical care services have two flavors that are related to historical context and specialty background-home-based primary care (HBPC) and home-based palliative care (HBPalC). Although the type of services provided by HBPC and HBPalC (together termed "home-based medical care") overlap, HBPC tends to encompass longitudinal and preventive care, while HBPalC often provides services for shorter durations focused more on distress management and goals of care clarification. Given workforce constraints and growing demand, both HBPC and HBPalC will benefit from working together within a population health framework-where HBPC provides care to all patients who have trouble accessing traditional office practices and where HBPalC offers adjunctive care to patients with high symptom burden and those who need assistance with goals clarification. Policy changes that support provision of medical care in the home, population health strategies that tailor home-based medical care to the specific needs of the patients and their caregivers, and educational initiatives to assure basic palliative care competence for all home-based medical providers will improve access and reduce illness burden to this important and underrecognized population. Copyright © 2017 American Academy of Hospice and Palliative Medicine. Published by Elsevier Inc. All rights reserved.
Santoso, Bedjo; Eko Ningtyas, Endah Aryati; Fatmasari, Diyah
2017-01-01
Stomatitis often occurs in elderly at nursing home. They need nursing home staff assistance to maintain their dental and oral health. Therefore, nursing home staff need dental health education. Lecture or discussion methods, which are more effective to improve knowledge, attitude and skill of nursing home staff was the purpose of this research. The research design was quasi-experiment research and pretest-posttest with control group. The sample was 42 nursing home staffs and 74 elderlies, div...
DEFF Research Database (Denmark)
Kreuzer, Maria; Mühlbacher, Hans; von Wallpach, Sylvia
2017-01-01
In an increasingly globalized, digitalized and perceived unmanageable world, consumers strive for belongingness, identification and security and re-discover the importance of home. Home is central to peoples’ individual as well as collective identities and their self-development (McCracken, 1989...... in Austria and the sample consisted of 15 locals (study 1) and 17 first generation immigrants (study 2) to identify possible commonalities and differences. This research adds to existing literature by 1) empirically confirming the existence of dimensions of home (e.g., physical, social, temporary...
Department of Housing and Urban Development — In accordance with 24 CFR Part 92.252, HUD provides maximum HOME rent limits. The maximum HOME rents are the lesser of: The fair market rent for existing housing for...
Directory of Open Access Journals (Sweden)
Nariyasu Mano
2010-02-01
Full Text Available Appropriate control of blood pressure (BP is essential for prevention of future cardiovascular events. However, BP control among treated hypertensive patients has been insufficient. Recently, the usefulness of self-measured BP at home (home BP measurement for the management of hypertension has been reported in many studies. We evaluated BP control both at home and in the office among treated hypertensive patients in primary care settings in Japan (the J-HOME study. We found poor control of home and office BPs and clarified some factors affecting control. We also examined factors associated with the magnitude of the white-coat effect, the morning–evening BP difference, and home heart rate in this J-HOME study.
Usefulness of implantable loop recorder in a patient with syncope during bathing
Directory of Open Access Journals (Sweden)
Motohiro Nakao, MD
2013-02-01
Full Text Available A 27-year-old man presented to our hospital with a 1-year-hisory of repeated syncope, which particularly occurred while bathing or on a hot day. The head-up tilt test did not induce arrhythmia; however, blood pressure decreased by 39 mm Hg without any symptoms. Given that no bradycardia/tachycardia was induced on electrophysiological study and carotid sinus massage, an implantable loop recorder (ILR was implanted. After 2 months, syncope again occurred during bathing at midnight. Sinus arrest and a maximum ventricular pause of 10.2 s were documented using the ILR. After pacemaker implantation, the patient had not experienced syncope for 14 months.
Meeting at the Edges: Spaces, Places and Grassroots Governance Activism in Delhi
Webb, Martin
2013-01-01
Through ethnography of activist organisations promoting transparency, accountability and active citizenship, and comprising coalitions of the city’s middle classes and urban poor, this article explores the spaces in which activists from different social backgrounds meet and carry out their work. By locating the positions of meeting rooms, offices and activists’ homes in urban space, I open up a view of the everyday practices of grassroots governance initiatives aimed at producing shared citiz...
Sustainable thermal technologies and care homes: Productive alignment or risky investment?
International Nuclear Information System (INIS)
Neven, Louis; Walker, Gordon; Brown, Sam
2015-01-01
The use of more sustainable thermal technologies is a policy imperative across the UK building stock. However, not all building uses provide the same opportunities for technology uptake as others. Care homes for older people have characteristics which in technical and economic terms suggest that they might be particularly appropriate for the implementation of more sustainable thermal technologies. They have comparatively high demands for space heating and hot water often sustained on a 24/7 basis. However there are many considerations, both generic and contextual, that will typically play into processes of technology uptake. Through qualitative research in six case study homes, focused on management and staff perspectives and experiences, we explore the degree to which there might be a productive alignment between care home operation and the use of sustainable thermal technologies. Two key themes emerge focused on business considerations and the importance of avoiding risk and damage to reputation; and the ways in which different thermal technologies are relevant to and can potentially impact on care practices. We conclude that despite potential benefits the sector could remain rather resistant to sustainability innovations. We suggest therefore areas in which productive action and further research could be undertaken. -- Highlights: •Care homes for older people might be particularly appropriate for the use of sustainable thermal technologies. •We examine if a productive alignment between care homes and the use of sustainable thermal technologies does exist in practice. •Two key themes are risks to business reputation; and relevance and potential benefits to care practices. •We conclude that the sector could remain rather reluctant to embrace sustainability innovation
Bull, P.; Limb, R.; Payne, R.
An increasing number of computers and other equipment, such as games consoles and multimedia appliances for the home, have networking capability. The rapid growth of broadband in the home is also fuelling the demand for people to network their homes. In the near future we will see a number of market sectors trying to 'own' the home by providing gateways either from the traditional ISP or from games and other service providers. The consumer is bombarded with attractive advertising to acquire the latest technological advances, but is left with a plethora of different appliances, which have a bewildering range of requirements and features in terms of networking, user interface, and higher-level communications protocols. In many cases, these are proprietary, preventing interworking. Such technical and usability anarchy confuses the consumer and could ultimately suppress market adoption.
More Livable Urban Space for Children: Practices around the World
Directory of Open Access Journals (Sweden)
Okşan TANDOĞAN
2014-02-01
Full Text Available Rather than by any personal or mental features, a child’s behaviour is shaped by the spaces he/she occupies, namely his/her physical environment. In this context, urban open spaces such as the immediate surroundings of the home, the school garden and playground, all of which constitute the child’s physical environment and the spaces the child interacts in, are of great importance in the formation of the child as a member of society, and his/her socialization and development. In light of the role it plays in child development, making the physical environment more livable for children has become crucial, particularly in northern European countries, and various studies, projects and practices are being realised in these countries. Foremost among these studies are Child Friendly City initiatives. Other studies and practices may be analysed under headings such as street, school garden, playgrounds and the child’s transportation between school and home. In this study, the aim is to highlight the importance of physical environment for children, and, in this context, to put together a literature study related to applied and on-going studies and practices around the world in the effort to make the physical environment more livable for children.
Public Open Spaces and Leisure-Time Walking in Brazilian Adults.
Florindo, Alex Antonio; Barrozo, Ligia Vizeu; Cabral-Miranda, William; Rodrigues, Eduardo Quieroti; Turrell, Gavin; Goldbaum, Moisés; Cesar, Chester Luiz Galvão; Giles-Corti, Billie
2017-05-23
Access to public open space is important to increase leisure-time walking (LTW) in high-income countries, but there is little evidence in middle-income countries. We conducted a cross-sectional analysis to examine the relationship between LTW and the presence of different public open spaces (parks, bike paths, and squares) and the mix of these recreational destinations near the homes of adults participating in the Sao Paulo Health Survey ( n = 3145). LTW was evaluated by a questionnaire. We delineated buffers (500, 1000, and 1500 m) from the geographic coordinates of the adults' residential addresses using a geographic information system. We used multilevel logistic regression taking account of clustering by census tracts and households, and with adjustment for social, demographics, and health characteristics. The main results showed that the presence of at least two recreational destinations within a 500-m buffer of participants' homes were associated with an increased odds of LTW compared with no destinations present (OR = 1.65; 95% CI 1.09-2.55). No associations were found for destinations further away. These results support actions outlined in the new urban plan for Sao Paulo city and could be used to highlight the importance access to a mix of public open spaces to promote physical activity in megacities of middle-income countries.
Vascular access for home haemodialysis.
Al Shakarchi, Julien; Day, C; Inston, N
2018-03-01
Home haemodialysis has been advocated due to improved quality of life. However, there are very little data on the optimum vascular access for it. A retrospective cohort study was carried on all patients who initiated home haemodialysis between 2011 and 2016 at a large university hospital. Access-related hospital admissions and interventions were used as primary outcome measures. Our cohort consisted of 74 patients. On initiation of home haemodialysis, 62 individuals were using an arteriovenous fistula as vascular access, while the remaining were on a tunnelled dialysis catheter. Of the 12 patients who started on a tunnelled dialysis catheter, 5 were subsequently converted to either an arteriovenous fistula ( n = 4) or an arteriovenous graft ( n = 1). During the period of home haemodialysis use, four arteriovenous fistula failed or thrombosed with patients continuing on home haemodialysis using an arteriovenous graft ( n = 3) or a tunnelled dialysis catheter ( n = 1). To maintain uninterrupted home haemodialysis, interventional rates were 0.32 per arteriovenous fistula/arteriovenous graft access-year and 0.4 per tunnelled dialysis catheter access-year. Hospital admission rates for patients on home haemodialysis were 0.33 per patient-year. Our study has shown that home haemodialysis can be safely and independently performed at home within a closely managed home haemodialysis programme. The authors also advocate the use of arteriovenous fistulas for this cohort of patients due to both low complication and intervention rates.
Family Friendly Entrepreneurship: New Business Formation in Family Spaces
Directory of Open Access Journals (Sweden)
Carol Ekinsmyth
2012-01-01
Full Text Available Seventy three per cent of UK enterprises have no employees and seventeen per cent of these are managed solely by women (GEM UK Data 2005. UK female entrepreneurship is thus a significant economic phenomenon and it is increasing, especially in rural areas. Suggestions are that women’s businesses are different to men’s (Ahl 2006, Hanson 2003, Hanson and Blake 2004 in terms of their nature, location, type and the way that business is done. Limited empirical investigation has been undertaken, especially within geography (Hanson 2003. In addition, it has been argued that women’s participation in self-employment generally, is under-theorised (Blake, 2006; Ahl, 2006; Lewis 2006. Buzar et al (2005 identify the need to consider within this, the social construction of gender, time, space, economy and culture. This paper aims to advance knowledge and understanding of both the characteristics of female businesses and the coordinates and circumstances of female entrepreneurship. This paper will investigate the nature, dynamics, networks and locations of the new businesses (started up within the past five years of thirty women entrepreneurs all of whom are mothers and most of whom work at home. Two different types of new work/economic space will be examined. The first, the work locations of this economic activity, are a key defining feature of these businesses – they are typically the kitchens, bedroom and garages of the entrepreneurs’ family homes within the spaces of family life. An understanding of such enterprises is assisted by adopting a household-level, work-life reconciliation perspective (Jarvis 2005, Moen and Sweet 2004. The second new economic space reported in this paper will be the typical spaces of networking and marketing which often take place in electronic space, particularly the social networking sites (and especially female social and business networking, and mothers’ networking internet sites that have become so popular in the
DOE Zero Energy Ready Home Case Study: Mandalay Homes, Phoenix, Arizona
Energy Technology Data Exchange (ETDEWEB)
none,
2013-09-01
This builder built fourteen homes in the Gordon Estates subdivision that achieved Challenge Home certification with HERS 38–58 on an affordable budget for homeowners. Every Mandalay home in the development also met the National Green Building Standard gold level. The Gordon Estates subdivision is also serving as a showcase of energy efficiency, and Mandalay is hosting education workshops for realtors, state and local officials, other builders, students, potential homeowners, and the public. The builder won a 2013 Housing Innovation Award in the affordable builder category.
Smart homes with smartphones : Creating a Smart home application for smartphones
Lärka, Martin
2015-01-01
The goal of this master thesis was to evaluate the field of Smart home applications run on mobile platforms such as smart phones. This was at the time a relatively new field that has attracted the attention of Smart phone giants like Apple and Google. This raised the question whether or not the users willingness to embrace the technology. To evaluate the field, a literature study was conducted covering the Smart home technology, and Apple’s and Google’s Smart home solutions. The rendered in a...
Net-Zero Energy Home Grows Up: Lessons and Puzzles from 10 Years of Data; Preprint
Energy Technology Data Exchange (ETDEWEB)
Sparn, Bethany; Earle, Lieko; Christensen, Craig; Norton, Paul
2016-05-17
In 2005, Habitat for Humanity of Metro Denver, with support from NREL and other partners, built one of the first homes in the US to achieve net-zero energy based on monitored data. A family of three moved into the house when it was completed and lives there still. The home has been monitored continuously for the past ten years. Although PV production has remained steady, net energy performance has varied each year. The home was a net producer of energy annually in each of the first three years and in the ninth year, but not in years four through eight. Over the years, the PV system provided between 124% and 64% of the home source energy use. Electricity use in the home increased steadily during the first eight years, even though no significant new appliance was introduced into the house, such as a window air conditioner. Miscellaneous electric loads and space heating, both strongly dependent on occupant behavior, appear to be primarily responsible for the observed increase in energy use. An interesting aspect of this case study is how, even within a single family, natural changes in occupant lifestyles over time (e.g., kids growing up, schedules changing) can substantially impact the overall energy intensity of a home. Data from the last ten years will be explored for lessons learned that can improve the way we design low-load homes without sacrificing comfort or convenience for the occupants, and how we can make realistic predictions of long-term energy performance.
Energy Technology Data Exchange (ETDEWEB)
none,
2013-09-01
The Passive House Challenge Home located in River Forest, Illinois, is a 5-bedroom, 4.5-bath, 3,600 ft2 two-story home (plus basement) that costs about $237 less per month to operate than a similar sized home built to the 2009 IECC. For a home with no solar photovoltaic panels installed, it scored an amazingly low 27 on the Home Energy Rating System (HERS) score.An ENERGY STAR-rated dishwasher, clothes washer, and refrigerator; an induction cooktop, condensing clothes dryer, and LED lighting are among the energy-saving devices inside the home. All plumbing fixtures comply with EPA WaterSense criteria. The home was awarded a 2013 Housing Innovation Award in the "systems builder" category.
... Page Search Home Health Conditions Genes Chromosomes & mtDNA Resources Help Me Understand Genetics Share: Email Facebook Twitter Genetics Home Reference provides consumer-friendly information about the effects of genetic variation on human health. Health Conditions More than 1,200 health ...
Oates, John
2007-01-01
"The distributed computing project LHC@home is moving to London from Cern in Switzerland. Researchers at Qeen Mary University have been trialling the system since June, but are now ready for the offical launch" (1 page)
BIODIESEL BLENDS IN SPACE HEATING EQUIPMENT
International Nuclear Information System (INIS)
KRISHNA, C.R.
2001-01-01
Biodiesel is a diesel-like fuel that is derived from processing vegetable oils from various sources, such as soy oil, rapeseed or canola oil, and also waste vegetable oils resulting from cooking use. Brookhaven National laboratory initiated an evaluation of the performance of blends of biodiesel and home heating oil in space heating applications under the sponsorship of the Department of Energy (DOE) through the National Renewable Energy Laboratory (NREL). This report is a result of this work performed in the laboratory. A number of blends of varying amounts of a biodiesel in home heating fuel were tested in both a residential heating system and a commercial size boiler. The results demonstrate that blends of biodiesel and heating oil can be used with few or no modifications to the equipment or operating practices in space heating. The results also showed that there were environmental benefits from the biodiesel addition in terms of reductions in smoke and in Nitrogen Oxides (NOx). The latter result was particularly surprising and of course welcome, in view of the previous results in diesel engines where no changes had been seen. Residential size combustion equipment is presently not subject to NOx regulation. If reductions in NOx similar to those observed here hold up in larger size (commercial and industrial) boilers, a significant increase in the use of biodiesel-like fuel blends could become possible
Durech, Josef; Hanus, J.; Vanco, R.
2012-10-01
We present a new project called Asteroids@home (http://asteroidsathome.net/boinc). It is a volunteer-computing project that uses an open-source BOINC (Berkeley Open Infrastructure for Network Computing) software to distribute tasks to volunteers, who provide their computing resources. The project was created at the Astronomical Institute, Charles University in Prague, in cooperation with the Czech National Team. The scientific aim of the project is to solve a time-consuming inverse problem of shape reconstruction of asteroids from sparse-in-time photometry. The time-demanding nature of the problem comes from the fact that with sparse-in-time photometry the rotation period of an asteroid is not apriori known and a huge parameter space must be densely scanned for the best solution. The nature of the problem makes it an ideal task to be solved by distributed computing - the period parameter space can be divided into small bins that can be scanned separately and then joined together to give the globally best solution. In the framework of the the project, we process asteroid photometric data from surveys together with asteroid lightcurves and we derive asteroid shapes and spin states. The algorithm is based on the lightcurve inversion method developed by Kaasalainen et al. (Icarus 153, 37, 2001). The enormous potential of distributed computing will enable us to effectively process also the data from future surveys (Large Synoptic Survey Telescope, Gaia mission, etc.). We also plan to process data of a synthetic asteroid population to reveal biases of the method. In our presentation, we will describe the project, show the first results (new models of asteroids), and discuss the possibilities of its further development. This work has been supported by the grant GACR P209/10/0537 of the Czech Science Foundation and by the Research Program MSM0021620860 of the Ministry of Education of the Czech Republic.
Home Appliances as Home Controllers: Concepts and Set-Top Box Implementation
Directory of Open Access Journals (Sweden)
Z. Jovanovic
2010-11-01
Full Text Available In this paper we present a novel softwarebased home control platform suitable as an extension to digital home appliances that are equipped with a CPU (settop boxes, home theatre systems, TV sets, gaming consoles, etc. By using an appliance they are already accustomed to, users become able to control lights, appliances and media playback in their homes. Intelligence and awareness are achieved with a support for execution of recipes – preprepared scripts that define timely actions and respond to triggers obtained from sensors. Software abstraction layer facilitates integration of any desired communication protocol. In our prototype, we supported Zigbee and DMX for light control, X10 for light/appliances control over power line, as well as Ethernet-based optical cameras as motion/presence sensors and UPnP/DLNA based equipment for distributed media playback.
Directory of Open Access Journals (Sweden)
OANA ALEXANDRA CIUPE
2017-10-01
Full Text Available The past decades has seen the rapid development of second homes in many country of the world. Therefore, secondary dwellings used for tourism-related purposes (vacation homes or second homes are a reality that becomes more pronounced and visible at both nationally and internationally level. However, the rapidity and the novelty of the phenomenon creates difficulties in terms of efficient management and suitable integration in spatial planning and urbanism plans, favoring - in a negative way - expanding of build-up areas (with second homes in a chaotic way. Since there has been no detailed investigation of second homes tourism from the perspective of informal settlements, this article follows a case-study design, with in-depth analysis of informal settlements with vacation homes found in Apuseni Nature Park. Based on long-term field research, will be exemplified 4 types of informal settlements with second homes (vacation homes identified in the case study. The aim of this paper is to critically analyse the effects of informal settlements with vacation homes on the natural environment.
Ramulu, Pradeep Y; Chan, Emilie S; Loyd, Tara L; Ferrucci, Luigi; Friedman, David S
2012-08-01
Measuring physical at home and away from home is essential for assessing health and well-being, and could help design interventions to increase physical activity. Here, we describe how physical activity at home and away from home can be quantified by combining information from cellular network-based tracking devices and accelerometers. Thirty-five working adults wore a cellular network-based tracking device and an accelerometer for 6 consecutive days and logged their travel away from home. Performance of the tracking device was determined using the travel log for reference. Tracking device and accelerometer data were merged to compare physical activity at home and away from home. The tracking device detected 98.6% of all away-from-home excursions, accurately measured time away from home and demonstrated few prolonged signal drop-out periods. Most physical activity took place away from home on weekdays, but not on weekends. Subjects were more physically active per unit of time while away from home, particularly on weekends. Cellular network-based tracking devices represent an alternative to global positioning systems for tracking location, and provide information easily integrated with accelerometers to determine where physical activity takes place. Promoting greater time spent away from home may increase physical activity.
Formal home help services and institutionalization
DEFF Research Database (Denmark)
Yamada, Yukari; Siersma, Volkert; Avlund, Kirsten
2012-01-01
The effect of home help services has been inconsistent. Raising the hypothesis that receiving small amounts of home help may postpone or prevent institutionalization, the aim of the present study is to analyze how light and heavy use of home help services was related to the risk...... for institutionalization. The study was a secondary analysis of a Danish intervention study on preventive home visits in 34 municipalities from 1999 to 2003, including 2642 home-dwelling older people who were nondisabled and did not receive public home help services at baseline in 1999 and who lived at home 18 months...... after baseline. Cox regression analysis showed that those who received home help services during the first 18 months after baseline were at higher risk of being institutionalized during the subsequent three years than those who did not receive such services. However, receiving home help for less than 1h...
DEFF Research Database (Denmark)
Tommerup, Henrik M.
2009-01-01
An important aim of the european energy performance of buildings directive is to improve the overall energy efficiency of new homes......An important aim of the european energy performance of buildings directive is to improve the overall energy efficiency of new homes...
Mobile home automation-merging mobile value added services and home automation technologies
Rosendahl, Andreas; Hampe, Felix J.; Botterweck, Goetz
2007-01-01
non-peer-reviewed In this paper we study mobile home automation, a field that emerges from an integration of mobile application platforms and home automation technologies. In a conceptual introduction we first illustrate the need for such applications by introducing a two-dimensional conceptual model of mobility. Subsequently we suggest an architecture and discuss different options of how a user might access a mobile home automation service and the controlled devices. As another contrib...
Living above the shop: home, business, and family in the English "Industrial Revolution".
Barker, Hannah; Hamlett, Jane
2010-01-01
This article explores the living arrangements and familial relations of small business households in northwest English towns between 1760 and 1820. Focusing on evidence from inventories and personal writing, it examines the homes that such households lived and worked in and the ways in which space was ordered and used: indicating that access to particular spaces was determined by status. This study suggests both the continuance of the "household family" into the nineteenth century (rather than its more modern, "nuclear" variant) and the existence of keenly felt gradations of status within households making it likely that the constitution of "the family" differed according to one's place in the domestic hierarchy.
The work-home interface : The role of home-based predictors of burnout among mothers
Missler, M.A.; Stroebe, M.S.; van der Laan, G.
2014-01-01
Research into the work–home interface has mainly focused on work-related variables, leaving aspects associated with the home domain relatively understudied. This investigation examined both facilitation and conflict between home and work in a sample of 260 working mothers with children up to four
Two energy storage alternatives for a solar-powered sustainable single floor desert home
Serag-Eldin, M. A.
2010-09-30
This paper is concerned with the thermodynamic analysis of a totally solarpowered desert home. The home is air-conditioned and provides all modern comforts and facilities. It features closely spaced, roof mounted photovoltaic modules, which collect the solar energy driving the whole energy system. During the day time, the modules form an elevated horizontal surface above the roof, shielding it from direct solar radiation. After sunset, the photovoltaic modules are flipped vertically upwards to expose the roof to the sky, thus enhancing night-time cooling. Two methods of energy storage are proposed and compared, one using solely battery storage of electrical output, and the other employing a combination of cold water storage and battery storage. The analysis is based on detailed dynamic heat transfer calculations for the entire building envelope, coupled with a solar radiation model, and followed by energy balances. The results reveal that indeed it is feasible to employ solar energy as the only source of energy to power the home, and that each storage system has its own merits and shortcomings. © 2010 WIT Press.
Changes in Space Food over the Last 45 Years
Smith, Scott M.; Lane, Helen W.; Kloeris, Vickie; Perchonok, Michele; Zwart, Sara
2006-01-01
The space food system has improved over the last 45 years. With the advances for a Moon base, there is a potential that foods in space will be more like home cooked foods. However, until that happens, there will continue to be dehydrated and thermostablized foods providing the bulk of the astronauts food. In order for the astronauts to have adequate macronutrients, a food system must be developed including raising plants and food preparation, both a major challenge given the limited water, volume, and power. The lunar kitchens will be very different, but good food is essential to maintain good health.
Exploring workplace violence among home care workers in a consumer-driven home health care program.
Nakaishi, Lindsay; Moss, Helen; Weinstein, Marc; Perrin, Nancy; Rose, Linda; Anger, W Kent; Hanson, Ginger C; Christian, Mervyn; Glass, Nancy
2013-10-01
Nominal research has examined sexual harassment and workplace violence against home care workers within consumer-driven home care models such as those offered in Oregon. This study examined home care workers' experiences of violence while providing care to consumer employers, the patients who hire and manage home care workers. Focus groups and interviews were conducted in Oregon with 83 home care workers, 99 Oregon Department of Human Services (DHS) employees, and 11 consumer employers. Home care workers reported incidents of workplace physical violence (44%), psychological abuse (65%), sexual harassment (41%), and sexual violence (14%). Further, three themes were identified that may increase the risk of workplace violence: (1) real and perceived barriers to reporting violence; (2) tolerance of violence; and (3) limited training to prevent violence. To ensure worker safety while maintaining quality care, safety policies and training for consumer employers, state DHS employees, and home care workers must be developed. Copyright 2013, SLACK Incorporated.
Research progress on the space-flight mutation breeding of woodyplant
International Nuclear Information System (INIS)
Cui Binbin; Sun Yuhan; Li Yun
2013-01-01
The space-flight mutation breeding conception, characteristics, mutagenic effects, research progress at home and abroad in woody plant were reviewed in this paper. Compared with crops, although the research of the woody plants space-flight mutation breeding in China started later, but it has developed rapidly and has gotten certain achievement. Now the satellite and high-altitude balloon experiment were conducted with over 20 tree species such as Populus ussuriensis and 50 flower species such as Paeonia suffruticosa. The above work will has profound significance for space-flight breeding technology application on woody plants. In the end, this thesis analyzes the prospect in the future from four aspects such as using woody plants asexual reproduction characteristic, strengthening the space mutation mechanism study, enhancing new space mutation varieties screen and strengthening ornamental specific types selection. This thesis also thinks that the space mutation breeding is expected to become an effective way in woody plant genetic breeding. (authors)
Space Use and Movement of a Neotropical Top Predator: The Endangered Jaguar.
Directory of Open Access Journals (Sweden)
Ronaldo G Morato
Full Text Available Accurately estimating home range and understanding movement behavior can provide important information on ecological processes. Advances in data collection and analysis have improved our ability to estimate home range and movement parameters, both of which have the potential to impact species conservation. Fitting continuous-time movement model to data and incorporating the autocorrelated kernel density estimator (AKDE, we investigated range residency of forty-four jaguars fit with GPS collars across five biomes in Brazil and Argentina. We assessed home range and movement parameters of range resident animals and compared AKDE estimates with kernel density estimates (KDE. We accounted for differential space use and movement among individuals, sex, region, and habitat quality. Thirty-three (80% of collared jaguars were range resident. Home range estimates using AKDE were 1.02 to 4.80 times larger than KDE estimates that did not consider autocorrelation. Males exhibited larger home ranges, more directional movement paths, and a trend towards larger distances traveled per day. Jaguars with the largest home ranges occupied the Atlantic Forest, a biome with high levels of deforestation and high human population density. Our results fill a gap in the knowledge of the species' ecology with an aim towards better conservation of this endangered/critically endangered carnivore-the top predator in the Neotropics.
Space Use and Movement of a Neotropical Top Predator: The Endangered Jaguar.
Morato, Ronaldo G; Stabach, Jared A; Fleming, Chris H; Calabrese, Justin M; De Paula, Rogério C; Ferraz, Kátia M P M; Kantek, Daniel L Z; Miyazaki, Selma S; Pereira, Thadeu D C; Araujo, Gediendson R; Paviolo, Agustin; De Angelo, Carlos; Di Bitetti, Mario S; Cruz, Paula; Lima, Fernando; Cullen, Laury; Sana, Denis A; Ramalho, Emiliano E; Carvalho, Marina M; Soares, Fábio H S; Zimbres, Barbara; Silva, Marina X; Moraes, Marcela D F; Vogliotti, Alexandre; May, Joares A; Haberfeld, Mario; Rampim, Lilian; Sartorello, Leonardo; Ribeiro, Milton C; Leimgruber, Peter
2016-01-01
Accurately estimating home range and understanding movement behavior can provide important information on ecological processes. Advances in data collection and analysis have improved our ability to estimate home range and movement parameters, both of which have the potential to impact species conservation. Fitting continuous-time movement model to data and incorporating the autocorrelated kernel density estimator (AKDE), we investigated range residency of forty-four jaguars fit with GPS collars across five biomes in Brazil and Argentina. We assessed home range and movement parameters of range resident animals and compared AKDE estimates with kernel density estimates (KDE). We accounted for differential space use and movement among individuals, sex, region, and habitat quality. Thirty-three (80%) of collared jaguars were range resident. Home range estimates using AKDE were 1.02 to 4.80 times larger than KDE estimates that did not consider autocorrelation. Males exhibited larger home ranges, more directional movement paths, and a trend towards larger distances traveled per day. Jaguars with the largest home ranges occupied the Atlantic Forest, a biome with high levels of deforestation and high human population density. Our results fill a gap in the knowledge of the species' ecology with an aim towards better conservation of this endangered/critically endangered carnivore-the top predator in the Neotropics.
Klomstad, Kristin; Pedersen, Reidar; Førde, Reidun; Romøren, Maria
2018-05-08
Many of the elderly in nursing homes are very ill and have a reduced quality of life. Life expectancy is often hard to predict. Decisions about life-prolonging treatment should be based on a professional assessment of the patient's best interest, assessment of capacity to consent, and on the patient's own wishes. The purpose of this study was to investigate and compare how these types of decisions were made in nursing homes and in hospital wards. Using a questionnaire, we studied the decision-making process for 299 nursing home patients who were treated for dehydration using intravenous fluids, or for bacterial infections using intravenous antibiotics. We compared the 215 (72%) patients treated in nursing homes to the 84 (28%) nursing home patients treated in the hospital. The patients' capacity to consent was considered prior to treatment in 197 (92%) of the patients treated in nursing homes and 56 (67%) of the patients treated in hospitals (p nursing homes than in hospital (90% vs. 52%). Next of kin and other health personnel were also more rarely involved when the nursing home patient was treated in hospital. Whether advance care planning had been carried out, was more often unknown in the hospital (69% vs. 17% in nursing homes). Hospital doctors expressed more doubt about the decision to admit the patient to the hospital than about the treatment itself. This study indicates a potential for improvement in decision-making processes in general, and in particular when nursing home patients are treated in a hospital ward. The findings corroborate that nursing home patients should be treated locally if adequate health care and treatment is available. The communication between the different levels of health care when hospitalization is necessary, must be better. ClinicalTrials.gov NCT01023763 (12/1/09) [The registration was delayed one month after study onset due to practical reasons].
... this? Submit What's this? Submit Button NCHS Home Home Health Care Recommend on Facebook Tweet Share Compartir Data are ... National Study of Long-Term Care Providers Nursing Home Care Residential Care Communities Centers for Medicare and Medicaid ...
Comparing Sleep Quality and General Health Among the Elderly Living at Home and at Nursing Home
Directory of Open Access Journals (Sweden)
Mansour Beyrami
2014-01-01
Full Text Available Objectives: Survey about the issues and problems related to elderly in order to improve their quality of life of this increasing population has become a universal concern.This study was performed by the purpose of comparing the sleep quality and general health among the Elderly Residing at Home and Old People's Homes. Methods & Materials: This study is descriptive-analytic type. Population of this investigation consisted of elderly men and women (upper than 60 years old living at personal home and at nursing home in Tabriz. Sample group composed of 100 elderly (50 men and 50 women 50 living at home and 50 living at nursing home who were selected through available sampling method. For collecting data, Goldberg General Health Questionnaire and Pittsburgh Sleep Quality Index were used. Data were analyzed by Multivariate analysis of variance (MANOVA. Results: Findings showed that In terms of general health and its components (Physical symptoms, anxiety, social dysfunction and depression and Sleep quality and its components (Subjective quality of sleep, time for sleep, total sleep time, sleep efficiency, routine, sleep disorders, sleep medications and daily dysfunction there were significant differences between nursing home residents and elderly residents in nursing homes (P=0.001. Conclusion: Findings indicated that elderly residents in nursing home are experiencing more symptoms of anxiety, depression, physical symptoms and social dysfunction Compared with the elderly whom resident at home. Also the results showed that the elderly residents of nursing homes have poor sleep quality than ones whom residents at home. On the other hand Future development of elderly care institution is inevitable. Therefore, more attention to the living conditions of elderly residents of institutions seems necessary.
Foraging optimally for home ranges
Mitchell, Michael S.; Powell, Roger A.
2012-01-01
Economic models predict behavior of animals based on the presumption that natural selection has shaped behaviors important to an animal's fitness to maximize benefits over costs. Economic analyses have shown that territories of animals are structured by trade-offs between benefits gained from resources and costs of defending them. Intuitively, home ranges should be similarly structured, but trade-offs are difficult to assess because there are no costs of defense, thus economic models of home-range behavior are rare. We present economic models that predict how home ranges can be efficient with respect to spatially distributed resources, discounted for travel costs, under 2 strategies of optimization, resource maximization and area minimization. We show how constraints such as competitors can influence structure of homes ranges through resource depression, ultimately structuring density of animals within a population and their distribution on a landscape. We present simulations based on these models to show how they can be generally predictive of home-range behavior and the mechanisms that structure the spatial distribution of animals. We also show how contiguous home ranges estimated statistically from location data can be misleading for animals that optimize home ranges on landscapes with patchily distributed resources. We conclude with a summary of how we applied our models to nonterritorial black bears (Ursus americanus) living in the mountains of North Carolina, where we found their home ranges were best predicted by an area-minimization strategy constrained by intraspecific competition within a social hierarchy. Economic models can provide strong inference about home-range behavior and the resources that structure home ranges by offering falsifiable, a priori hypotheses that can be tested with field observations.
... Submit What's this? Submit Button NCHS Home Nursing Home Care Recommend on Facebook Tweet Share Compartir Data are ... Person’s Health Related Links Adult Day Services Centers Home Health Care Hospice Care National Study of Long-Term Care ...
Directory of Open Access Journals (Sweden)
Titan Ligita
2017-08-01
Full Text Available Background: Provision of health care service at home is one of the advanced forms of care for patients being discharged from hospitalization. Little is known about the experience of nurses providing home care services through a nursing home-care model especially in Indonesian context. Objective: This study aims to explore the experience in order to increase understanding on the form of home care provision, and consequently the nurses may understand the form of home care globally. Methods: This study employed a phenomenological design and performed interview in the process of data collection. Data were analysed by using content analysis. Results: The main contexts of home care nurse experiences were generated. There were definition and role of home care nurses, the involvement of family members in the provision of care, the facilitating and hindering factors contributed to home care provision as well as manual on providing home care nursing. Conclusion: The implication from this study is that nursing care should be given to the patients continuously and consequently the need for family involvement is important. Additionally, in providing the home care, a proper manual is needed by home care nurses as the guidance to give best quality of care to patients.
Nagaviroj, Kittiphon; Anothaisintawee, Thunyarat
2017-06-01
Many terminally ill patients would prefer to stay and die in their own homes, but unfortunately, some may not be able to do so. Although there are many factors associated with successful home deaths, receiving palliative home visits from the multidisciplinary care teams is one of the key factors that enable patients to die at home. Our study was aimed to find whether there was any association between our palliative home care program and home death. A retrospective study was conducted in the Department of Family Medicine at Ramathibodi Hospital between January 2012 and May 2014. All of the patients who were referred to multidisciplinary palliative care teams were included. The data set comprised of patient's profile, disease status, functional status, patient's symptoms, preferred place of death, frequency of home visits, types of team interventions, and patient's actual place of death. Multiple logistic regression was applied in order to determine the association between the variables and the probability of dying at home. A total of 142 patients were included into the study. At the end of the study, 50 (35.2%) patients died at home and 92 (64.8%) patients died in the hospital. The multivariate logistic regression analysis demonstrated a strong association between multidisciplinary home care and home death (odds ratio 6.57, 95% confidence interval [CI] 2.48-17.38). Palliative home care was a significant factor enabling patients who want to die at home. We encourage health policy makers to promote the development of community-based palliative care programs in Thailand.
ten Brinke, S.S.|info:eu-repo/dai/nl/370549449
2014-01-01
In this article I tackle two related and often held assumptions: the first being that children are ‘out of place’ when not in the private sphere and second that home is necessarily related to the private sphere. Based on my ethnographic fieldwork among street-working children in Cusco, Peru, I
Biometrics for home networks security
Ansari, Imran Shafique; Ahmad, Qutbuddin S.
2009-01-01
Hacking crimes committed to the home networks are increasing. Advanced network protection is not always possible for the home networks. In this paper we will study the ability of using biometric systems for authentication in home networks. ©2009
THE SPATIALITY OF VEILING – MUSLIM WOMEN LIVING PRACTICES IN MINNESOTA HOMES
Directory of Open Access Journals (Sweden)
Samaneh Vahaji
2009-07-01
Full Text Available Although much controversy surrounds the Muslim veiling tradition, little has been studied about how immigrant Muslim veiled women navigate the practice of veiling while living in western-type houses. Through interviews with ten Muslim veiled women in Minnesota, this study explores the relationship between veiling and domestic environments. The findings point to both dress and interior spaces as being forms of enclosure, one being mobile (dress, that help women construct their cultural and religious identity while providing them with privacy, protection, and a sense of control. Residing in typical, suburban American homes however, the women we interviewed experienced difficulties being unveiled in one of the few places where the veil can come off. Designers who are cognizant of cultural differences in housing needs can create homes that support various ways of living, that is, culturally sensitive housing.
Biometrics for home networks security
Ansari, Imran Shafique
2009-01-01
Hacking crimes committed to the home networks are increasing. Advanced network protection is not always possible for the home networks. In this paper we will study the ability of using biometric systems for authentication in home networks. ©2009 IEEE.
The Future of Home Health project: developing the framework for health care at home.
Lee, Teresa; Schiller, Jennifer
2015-02-01
In addition to providing high-quality care to vulnerable patient populations, home healthcare offers the least costly option for patients and the healthcare system, particularly in postacute care. As the baby boom generation ages, policymakers are expressing concerns about rising costs, variation in home healthcare service use, and program integrity. The Alliance for Home Health Quality and Innovation seeks to develop a research-based strategic framework for the future of home healthcare for older Americans and those with disabilities. This article describes the initiative and invites readers to provide comments and suggestions.
DEFF Research Database (Denmark)
McIlvenny, Paul
2008-01-01
The House of Tiny Tearaways (HTT) first appeared on British television in May 2005. Over a six-day period, three families are invited to reside in a specially designed house together with a resident clinical psychologist. The house is to be “a home away from home” for the resident families...... in order to analyze excerpts from the program and to explore how the affordances and constraints of the specially designed house—its architecture and spatial configuration, as well as the surveillance technology embedded within its walls—are assembled within particular familial activities, and how...... the relationships between family members are reshaped as a result. The analysis focuses on several key phenomena: 1) practices of video observation in relation to the domestic sphere; 2) use of inscription devices, such as video displays, to capture and visualize behavior and action in the “home;” 3) practicing...
The Future of Home Health Care
Landers, Steven; Madigan, Elizabeth; Leff, Bruce; Rosati, Robert J.; McCann, Barbara A.; Hornbake, Rodney; MacMillan, Richard; Jones, Kate; Bowles, Kathryn; Dowding, Dawn; Lee, Teresa; Moorhead, Tracey; Rodriguez, Sally; Breese, Erica
2016-01-01
The Future of Home Health project sought to support transformation of home health and home-based care to meet the needs of patients in the evolving U.S. health care system. Interviews with key thought leaders and stakeholders resulted in key themes about the future of home health care. By synthesizing this qualitative research, a literature review, case studies, and the themes from a 2014 Institute of Medicine and National Research Council workshop on “The Future of Home Health Care,” the authors articulate a vision for home-based care and recommend a bold framework for the Medicare-certified home health agency of the future. The authors also identify challenges and recommendations for achievement of this framework. PMID:27746670
Home care services for sick children
DEFF Research Database (Denmark)
Castor, Charlotte; Hallström, Inger; Hansson, Eva Helena
2017-01-01
as challenging for healthcare professionals in home care services used to providing care predominately for adults. DESIGN: An inductive qualitative design. METHOD: Seven focus group interviews were performed with 36 healthcare professionals from multidisciplinary home care services. Data were analysed stepwise......AIMS AND OBJECTIVES: To explore healthcare professionals' conceptions of caring for sick children in home care services. BACKGROUND: Families often prefer home care to hospital care, and the number of home care services for children is increasing. Caring for children at home has been recognised...... using a phenomenographic analysis. RESULTS: Three description categories emerged: "A challenging opportunity", "A child perspective", and "Re-organise in accordance with new prerequisites." Providing home care services for children was conceived to evoke both professional and personal challenges...
Acquiring taste in home economics?
DEFF Research Database (Denmark)
Stenbak Larsen, Christian
Objective: To explore how home economics was taught in Denmark before the recent Danish school reform, which also revised the objectives and content of home economics, naming it Food Knowledge (Madkundskab) Methods: Participant observation was done in home economic lessons in two case schools...... appreciated by the group of boys, and others again learned to stick with their idiosyncrasies when pressured by the teacher. Conclusions: Children were acquiring taste in the home economic lessons, but not only the kind of tastes that the teacher had planned for. This leads to reflections on the very complex...... process of taste acquiring and to a call for further research into taste acquiring in complex real life contexts as home economics lessons....
Arora, Gaurav; Frisvold, George; Norman, Laura
2014-01-01
For this study, we used the hedonic pricing method to measure the effects of natural amenities on home prices in the U.S-side of the Santa Cruz Watershed. We employed multivariate spatial regression techniques to estimate how difference factors affect median home values in 613 census block groups of the 2000 Census, accounting for spatial autocorrelation, spatial lags, and/or spatial heterogeneity in the data. Diagnostic tests suggest that failure to account for the hedonic model can be classified as (1) physical features of the housing stock, (2) neighborhood characteristics, and (3) environmental attributes. Census data was combined with GIS data for vegetation and land cover, land administration, measures of species richness and open space, and proximity to amenities and disamenities. Census block groups close to the US-Mexico border of airports/air bases were negative. Results suggest that policies to maintain biodiversity and open space provide economic benefits to homeowners, reflected in higher home values. Future research will quantify the marginal effects of regression explanatory variables on home values to assess their economic and policy significant. These marginal effects will be used as input indicators to discern potential economic impacts of various scenarios in the Santa Cruz Watershed Ecosystem Portfolio Model (SCWEPM). Future research will also expand this effort into the Mexican-portion of the watershed.
Home Learning, Technology, and Tomorrow's Workplace.
Rieseberg, Rhonda L.
1995-01-01
Discusses characteristics and trends of home schools and workplaces. Use of computers and computer applications (CD-ROMS, interactive software, and networking) in home schooling provides a compatible environment for future home-based businesses and telecommuting trends. Sidebars include information on home schools on line; standardized test…
Department of Veterans Affairs — The Community Nursing Home (CNH) database contains a list of all Community Nursing Home facilities under local contract to Veterans Health Administration (VHA). CNH...
Optimal taxation with home production
Olovsson, Conny
2014-01-01
Optimal taxes for Europe and the U.S. are derived in a realistically calibrated model in which agents buy consumption goods and services and use home capital and labor to produce household services. The optimal tax rate on services is substantially lower than the tax rate on goods. Specifically, the planner cannot tax home production directly and instead lowers the tax rate on market services to increase the relative price of home production. The optimal tax rate on the return to home capital...
Home Automation and Security System
Surinder Kaur,; Rashmi Singh; Neha Khairwal; Pratyk Jain
2016-01-01
Easy Home or Home automation plays a very important role in modern era because of its flexibility in using it at different places with high precision which will save money and time by decreasing human hard work. Prime focus of this technology is to control the household equipment’s like light, fan, door, AC etc. automatically. This research paper has detailed information on Home Automation and Security System using Arduino, GSM and how we can control home appliances using Android application....
The role of defensible space for residential structure protection during wildfires
Syphard, Alexandra D.; Brennan, Teresa J.; Keeley, Jon E.
2014-01-01
With the potential for worsening fire conditions, discussion is escalating over how to best reduce effects on urban communities. A widely supported strategy is the creation of defensible space immediately surrounding homes and other structures. Although state and local governments publish specific guidelines and requirements, there is little empirical evidence to suggest how much vegetation modification is needed to provide significant benefits. We analysed the role of defensible space by mapping and measuring a suite of variables on modern pre-fire aerial photography for 1000 destroyed and 1000 surviving structures for all fires where homes burned from 2001 to 2010 in San Diego County, CA, USA. Structures were more likely to survive a fire with defensible space immediately adjacent to them. The most effective treatment distance varied between 5 and 20 m (16–58 ft) from the structure, but distances larger than 30 m (100 ft) did not provide additional protection, even for structures located on steep slopes. The most effective actions were reducing woody cover up to 40% immediately adjacent to structures and ensuring that vegetation does not overhang or touch the structure. Multiple-regression models showed landscape-scale factors, including low housing density and distances to major roads, were more important in explaining structure destruction. The best long-term solution will involve a suite of prevention measures that include defensible space as well as building design approach, community education and proactive land use planning that limits exposure to fire.
Hollaar, V.R.Y.; Putten, G.J. van der; Maarel-Wierink, C.D. van der; Bronkhorst, E.M.; Swart, B.J.M. de; Baat, C. de; Creugers, N.H.J.
2017-01-01
BACKGROUND: Nursing home-acquired pneumonia (NHAP) is a common infection among nursing home residents. There is also a high prevalence of dysphagia in nursing home residents and they suffer more often from comorbidity and multimorbidity. This puts nursing home residents at higher risk of (mortality
2013-07-31
... State homes providing nursing home and adult day health services care to Veterans. VA requires... Diem for Nursing Home Care of Veterans in State Homes; Per Diem for Adult Day Care of Veterans in State... information needed to ensure that nursing home and adult day health care facilities are providing high quality...
Full Text Available ... ACS Careers at ACS About ACS Career Types Working at ACS ... Education Patients and Family Skills Programs Ostomy Home Skills Program Ostomy Home Skills Program Adult Ostomy ...
Home advantage in professional tennis
Koning, Ruud H.
2011-01-01
Home advantage is a pervasive phenomenon in sport. It has been established in team sports such as basketball, baseball, American football, and European soccer. Attention to home advantage in individual sports has so far been limited. The aim of this study was to examine home advantage in
Interplanetary laser ranging - an emerging technology for planetary science missions
Dirkx, D.; Vermeersen, L. L. A.
2012-09-01
Interplanetary laser ranging (ILR) is an emerging technology for very high accuracy distance determination between Earth-based stations and spacecraft or landers at interplanetary distances. It has evolved from laser ranging to Earth-orbiting satellites, modified with active laser transceiver systems at both ends of the link instead of the passive space-based retroreflectors. It has been estimated that this technology can be used for mm- to cm-level accuracy range determination at interplanetary distances [2, 7]. Work is being performed in the ESPaCE project [6] to evaluate in detail the potential and limitations of this technology by means of bottom-up laser link simulation, allowing for a reliable performance estimate from mission architecture and hardware characteristics.
Modular Zero Energy. BrightBuilt Home
Energy Technology Data Exchange (ETDEWEB)
Aldrich, Robb [Consortium for Advanced Residential Buildings (CARB), Norwalk, CT (United States). Steven Winters Associates, Inc.; Butterfield, Karla [Consortium for Advanced Residential Buildings (CARB), Norwalk, CT (United States). Steven Winters Associates, Inc.
2016-03-01
Kaplan Thompson Architects (KTA) has specialized in sustainable, energy-efficient buildings, and they have designed several custom, zero-energy homes in New England. These zero-energy projects have generally been high-end, custom homes with budgets that could accommodate advanced energy systems. In an attempt to make zero energy homes more affordable and accessible to a larger demographic, KTA explored modular construction as way to provide high-quality homes at lower costs. In the mid-2013, KTA formalized this concept when they launched BrightBuilt Home (BBH). The BBH mission is to offer a line of architect-designed, high-performance homes that are priced to offer substantial savings off the lifetime cost of a typical home and can be delivered in less time. For the past two years, CARB has worked with BBH and Keiser Homes (the primary modular manufacturer for BBH) to discuss challenges related to wall systems, HVAC, and quality control. In Spring of 2014, CARB and BBH began looking in detail on a home to be built in Lincolnville, ME by Black Bros. Builders. This report details the solution package specified for this modular plan and the challenges that arose during the project.
Fukui, Sakiko; Fujita, Junko; Tsujimura, Mayuko; Sumikawa, Yuka; Hayashi, Yayoi
2011-11-01
To identify factors influencing the place of death among home palliative cancer care patients, focusing on the role of nurses in terms of pre- and post-discharge from hospital to home care settings. A cross-sectional nationwide questionnaire survey was conducted at 1000 randomly selected homecare agencies in Japan. The questionnaires were completed by primary community nurses of home palliative patients just after their discharge. A total of 568 responses were analyzed (effective response rate, 69%). Multivariate logistic regression analysis revealed the following independent factors of place of death among those patients: desire for home death at referral by both patient and family caregiver; caregiver relationship to patient as daughter or daughter-in-law; totally bedridden functional status of patient; patient not suffering from depression and/or anxiety at referral; patients and caregivers duly informed about the dying process/death in detail, as well as instructed by community nurses about pain management and how to treat/prevent bedsores in home care settings. This study demonstrated the importance of both the hospital and community nurses' role in increasing the patients' chance of dying at home. Hospital nurses should support early transfer to home palliative care according to their assessment of the desire of patient/family caregiver for home death, the patients' clinical status, and caregivers' ability to provide patient care at home. Community nurses should inform patients/family caregiver in detail about the dying process/death just after discharge, relieve patient pain, treat/prevent bedsores, and instruct family caregivers on their symptom control. Crown Copyright © 2011. Published by Elsevier Ltd. All rights reserved.
Vocational Home Economics Curriculum Guide for Occupational Home and Institutional Services.
Dewald, Margaret R.
The training program outlined in this guide focuses upon the development of students for gainful employment through a two-year course of study in home and institutional services. Instructional topics are provided in nine areas: orientation to home and institutional services, cleaning supplies and equipment, cleaning surfaces, cleaning clothes and…
Grit, Alexander
2010-01-01
It can be argued that many potentialities within society are left unused by organising hospitality venues based on modern planning practices. These planning practises regard the setting as a rational space which is predictable and manageable. By applying modern management principles to spaces of
Public Open Spaces and Leisure-Time Walking in Brazilian Adults
Directory of Open Access Journals (Sweden)
Alex Antonio Florindo
2017-05-01
Full Text Available Access to public open space is important to increase leisure-time walking (LTW in high-income countries, but there is little evidence in middle-income countries. We conducted a cross-sectional analysis to examine the relationship between LTW and the presence of different public open spaces (parks, bike paths, and squares and the mix of these recreational destinations near the homes of adults participating in the Sao Paulo Health Survey (n = 3145. LTW was evaluated by a questionnaire. We delineated buffers (500, 1000, and 1500 m from the geographic coordinates of the adults’ residential addresses using a geographic information system. We used multilevel logistic regression taking account of clustering by census tracts and households, and with adjustment for social, demographics, and health characteristics. The main results showed that the presence of at least two recreational destinations within a 500-m buffer of participants’ homes were associated with an increased odds of LTW compared with no destinations present (OR = 1.65; 95% CI 1.09–2.55. No associations were found for destinations further away. These results support actions outlined in the new urban plan for Sao Paulo city and could be used to highlight the importance access to a mix of public open spaces to promote physical activity in megacities of middle-income countries.
2012-08-01
... per diem to State homes providing nursing home and adult day health services care to Veterans. VA... Diem for Nursing Home Care of Veterans in State Homes; Per Diem for Adult Day Care of Veterans in State... information needed to ensure that nursing home and adult day health care facilities are providing high quality...
Nursing Home Quality Initiative
U.S. Department of Health & Human Services — This Nursing Home Quality Initiative (NHQI) website provides consumer and provider information regarding the quality of care in nursing homes. NHQI discusses quality...
7 CFR 1755.509 - Mobile homes.
2010-01-01
... homes, motor homes, truck campers, travel trailers, and all forms of recreational vehicles. Customer... ® for a mobile home depends on how the electric power is installed at the mobile home and it can involve considerable judgment on the part of the telecommunications installer. The National Electrical Code ® and NEC...
The HOME Inventory and Family Demographics.
Bradley, Robert H.; Caldwell, Bettye M.
1984-01-01
Examines the relation between the Home Observation for Measurement of Environment (HOME) Inventory and sex, race, socioeconomic status, the amount of crowding in the home, and birth order. Performs multivariate analysis of covariance on an intact family sample using HOME subscales as criterion measures and status and structural variables as…
Sarrett, Jennifer C
2015-06-01
The home is a critical place to learn about cultural values of childhood disability, including autism and intellectual disabilities. The current article describes how the introduction of autism into a home and the availability of intervention options change the structure and meaning of a home and reflect parental acceptance of a child's autistic traits. Using ethnographic data from Kerala, India and Atlanta, GA USA, a description of two types of homes are developed: the custodial home, which is primarily focused on caring for basic needs, and the therapeutic home, which is focused on changing a child's autistic traits. The type of home environment is respondent to cultural practices of child rearing in the home and influences daily activities, management, and care in the home. Further, these homes differ in parental acceptance of their autistic children's disabilities, which is critical to understand when engaging in international work related to autism and intellectual disability. It is proposed that parental acceptance can be fostered through the use of neurodiverse notions that encourage autism acceptance.
Home e-health system integration in the Smart Home through a common media server.
Pau, I; Seoane, F; Lindecrantz, K; Valero, M A; Carracedo, J
2009-01-01
Home e-health systems and services are revealed as one of the most important challenges to promote Quality of Life related to Health in the Information Society. Leading companies have worked on e-health systems although the majority of them are addressed to hospital or primary care settings. The solution detailed in this paper offers a personal health system to be integrated with Smart Home services platform to support home based e-care. Thus, the home e-health system and architecture detailed in this research work is ready to supply a seamless personal care solution both from the biomedical data analysis, service provision, security guarantee and information management s point of view. The solution is ready to be integrated within the Accessible Digital Home, a living lab managed by Universidad Politécnica de Madrid for R&D activities.
Ensuring Quality Nursing Home Care
... cases, you can also call the Department of Health. Nursing homes are required to post information on how you ... nursing homes in your area, go to Medicare’s Nursing Home Compare website at ... information is not intended to diagnose health problems or to take the place of medical ...
The 'Cancer Home-Life Intervention'
DEFF Research Database (Denmark)
Pilegaard, Marc Sampedro; la Cour, Karen; Gregersen Oestergaard, Lisa
2018-01-01
, occupational therapy-based and adaptive programme for people with advanced cancer targeting the performance of their prioritised everyday activities. SETTING/PARTICIPANTS: Home-living adults diagnosed with advanced cancer experiencing functional limitations were recruited from two Danish hospitals. They were......BACKGROUND: People with advanced cancer face difficulties with their everyday activities at home that may reduce their health-related quality of life. To address these difficulties, we developed the 'Cancer Home-Life Intervention'. AIM: To evaluate the efficacy of the 'Cancer Home Life......-Intervention' compared with usual care with regard to patients' performance of, and participation in, everyday activities, and their health-related quality of life. DESIGN AND INTERVENTION: A randomised controlled trial ( ClinicalTrials.gov NCT02356627). The 'Cancer Home-Life Intervention' is a brief, tailored...
Kotooka, Norihiko; Kitakaze, Masafumi; Nagashima, Kengo; Asaka, Machiko; Kinugasa, Yoshiharu; Nochioka, Kotaro; Mizuno, Atsushi; Nagatomo, Daisuke; Mine, Daigo; Yamada, Yoko; Kuratomi, Akiko; Okada, Norihiro; Fujimatsu, Daisuke; Kuwahata, So; Toyoda, Shigeru; Hirotani, Shin-Ichi; Komori, Takahiro; Eguchi, Kazuo; Kario, Kazuomi; Inomata, Takayuki; Sugi, Kaoru; Yamamoto, Kazuhiro; Tsutsui, Hiroyuki; Masuyama, Tohru; Shimokawa, Hiroaki; Momomura, Shin-Ichi; Seino, Yoshihiko; Sato, Yasunori; Inoue, Teruo; Node, Koichi
2018-02-15
Home telemonitoring is becoming more important to home medical care for patients with heart failure. Since there are no data on home telemonitoring for Japanese patients with heart failure, we investigated its effect on cardiovascular outcomes. The HOMES-HF study was the first multicenter, open-label, randomized, controlled trial (RCT) to elucidate the effectiveness of home telemonitoring of physiological data, such as body weight, blood pressure, and pulse rate, for Japanese patients with heart failure (UMIN Clinical Trials Registry 000006839). The primary end-point was a composite of all-cause death or rehospitalization due to worsening heart failure. We analyzed 181 recently hospitalized patients with heart failure who were randomly assigned to a telemonitoring group (n = 90) or a usual care group (n = 91). The mean follow-up period was 15 (range 0-31) months. There was no statistically significant difference in the primary end-point between groups [hazard ratio (HR), 0.95; 95% confidence interval (CI), 0.548-1.648; p = 0.572]. Home telemonitoring for Japanese patients with heart failure was feasible; however, beneficial effects in addition to those of usual care were not demonstrated. Further investigation of more patients with severe heart failure, participation of home medical care providers, and use of a more integrated home telemonitoring system emphasizing communication as well as monitoring of symptoms and physiological data are required.
Mobile work, multilocal dwelling and spaces of wellbeing.
Gorman-Murray, Andrew; Bissell, David
2018-05-01
Mobile work is increasingly common. For our purposes, mobile work entails long-distance commuting arrangements with periods living away from the primary domestic residence that may be considered 'home'. Mobile work reconfigures the relational fabric of 'home', introducing multilocal mooring points into worker's lives, and thus reshaping the spatial and temporal patterns and meanings of dwelling. Geography and cognate disciplines have begun to investigate the spatialities and temporalities of mobile work and multilocal dwelling, including the complexities of space-time management, but as yet little attention has been given to implications and impacts on the wellbeing of workers and their families - this is despite growing concern for worker and family wellbeing in some mobile work sectors, such as FIFO mining. Wellbeing is also a complex and multivalent concept, taking in objective and subjective dimensions, including health indicators and quality of life. In this context, this paper reviews recent literature on mobile work and multilocal dwelling and geographies of wellbeing to identify productive intersections for conceptual and empirical development. We suggest that provocations about space-times of wellbeing (Fleuret and Prugneau, 2015) and wellbeing as a relational, situated assemblage (Atkinson, 2013) are productive for analysing wellbeing in a context of mobility and multilocality. Copyright © 2018 Elsevier Ltd. All rights reserved.
Genetic Mediation of the Home Environment during Infancy: A Sibling Adoption Study of the HOME.
Braungart, Julia M.; And Others
1992-01-01
The home environment of nonadoptive and adoptive sibling pairs was assessed using the Home Observation for Measurement of the Environment when each sibling was one and two years of age. Correlations between home environment scores for nonadoptive siblings were greater than those for adoptive siblings. (BC)
Chew, Emily Y; Clemons, Traci E; Bressler, Susan B; Elman, Michael J; Danis, Ronald P; Domalpally, Amitha; Heier, Jeffrey S; Kim, Judy E; Garfinkel, Richard A
2014-03-01
To evaluate the effects of a home-monitoring device with tele-monitoring compared with standard care in detection of progression to choroidal neovascularization (CNV) associated with age-related macular degeneration (AMD), the leading cause of blindness in the US. Participants, aged 55 to 90 years, at high risk of developing CNV associated with AMD were recruited to the HOme Monitoring of Eye (HOME) Study, an unmasked, multi-center, randomized trial of the ForeseeHome (FH) device plus standard care vs. standard care alone. The FH device utilizes preferential hyperacuity perimetry and tele-monitoring to detect changes in vision function associated with development of CNV, potentially prior to symptom and visual acuity loss. After establishing baseline measurements, subsequent changes on follow-up are detected by the device, causing the monitoring center to alert the clinical center to recall participants for an exam. Standard care consists of instructions for self-monitoring visual changes with subsequent self-report to the clinical center. The primary objective of this study is to determine whether home monitoring plus standard care in comparison with standard care alone, results in earlier detection of incident CNV with better present visual acuity. The primary outcome is the decline in visual acuity at CNV diagnosis from baseline. Detection of CNV prior to substantial vision loss is critical as vision outcome following anti-angiogenic therapy is dependent on the visual acuity at initiation of treatment. HOME Study is the first large scale study to test the use of home tele-monitoring system in the management of AMD patients. Published by Elsevier Inc.
Igarashi, Ayumi; Kurinobu, Takeshi; Ko, Ayako; Okamoto, Yuko; Matsuura, Shino; Feng, Mei; Yamamoto-Mitani, Noriko
2015-09-12
To promote home death, it is necessary to clarify the institutional barriers to conducting end-of-life (EOL) care and consider strategies to deal with this process. This study aims to clarify institution-related factors associated with the provision of home-based EOL care cases, and to compare them among three different types of home-care agencies. We administered a cross-sectional survey throughout Japan to investigate the number and characteristics of EOL cases of home-care nursing (HN), home-help (HH) and care management (CM) agencies. Bivariate and multivariate analyses were performed for each type of agency to examine factors related to the provision of EOL care. 378 HN agencies, 274 HH agencies, and 452 CM agencies responded to the distributed questionnaire. HN agencies had on average 2.1 (SD = 4.0; range 0-60) home-based EOL cases in the last 3 months, while HH agencies had 0.9 (SD = 1.3; range 0-7) and CM agencies had 1.5 (SD = 2.2; range 0-18) in the last 6 months. In a multivariable analysis of HN agencies, a large number of staff (OR: 1.52; p EOL care; in HH agencies, accepting EOL clients in the agency (OR: 3.29; p EOL care; in CM agencies, the number of staff (OR: 1.21; p = 0.037), the number of collaborating HH agencies (OR: 1.07; p = 0.032), and whether home-care nurses and home helpers visit clients together (OR: 1.89; p = 0.007) were positively associated with the provision of EOL care. The agency's size and the inter-agency collaborative system seemed most important among HN agencies and CM agencies, while institutional preparedness for EOL was most important for HH agencies. These findings represent important new information for targeting different effective strategies in the promotion of home-based EOL care, depending on the agency type.
Titan Ligita
2017-01-01
Background: Provision of health care service at home is one of the advanced forms of care for patients being discharged from hospitalization. Little is known about the experience of nurses providing home care services through a nursing home-care model especially in Indonesian context. Objective: This study aims to explore the experience in order to increase understanding on the form of home care provision, and consequently the nurses may understand the form of home care globally. Metho...
The incidence of depression and its risk factors in Dutch nursing homes and residential care homes.
Boorsma, Marijke; Joling, Karlijn; Dussel, Martine; Ribbe, Miel; Frijters, Dinnus; van Marwijk, Harm W J; Nijpels, Giel; van Hout, Hein
2012-11-01
Although it is known that depression is highly prevalent in institutionalized older adults, little is known about its incidence and risk factors in nursing homes and residential care homes. The aim of this study was to investigate and compare the incidence and associated risk factors for depression in Dutch nursing homes and residential care homes. Data on depression were extracted from the Vrije Universiteit naturalistic cohort on routine care monitoring with the Minimum Data Set of the Resident Assessment Instrument. A total of 1,324 residents in six nursing homes and 1,723 residents in 23 residential care homes with an average follow-up of 1.2 years. Depression was defined as a clinical diagnosis according to Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition, criteria and the use of antidepressants. Residents with prevalent depression at baseline were excluded. The incidence rate was 13.6 per 100 person years in the nursing homes and 10.2 per 100 person years in the residential care homes. The independent risk factors for in-home depression for residents in nursing homes included dementia (OR: 1.7; 95% CI: 1.02-2.95) and a score of 3 or more on the Depression Rating Scale (odds ratio [OR]: 2.1; 95% confidence interval [CI]: 1.23-3.70). A protective effect was seen on the use of a hearing aid (OR: 0.3; 95% CI: 0.12-0.80). In the residential care homes, being male (OR: 2.1; 95% CI: 1.27-3.30), having cancer (OR: 2.9; 95% CI: 1.64-4.95), and a score of 2 or higher on the Cognitive Performance Scale (OR: 1.5; 95% CI: 1.05-2.22) increased the risk to develop depression. Age greater than 85 years (OR: 0.5; 95% CI: 0.31-0.67) and hearing impairment (OR: 0.8; 95% CI: 0.60-1.00) appeared to be protective. The incidence rate for depression in residents of Dutch nursing homes and residential care homes was high and the associated risk factors found may have important implications for staff. 2012 American Association for Geriatric Psychiatry
Full Text Available ... Careers at ACS Careers at ACS About ACS Career Types Working at ACS ... American College of Surgeons Education Patients and Family Skills Programs Ostomy Home Skills Program Ostomy Home Skills ...
Home is Private…Do Not Enter! Introversion and Sensitivity to Work-Home Conflict.
Baer, Stacy M; Jenkins, Jade S; Barber, Larissa K
2016-10-01
This study examined extraversion as a moderator of the relationship between negative work-home conflict and stress-related outcomes among US employees using conservation of resources theory and privacy regulation theory. Introverts only experienced stronger negative effects of negative work-home conflict on work-related resource depletion (job burnout, low engagement, low satisfaction with balance) rather than general resource depletion (personal burnout) and strain (physical and psychological). This finding suggests that introverts selectively withdraw from the work domain to conserve resources when privacy at home is threatened. Employers may want to consider ways to help introverts increase work-home segmentation, such as reducing workplace norms that encourage employees to be continuously accessible. Copyright © 2014 John Wiley & Sons, Ltd. Copyright © 2014 John Wiley & Sons, Ltd.
Connecting the physical and psychosocial space to Sandia's mission
Energy Technology Data Exchange (ETDEWEB)
Emmanuel, Glory Ruth [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Silva, Austin Ray [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2014-07-01
Sandia Labs has corporate, lab-wide efforts to enhance the research environment as well as improve physical space. However, these two efforts are usually done in isolation. The integration of physical space design with the nurturing of what we call psychosocial space can foster more efficient and effective creativity, innovation, collaboration, and performance. This paper presents a brief literature review on how academia and industry are studying the integration of physical and psychosocial space and focuses on the efforts that we, the authors, have made to improve the research environment in the Cyber Engineering Research Lab (CERL), home to Group 1460. Interviews with subject matter experts from Silicon Valley and the University of New Mexico plus changes to actual spaces in CERL provided us with six lessons learned when integrating physical and psychosocial space. We describe these six key takeaways in hopes that Sandia will see this area as an evolving research capability that Sandia can both contribute to and benefit from.
Influences of landscape heterogeneity on home-range sizes of brown bears
Mangipane, Lindsey S.; Belant, Jerrold L.; Hiller, Tim L.; Colvin, Michael E.; Gustine, David; Mangipane, Buck A.; Hilderbrand, Grant V.
2018-01-01
Animal space use is influenced by many factors and can affect individual survival and fitness. Under optimal foraging theory, individuals use landscapes to optimize high-quality resources while minimizing the amount of energy used to acquire them. The spatial resource variability hypothesis states that as patchiness of resources increases, individuals use larger areas to obtain the resources necessary to meet energetic requirements. Additionally, under the temporal resource variability hypothesis, seasonal variation in available resources can reduce distances moved while providing a variety of food sources. Our objective was to determine if seasonal home ranges of brown bears (Ursus arctos) were influenced by temporal availability and spatial distribution of resources and whether individual reproductive status, sex, or size (i.e., body mass) mediated space use. To test our hypotheses, we radio collared brown bears (n = 32 [9 male, 23 female]) in 2014–2016 and used 18 a prioriselected linear models to evaluate seasonal utilization distributions (UD) in relation to our hypotheses. Our top-ranked model by AICc, supported the spatial resource variability hypothesis and included percentage of like adjacency (PLADJ) of all cover types (P 0.17 for males, solitary females, and females with dependent young), and body mass (kg; P = 0.66). Based on this model, for every percentage increase in PLADJ, UD area was predicted to increase 1.16 times for all sex and reproductive classes. Our results suggest that landscape heterogeneity influences brown bear space use; however, we found that bears used larger areas when landscape homogeneity increased, presumably to gain a diversity of food resources. Our results did not support the temporal resource variability hypothesis, suggesting that the spatial distribution of food was more important than seasonal availability in relation to brown bear home range size.
Full Text Available ... kit contains: A booklet with information on the operation, home skills such as emptying and changing a pouch, problem solving, and home management. A DVD with demonstration of each skill Stoma ...
... Medical Procedures In Vitro Diagnostics Home Use Tests Cholesterol Share Tweet Linkedin Pin it More sharing options ... a home-use test kit to measure total cholesterol. What cholesterol is: Cholesterol is a fat (lipid) ...
The determinants of home and nursing home death: a systematic review and meta-analysis.
Costa, Vania; Earle, Craig C; Esplen, Mary Jane; Fowler, Robert; Goldman, Russell; Grossman, Daphna; Levin, Leslie; Manuel, Douglas G; Sharkey, Shirlee; Tanuseputro, Peter; You, John J
2016-01-20
Most Canadians die in hospital, and yet, many express a preference to die at home. Place of death is the result of the interaction among sociodemographic, illness- and healthcare-related factors. Although home death is sometimes considered a potential indicator of end-of-life/palliative care quality, some determinants of place of death are more modifiable than others. The objective of this systematic review was to evaluate the determinants of home and nursing home death in adult patients diagnosed with an advanced, life-limiting illness. A systematic literature search was performed for studies in English published from January 1, 2004 to September 24, 2013 that evaluated the determinants of home or nursing home death compared to hospital death in adult patients with an advanced, life-limiting condition. The adjusted odds ratios, relative risks, and 95% confidence intervals of each determinant were extracted from the studies. Meta-analyses were performed if appropriate. The quality of individual studies was assessed using the Newcastle-Ottawa scale and the body of evidence was assessed according to the GRADE Working Group criteria. Of the 5,900 citations identified, 26 retrospective cohort studies were eligible. The risk of bias in the studies identified was considered low. Factors associated with an increased likelihood of home versus hospital death included multidisciplinary home palliative care, preference for home death, cancer as opposed to other diagnoses, early referral to palliative care, not living alone, having a caregiver, and the caregiver's coping skills. Knowledge about the determinants of place of death can be used to inform care planning between healthcare providers, patients and family members regarding the feasibility of dying in the preferred location and may help explain the incongruence between preferred and actual place of death. Modifiable factors such as early referral to palliative care, presence of a multidisciplinary home palliative care
An Ontology-based Context-aware System for Smart Homes: E-care@home
Directory of Open Access Journals (Sweden)
Marjan Alirezaie
2017-07-01
Full Text Available Smart home environments have a significant potential to provide for long-term monitoring of users with special needs in order to promote the possibility to age at home. Such environments are typically equipped with a number of heterogeneous sensors that monitor both health and environmental parameters. This paper presents a framework called E-care@home, consisting of an IoT infrastructure, which provides information with an unambiguous, shared meaning across IoT devices, end-users, relatives, health and care professionals and organizations. We focus on integrating measurements gathered from heterogeneous sources by using ontologies in order to enable semantic interpretation of events and context awareness. Activities are deduced using an incremental answer set solver for stream reasoning. The paper demonstrates the proposed framework using an instantiation of a smart environment that is able to perform context recognition based on the activities and the events occurring in the home.
An Ontology-based Context-aware System for Smart Homes: E-care@home.
Alirezaie, Marjan; Renoux, Jennifer; Köckemann, Uwe; Kristoffersson, Annica; Karlsson, Lars; Blomqvist, Eva; Tsiftes, Nicolas; Voigt, Thiemo; Loutfi, Amy
2017-07-06
Smart home environments have a significant potential to provide for long-term monitoring of users with special needs in order to promote the possibility to age at home. Such environments are typically equipped with a number of heterogeneous sensors that monitor both health and environmental parameters. This paper presents a framework called E-care@home, consisting of an IoT infrastructure, which provides information with an unambiguous, shared meaning across IoT devices, end-users, relatives, health and care professionals and organizations. We focus on integrating measurements gathered from heterogeneous sources by using ontologies in order to enable semantic interpretation of events and context awareness. Activities are deduced using an incremental answer set solver for stream reasoning. The paper demonstrates the proposed framework using an instantiation of a smart environment that is able to perform context recognition based on the activities and the events occurring in the home.
Business Solutions Case Study: Marketing Zero Energy Homes: LifeStyle Homes, Melbourne, Florida
Energy Technology Data Exchange (ETDEWEB)
None
2015-06-01
Building America research has shown that high-performance homes can potentially give builders an edge in the marketplace and can boost sales. But it doesn't happen automatically. It requires a tailored, easy to understand marketing campaign and sometimes a little flair. This case study highlights LifeStyle Homes’ successful marketing approach for their SunSmart home package, which has helped to boost sales for the company. SunSmart marketing includes a modified logo, weekly blog, social media, traditional advertising, website, and sales staff training. Marketing focuses on quality, durability, healthy indoor air, and energy efficiency with an emphasis on the surety of third-party verification and the scientific approach to developing the SunSmart package. With the introduction of SunSmart, LifeStyle began an early recovery, nearly doubling sales in 2010; SunSmart sales now exceed 300 homes, including more than 20 zero energy homes. Completed homes in 2014 far outpaced the national (19%) and southern census region (27%) recovery rates for the same period. As technology improves and evolves, this builder will continue to collaborate with Building America.
International Nuclear Information System (INIS)
Nelson, D.R.; McKibben, J.N.; Tricas, T.C.; Cooksey, D.J.
1979-01-01
Progress is reported on the following studies: determining home range dimensions and stabilities by tracking sharks equipped with ultrasonic transmitters; telemetry instrumentation and techniques for applicability under Enewetak conditions; studies on social behavior, especially aggression toward divers, in relation to space utilization and group organization; and compilation of food-habit data from examination of stomach contents
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Home. 541.14 Section 541.14 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY DEFINITIONS FOR REGULATIONS AFFECTING FEDERAL SAVINGS ASSOCIATIONS § 541.14 Home. The term home means real estate comprising a single-family dwelling(s...
Home Here, Home There: The lives and Landscape within High-tech Trans-Pacific Commuter Culture
Directory of Open Access Journals (Sweden)
Shenglin Chang
2004-12-01
Full Text Available Within the last two decades the issue of 'home identity' (how a home reflects a person's identity has been an emerging topic within contemporary intellectual discourse in fields as diverse as Asian-American studies, anthropology, cultural geography, cultural studies, literary criticism and landscape architecture. In this article, I focus on the transnational experiences of members of a newly emerging trans-Pacific commuter culture, and give special attention to describing how individual members of this group construct the relationship between self and landscape. This article reveals the complex process in which members of a newly emerging trans-Pacific commuter culture have developed new non-traditional ways of constructing the landscape/home relationship - ways that call for challenging essentialist versions of home within a rapidly changing information age. I examine how Taiwanese-born, high-tech computer engineers who relocated to Silicon Valley engage in a struggle between their old identities and their newly forming American identities. These engineers and their families - members of the 'trans-Pacific home phenomenon' that emerged in the late 1990s - have a lifestyle in which they regularly commute between their American and Taiwanese homes. The ease of global travel and instant worldwide communication that became available in the 1990s afforded the trans-Pacific commuter group ease of travel, simultaneous ownership of two homes, and led to the reinvention of the relationship between global and local within the construction of self and home. This article explores how members of the trans-Pacific commuter culture struggle to make sense between the here-and-there homes across the Pacific Rim. With evidence from 80 interviews conducted in Silicon Valley (USA, Hsinchu (Taiwan, and Shanghai and Beijing (China, I focus on the ways in which members of the global-commuter group invented new, non-essentialist ways of constructing their home
Full Text Available ... JACS Jobs Events Find a Surgeon Patients and Family Contact My Profile Shop ( 0 ) Cart Donate American College of Surgeons Education Patients and Family Skills Programs Ostomy Home Skills Program Ostomy Home ...
Home Improvements Prevent Falls
... turn JavaScript on. Feature: Falls and Older Adults Home Improvements Prevent Falls Past Issues / Winter 2014 Table ... and ensure your safety. "Safe-ty-fy" Your Home Some Questions for Your Provider Will my medicines ...
Home economics in past and present
DEFF Research Database (Denmark)
Benn, Jette
2012-01-01
. Through the 100 years period thee roles and valuations of the teachers have changed. Why and how the subject has changed is essential to analyse in order to understand the present situation and to give proposals for the future. Teachers within home economics have been and are still mainly female. This can......, essential and important aspects of home economics, take these aspects up to present time and make perspectives for the future. As a start I will state some postulates to show some of the dilemmas and dialectics, which are at the agenda. • Home economics is a subject in a conflict between science (theory......) and everyday life experiences (practice) • Home economics is gendered • Home economics is culturally dependant, society determined, individually featured • Home economics holds potentials, possibilities, and difficulties These postulates are essential to bring to an open discussion for developing home...
Energy Technology Data Exchange (ETDEWEB)
Martin, Eric [Univ. of Central Florida, Orlando, FL (United States). Florida Solar Energy Center; Withers, Chuck [Univ. of Central Florida, Orlando, FL (United States). Florida Solar Energy Center; McIlvaine, Janet [Univ. of Central Florida, Orlando, FL (United States). Florida Solar Energy Center; Chasar, Dave [Univ. of Central Florida, Orlando, FL (United States). Florida Solar Energy Center; Beal, David [Univ. of Central Florida, Orlando, FL (United States). Florida Solar Energy Center
2018-02-07
The well-sealed, highly insulated building enclosures constructed by today's home building industry coupled with efficient lighting and appliances are achieving significantly reduced heating and cooling loads. These low-load homes can present a challenge when selecting appropriate space-conditioning equipment. Conventional, fixed-capacity heating and cooling equipment is often oversized for small homes, causing increased first costs and operating costs. Even if fixed-capacity equipment can be properly specified for peak loads, it remains oversized for use during much of the year. During these part-load cooling hours, oversized equipment meets the target dry-bulb temperatures very quickly, often without sufficient opportunity for moisture control. The problem becomes more acute for high-performance houses in humid climates when meeting ASHRAE Standard 62.2 recommendations for wholehouse mechanical ventilation.
The U.S. home infusion market.
Monk-Tutor, M R
1998-10-01
Medicare legislation stimulated the development of home care services but also resulted in fragmentation of service components. In the 1980s, prospective pricing and diagnosis-related groups, and resulting pressures to reduce inpatient length of stay, prompted additional growth of the industry. Even so, in 1995 home care represented only 3% of total national expenditures on health care. The annual growth rate of the home infusion industry dropped from 64% in 1982-86 to 24% in 1986-93. While revenue per patient for home infusion is expected to decrease under managed care, an increasing number of patients will support continued market growth. The home infusion market is highly competitive, with only a few large national providers and many small local providers. In 1996, 29% of acute care hospitals provided or were developing a home care program. Community pharmacists' options in the home infusion area include independent services, partnerships, joint ventures, contracts with hospitals, and franchises. The home infusion market is being integrated into alternative sites, such as ambulatory infusion centers (AICs), as providers attempt to diversify to maintain managed care contracts. AICs provide infusion therapy and nursing to noninstitutionalized, nonhome-bound patients. Untapped sources for future growth of the infusion market include long-term-care facilities. More consistent studies of the home care market are needed. Despite slowed growth in recent years, home care has a strong market in the United States.
Human-centered design and smart homes : How to study and design for the home experience?
Eggen, J.H.; van den Hoven, E.A.W.H; Terken, J.M.B.; van Hoof, J.; Demiris, G.; Wouters, E.J.M.
2016-01-01
The focus of this chapter is on designing for smart homes. The perspective will be user-driven design research. The chapter starts with a context analysis of the home environment. This analysis shows that, from a user perspective, home is about emotions and not about the physical house with all its
Home care decision support using an Arden engine--merging smart home and vital signs data.
Marschollek, Michael; Bott, Oliver J; Wolf, Klaus-H; Gietzelt, Matthias; Plischke, Maik; Madiesh, Moaaz; Song, Bianying; Haux, Reinhold
2009-01-01
The demographic change with a rising proportion of very old people and diminishing resources leads to an intensification of the use of telemedicine and home care concepts. To provide individualized decision support, data from different sources, e.g. vital signs sensors and home environmental sensors, need to be combined and analyzed together. Furthermore, a standardized decision support approach is necessary. The aim of our research work is to present a laboratory prototype home care architecture that integrates data from different sources and uses a decision support system based on the HL7 standard Arden Syntax for Medical Logical Modules. Data from environmental sensors connected to a home bus system are stored in a data base along with data from wireless medical sensors. All data are analyzed using an Arden engine with the medical knowledge represented in Medical Logic Modules. Multi-modal data from four different sensors in the home environment are stored in a single data base and are analyzed using an HL7 standard conformant decision support system. Individualized home care decision support must be based on all data available, including context data from smart home systems and medical data from electronic health records. Our prototype implementation shows the feasibility of using an Arden engine for decision support in a home setting. Our future work will include the utilization of medical background knowledge for individualized decision support, as there is no one-size-fits-all knowledge base in medicine.
Music Therapy Clinical Practice in Hospice: Differences Between Home and Nursing Home Delivery.
Liu, Xiaodi; Burns, Debra S; Hilliard, Russell E; Stump, Timothy E; Unroe, Kathleen T
2015-01-01
Hospice music therapy is delivered in both homes and nursing homes (NH). No studies to date have explored differences in music therapy delivery between home and NH hospice patients. To compare music therapy referral reasons and delivery for hospice patients living in NH versus home. A retrospective, electronic medical record review was conducted from a large U.S. hospice of patients receiving music therapy between January 1, 2006, and December 31, 2010. Among the 4,804 patients, 2,930 lived in an NH and 1,847 patients lived at home. Compared to home, NH hospice patients were more likely to be female, older, unmarried, and Caucasian. For home hospice patients, the top referral reasons were patient/family emotional and spiritual support, quality of life, and isolation. The most frequent referral reasons for NH hospice patients were isolation, quality of life, and patient/family emotional and spiritual support. Differences in music therapy delivery depended mainly on patients' primary diagnosis and location of care. Results suggest differences in referral reasons and delivery based on an interaction between location of care and patient characteristics. Delivery differences are likely a result of individualized assessment and care plans developed by the music therapist and other interdisciplinary team members to address the unique needs of the patient. Thus, it is important to have professionally trained music therapists assess and provide tailored music-based interventions for patients with different referral reasons and personal characteristics. This study also supports staffing decisions based on patient need rather than average daily census. © the American Music Therapy Association 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
... this? Submit What's this? Submit Button Past Emails Home Canning and Botulism Language: English (US) Español (Spanish) ... myself and others safe when it comes to home-canned foods? Many cases of foodborne botulism have ...
Client Involvement in Home Care Practice
DEFF Research Database (Denmark)
Glasdam, Stinne; Henriksen, Nina; Kjær, Lone
2013-01-01
, political and administrative frames that rule home- care practice. Client involvement is shown within four constructed analytical categories: ‘Structural conditions of providing and receiving home care’; ‘Client involvement inside the home: performing a professional task and living an everyday life......’; ‘Client involvement outside the home: liberal business and mutual goal setting’; and ‘Converting a home to a working place: refurnishing a life’. The meaning of involvement is depending on which position it is viewed from. On the basis of this analysis, we raise the question of the extent to which...
On-line hemodiafiltration at home.
Vega, Almudena; Abad, Soraya; Macías, Nicolás; Aragoncillo, Inés
2018-04-01
Survival with online hemodiafiltration (OL-HDF) is higher than with hemodialysis; frequent hemodialysis has also improved survival and quality of life. Home hemodialysis facilitates frequent therapy. We report our experience with 2 patients with stage 5 CKD who started home hemodialysis with OL-HDF in November 2016. After a training period at the hospital, they started home hemodialysis with OL-HDF after learning how to manage dialysis monitors and how to administer water treatment. We used the "5008-home" (FMC © ) monitor, and the Acqua C © (Fresenius Medical Care) for water treatment. Water conductivity was always checked before and during dialysis sessions and was always 2.5 to 3 mS/cm. Water cultures always fulfilled the criteria for ultrapurity. As far as we know, this is the first report on patients receiving OL-HDF at home. The technique proved to be safe and valid for renal replacement therapy and transfers the benefits of hospital convective therapy to the home setting. Future data will enable us to determine whether survival has also improved. © 2017 International Society for Hemodialysis.
Directory of Open Access Journals (Sweden)
Kimber Haddix McKay
2010-02-01
Full Text Available This paper analyzes the socio-cultural dimensions of obstacles facing solar photovoltaic projects in two villages in rural Nepal. The study was conducted in Humla District, Nepal, one of the most remote and impoverished regions of the country. There are no roads in the district, homes lack running water and villagers’ health suffers from high levels of indoor air pollution from open cooking/heating fires and the smoky torches traditionally burned for light. The introduction of solar energy is important to these villagers, as it removes one major source of indoor air pollution from homes and provides brighter light than the traditional torches. Solar energy is preferable in many villages in the region due to the lack of suitable streams or rivers for micro-hydroelectric projects. In the villages under study in this paper, in-home solar electricity is a novel and recent innovation, and was installed within the last three years in two different geo-spatial styles, depending upon the configuration of homes in the village. In some villages, houses are grouped together, while in others households are widely dispersed. In the former, solar photovoltaic systems were installed in a “cluster” fashion with multiple homes utilizing power from a central battery store under the control of the householder storing the battery bank. In villages with widely spaced households, a single home system was used so that each home had a separate solar photovoltaic array, wiring system and battery bank. It became clear that the cluster system was the sensible choice due to the geographic layout of certain villages, but this put people into management groups that did not always work well due to caste or other differences. This paper describes the two systems and their management and usage costs and benefits from the perspective of the villagers themselves.
DEFF Research Database (Denmark)
Agergaard, Jytte; Brøgger, Ditte
2016-01-01
flows. By focusing on these educational migrants, this paper explores how they connect to their rural homes. Guided by a critical reading of the migration-development scholarship, the paper examines how migrants and their relatives make sense of educational migrants’ remitting and returning practices......, and by comparing three groups of educational migrants, the migrants’ reasons for staying connected and sending remittances are scrutinized. The paper finds that although educational migrants do not generate extensive economic remittances for local development in Nepal, they stay connected to their rural homes...
DEFF Research Database (Denmark)
Le Guilly, Thibaut; Olsen, Petur; Ravn, Anders Peter
2013-01-01
Ambient Intelligence systems use many sensors and actuators, with a diversity of networks, protocols and technologies which makes it impossible to access the devices in a common manner. This paper presents the HomePort software, which provides an open source RESTful interface to heterogeneous...... sensor networks, allowing a simple unified access to virtually any kind of protocol using well known standards. HomePort includes means to provide event notification, as well as a tracing mechanism. The software is implemented and we report on initial experiments and provide an evaluation that shows...
Reducing Energy Use in Existing Homes by 30%: Learning From Home Performance with ENERGY STAR
Energy Technology Data Exchange (ETDEWEB)
Liaukus, C. [Building America Research Alliance (BARA), Kent, WA (United States)
2014-12-01
The improvement of existing homes in the United States can have a much greater impact on overall residential energy use than the construction of highly efficient new homes. There are over 130 million existing housing units in the U.S., while annually new construction represents less than two percent of the total supply (U.S. Census Bureau, 2013). Therefore, the existing housing stock presents a clear opportunity and responsibility for Building America (BA) to guide the remodeling and retrofit market toward higher performance existing homes. There are active programs designed to improve the energy performance of existing homes. Home Performance with ENERGY STAR (HPwES) is a market-rate program among them. BARA's research in this project verified that the New Jersey HPwES program is achieving savings in existing homes that meet or exceed BA's goal of 30%. Among the 17 HPwES projects with utility data included in this report, 15 have actual energy savings ranging from 24% to 46%. Further, two of the homes achieved that level of energy savings without the costly replacement of heating and cooling equipment, which indicates that less costly envelope packages could be offered to consumers unable to invest in more costly mechanical packages, potentially creating broader market impact.
DOE Zero Energy Ready Home Case Study: Mandalay Homes — Pronghorn Ranch, Prescott Valley, AZ
Energy Technology Data Exchange (ETDEWEB)
none,
2014-09-01
The builder has certified 20 homes to DOE Zero Energy Ready Home program and plans are underway for 50 more. Winner of a Production Builder prize in the 2014 Housing Innovation Awards, the homes achieved a HERS score of 48 without photovoltaics (PV) or HERS 25 with 3.5 kW PV included.
Achieving Improvement Through Nursing Home Quality Measurement
Harris, Yael; Clauser, Steven B.
2002-01-01
CMS has initiated the Nursing Home Quality Initiative (NHQI) to improve the quality of nursing home care. Central to the NHQI is the public reporting of nursing home quality measures that serve as the basis for the Initiative's communication and quality improvement program. This article provides an overview of the NHQI, focusing on the role of nursing home quality measures in achieving improvements in nursing home care. We also describe the evolution of quality measurement in nursing homes, a...
SMS security system for smart home detectors
Cekova, Katerina; Gelev, Saso
2016-01-01
Security has always been an important problem everywhere. Home security has been a major issue where crime is increasing and everybody wants home security to protect the home. Safety from theft and flame are the most important requirements of a home security system for people. A remote home security system offers many benefits from keeping homeowners, and their property safe. This paper present controlling of the home security system remotely from Android Application. Owners can turn on or...
On preventive blood pressure self-monitoring at home
DEFF Research Database (Denmark)
Verdezoto, Nervo; Grönvall, Erik
2015-01-01
for self-measuring, the importance of interpretation, understanding and health awareness, sharing self-monitoring information for prevention, various motivational factors, the role of the doctor in prevention, and the home as a distributed information space. An awareness of these aspects can help designers......, to understand existing challenges, and uncover opportunities for self-monitoring technologies to support preventive healthcare activities among older adults. From our study, several important aspects emerged to consider when designing preventive self-monitoring technology, such as the complexity of guidelines...... how these aspects can both inform people engaged in Quantified Self activities and designers alike, and the tools and approaches that have sprung from the so-called Quantified Self movement...
Full Text Available ... Overview The skills kit contains: A booklet with information on the operation, home skills such as emptying and changing a pouch, problem solving, and home management. A DVD with demonstration of each skill Stoma ...
... at Home Tell your local fire department, electric company, and telephone company that you use oxygen in your home. They ... M. is also a founding member of Hi-Ethics and subscribes to the principles of the Health ...
[Maintaining patients' autonomy at home].
Niang, Bénédicte; Coudre, Jean Pierre
2015-01-01
To maintain the flow of hospital discharges, the patient's return home with support from a home nursing service is important. If any difficulties are identified, there are various programmes or good practices which can be put into place. The future law on adapting society to ageing also comprises a scheme combining home assistance and nursing care.
Brain Computer Interface on Track to Home.
Miralles, Felip; Vargiu, Eloisa; Dauwalder, Stefan; Solà, Marc; Müller-Putz, Gernot; Wriessnegger, Selina C; Pinegger, Andreas; Kübler, Andrea; Halder, Sebastian; Käthner, Ivo; Martin, Suzanne; Daly, Jean; Armstrong, Elaine; Guger, Christoph; Hintermüller, Christoph; Lowish, Hannah
2015-01-01
The novel BackHome system offers individuals with disabilities a range of useful services available via brain-computer interfaces (BCIs), to help restore their independence. This is the time such technology is ready to be deployed in the real world, that is, at the target end users' home. This has been achieved by the development of practical electrodes, easy to use software, and delivering telemonitoring and home support capabilities which have been conceived, implemented, and tested within a user-centred design approach. The final BackHome system is the result of a 3-year long process involving extensive user engagement to maximize effectiveness, reliability, robustness, and ease of use of a home based BCI system. The system is comprised of ergonomic and hassle-free BCI equipment; one-click software services for Smart Home control, cognitive stimulation, and web browsing; and remote telemonitoring and home support tools to enable independent home use for nonexpert caregivers and users. BackHome aims to successfully bring BCIs to the home of people with limited mobility to restore their independence and ultimately improve their quality of life.
Investigating Solutions to Wind Washing Issues in Two-Story Florida Homes, Phase 2
Energy Technology Data Exchange (ETDEWEB)
Withers, C. [Building America Partnership for Improved Residential Construction, Cocoa, FL (United States); Kono, J. [Building America Partnership for Improved Residential Construction, Cocoa, FL (United States)
2015-04-01
This report provides results from a second-phase research study of a phenomenon generally referred to as wind washing. Wind washing is the movement of unconditioned air around or through building thermal barriers in such a way as to diminish or nullify the intended thermal performance. In some cases, thermal and air barriers are installed very poorly or not at all, and air can readily move from unconditioned attic spaces into quasi-conditioned interstitial spaces. This study focused on the impact of poorly sealed and insulated floor cavities adjacent to attic spaces in Florida homes. In these cases, unconditioned attic air can be transferred into floor cavities through pathways driven by natural factors such as wind, or by thermal differences between the floor cavity and the attic. Air can also be driven into a floor cavity through mechanical forces imposed by return duct leakage in the floor cavity.
Inclusive design for a care home
DEFF Research Database (Denmark)
Raudaskoski, Pirkko Liisa
2011-01-01
Nordic Conference on Activity Theory and the Forth Finnish Conference on Cultural and Activity Research (FISCAR10) Proceedings ISBN 987-952-60-0021-3 p. 160 INCLUSIVE DESIGN FOR A CARE HOME Pirkko Raudaskoski The paper discusses the methodological challenges of both theorizing and implementing...... communication skills with language or by other means. Instead, others will have to mediate their experiences. These accounts are necessarily (value-laden) transformations that can be problematic also due to the sudden identity change for the occupant from a ‘normal’ person to a ‘disabled’ person and the wish...... for the people around to restore the ‘old version’ of the person. Is there space for disability advocacy in this environment? Büscher, M., O’Neille, J., Rooksby, J. 2009. Designing for diagnosing. CSCW 18. Keinonen, T. 2007. Immediate, product and remote design. IASDR07....
Ownership conversions and nursing home performance.
Grabowski, David C; Stevenson, David G
2008-08-01
To examine the effects of ownership conversions on nursing home performance. Online Survey, Certification, and Reporting system data from 1993 to 2004, and the Minimum Data Set (MDS) facility reports from 1998 to 2004. Regression specification incorporating facility fixed effects, with terms to identify trends in the pre- and postconversion periods. The annual rate of nursing home conversions almost tripled between 1994 and 2004. Our regression results indicate converting facilities are generally different throughout the pre/postconversion years, suggesting little causal effect of ownership conversions on nursing home performance. Before and after conversion, nursing homes converting from nonprofit to for-profit status generally exhibit deterioration in their performance, while nursing homes converting from for-profit to nonprofit status generally exhibit improvement. Policy makers have expressed concern regarding the implications of ownership conversions for nursing home performance. Our results imply that regulators and policy makers should not only monitor the outcomes of nursing home conversions, but also the targets of these conversions.
Diabetes - home glucose testing; Diabetes - home blood sugar testing ... Usual times to test your blood sugar are before meals and at bedtime. Your provider may ask you to check your blood sugar 2 hours after a meal or ...
Ward Thompson, Catharine; Aspinall, Peter; Roe, Jenny; Robertson, Lynette; Miller, David
2016-04-22
Environment-health research has shown significant relationships between the quantity of green space in deprived urban neighbourhoods and people's stress levels. The focus of this paper is the nature of access to green space (i.e., its quantity or use) necessary before any health benefit is found. It draws on a cross-sectional survey of 406 adults in four communities of high urban deprivation in Scotland, United Kingdom. Self-reported measures of stress and general health were primary outcomes; physical activity and social wellbeing were also measured. A comprehensive, objective measure of green space quantity around each participant's home was also used, alongside self-report measures of use of local green space. Correlated Component Regression identified the optimal predictors for primary outcome variables in the different communities surveyed. Social isolation and place belonging were the strongest predictors of stress in three out of four communities sampled, and of poor general health in the fourth, least healthy, community. The amount of green space in the neighbourhood, and in particular access to a garden or allotment, were significant predictors of stress. Physical activity, frequency of visits to green space in winter months, and views from the home were predictors of general health. The findings have implications for public health and for planning of green infrastructure, gardens and public open space in urban environments.
Directory of Open Access Journals (Sweden)
Catharine Ward Thompson
2016-04-01
Full Text Available Environment-health research has shown significant relationships between the quantity of green space in deprived urban neighbourhoods and people’s stress levels. The focus of this paper is the nature of access to green space (i.e., its quantity or use necessary before any health benefit is found. It draws on a cross-sectional survey of 406 adults in four communities of high urban deprivation in Scotland, United Kingdom. Self-reported measures of stress and general health were primary outcomes; physical activity and social wellbeing were also measured. A comprehensive, objective measure of green space quantity around each participant’s home was also used, alongside self-report measures of use of local green space. Correlated Component Regression identified the optimal predictors for primary outcome variables in the different communities surveyed. Social isolation and place belonging were the strongest predictors of stress in three out of four communities sampled, and of poor general health in the fourth, least healthy, community. The amount of green space in the neighbourhood, and in particular access to a garden or allotment, were significant predictors of stress. Physical activity, frequency of visits to green space in winter months, and views from the home were predictors of general health. The findings have implications for public health and for planning of green infrastructure, gardens and public open space in urban environments.
Ward Thompson, Catharine; Aspinall, Peter; Roe, Jenny; Robertson, Lynette; Miller, David
2016-01-01
Environment-health research has shown significant relationships between the quantity of green space in deprived urban neighbourhoods and people’s stress levels. The focus of this paper is the nature of access to green space (i.e., its quantity or use) necessary before any health benefit is found. It draws on a cross-sectional survey of 406 adults in four communities of high urban deprivation in Scotland, United Kingdom. Self-reported measures of stress and general health were primary outcomes; physical activity and social wellbeing were also measured. A comprehensive, objective measure of green space quantity around each participant’s home was also used, alongside self-report measures of use of local green space. Correlated Component Regression identified the optimal predictors for primary outcome variables in the different communities surveyed. Social isolation and place belonging were the strongest predictors of stress in three out of four communities sampled, and of poor general health in the fourth, least healthy, community. The amount of green space in the neighbourhood, and in particular access to a garden or allotment, were significant predictors of stress. Physical activity, frequency of visits to green space in winter months, and views from the home were predictors of general health. The findings have implications for public health and for planning of green infrastructure, gardens and public open space in urban environments. PMID:27110803
Long-term home care scheduling
DEFF Research Database (Denmark)
Gamst, Mette; Jensen, Thomas Sejr
In several countries, home care is provided for certain citizens living at home. The long-term home care scheduling problem is to generate work plans spanning several days such that a high quality of service is maintained and the overall cost is kept as low as possible. A solution to the problem...... provides detailed information on visits and visit times for each employee on each of the covered days. We propose a branch-and-price algorithm for the long-term home care scheduling problem. The pricing problem generates one-day plans for an employee, and the master problem merges the plans with respect...
Music@Home: A novel instrument to assess the home musical environment in the early years.
Politimou, Nina; Stewart, Lauren; Müllensiefen, Daniel; Franco, Fabia
2018-01-01
The majority of children under the age of 5 appear to show spontaneous enjoyment of singing, being exposed to music and interacting with musical instruments, but whether variations in engaging in such activities in the home could contribute to developmental outcomes is still largely unknown. Critically, researchers lack a comprehensive instrument with good psychometric properties to assess the home musical environment from infancy to the preschool years. To address this gap, this paper presents two studies that describe the development and validation of the Music@Home questionnaire, which comprises two versions: Infant and Preschool. In Study 1, an initial pool of items was generated and administered to a wide audience of parents (n = 287 for the Infant, n = 347 for the Preschool version). Exploratory factor analysis was used to identify different dimensions comprising the home musical environment of both infants and pre-schoolers, and to reduce the initial pool of items to a smaller number of meaningful items. In Study 2, convergent and divergent validity and internal and test-retest reliability of the new instrument were established, using data from a different sample of participants (n = 213 for the Infant, n = 213 for the Preschool version). The second study also investigated associations between the Music@Home and musical characteristics of the parents, such as their musical education and personal engagement with music. Overall, the Music@Home constitutes a novel, valid and reliable instrument that allows for the systematic assessment of distinct aspects of the home musical environment in families with children under the age of 5. Furthermore, the Infant and Preschool versions of the Music@Home present differential associations with musical characteristics of the parents opening a new area of inquiry into how musical exposure and interaction in the home may vary across different developmental stages.
Music@Home: A novel instrument to assess the home musical environment in the early years
Stewart, Lauren; Müllensiefen, Daniel; Franco, Fabia
2018-01-01
The majority of children under the age of 5 appear to show spontaneous enjoyment of singing, being exposed to music and interacting with musical instruments, but whether variations in engaging in such activities in the home could contribute to developmental outcomes is still largely unknown. Critically, researchers lack a comprehensive instrument with good psychometric properties to assess the home musical environment from infancy to the preschool years. To address this gap, this paper presents two studies that describe the development and validation of the Music@Home questionnaire, which comprises two versions: Infant and Preschool. In Study 1, an initial pool of items was generated and administered to a wide audience of parents (n = 287 for the Infant, n = 347 for the Preschool version). Exploratory factor analysis was used to identify different dimensions comprising the home musical environment of both infants and pre-schoolers, and to reduce the initial pool of items to a smaller number of meaningful items. In Study 2, convergent and divergent validity and internal and test-retest reliability of the new instrument were established, using data from a different sample of participants (n = 213 for the Infant, n = 213 for the Preschool version). The second study also investigated associations between the Music@Home and musical characteristics of the parents, such as their musical education and personal engagement with music. Overall, the Music@Home constitutes a novel, valid and reliable instrument that allows for the systematic assessment of distinct aspects of the home musical environment in families with children under the age of 5. Furthermore, the Infant and Preschool versions of the Music@Home present differential associations with musical characteristics of the parents opening a new area of inquiry into how musical exposure and interaction in the home may vary across different developmental stages. PMID:29641607
Features of public open spaces and physical activity among children: findings from the CLAN study.
Timperio, Anna; Giles-Corti, Billie; Crawford, David; Andrianopoulos, Nick; Ball, Kylie; Salmon, Jo; Hume, Clare
2008-11-01
To examine associations between features of public open spaces, and children's physical activity. 163 children aged 8-9 years and 334 adolescents aged 13-15 years from Melbourne, Australia participated in 2004. A Geographic Information System was used to identify all public open spaces (POS) within 800 m of participants' homes and their closest POS. The features of all POS identified were audited in 2004/5. Accelerometers measured moderate-to-vigorous physical activity (MVPA) after school and on weekends. Linear regression analyses examined associations between features of the closest POS and participants' MVPA. Most participants had a POS within 800 m of their home. The presence of playgrounds was positively associated with younger boys' weekend MVPA (B=24.9 min/day; pPOS were associated with participants' MVPA, although mixed associations were evident. Further research is required to clarify these complex relationships.
Field Evaluation of Four Novel Roof Designs for Energy-Efficient Manufactured Homes
Energy Technology Data Exchange (ETDEWEB)
Levy, E. [Levy Partnership Inc., New York, NY (United States); Dentz, J. [Levy Partnership Inc., New York, NY (United States); Ansanelli, E. [Levy Partnership Inc., New York, NY (United States); Barker, G. [Levy Partnership Inc., New York, NY (United States); Rath, P. [Levy Partnership Inc., New York, NY (United States); Dadia, D. [Levy Partnership Inc., New York, NY (United States)
2015-12-01
A five-bay roof test structure was built, instrumented and monitored in an effort to determine through field testing and analysis the relative contributions of select technologies toward reducing energy use in new manufactured homes. The roof structure in Jamestown, California was designed to examine how differences in roof construction impact space conditioning loads, wood moisture content and attic humidity levels. Conclusions are drawn from the data on the relative energy and moisture performance of various configurations of vented and sealed attics.
Field Evaluation of Four Novel Roof Designs for Energy-Efficient Manufactured Homes
Energy Technology Data Exchange (ETDEWEB)
Levy, E. [ARIES Collaborative, New York, NY (United States); Dentz, J. [ARIES Collaborative, New York, NY (United States); Ansanelli, E. [ARIES Collaborative, New York, NY (United States); Barker, G. [ARIES Collaborative, New York, NY (United States); Rath, P. [ARIES Collaborative, New York, NY (United States); Dadia, D. [ARIES Collaborative, New York, NY (United States)
2015-12-03
"9A five-bay roof test structure was built, instrumented and monitored in an effort to determine through field testing and analysis the relative contributions of select technologies toward reducing energy use in new manufactured homes. The roof structure in Jamestown, California was designed to examine how differences in roof construction impact space conditioning loads, wood moisture content and attic humidity levels. Conclusions are drawn from the data on the relative energy and moisture performance of various configurations of vented and sealed attics.
Xerostomia among older home care clients.
Viljakainen, Sari; Nykänen, Irma; Ahonen, Riitta; Komulainen, Kaija; Suominen, Anna Liisa; Hartikainen, Sirpa; Tiihonen, Miia
2016-06-01
The purpose of this study was to examine drug use and other factors associated with xerostomia in home care clients aged 75 years or older. The study sample included 270 home care clients aged ≥75 years living in Eastern and Central Finland. The home care clients underwent in-home interviews carried out by trained home care nurses, nutritionists, dental hygienists and pharmacists. The collected data contained information on sociodemographic factors, health and oral health status, drug use, depressive symptoms (GDS-15), cognitive functioning (MMSE), functional ability (Barthel Index, IADL) and nutrition (MNA). The primary outcome was xerostomia status (never, occasionally or continuously). Among the home care clients, 56% (n = 150) suffered from xerostomia. Persons with continuous xerostomia used more drugs and had more depressive symptoms and a higher number of comorbidities than other home care clients. In multivariate analyses, excessive polypharmacy (OR = 1.83, 95% Cl 1.08-3.10) and depressive symptoms (OR = 1.12, 95% Cl 1.03-1.22) were associated with xerostomia. Xerostomia is a common problem among old home care clients. Excessive polypharmacy, use of particular drug groups and depressive symptoms were associated with xerostomia. The findings support the importance of a multidisciplinary approach in the care of older home care clients. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Implementing Home Health Standards in Clinical Practice.
Gorski, Lisa A
2016-02-01
In 1986, the American Nurses Association (ANA) published the first Standards of Home Health Practice. Revised in 1992 and expanded in 1999 to become Home Health Nursing: Scope and Standards of Practice, it was revised in 2008 and again in 2014. In the 2014 edition, there are 6 standards of home healthcare nursing practice and 10 standards of professional performance for home healthcare nursing. The focus of this article is to describe the home healthcare standards and to provide guidance for implementation in clinical practice. It is strongly encouraged that home healthcare administrators, educators, and staff obtain a copy of the standards and fully read this essential home healthcare resource.