NuSTAR Observation of the Symbiotic System GX 1+4

Science.gov (United States)

Wolff, Michael Thomas; Becker, Peter A.; Enoto, Teruaki; Pottschmidt, Katja; Wood, Kent

2017-08-01

We report on a NuSTAR observation of the symbiotic binary system GX 1+4. GX 1+4 is one of a small number of systems with a red giant mass donor and a magnetic neutron star in orbit around each other. The accreting pulsar in GX 1+4 has a spin period of ~150 seconds with epochs of both spin-up and spin-down. The orbital period that has not been determined. Magnetic accretion theory in such systems suggests that the neutron star has a magnetic field in the range 1013-1014 Gauss although this is not settled because no cyclotron absorption feature has been observed in the X-ray spectrum. The NuSTAR spectrum shows broad Fe-line emission near ~6.5 keV and also shows a broad power law shape detected up to ~60 keV. We analyze and discuss the NuSTAR X-ray data with particular attention to the question of what can the spectrum tell us about the structure of the accretion flow onto the neutron star and the magnetic field strength.

Spectrophotometry of the unusual optical candidate for 3U 1728-24 (=GX 2 + 5 = GX 1 + 4)

International Nuclear Information System (INIS)

Davidsen, A.; Malina, R.; Bowyer, S.

1976-01-01

The spectrum of the object suggested as a possible optical counterpart of GX 2 + 5 (Glass and Feast 1973) was investigated, using the image tube scanner attached to the 3-m telescope of Lick Observatory. An improved x-ray error box obtained with Copernicus (Mason 1974) strongly supports this proposed identification. It is found that the candidate displays all the characteristics of the symbiotic stars and the related recurrent novae. The spectrum reveals the presence of an M star together with a blue component and a large number of emission lines displaying a wide range of ionization. Among the emission lines identified or suspected are: H I, He I, O I, [O I], [O II], [O III], Na I, Fe II, [Fe VII], [Fe X], [A X], and [A XI]. There is evidence of variability of both the continuum and the line intensities. This object provides strong support for the often proposed association of some x-ray sources with nova-like systems. It is suggested that in GX 2 + 5 accretion on a compact companion of an M giant produces x-rays and ultraviolet radiation which ionizes a circumstellar nebula, perhaps ejected in a previous nova-like outburst

Many faces of compact objects: distance, optical extinction and multi-wavelength behaviour

International Nuclear Information System (INIS)

Corbel, Stephane

1999-01-01

This thesis is devoted to a multi-wavelength study of accretion-ejection phenomena around compact stars (black holes and neutron stars). The first part of this manuscript describes problems related to the determination of the distance and the optical extinction to compact objects - fundamental parameters for the evaluation of the energy budget of these systems. To this end, the structure and the dynamics of the Galaxy are studied by observations of the atomic and molecular gas along the line of sight to compact stars. This method leads to the first evaluation of the distance to two Soft Gamma Repeaters: SGR 1806-20 and SGR 1627-41. We then draw some conclusions on the nature of these sources of recurrent gamma-ray bursts. The above method is then applied to two X-ray binaries: Cir X-1 and GX 339-4. In the second part of this thesis, we present a multi-wavelength study of the Galactic black hole candidate GX 339-4. We first discuss the characteristics of the radio emission from GX 339-4. In 1998, GX 339-4 underwent a transition to a soft-high X-ray state and observations in three wavelength regimes (radio, soft and hard X-rays) revealed new patterns of behaviour. This allowed us to constrain the region of origin of the radio emission (a compact jet) in GX 339-4 and allowed a better understanding of the physical coupling between accretion and ejection in GX 339-4. An analogy with the black hole candidate Cyg X-1 is then presented. Finally, these results are discussed in the context of micro-quasars and active galactic nuclei in order to gain a deeper insight into the accretion-ejection coupling around compact objects. (author) [fr

INTEGRAL observation of renewed activity from 4U 1608-522

DEFF Research Database (Denmark)

Ishibashi, W.; Ferrigno, C.; Sánchez-Fernández, C.

2010-01-01

On 3 March 2010 SuperAGILE detected an X-ray burst from the LMXB 4U 1608-522 (Atel #2461). Confirmation of the renewed activity of this transient source was reported by MAXI/GSC (Atel #2462). 4U1608-522 was in the IBIS/ISGRI and JEMX field of view during several observations between 2010-Feb-23 06......, the source was not detected by IBIS/ISGRI. We derive an upper limit (5-sigma) on the X-ray flux of 5-10 mCrab in the 20-40 keV band. INTEGRAL is currently observing the field of GX 339-4 (March 4th-6th) and will continue monitoring of the inner Galactic Disk until the end of March. 4U 1608...

Validation of the 172 group ENDFB7GX library

International Nuclear Information System (INIS)

Khan, Suhail Ahmad; Raj, Devesh; Karthikeyan, R.; Jagannathan, V.

2007-01-01

Full text: Five 172 group libraries, viz., IAEAGX, ENDFB6GX, JENDL3GX, JEFF31GX, and LWRPSGX were obtained as a part of the IAEA WIMS Library Update Project (WLUP). The first four libraries have data available for 173 nuclides up to 244 Cm. The LWRPSGX library based on JEFF3.1 point dataset is an extended library up to 252 Cf. Data for 12 more actinides and the related burnup chain were added. The five libraries were validated against known experiments in an earlier work. In general the LWRPSGX was found to be giving better results. Recently another version of 172 group library 'ENDFB7GX' has been released. In the present work we provide the results of validation of the ENDFB7GX library against the same set of experimental data and a comparison with results of other libraries. The experimental configuration data include a variety of uniform lattices with enriched UO 2 , U- metal, mixed oxide (UO 2 -PuO 2 ) fuels with H 2 O and D 2 O moderators for a wide range of enrichment, fuel diameter and ratio of moderator to fuel volume (V m /V f ). The calculations have been done using the code LATTEST which solves the single pin lattice cell problem by 1-D multi-group transport theory after cylindricalising the square or hexagonal cell boundary. The LATTEST code is an improved version of the MURLI code and is capable of providing a ready testing of any new cross section library against a set of experimental benchmark lattices collected from various sources. The calculated k eff values and certain spectral indices, where available, have been compared for all the libraries for more than hundred critical lattices. There is a general under prediction of k eff values by all libraries. The maximum under prediction is for ENDFB6GX library and the least is for JENDL3GX library. The ENDFB7GX library, in general, is found to over predict in comparison to the k eff values obtained using LWRPSGX library. While scrutinizing the basic nuclear data it was noted that the slowing down cross

Physiological responses of astronaut candidates to simulated +Gx orbital emergency re-entry.

Science.gov (United States)

Wu, Bin; Xue, Yueying; Wu, Ping; Gu, Zhiming; Wang, Yue; Jing, Xiaolu

2012-08-01

We investigated astronaut candidates' physiological and pathological responses to +Gx exposure during simulated emergency return from a running orbit to advance astronaut +Gx tolerance training and medical support in manned spaceflight. There were 13 male astronaut candidates who were exposed to a simulated high +Gx acceleration profile in a spacecraft during an emergency return lasting for 230 s. The peak value was 8.5 G. Subjective feelings and symptoms, cardiovascular and respiratory responses, and changes in urine component before, during, and after +Gx exposure were investigated. Under high +Gx exposure, 15.4% of subjects exhibited arrhythmia. Heart rate (HR) increased significantly and four different types of HR response curves were distinguished. The ratio of QT to RR interval on the electrocardiograms was significantly increased. Arterial oxygen saturation (SaO2) declined with increasing G value and then returned gradually. SaO2 reached a minimum (87.7%) at 3 G during the decline phase of the +Gx curve. Respiratory rate increased significantly with increasing G value, while the amplitude and area of the respiratory waves were significantly reduced. The overshoot appeared immediately after +Gx exposure. A few subjects suffered from slight injuries, including positive urine protein (1/13), positive urinary occult blood (1/13), and a large area of petechiae on the back (1/13). Astronaut candidates have relatively good tolerance to the +Gx profile during a simulation of spacecraft emergent ballistic re-entry. However, a few subjects exhibited adverse physiological responses and slight reversible pathological injuries.

A connection between the X-ray spectral branches and the radio brightness in GX17+2

International Nuclear Information System (INIS)

Penninx, Wim; Lewin, W.H.G.; Paradijs, J. van; Klis, M. van der

1988-01-01

GX17 + 2(4U 1813 - 14) is a bright X-ray binary in which matter is accreting on to a neutron star from a nearby companion. X-ray bursts are sometimes observed, as well as quasiperiodic oscillations in the X-ray flux. The frequencies of the quasiperiodic oscillations depend on the spectral state of the source, which manifests itself as three distinct spectral 'branches' in an X-ray colour-colour diagram. GX17 + 2 is also a variable radio source; there is no believable optical counterpart. We report here on simultaneous X-ray and radio observations which showed a connection between the spectral branches and the radio brightness. The 6-cm and 20-cm flux density increased by factors of 30±5 and 40± 10, respectively, as the X-ray state changed from the so-called 'flaring branch' to the 'horizontal branch'. (author)

A curious case of the accretion-powered X-ray pulsar GX 1+4

Science.gov (United States)

Jaisawal, Gaurava K.; Naik, Sachindra; Gupta, Shivangi; Chenevez, Jérôme; Epili, Prahlad

2018-04-01

We present detailed spectral and timing studies using a NuSTAR observation of GX 1+4 in October 2015 during an intermediate intensity state. The measured spin period of 176.778 s is found to be one of the highest values since its discovery. In contrast to a broad sinusoidal-like pulse profile, a peculiar sharp peak is observed in profiles below ˜25 keV. The profiles at higher energies are found to be significantly phase-shifted compared to the soft X-ray profiles. Broadband energy spectra of GX 1+4, obtained from NuSTAR and Swift observations, are described with various continuum models. Among these, a two component model consisting of a bremsstrahlung and a blackbody component is found to best-fit the phase-averaged and phase-resolved spectra. Physical models are also used to investigate the emission mechanism in the pulsar, which allows us to estimate the magnetic field strength to be in ˜(5-10)× 1012 G range. Phase-resolved spectroscopy of NuSTAR observation shows a strong blackbody emission component in a narrow pulse phase range. This component is interpreted as the origin of the peculiar peak in the pulse profiles below ≤25 keV. The size of emitting region is calculated to be ˜400 m. The bremsstrahlung component is found to dominate in hard X-rays and explains the nature of simple profiles at high energies.

Overview of GX launch services by GALEX

Science.gov (United States)

Sato, Koji; Kondou, Yoshirou

2006-07-01

Galaxy Express Corporation (GALEX) is a launch service company in Japan to develop a medium size rocket, GX rocket and to provide commercial launch services for medium/small low Earth orbit (LEO) and Sun synchronous orbit (SSO) payloads with a future potential for small geo-stationary transfer orbit (GTO). It is GALEX's view that small/medium LEO/SSO payloads compose of medium scaled but stable launch market due to the nature of the missions. GX rocket is a two-stage rocket of well flight proven liquid oxygen (LOX)/kerosene booster and LOX/liquid natural gas (LNG) upper stage. This LOX/LNG propulsion under development by Japan's Aerospace Exploration Agency (JAXA), is robust with comparable performance as other propulsions and have future potential for wider application such as exploration programs. GX rocket is being developed through a joint work between the industries and GX rocket is applying a business oriented approach in order to realize competitive launch services for which well flight proven hardware and necessary new technology are to be introduced as much as possible. It is GALEX's goal to offer “Easy Access to Space”, a highly reliable and user-friendly launch services with a competitive price. GX commercial launch will start in Japanese fiscal year (JFY) 2007 2008.

Discovery of radio emission from the symbiotic X-ray binary system GX 1+4

Science.gov (United States)

van den Eijnden, J.; Degenaar, N.; Russell, T. D.; Miller-Jones, J. C. A.; Wijnands, R.; Miller, J. M.; King, A. L.; Rupen, M. P.

2018-02-01

We report the discovery of radio emission from the accreting X-ray pulsar and symbiotic X-ray binary GX 1+4 with the Karl G. Jansky Very Large Array. This is the first radio detection of such a system, wherein a strongly magnetized neutron star accretes from the stellar wind of an M-type giant companion. We measure a 9 GHz radio flux density of 105.3 ± 7.3 μJy, but cannot place meaningful constraints on the spectral index due to a limited frequency range. We consider several emission mechanisms that could be responsible for the observed radio source. We conclude that the observed properties are consistent with shocks in the interaction of the accretion flow with the magnetosphere, a synchrotron-emitting jet, or a propeller-driven outflow. The stellar wind from the companion is unlikely to be the origin of the radio emission. If the detected radio emission originates from a jet, it would show that strong magnetic fields (≥1012 G) do not necessarily suppress jet formation.

Resolving the hard X-ray emission of GX 5-1 with INTEGRAL

DEFF Research Database (Denmark)

Paizis, A.; Ebisawa, K.; Tikkanen, T.

2005-01-01

We present the study of one year of INTEGRAL data on the neutron star low mass X-ray binary GX 5-1. Thanks to the excellent angular resolution and sensitivity of INTEGRAL, we are able to obtain a high quality spectrum of GX 5-1 from similar to 5keV to similar to 100 keV, for the first time without...... contamination from the nearby black hole candidate GRS 1758-258 above 20 keV. During our observations, GX 5-1 was mostly found in the horizontal and normal branch of its hardness intensity diagram. A clear hard X-ray emission is observed above similar to 30 keV which exceeds the exponential cut-off spectrum...... expected from lower energies. This spectral flattening may have the same origin of the hard components observed in other Z sources as it shares the property of being characteristic to the horizontal branch. The hard excess is explained by introducing Compton up-scattering of soft photons from the neutron...

12 CFR 339.8 - Determination fees.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Determination fees. 339.8 Section 339.8 Banks... IN AREAS HAVING SPECIAL FLOOD HAZARDS § 339.8 Determination fees. (a) General. Notwithstanding any... hazard area. A determination fee may also include, but is not limited to, a fee for life-of-loan...

A magnetic model for low/hard state of black hole binaries

Science.gov (United States)

Ye, Yong-Chun; Wang, Ding-Xiong; Huang, Chang-Yin; Cao, Xiao-Feng

2016-03-01

A magnetic model for the low/hard state (LHS) of two black hole X-ray binaries (BHXBs), H1743-322 and GX 339-4, is proposed based on transport of the magnetic field from a companion into an accretion disk around a black hole (BH). This model consists of a truncated thin disk with an inner advection-dominated accretion flow (ADAF). The spectral profiles of the sources are fitted in agreement with the data observed at four different dates corresponding to the rising phase of the LHS. In addition, the association of the LHS with a quasi-steady jet is modeled based on transport of magnetic field, where the Blandford-Znajek (BZ) and Blandford-Payne (BP) processes are invoked to drive the jets from BH and inner ADAF. It turns out that the steep radio/X-ray correlations observed in H1743-322 and GX 339-4 can be interpreted based on our model.

No time for dead time: timing analysis of bright black hole binaries with NuSTAR

DEFF Research Database (Denmark)

Bachetti, Matteo; Harrison, Fiona A.; Cook, Rick

2015-01-01

Timing of high-count-rate sources with the NuSTAR Small Explorer Mission requires specialized analysis techniques. NuSTAR was primarily designed for spectroscopic observations of sources with relatively low count rates rather than for timing analysis of bright objects. The instrumental dead time ...... techniques. We apply this technique to NuSTAR observations of the black hole binaries GX 339-4, Cyg X-1, and GRS 1915+105....

Discovery of the near-infrared counterpart to the luminous neutron-star low-mass X-ray binary GX 3+1

Energy Technology Data Exchange (ETDEWEB)

Van den Berg, Maureen; Fridriksson, Joel K. [Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Homan, Jeroen [Massachusetts Institute of Technology, Kavli Institute for Astrophysics and Space Research, 70 Vassar Street, Cambridge, MA 02139 (United States); Linares, Manuel, E-mail: M.C.vandenBerg@uva.nl [Instituto de Astrofísica de Canarias (IAC), Vía Láctea s/n, La Laguna, E-38205, S/C de Tenerife (Spain)

2014-10-01

Using the High Resolution Camera on board the Chandra X-ray Observatory, we have measured an accurate position for the bright persistent neutron star X-ray binary and atoll source GX 3+1. At a location that is consistent with this new position, we have discovered the near-infrared (NIR) counterpart to GX 3+1 in images taken with the PANIC and FourStar cameras on the Magellan Baade Telescope. The identification of this K{sub s} = 15.8 ± 0.1 mag star as the counterpart is based on the presence of a Br γ emission line in an NIR spectrum taken with the Folded-port InfraRed Echelette spectrograph on the Baade Telescope. The absolute magnitude derived from the best available distance estimate to GX 3+1 indicates that the mass donor in the system is not a late-type giant. We find that the NIR light in GX 3+1 is likely dominated by the contribution from a heated outer accretion disk. This is similar to what has been found for the NIR flux from the brighter class of Z sources, but unlike the behavior of atolls fainter (L{sub X} ≈ 10{sup 36}-10{sup 37} erg s{sup –1}) than GX 3+1, where optically thin synchrotron emission from a jet probably dominates the NIR flux.

Spectral evolution of the Atoll source 4U 1728-34 with RXTE and INTEGRAL: evidence for hard X-ray tail

NARCIS (Netherlands)

Tarana, A.; Belloni, T.; Bazzano, A.; Homan, J.; Méndez, M.; Ubertini, P.; Comastri, A.; Angelini, L.; Cappi, M.

We report the temporal and spectral results on the INTEGRAL and RXTE 2006-2007 observation campaign of the Atoll source 4U 1728-34 (GX 354-0). The source shows, more than once, spectral evolution as revealed by the hardness intensity diagram. The soft state is well described by a Comptonization with

12 CFR 339.10 - Notice of servicer's identity.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Notice of servicer's identity. 339.10 Section... POLICY LOANS IN AREAS HAVING SPECIAL FLOOD HAZARDS § 339.10 Notice of servicer's identity. (a) Notice... Director of FEMA (or the Director of FEMA's designee) in writing of the identity of the servicer of the...

7 CFR 58.339 - Containers.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Containers. 58.339 Section 58.339 Agriculture... Procedures § 58.339 Containers. (a) Containers used for the packaging of butter and related products shall be commercially acceptable containers or packaging material that will satisfactorily protect the quality of the...

40 CFR 81.339 - Pennsylvania.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Pennsylvania. 81.339 Section 81.339... AREAS FOR AIR QUALITY PLANNING PURPOSES Section 107 Attainment Status Designations § 81.339 Pennsylvania. Pennsylvania—TSP Designated area Does not meet primary standards Does not meet secondary standards Cannot be...

Testing GxG interactions between coinfecting microbial parasite genotypes within hosts

Directory of Open Access Journals (Sweden)

Rebecca D Schulte

2014-05-01

Full Text Available Host-parasite interactions represent one of the strongest selection pressures in nature. They are often governed by genotype-specific (GxG interactions resulting in host genotypes that differ in resistance and parasite genotypes that differ in virulence depending on the antagonist’s genotype. Another type of GxG interactions, which is often neglected but which certainly influences host-parasite interactions, are those between coinfecting parasite genotypes. Mechanistically, within-host parasite interactions may range from competition for limited host resources to cooperation for more efficient host exploitation. The exact type of interaction, i.e. whether competitive or cooperative, is known to affect life-history traits such as virulence. However, the latter has been shown for chosen genotype combinations only, not considering whether the specific genotype combination per se may influence the interaction (i.e. GxG interactions. Here, we want to test for the presence of GxG interactions between coinfections of the bacterium Bacillus thuringiensis infecting the nematode Caenorhabditis elegans by combining two non-pathogenic and five pathogenic strains in all possible ways. Furthermore, we evaluate whether the type of interaction, reflected by the direction of virulence change of multiple compared to single infections, is genotype-specific. Generally, we found no indication for GxG interactions between non-pathogenic and pathogenic bacterial strains, indicating that virulence of pathogenic strains is equally affected by both non-pathogenic strains. Specific genotype combinations, however, differ in the strength of virulence change, indicating that the interaction type between coinfecting parasite strains and thus the virulence mechanism is specific for different genotype combinations. Such interactions are expected to influence host-parasite interactions and to have strong implications for coevolution.

47 CFR 1.339 - Witness fees.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 1 2010-10-01 2010-10-01 false Witness fees. 1.339 Section 1.339....339 Witness fees. Witnesses who are subpenaed and respond thereto are entitled to the same fees, including mileage, as are paid for like service in the courts of the United States. Fees shall be paid by...

Effect of acute exposure to hypergravity (GX vs. GZ) on dynamic cerebral autoregulation

Science.gov (United States)

Serrador, J. M.; Wood, S. J.; Picot, P. A.; Stein, F.; Kassam, M. S.; Bondar, R. L.; Rupert, A. H.; Schlegel, T. T.

2001-01-01

We examined the effects of 30 min of exposure to either +3GX (front-to-back) or +GZ (head-to-foot) centrifugation on cerebrovascular responses to 80 degrees head-up tilt (HUT) in 14 healthy individuals. Both before and after +3 GX or +3 GZ centrifugation, eye-level blood pressure (BP(eye)), end tidal PCO2 (PET(CO2)), mean cerebral flow velocity (CFV) in the middle cerebral artery (transcranial Doppler ultrasound), cerebral vascular resistance (CVR), and dynamic cerebral autoregulatory gain (GAIN) were measured with subjects in the supine position and during subsequent 80 degrees HUT for 30 min. Mean BP(eye) decreased with HUT in both the GX (n = 7) and GZ (n = 7) groups (P centrifugation only in the GZ group (P centrifugation. CFV decreased during HUT more significantly after centrifugation than before centrifugation in both groups (P centrifugation compared with before centrifugation, GAIN increased in both groups (P centrifugation resulted in a leftward shift of the cerebral autoregulation curve. We speculate that this leftward shift may have been due to vestibular activation (especially during +GX) or potentially to an adaptation to reduced cerebral perfusion pressure during +GZ.

X-ray bursts from GX 17+2: a new approach

International Nuclear Information System (INIS)

Sztajno, M.; Langmeier, A.; Truemper, J.; Pietsch, W.; Paradijs, J. van; Lewin, W.H.G.; Massachusetts Inst. of Tech., Cambridge

1986-01-01

The detection of two X-ray bursts from GX 17+2 is reported; a short one (lasting about 10s), and a long one (which lasted about 5 min). These bursts reached a maximum intensity of only about 40 per cent above the persistent flux level. Like previous long bursts observed from GX 17+2 the long burst showed little softening during its decay, and it is difficult at first glance to classify it as either a type 1 or a type 2 burst. Following the recent results of two of the authors a time-dependent spectral analysis of these bursts has been made. (author)

A method to associate all possible combinations of genetic and environmental factors using GxE landscape plot.

Science.gov (United States)

Nagaie, Satoshi; Ogishima, Soichi; Nakaya, Jun; Tanaka, Hiroshi

2015-01-01

Genome-wide association studies (GWAS) and linkage analysis has identified many single nucleotide polymorphisms (SNPs) related to disease. There are many unknown SNPs whose minor allele frequencies (MAFs) as low as 0.005 having intermediate effects with odds ratio between 1.5~3.0. Low frequency variants having intermediate effects on disease pathogenesis are believed to have complex interactions with environmental factors called gene-environment interactions (GxE). Hence, we describe a model using 3D Manhattan plot called GxE landscape plot to visualize the association of p-values for gene-environment interactions (GxE). We used the Gene-Environment iNteraction Simulator 2 (GENS2) program to simulate interactions between two genetic loci and one environmental factor in this exercise. The dataset used for training contains disease status, gender, 20 environmental exposures and 100 genotypes for 170 subjects, and p-values were calculated by Cochran-Mantel-Haenszel chi-squared test on known data. Subsequently, we created a 3D GxE landscape plot of negative logarithm of the association of p-values for all the possible combinations of genetic and environmental factors with their hierarchical clustering. Thus, the GxE landscape plot is a valuable model to predict association of p-values for GxE and similarity among genotypes and environments in the context of disease pathogenesis. GxE - Gene-environment interactions, GWAS - Genome-wide association study, MAFs - Minor allele frequencies, SNPs - Single nucleotide polymorphisms, EWAS - Environment-wide association study, FDR - False discovery rate, JPT+CHB - HapMap population of Japanese in Tokyo, Japan - Han Chinese in Beijing.

TRACING THE REVERBERATION LAG IN THE HARD STATE OF BLACK HOLE X-RAY BINARIES

International Nuclear Information System (INIS)

De Marco, B.; Ponti, G.; Nandra, K.; Muñoz-Darias, T.

2015-01-01

We report results obtained from a systematic analysis of X-ray lags in a sample of black hole X-ray binaries, with the aim of assessing the presence of reverberation lags and studying their evolution during outburst. We used XMM-Newton and simultaneous Rossi X-ray Timing Explorer (RXTE) observations to obtain broadband energy coverage of both the disk and the hard X-ray Comptonization components. In most cases the detection of reverberation lags is hampered by low levels of variability-power signal-to-noise ratio (typically when the source is in a soft state) and/or short exposure times. The most detailed study was possible for GX 339-4 in the hard state, which allowed us to characterize the evolution of X-ray lags as a function of luminosity in a single source. Over all the sampled frequencies (∼0.05–9 Hz), we observe the hard lags intrinsic to the power-law component, already well known from previous RXTE studies. The XMM-Newton soft X-ray response allows us to detail the disk variability. At low frequencies (long timescales) the disk component always leads the power-law component. On the other hand, a soft reverberation lag (ascribable to thermal reprocessing) is always detected at high frequencies (short timescales). The intrinsic amplitude of the reverberation lag decreases as the source luminosity and the disk fraction increase. This suggests that the distance between the X-ray source and the region of the optically thick disk where reprocessing occurs gradually decreases as GX 339-4 rises in luminosity through the hard state, possibly as a consequence of reduced disk truncation

Dicty_cDB: SSI339 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

7 CFR 1205.339 - Books and records.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1205.339 Section 1205.339... Cotton Research and Promotion Order Reports, Books, and Records § 1205.339 Books and records. Each... and make available for inspection by the Secretary such books and records as are necessary to carry...

5 CFR 339.303 - Examination procedures.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Examination procedures. 339.303 Section... QUALIFICATION DETERMINATIONS Medical Examinations § 339.303 Examination procedures. (a) When an agency orders or offers a medical examination under this subpart, it must inform the applicant or employee in writing of...

Changes of structure and properties of cast steels GX10NiCrNb32-20 and GX10NiCrNb3-25 after long-term tempering at 600-1000 C

International Nuclear Information System (INIS)

Gommans, R.; Schrijen, H.; Sundermann, J.; Steinkusch, W.; Hering, W.

2001-01-01

Low-alloy cast steels of type GX 10NiCrNb 32.20 are commonly used for the outlet section of reformer and cracker tubes for the temperature range of 600-1000 C. There was a lack of data on the ductility of the 25%Cr alloyed cast steel GX10NiCrNb 35.25 at room temperature after tempering, which was investigated in a joint project of Pose-Marre and DSM. Mechanical tests were carried out at room temperature and at elevated temperatures. Apart from light microscopy, also SEM/EDX, SAM and TEM analyses were carried out. The 25% alloy has lower ductility than the 20% alloy, owing primarily to the more pronounced development of M 6 C carbide from primary NbC carbide, which takes up Ni and Si during tempering. The microstructure and composition of the M 6 C carbide wre not fully clarified. Information is presented on the potential application of low-carbon materials of the type GX10NiCrNb35.25 [de

Analytical verification and quality assessment of the Tosoh HLC-723GX HbA1c analyzer

Directory of Open Access Journals (Sweden)

Marko Ris

2017-04-01

Full Text Available Objectives: Ion-exchange high-performance liquid chromatography (IE-HPLC has long been used as a reproducible and versatile analytical tool for HbA1c measurement.In this study, we performed analytical verification and quality assessment of the recently introduced small IE-HPLC Tosoh HLC-723GX HbA1c analyzer, and a comparison of results to immunoassay (IA and capillary electrophoresis (CE. Design and methods: The total imprecision of Tosoh HLC-723GX was verified according to CLSI EP15-A2 protocol using commercial control materials (C-QC and pooled human whole blood samples (HWB. The Sigma metric was used for the evaluation of quality targets. HbA1c results were compared to automated CE (MiniCap Flex Piercing, Sebia, France and IA (Tina-quant HbA1c Gen 2, Cobas Integra 400+, Roche Diagnostics, USA procedures. Results: The total imprecision of Tosoh HLC-723GX-HbA1c for IFCC(mmol/mol and NGSP(% units was: 1.91/1.25% (HbA1c=31 mmol/mol/5.0% and 0.51/0.63% (HbA1c=84 mmol/mol/9.8% for C-QC, and 0.39/0.2% (HbA1c=47 mmol/mol/6.5% and 0.77/0.46% (HbA1c=94 mmol/mol/10.8% in HWB samples, respectively. Bland-Altman analysis did not reveal any deviation of the results between Tosoh HLC-723GX and CE: mean difference 0.0% (95%CI: −0.02927 to 0.02653%, while the mean HbA1c difference against IA was −0.07% (95%CI: −0.1039 to −0.02765. At the selected HbA1c clinical decision level (48 mmol/mol/6,5%, six sigma analysis gave σ value of 3.91, within a desirable classification of performance. Conclusion: The analytical performance of the Tosoh HLC-723GX complies with the rigorous quality criteria for clinical use of HbA1c, with the results comparable to the CE procedure. Tosoh HLC-723GX provides a plausible analytical choice for reliable HbA1c measurement in low-volume laboratories. Keywords: HbA1c, Quality targets, Six sigma, Tosoh HLC-723GX analyzer

Tracing the Jet Contribution to the Mid-IR over the 2005 Outburst of GRO J1655-40 via Broadband Spectral Modeling

Science.gov (United States)

Migliari, S.; Tomsick, J. A.; Markoff, S.; Kalemci, E.; Bailyn, C. D.; Buxton, M.; Corbel, S; Fender, R. P.; Kaaret, P.

2007-01-01

We present new results from a multi-wavelength (radio/infrared/optical/X-ray) study of the black hole Xray binary GRO 51655-40 during its 2005 outburst. We detected, for the first time, mid-infrared emission at 24 micron from the compact jet of a black hole X-ray binary during its hard state, when the source shows emission from a radio compact jet, as well as a strong non-thermal hard X-ray component. These detections strongly constrain the optically thick part of the synchrotron spectrum of the compact jet, which is consistent with it being flat over 4 orders of magnitude in frequency. Moreover, using this unprecedented coverage, and especially thanks to the new Spitzer observations, we can test broadband disk and jet models during the hard state. Two of the hard-state broadband spectra are reasonably well fitted using a jet model with parameters that overall are similar to those previously found for Cyg X-1 and GX 339-4. Differences are also present; most notably, the jet power in GRO J1655-40 appears to be a factor of at least approximately 3-5 higher (depending on the distance) than those of Cyg X-1 and GX-339-4 at comparable disk luminosities. Furthermore, a few discrepancies between the model and the data, previously not found for the other two black hole systems for which there was no mid-IR/IR and optical coverage, are evident, and will help to constrain and refine theoretical models.

9 CFR 3.39 - Care in transit.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Care in transit. 3.39 Section 3.39 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of Guinea...

Temperature-dependent thermal and thermoelectric properties of n -type and p -type S c1 -xM gxN

Science.gov (United States)

Saha, Bivas; Perez-Taborda, Jaime Andres; Bahk, Je-Hyeong; Koh, Yee Rui; Shakouri, Ali; Martin-Gonzalez, Marisol; Sands, Timothy D.

2018-02-01

Scandium Nitride (ScN) is an emerging rocksalt semiconductor with octahedral coordination and an indirect bandgap. ScN has attracted significant attention in recent years for its potential thermoelectric applications, as a component material in epitaxial metal/semiconductor superlattices, and as a substrate for defect-free GaN growth. Sputter-deposited ScN thin films are highly degenerate n -type semiconductors and exhibit a large thermoelectric power factor of ˜3.5 ×10-3W /m -K2 at 600-800 K. Since practical thermoelectric devices require both n- and p-type materials with high thermoelectric figures-of-merit, development and demonstration of highly efficient p-type ScN is extremely important. Recently, the authors have demonstrated p-type S c1 -xM gxN thin film alloys with low M gxNy mole-fractions within the ScN matrix. In this article, we demonstrate temperature dependent thermal and thermoelectric transport properties, including large thermoelectric power factors in both n- and p-type S c1 -xM gxN thin film alloys at high temperatures (up to 850 K). Employing a combination of temperature-dependent Seebeck coefficient, electrical conductivity, and thermal conductivity measurements, as well as detailed Boltzmann transport-based modeling analyses of the transport properties, we demonstrate that p-type S c1 -xM gxN thin film alloys exhibit a maximum thermoelectric power factor of ˜0.8 ×10-3W /m -K2 at 850 K. The thermoelectric properties are tunable by adjusting the M gxNy mole-fraction inside the ScN matrix, thereby shifting the Fermi energy in the alloy films from inside the conduction band in case of undoped n -type ScN to inside the valence band in highly hole-doped p -type S c1 -xM gxN thin film alloys. The thermal conductivities of both the n- and p-type films were found to be undesirably large for thermoelectric applications. Thus, future work should address strategies to reduce the thermal conductivity of S c1 -xM gxN thin-film alloys, without affecting

GxGrare: gene-gene interaction analysis method for rare variants from high-throughput sequencing data.

Science.gov (United States)

Kwon, Minseok; Leem, Sangseob; Yoon, Joon; Park, Taesung

2018-03-19

With the rapid advancement of array-based genotyping techniques, genome-wide association studies (GWAS) have successfully identified common genetic variants associated with common complex diseases. However, it has been shown that only a small proportion of the genetic etiology of complex diseases could be explained by the genetic factors identified from GWAS. This missing heritability could possibly be explained by gene-gene interaction (epistasis) and rare variants. There has been an exponential growth of gene-gene interaction analysis for common variants in terms of methodological developments and practical applications. Also, the recent advancement of high-throughput sequencing technologies makes it possible to conduct rare variant analysis. However, little progress has been made in gene-gene interaction analysis for rare variants. Here, we propose GxGrare which is a new gene-gene interaction method for the rare variants in the framework of the multifactor dimensionality reduction (MDR) analysis. The proposed method consists of three steps; 1) collapsing the rare variants, 2) MDR analysis for the collapsed rare variants, and 3) detect top candidate interaction pairs. GxGrare can be used for the detection of not only gene-gene interactions, but also interactions within a single gene. The proposed method is illustrated with 1080 whole exome sequencing data of the Korean population in order to identify causal gene-gene interaction for rare variants for type 2 diabetes. The proposed GxGrare performs well for gene-gene interaction detection with collapsing of rare variants. GxGrare is available at http://bibs.snu.ac.kr/software/gxgrare which contains simulation data and documentation. Supported operating systems include Linux and OS X.

5 CFR 339.302 - Authority to offer examinations.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority to offer examinations. 339.302... QUALIFICATION DETERMINATIONS Medical Examinations § 339.302 Authority to offer examinations. An agency may, at its option, offer a medical examination (including a psychiatric evaluation) in any situation where...

Relativistic jets from accreting black holes

International Nuclear Information System (INIS)

Coriat, Mickael

2010-01-01

Matter ejection processes, more commonly called jets, are among the most ubiquitous phenomena of the universe at ail scales of size and energy and are inseparable from accretion process. This intimate link, still poorly understood, is the main focus of this thesis. Through multi-wavelength observations of X-ray binary Systems hosting a black hole, I will try to bring new constraints on the physics of relativistic jets and the accretion - ejection coupling. We strive first to compare the simultaneous infrared, optical and X-ray emissions of the binary GX 339-4 over a period of five years. We study the nature of the central accretion flow, one of the least understood emission components of X-ray binaries, both in its geometry and in term of the physical processes that take place. This component is fundamental since it is could be the jets launching area or be highly connected to it. Then we focus on the infrared emission of the jets to investigate the physical conditions close to the jets base. We finally study the influence of irradiation of the outer accretion disc by the central X-ray source. Then, we present the results of a long-term radio and X-ray study of the micro-quasar H1743- 322. This System belongs to a population of accreting black holes that display, for a given X-ray luminosity, a radio emission fainter than expected. We make several assumptions about the physical origin of this phenomenon and show in particular that these sources could have a radiatively efficient central accretion flow. We finally explore the phases of return to the hard state of GX 339-4. We follow the re-emergence of the compact jets emission and try to bring new constraints on the physics of jet formation. (author) [fr

49 CFR 350.339 - What are tolerance guidelines?

Science.gov (United States)

2010-10-01

... 49 Transportation 5 2010-10-01 2010-10-01 false What are tolerance guidelines? 350.339 Section 350... MOTOR CARRIER SAFETY ASSISTANCE PROGRAM Funding § 350.339 What are tolerance guidelines? Tolerance guidelines set forth the limited deviations from the FMCSRs allowed in your State's laws and regulations...

Gene-by-social-environment interaction (GxSE) between ADCYAP1R1 genotype and neighborhood crime predicts major depression symptoms in trauma-exposed women.

Science.gov (United States)

Lowe, Sarah R; Pothen, John; Quinn, James W; Rundle, Andrew; Bradley, Bekh; Galea, Sandro; Ressler, Kerry J; Koenen, Karestan C

2015-11-15

Few studies have explored interactions between genes and social environmental exposures (GxSEs) for trauma-related psychopathology, including symptoms of posttraumatic stress (PTS) and major depression (MD). The extant literature suggests the possibility of a GxSE between the rs2267735 variant of the ADCYAP1R1 gene and neighborhood crime. The current study aimed to explore this possibility among a predominantly African American sample of trauma-exposed women. Female participants (N=1361) were recruited from a public hospital, and completed measures of PTS and MD symptoms and provided DNA samples. Participants' home addresses were mapped onto 300 neighborhoods (2010 census tracts), and data on crime within neighborhoods was collected. Multilevel models detected a significant GxSE between rs2267735 and neighborhood crime for MD symptoms (p=.01). Having two copies of the risk (C) allele was associated with higher MD symptoms for participants living in high-crime neighborhoods. At least six limitations are noteworthy: (1) low statistical power; (2) use of self-report symptom inventories; (3) lack of information on symptom onset; (4) homogeneous sample from a single metropolitan area; (5) non-specific index of crime; and (6) use of census tracts to define neighborhoods. The results provide further evidence of GxSEs for psychiatric outcomes among trauma-exposed populations. Further investigations of genetic factors for trauma-related psychopathology should include careful assessments of the social environment. Copyright © 2015 Elsevier B.V. All rights reserved.

Two-phase X-ray burst from GX 3+1 observed by INTEGRAL

DEFF Research Database (Denmark)

Chenevez, Jérôme; Falanga, M.F.; Brandt, Søren

2006-01-01

INTEGRAL detected on August 31, 2004, an unusual thermonuclear X-ray burst from the low-mass X-ray binary GX 3 3+1. Its duration was 30 min, which is between the normal burst durations for this source (less than or similar to 10 s) and the superburst observed in 1998 ( several hours). We see...... emission up to 30 keV energy during the first few seconds of the burst where the bolometric peak luminosity approaches the Eddington limit. This peculiar burst is characterized by two distinct phases: an initial short spike of similar to 6 s consistent with being similar to a normal type I X-ray burst...... in the present case); and 3) limited carbon burning at an unusually shallow depth triggered by unstable helium ignition. Though none of these provide a satisfactory description of this uncommon event, the former one seems the most probable....

ANTI-CORRELATED TIME LAGS IN THE Z SOURCE GX 5-1: POSSIBLE EVIDENCE FOR A TRUNCATED ACCRETION DISK

Energy Technology Data Exchange (ETDEWEB)

Sriram, K.; Choi, C. S. [Korea Astronomy and Space Science Institute, Daejeon 305-348 (Korea, Republic of); Rao, A. R., E-mail: astrosriram@yahoo.co.in [Tata Institute of Fundamental Research, Mumbai 400005 (India)

2012-06-01

We investigate the nature of the inner accretion disk in the neutron star source GX 5-1 by making a detailed study of time lags between X-rays of different energies. Using the cross-correlation analysis, we found anti-correlated hard and soft time lags of the order of a few tens to a few hundred seconds and the corresponding intensity states were mostly the horizontal branch (HB) and upper normal branch. The model independent and dependent spectral analysis showed that during these time lags the structure of the accretion disk significantly varied. Both eastern and western approaches were used to unfold the X-ray continuum and systematic changes were observed in soft and hard spectral components. These changes along with a systematic shift in the frequency of quasi-periodic oscillations (QPOs) made it substantially evident that the geometry of the accretion disk is truncated. Simultaneous energy spectral and power density spectral study shows that the production of the horizontal branch oscillations (HBOs) is closely related to the Comptonizing region rather than the disk component in the accretion disk. We found that as the HBO frequency decreases from the hard apex to upper HB, the disk temperature increases along with an increase in the coronal temperature, which is in sharp contrast with the changes found in black hole binaries where the decrease in the QPO frequency is accompanied by a decrease in the disk temperature and a simultaneous increase in the coronal temperature. We discuss the results in the context of re-condensation of coronal material in the inner region of the disk.

48 CFR 339.7102 - Applicability.

Science.gov (United States)

2010-10-01

... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Information Security Management 339.7102 Applicability. Contracting Officers are responsible for ensuring that all information technology acquisitions comply with the Federal Information Security Management Act (FISMA), the HHS-OCIO Information Systems Security and Privacy...

48 CFR 339.7101 - Policy.

Science.gov (United States)

2010-10-01

... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Information Security Management 339.7101 Policy. HHS is responsible for implementing an information security program to ensure that its information systems and... information contained in those systems. Each system's level of security shall protect the integrity...

Is there a highly magnetized neutron star in GX 301-2?

Science.gov (United States)

Doroshenko, V.; Santangelo, A.; Suleimanov, V.; Kreykenbohm, I.; Staubert, R.; Ferrigno, C.; Klochkov, D.

2010-06-01

We present the results of an in-depth study of the long-period X-ray pulsar GX 301-2. Using archival data of INTEGRAL, RXTE ASM, and CGRO BATSE, we study the spectral and timing properties of the source. Comparison of our timing results with previously published work reveals a secular decay of the orbital period at a rate of ≃ - 3.25 × 10-5 d yr-1, which is an order of magnitude faster than for other known systems. We argue that this is probably result either of the apsidal motion or of gravitational coupling of the matter lost by the optical companion with the neutron star, although current observations do not allow us to distinguish between those possibilities. We also propose a model to explain the observed long pulse period. We find that a very strong magnetic field B ~ 1014 G can explain the observed pulse period in the framework of existing models for torques affecting the neutron star. We show that the apparent contradiction with the magnetic field strength BCRSF ~ 4 × 1012 G derived from the observed cyclotron line position may be resolved if the line formation region resides in a tall accretion column of height ~2.5-3 RNS. The color temperature measured from the spectrum suggests that such a column may indeed be present, and our estimates show that its height is sufficient to explain the observed cyclotron line position.

Genotype by sex and genotype by age interactions with sedentary behavior: the Portuguese Healthy Family Study.

Directory of Open Access Journals (Sweden)

Daniel M V Santos

Full Text Available Sedentary behavior (SB expression and its underlying causal factors have been progressively studied, as it is a major determinant of decreased health quality. In the present study we applied Genotype x Age (GxAge and Genotype x Sex (GxSex interaction methods to determine if the phenotypic expression of different SB traits is influenced by an interaction between genetic architecture and both age and sex. A total of 1345 subjects, comprising 249 fathers, 327 mothers, 334 sons and 325 daughters, from 339 families of The Portuguese Healthy Family Study were included in the analysis. SB traits were assessed by means of a 3-d physical activity recall, the Baecke and IPAQ questionnaires. GxAge and GxSex interactions were analyzed using SOLAR 4.0 software. Sedentary behaviour heritability estimates were not always statistically significant (p>0.05 and ranged from 3% to 27%. The GxSex and GxAge interaction models were significantly better than the single polygenic models for TV (min/day, EEsed (kcal/day, personal computer (PC usage and physical activty (PA tertiles. The GxAge model is also significantly better than the polygenic model for Sed (min/day. For EEsed, PA tertiles, PC and Sed, the GxAge interaction was significant because the genetic correlation between SB environments was significantly different from 1. Further, PC and Sed variance heterogeneity among distinct ages were observed. The GxSex interaction was significant for EEsed due to genetic variance heterogeneity between genders and for PC due to a genetic correlation less than 1 across both sexes. Our results suggest that SB expression may be influenced by the interactions between genotype with both sex and age. Further, different sedentary behaviors seem to have distinct genetic architectures and are differentially affected by age and sex.

GX1-conjugated poly(lactic acid nanoparticles encapsulating Endostar for improved in vivo anticolorectal cancer treatment

Directory of Open Access Journals (Sweden)

Du Y

2015-05-01

Full Text Available Yang Du,1,* Qian Zhang,1,* Lijia Jing,2 Xiaolong Liang,2 Chongwei Chi,1 Yaqian Li,1 Xin Yang,1 Zhifei Dai,2 Jie Tian1 1Key Laboratory of Molecular Imaging, The State Key Laboratory of Management and Control for Complex Systems, Institute of Automation, Chinese Academy of Sciences, Beijing, People’s Republic of China; 2Department of Biomedical Engineering, College of Engineering, Peking University, Beijing People’s Republic of China *These authors contributed equally to this work Abstract: Tumor angiogenesis plays a key role in tumor growth and metastasis; thus, targeting tumor-associated angiogenesis is an important goal in cancer therapy. However, the efficient delivery of drugs to tumors remains a key issue in antiangiogenesis therapy. GX1, a peptide identified by phage-display technology, is a novel tumor vasculature endothelium-specific ligand and possesses great potential as a targeted vector and antiangiogenic agent in the diagnosis and treatment of human cancers. Endostar, a novel recombinant human endostatin, has been shown to inhibit tumor angiogenesis. In this study, we developed a theranostic agent composed of GX1-conjugated poly(lactic acid nanoparticles encapsulating Endostar (GPENs and labeled with the near-infrared dye IRDye 800CW to improve colorectal tumor targeting and treatment efficacy in vivo. The in vivo fluorescence molecular imaging data showed that GPENs (IRDye 800CW more specifically targeted tumors than free IRDye 800CW in colorectal tumor-bearing mice. Moreover, the antitumor efficacy was evaluated by bioluminescence imaging and immunohistology, revealing that GPENs possessed improved antitumor efficacy on subcutaneous colorectal xenografts compared to other treatment groups. Thus, our study showed that GPENs, a novel GX1 peptide guided form of nanoscale Endostar, can be used as a theranostic agent to facilitate more efficient targeted therapy and enable real-time monitoring of therapeutic efficacy in vivo

Genotype by Environment Interactions in Cognitive Ability: A Survey of 14 Studies from 4 Countries covering 4 Age Groups

Science.gov (United States)

Molenaar, Dylan; van der Sluis, Sophie; Boomsma, Dorret I.; Haworth, Claire M. A.; Hewitt, John K.; Martin, Nicholas G.; Plomin, Robert; Wright, Margie J.; Dolan, Conor V.

2014-01-01

A large part of the variation in cognitive ability is known to be due to genetic factors. Researchers have tried to identify modifiers that influence the heritability of cognitive ability, indicating a genotype by environment interaction (GxE). To date, such modifiers include measured variables like income and socioeconomic status. The present paper focuses on GxE in cognitive ability where the environmental variable is an unmeasured environmental factor that is uncorrelated in family members. We examined this type of GxE in the GHCA-database (Haworth et al., 2009), which comprises data of 14 different cognition studies from 4 different countries including participants of different ages. Results indicate that for younger participants (4–13 years), the strength of E decreases across the additive genetic factor A, but that this effect reverts for older participants (17–34 years). However, a clear and general conclusion about the presence of a genuine GxE is hampered by differences between the individual studies with respect to environmental and genetic influences on cognitive ability. PMID:23397253

31 CFR 339.1 - Definitions of words and terms as used in this circular.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definitions of words and terms as used in this circular. 339.1 Section 339.1 Money and Finance: Treasury Regulations Relating to Money... OFFERING OF UNITED STATES SAVINGS BONDS, SERIES H § 339.1 Definitions of words and terms as used in this...

INTEGRAL hard X-ray detection of HMXB GX 304-1 and H1417-624

DEFF Research Database (Denmark)

Manousakis, A.; Beckmann, V.; Bianchin, V.

2008-01-01

We report on the first detection of the Be star HMXBs GX 304-1 and H1417-624 above 20 keV with the IBIS/ISGRI X-ray imager on board INTEGRAL. From 2008-06-24 to 2008-07-09, INTEGRAL performed monitoring observations of the Galactic plane around l=305 degrees for a total exposure time of 352 ksec....

THE HOST GALAXY OF THE SUPER-LUMINOUS SN 2010gx AND LIMITS ON EXPLOSIVE 56Ni PRODUCTION

International Nuclear Information System (INIS)

Chen, Ting-Wan; Smartt, Stephen J.; Kotak, Rubina; McCrum, Matt; Fraser, Morgan; Bresolin, Fabio; Kudritzki, Rolf-Peter; Pastorello, Andrea; Valenti, Stefano

2013-01-01

Super-luminous supernovae have a tendency to occur in faint host galaxies which are likely to have low mass and low metallicity. While these extremely luminous explosions have been observed from z = 0.1 to 1.55, the closest explosions allow more detailed investigations of their host galaxies. We present a detailed analysis of the host galaxy of SN 2010gx (z = 0.23), one of the best studied super-luminous type Ic supernovae. The host is a dwarf galaxy (M g = –17.42 ± 0.17) with a high specific star formation rate. It has a remarkably low metallicity of 12 + log (O/H) = 7.5 ± 0.1 dex as determined from the detection of the [O III] λ4363 line. This is the first reliable metallicity determination of a super-luminous stripped-envelope supernova host. We collected deep multi-epoch imaging with Gemini + GMOS between 240 and 560 days after explosion to search for any sign of radioactive 56 Ni, which might provide further insights on the explosion mechanism and the progenitor's nature. We reach griz magnitudes of m AB ∼ 26, but do not detect SN 2010gx at these epochs. The limit implies that any 56 Ni production was similar to or below that of SN 1998bw (a luminous type Ic SN that produced around 0.4 M ☉ of 56 Ni). The low volumetric rates of these supernovae (∼10 –4 of the core-collapse population) could be qualitatively matched if the explosion mechanism requires a combination of low-metallicity (below 0.2 Z ☉ ), high progenitor mass (>60 M ☉ ) and high rotation rate (fastest 10% of rotators).

Phenotype abnormality: 339 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 339 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u844i increased number of inflore...scence in organ named whole plant ... whole plant ... present in greater numbers in organism ... inflorescence ...

miR-339-5p inhibits alcohol-induced brain inflammation through regulating NF-κB pathway

International Nuclear Information System (INIS)

Zhang, Yu; Wei, Guangkuan; Di, Zhiyong; Zhao, Qingjie

2014-01-01

Graphical abstract: - Highlights: • Alcohol upregulates miR-339-5p expression. • miR-339-5p inhibits the NF-kB pathway. • miR-339-5p interacts with and blocks activity of IKK-beat and IKK-epsilon. • miR-339-5p modulates IL-1β, IL-6 and TNF-α. - Abstract: Alcohol-induced neuroinflammation is mediated by the innate immunesystem. Pro-inflammatory responses to alcohol are modulated by miRNAs. The miRNA miR-339-5p has previously been found to be upregulated in alcohol-induced neuroinflammation. However, little has been elucidated on the regulatory functions of this miRNA in alcohol-induced neuroinflammation. We investigated the function of miR-339-5p in alcohol exposed brain tissue and isolated microglial cells using ex vivo and in vitro techniques. Our results show that alcohol induces transcription of miR 339-5p, IL-6, IL-1β and TNF-α in mouse brain tissue and isolated microglial cells by activating NF-κB. Alcohol activation of NF-κB allows for nuclear translocation of the NF-κB subunit p65 and expression of pro-inflammatory mediators. miR-339-5p inhibited expression of these pro-inflammatory factors through the NF-κB pathway by abolishing IKK-β and IKK-ε activity

miR-339-5p inhibits alcohol-induced brain inflammation through regulating NF-κB pathway

Energy Technology Data Exchange (ETDEWEB)

Zhang, Yu [Department of Neurology, The First Affiliated School of Harbin Medical University, Harbin 150001 (China); Wei, Guangkuan [Department of Neurology, Heilongjiang Provincial Hospital, Harbin 150036 (China); Di, Zhiyong [Department of Laboratory, Heilongjiang Provincial Hospital, Harbin 150036 (China); Zhao, Qingjie, E-mail: zhaoqingjie2013@163.com [Department of Neurology, The First Affiliated School of Harbin Medical University, Harbin 150001 (China)

2014-09-26

Graphical abstract: - Highlights: • Alcohol upregulates miR-339-5p expression. • miR-339-5p inhibits the NF-kB pathway. • miR-339-5p interacts with and blocks activity of IKK-beat and IKK-epsilon. • miR-339-5p modulates IL-1β, IL-6 and TNF-α. - Abstract: Alcohol-induced neuroinflammation is mediated by the innate immunesystem. Pro-inflammatory responses to alcohol are modulated by miRNAs. The miRNA miR-339-5p has previously been found to be upregulated in alcohol-induced neuroinflammation. However, little has been elucidated on the regulatory functions of this miRNA in alcohol-induced neuroinflammation. We investigated the function of miR-339-5p in alcohol exposed brain tissue and isolated microglial cells using ex vivo and in vitro techniques. Our results show that alcohol induces transcription of miR 339-5p, IL-6, IL-1β and TNF-α in mouse brain tissue and isolated microglial cells by activating NF-κB. Alcohol activation of NF-κB allows for nuclear translocation of the NF-κB subunit p65 and expression of pro-inflammatory mediators. miR-339-5p inhibited expression of these pro-inflammatory factors through the NF-κB pathway by abolishing IKK-β and IKK-ε activity.

Bounds on the degree of APN polynomials: the case of x −1 + g(x)

DEFF Research Database (Denmark)

Leander, Gregor; Rodier, François

2011-01-01

In this paper we consider APN functions $${f:\\mathcal{F}_{2^m}\\to \\mathcal{F}_{2^m}}$$ of the form f(x) = x −1 + g(x) where g is any non $${\\mathcal{F}_{2}}$$-affine polynomial. We prove a lower bound on the degree of the polynomial g. This bound in particular implies that such a function f is AP...

NuSTAR Observations of Fermi-detected Novae, V339 Delphini and V5668 Sagitarii

Science.gov (United States)

Mukai, K.; Nelson, T.; Sokoloski, J.; Chomiuk, L.; Finzell, T.; Linford, J.; Weston, J.; Rupen, M.; Mioduszewski, A.

2017-10-01

Ten Galactic novae have been detected as transient GeV gamma-ray sources with Fermi/LAT to date, presumably due to shock acceleration that produces relativistic particles. This unexpected discovery highlights the complexity of the mass ejection process in novae. It has also added a new class of objects in which particle acceleration can be studied. We can in principle study the same shock in X-rays through their thermal emission and the lower energy extension of the non-thermal emission. Here we present our NuSTAR observations of two Fermi-detected novae, V339 Del and V5668 Sgr, that were carried out while they were being detected with the LAT. We did not detect thermal or non-thermal emissions from these novae. Our results place a tight limit on the properties of the putative shocks in V339 Del and V5668 Sgr. We also compare our results with previous reports of possible detection of non-thermal hard X-rays from novae, and discuss the implications in the context of our current understanding of the complicated process of mass ejection in novae.

Truncation of the Inner Accretion Disk Around a Black Hole at Low Luminosity

Science.gov (United States)

Tomsick, John A.; Yamoka, Kazutaka; Corbel, Stephane; Kaaret, Philip; Kalemci, Emrah; Migliari, Simone

2011-01-01

Most black hole binaries show large changes in X-ray luminosity caused primarily by variations in mass accretion rate. An important question for understanding black hole accretion and jet production is whether the inner edge of the accretion disk recedes at low accretion rate. Measurements of the location of the inner edge (R(sub in)) can be made using iron emission lines that arise due to fluorescence of iron in the disk, and these indicate that R(sub in) is very close to the black hole at high and moderate luminosities (greater than or equal to 1% of the Eddington luminosity, L(sub Edd). Here, we report on X-ray observations of the black hole GX 339-4 in the hard state by Suzaku and the Rossi X-ray Timing Explorer that extend iron line studies to 0.14% L(sub Edd) and show that R(sub in) increases by a factor of greater than 27 over the value found when GX 339-4 was bright. The exact value of R(sub in) depends on the inclination of the inner disk (i), and we derive 90% confidence limits of R(sub in) greater than 35 R(sub g) at i = 0 degrees and R(sub in) greater than 175 R(sub g) at i = 30 degrees. This provides direct evidence that the inner portion of the disk is not present at low luminosity, allowing for the possibility that the inner disk is replaced by advection- or magnetically dominated accretion flows.

Spectral State Evolution of 4U 1820-30: the Stability of the Spectral Index of Comptonization Tail

Science.gov (United States)

Titarchuk, Lev G.; Seifina, Elena; Frontera, Filippo

2013-01-01

We analyze the X-ray spectra and their timing properties of the compact Xray binary 4U 1820-30. We establish spectral transitions in this source seen with BeppoSAX and the Rossi X-ray Timing Explorer (RXTE). During the RXTE observations (1996 - 2009), the source were approximately approximately 75% of its time in the soft state making the lower banana and upper banana transitions combined with long-term low-high state transitions. We reveal that all of the X-ray spectra of 4U 1820-30 are fit by a composition of a thermal (blackbody) component, a Comptonization component (COMPTB) and a Gaussian-line component. Thus using this spectral analysis we find that the photon power-law index Gamma of the Comptonization component is almost unchangeable (Gamma approximately 2) while the electron temperature kTe changes from 2.9 to 21 keV during these spectral events. We also establish that for these spectral events the normalization of COMPTB component (which is proportional to mass accretion rate ?M) increases by factor 8 when kTe decreases from 21 keV to 2.9 keV. Before this index stability effect was also found analyzing X-ray data for Z-source GX 340+0 and for atolls, 4U 1728-34, GX 3+1. Thus, we can suggest that this spectral stability property is a spectral signature of an accreting neutron star source. On the other hand in a black hole binary G monotonically increases with ?Mand ultimately its value saturates at large ?M.

Rossi X-Ray Timing Explorer Observations of the First Transient Z Source XTE J1701-462: Shedding New Light on Mass Accretion in Luminous Neutron Star X-Ray Binaries

Science.gov (United States)

Homan, Jeroen; van der Klis, Michiel; Wijnands, Rudy; Belloni, Tomaso; Fender, Rob; Klein-Wolt, Marc; Casella, Piergiorgio; Méndez, Mariano; Gallo, Elena; Lewin, Walter H. G.; Gehrels, Neil

2007-02-01

We report on the first 10 weeks of RXTE observations of the X-ray transient XTE J1701-462 and conclude that it had all the characteristics of the neutron star Z sources, i.e., the brightest persistent neutron star low-mass X-ray binaries. These include the typical Z-shaped tracks traced out in X-ray color diagrams and the variability components detected in the power spectra, such as kHz QPOs and normal and horizontal branch oscillations. XTE J1701-462 is the first transient Z source and provides unique insights into mass accretion rate (m˙) and luminosity dependencies in neutron star X-ray binaries. As its overall luminosity decreased, we observed a switch between two types of Z source behavior, with the branches of the Z track changing their shape and/or orientation. We interpret this as an extreme case of the more moderate long-term changes seen in the persistent Z sources and suggest that they result from changes in m˙. We also suggest that the Cyg-like Z sources (Cyg X-2, GX 5-1, and GX 340+0) are substantially more luminous (>50%) than the Sco-like Z sources (Sco X-1, GX 17+2, and GX 349+2). Adopting a possible explanation for the behavior of kHz QPOs, which involves a prompt as well as a filtered response to changes in m˙, we further propose that changes in m˙ can explain both movement along the Z track and changes in the shape of the Z track. We discuss some consequences of this and consider the possibility that the branches of the Z will smoothly evolve into the branches observed in X-ray color diagrams of the less luminous atoll sources, although not in a way that was previously suggested.

M. I. T. studies of transient X-ray phenomena

Energy Technology Data Exchange (ETDEWEB)

Canizares, C R [Massachusetts Inst. of Tech., Cambridge (USA). Dept. of Physics

1976-06-01

A variety of transient X-ray phenomena have been studied by the M.I.T. X-ray Astronomy Group. Data from the OSO-7 satellite reveal both long and short time-scale transients. Extensive observations have been made of the Lupus X-ray Nova (3U1543-47) and of GX339-4 (MX1658-48) which may represent a very different type of transient source. A unique, intense X-ray flare lasting ten minutes was also recorded, and the X-ray emission from the active galaxy Cen A was found to vary significantly over a period of several days. In a recent balloon flight the Crab pulsar, NP0532, was observed to exhibit a transient pulsed component distinct from the usual main pulse and interpulse. A sounding-rocket experiment detected an ultrasoft transient X-ray source tentatively associated with SS Cygni, and preliminary results from SAS-3 show a very hard spectrum for the new source A0535+26. On the other hand, extensive OSO-7 null observations of both Type I and II supernovae and of the flaring radio star Algol make it unlikely that these types of objects are potent transient X-ray emitters.

Two-dimensional transport of dust from an infinite line source at ground level: non-zero roughness height

International Nuclear Information System (INIS)

Hassan, M.H.A.; Eltayeb, I.A.

1992-07-01

The previous study (Eltayeb and Hassan, 1992) of the two-dimensional diffusion equation of dust over a rough ground surface, which acts as a dust source of variable strength, under the influence of horizontal wind and gravitational attraction is here extended to all finite values of the roughness height Z 0 . An analytic expression is obtained for the concentration of dust for a general strength of the source. The result reduces to the previously known solutions as special cases. The expression for the concentration has been evaluated for some representative example of the source strength g(X). It is found that the concentration decreases with roughness height at any fixed point above ground level. (author). 4 refs, 2 figs

The variable cyclotron line of GX 301-2

Energy Technology Data Exchange (ETDEWEB)

Kreykenbohm, I.; Wilms, J.; Coburn, W.; Kuster, M.; Rothschild, R.E.; Heindl, W.A.; Kretschmar, P.; Staubert, R

2004-06-01

We present a 200 ksec observation of the High Mass X-ray Binary GX 301-2 taken in 2000 November with the Rossi X-ray Timing Explorer during the pre-periastron flare and the actual periastron passage of the neutron star. To model the spectrum we use a power law with the Fermi Dirac cutoff and a cyclotron line at higher energies plus either a reflection component or a heavily absorbed partial covering component. Although completely different, both models describe the data equally well. Phase resolved spectra show that the energy and the depth of the cyclotron resonant scattering feature vary strongly with pulse phase: It is deepest in the fall of the main pulse, the rise of the secondary pulse, and the pulse minimum in-between with {tau}{sub C}{approx}0.3. In the other phase bins the line is much less deep with {tau}{sub C}{approx}0.1. The energy of the line correlates strongly with its depth and varies by 25 % from 30.1 keV in the fall of the secondary pulse to 37.9 keV in the fall of the main pulse.

Characteristics of centrifugally cast GX25CrNiSi18-9 steel

Directory of Open Access Journals (Sweden)

R. Zapała

2011-07-01

Full Text Available The paper presents the results of microstructural examinations of the industrial heat-resistant centrifugally cast GX25CrNiSi18-9 steel characterised by increased content of Cu. The study included changes in the microstructure of base cast steel respective of the steel held at a temperature of 900 and 950°C for 48 hours. Based on the results obtained, an increase in microhardness of the examined cast steel matrix with increasing temperature was stated, which was probably caused by fine precipitates enriched in Cr, Mo, and C forming inside the matrix grains.The layer of scale formed on the tested cast steel oxidised in the atmosphere of air at 900 and 950°C was characterised by an increased tendency to degradation with increasing temperature of the conducted tests.

Several tetratricopeptide repeat (TPR) motifs of FANCG are required for assembly of the BRCA2/D1-D2-G-X3 complex, FANCD2 monoubiquitylation and phleomycin resistance

International Nuclear Information System (INIS)

Wilson, James B.; Blom, Eric; Cunningham, Ryan; Xiao, Yuxuan; Kupfer, Gary M.; Jones, Nigel J.

2010-01-01

The Fanconi anaemia (FA) FANCG protein is an integral component of the FA nuclear core complex that is required for monoubiquitylation of FANCD2. FANCG is also part of another protein complex termed D1-D2-G-X3 that contains FANCD2 and the homologous recombination repair proteins BRCA2 (FANCD1) and XRCC3. Formation of the D1-D2-G-X3 complex is mediated by serine-7 phosphorylation of FANCG and occurs independently of the FA core complex and FANCD2 monoubiquitylation. FANCG contains seven tetratricopeptide repeat (TPR) motifs that mediate protein-protein interactions and here we show that mutation of several of the TPR motifs at a conserved consensus residue ablates the in vivo binding activity of FANCG. Expression of mutated TPR1, TPR2, TPR5 and TPR6 in Chinese hamster fancg mutant NM3 fails to functionally complement its hypersensitivities to mitomycin C (MMC) and phleomycin and fails to restore FANCD2 monoubiquitylation. Using co-immunoprecipitation analysis, we demonstrate that these TPR-mutated FANCG proteins fail to interact with BRCA2, XRCC3, FANCA or FANCF. The interactions of other proteins in the D1-D2-G-X3 complex are also absent, including the interaction of BRCA2 with both the monoubiquitylated (FANCD2-L) and non-ubiquitylated (FANCD2-S) isoforms of FANCD2. Interestingly, a mutation of TPR7 (R563E), that complements the MMC and phleomycin hypersensitivity of human FA-G EUFA316 cells, fails to complement NM3, despite the mutated FANCG protein co-precipitating with FANCA, BRCA2 and XRCC3. Whilst interaction of TPR7-mutated FANCG with FANCF does appear to be reduced in NM3, FANCD2 is monoubiquitylated suggesting that sub-optimal interactions of FANCG in the core complex and the D1-D2-G-X3 complex are responsible for the observed MMC- and phleomycin-hypersensitivity, rather than a defect in FANCD2 monoubiquitylation. Our data demonstrate that FANCG functions as a mediator of protein-protein interactions and is vital for the assembly of multi-protein complexes

Several tetratricopeptide repeat (TPR) motifs of FANCG are required for assembly of the BRCA2/D1-D2-G-X3 complex, FANCD2 monoubiquitylation and phleomycin resistance

Energy Technology Data Exchange (ETDEWEB)

Wilson, James B. [Molecular Oncology and Stem Cell Research Group, School of Biological Sciences, University of Liverpool, Biosciences Building, Crown Street, Liverpool L69 7ZB (United Kingdom); Blom, Eric [Department of Clinical Genetics and Human Genetics, VU University Medical Center, Van der Boechorststraat 7, NL-1081 BT Amsterdam (Netherlands); Cunningham, Ryan; Xiao, Yuxuan [Molecular Oncology and Stem Cell Research Group, School of Biological Sciences, University of Liverpool, Biosciences Building, Crown Street, Liverpool L69 7ZB (United Kingdom); Kupfer, Gary M. [Departments of Pediatrics and Pathology, Yale University School of Medicine, Section of Hematology/Oncology, 333 Cedar Street, New Haven, CT 0652 (United States); Jones, Nigel J., E-mail: njjones@liv.ac.uk [Molecular Oncology and Stem Cell Research Group, School of Biological Sciences, University of Liverpool, Biosciences Building, Crown Street, Liverpool L69 7ZB (United Kingdom)

2010-07-07

The Fanconi anaemia (FA) FANCG protein is an integral component of the FA nuclear core complex that is required for monoubiquitylation of FANCD2. FANCG is also part of another protein complex termed D1-D2-G-X3 that contains FANCD2 and the homologous recombination repair proteins BRCA2 (FANCD1) and XRCC3. Formation of the D1-D2-G-X3 complex is mediated by serine-7 phosphorylation of FANCG and occurs independently of the FA core complex and FANCD2 monoubiquitylation. FANCG contains seven tetratricopeptide repeat (TPR) motifs that mediate protein-protein interactions and here we show that mutation of several of the TPR motifs at a conserved consensus residue ablates the in vivo binding activity of FANCG. Expression of mutated TPR1, TPR2, TPR5 and TPR6 in Chinese hamster fancg mutant NM3 fails to functionally complement its hypersensitivities to mitomycin C (MMC) and phleomycin and fails to restore FANCD2 monoubiquitylation. Using co-immunoprecipitation analysis, we demonstrate that these TPR-mutated FANCG proteins fail to interact with BRCA2, XRCC3, FANCA or FANCF. The interactions of other proteins in the D1-D2-G-X3 complex are also absent, including the interaction of BRCA2 with both the monoubiquitylated (FANCD2-L) and non-ubiquitylated (FANCD2-S) isoforms of FANCD2. Interestingly, a mutation of TPR7 (R563E), that complements the MMC and phleomycin hypersensitivity of human FA-G EUFA316 cells, fails to complement NM3, despite the mutated FANCG protein co-precipitating with FANCA, BRCA2 and XRCC3. Whilst interaction of TPR7-mutated FANCG with FANCF does appear to be reduced in NM3, FANCD2 is monoubiquitylated suggesting that sub-optimal interactions of FANCG in the core complex and the D1-D2-G-X3 complex are responsible for the observed MMC- and phleomycin-hypersensitivity, rather than a defect in FANCD2 monoubiquitylation. Our data demonstrate that FANCG functions as a mediator of protein-protein interactions and is vital for the assembly of multi-protein complexes

BROADBAND SPECTROSCOPY USING TWO SUZAKU OBSERVATIONS OF THE HMXB GX 301-2

Energy Technology Data Exchange (ETDEWEB)

Suchy, Slawomir; Markowitz, Alex; Rothschild, Richard E. [Center for Astrophysics and Space Sciences, University of California, San Diego, 9500 Gilman Dr., La Jolla, CA 92093-0424 (United States); Fuerst, Felix; Kreykenbohm, Ingo; Wilms, Joern [Dr. Karl Remeis Sternwarte and Erlangen Center for Astroparticle Physics, Sternwartstr. 7, 96049 Bamberg (Germany); Pottschmidt, Katja [Center for Space Science and Technology, University of Maryland Baltimore County, 1000 Hilltop Circle, Baltimore, MD 21250 (United States); Caballero, Isabel, E-mail: ssuchy@ucsd.edu [CEA Saclay, DSM/IRFU/SAp-UMR AIM (7158), CNRS/CEA, University Paris 7, Diderot, Gif sur Yvette (France)

2012-02-01

We present the analysis of two Suzaku observations of GX 301-2 at two orbital phases after the periastron passage. Variations in the column density of the line-of-sight absorber are observed, consistent with accretion from a clumpy wind. In addition to a cyclotron resonance scattering feature (CRSF), multiple fluorescence emission lines were detected in both observations. The variations in the pulse profiles and the CRSF throughout the pulse phase have a signature of a magnetic dipole field. Using a simple dipole model we calculated the expected magnetic field values for different pulse phases and were able to extract a set of geometrical angles, loosely constraining the dipole geometry in the neutron star. From the variation of the CRSF width and energy, we found a geometrical solution for the dipole, making the inclination consistent with previously published values.

MiR-339-5p inhibits breast cancer cell migration and invasion in vitro and may be a potential biomarker for breast cancer prognosis

International Nuclear Information System (INIS)

Wu, Zheng-sheng; Xu, Xiao-chun; Wu, Qiang; Wang, Chao-qun; Wang, Xiao-nan; Wang, Yan; Zhao, Jing-jing; Mao, Shan-shan; Zhang, Gui-hong; Zhang, Nong

2010-01-01

MicroRNAs (miRNAs) play an important role in the regulation of cell growth, differentiation, apoptosis, and carcinogenesis. Detection of their expression may lead to identifying novel markers for breast cancer. We profiled miRNA expression in three breast cancer cell lines (MCF-7, MDA-MB-231, and MDA-MB-468) and then focused on one miRNA, miR-339-5p, for its role in regulation of tumor cell growth, migration, and invasion and target gene expression. We then analyzed miR-339-5p expression in benign and cancerous breast tissue specimens. A number of miRNAs were differentially expressed in these cancer cell lines. Real-time PCR indicated that miR-339-5p expression was downregulated in the aggressive cell lines MDA-MB-468 and MDA-MB-231 and in breast cancer tissues compared with benign tissues. Transfection of miR-339-5p oligonucleotides reduced cancer cell growth only slightly but significantly decreased tumor cell migration and invasion capacity compared with controls. Real-time PCR analysis showed that BCL-6, a potential target gene of miR-339-5p, was downregulated in MDA-MB-231 cells by miR-339-5p transfection. Furthermore, the reduced miR-339-5p expression was associated with an increase in metastasis to lymph nodes and with high clinical stages. Kaplan-Meier analyses found that the patients with miR-339-5p expression had better overall and relapse-free survivals compared with those without miR-339-5p expression. Cox proportional hazards analyses showed that miR-339-5p expression was an independent prognostic factor for breast cancer patients. MiR-339-5p may play an important role in breast cancer progression, suggesting that miR-339-5p should be further evaluated as a biomarker for predicting the survival of breast cancer patients

X-ray scattering by interstellar dust

International Nuclear Information System (INIS)

Rolf, D.

1980-10-01

This thesis reports work carried out to make a first observation of x-rays scattered by interstellar dust grains. Data about the dust, obtained at wavelengths ranging from the infrared to ultra-violet spectral regions, are discussed in order to establish a useful description of the grains themselves. This is then used to estimate the magnitude and form of the expected x-ray scattering effect which is shown to manifest itself as a diffuse halo accompanying the image of a celestial x-ray source. Two x-ray imaging experiments are then discussed. The first, specifically proposed to look for this effect surrounding a point x-ray source, was the Skylark 1611 project, and comprised an imaging proportional counter coupled to an x-ray mirror. This is described up to its final calibration when the basis for a concise model of its point response function was established. The experiment was not carried out but its objective and the experience gained during its testing were transferred to the second of the x-ray imaging experiments, the Einstein Observatory. The new instrumental characteristics are described and a model for its point response function is developed. Using this, image data for the point x-ray source GX339-4 is shown to exhibit the sought after scattering phenomenon. (author)

Photoelectric UBVRI sequences in the Magellanic Cloud clusters Lindsay 1, NGC 339, NGC 361, and NGC 1466

International Nuclear Information System (INIS)

Alcaino, G.; Alvarado, F.; Wenderoth, E.; Liller, W.

1990-01-01

UBVRI sequences in three Small Magellanic Cloud (SMC) clusters Lindsay 1, NGC 339, NGC 361, and in NGC 1466, which lies between the two Magellanic Clouds, are presented. These sequences are appropriate for charge-coupled device (CCD) coverage. Only BV standards have been published in NGC 339 and UBV in NGC 1466; no sequences exist for the two other clusters. 15 refs

A curious case of the accretion-powered X-ray pulsar GX 1+4

DEFF Research Database (Denmark)

Jaisawal, Gaurava K.; Naik, Sachindra; Gupta, Shivangi

2018-01-01

We present detailed spectral and timing studies using a NuSTAR observation of GX 1+4 in 2015 October during an intermediate-intensity state. The measured spin period of 176.778 s is found to be one of the highest values since its discovery. In contrast to a broad sinusoidal-like pulse profile......, a peculiar sharp peak is observed in profiles below ∼25 keV. The profiles at higher energies are found to be significantly phase shifted compared to the soft X-ray profiles. Broad-band energy spectra of GX 1+4, obtained from NuSTAR and Swift observations, are described with various continuum models. Among...

A Deep ROSAT HRI Observation of NGC 1313

Science.gov (United States)

Schlegel, Eric M.; Petre, Robert; Colbert, E. J. M.; Miller, Scott

2000-11-01

We describe a series of observations of NGC 1313 using the ROSAT HRI with a combined exposure time of 183.5 ks. The observations span an interval between 1992 and 1998; the purpose of observations since 1994 was to monitor the X-ray flux of SN 1978K, one of several luminous sources in the galaxy. No diffuse emission is detected in the galaxy to a level of ~1-2×1037 ergs s-1 arcmin-2. A total of eight sources are detected in the summed image within the D25 diameter of the galaxy. The luminosities of five of the eight range from ~6×1037 to ~6×1038 ergs s-1 these sources are most likely accreting X-ray binaries, similar to sources observed in M31 and M33. The remaining three sources all emit above 1039 ergs s-1. We present light curves of the five brightest sources. Variability is detected at the 99.9% level in four of these. We identify one of the sources as an NGC 1313 counterpart of a Galactic X-ray source. The light curve, though crudely sampled, most closely resembles that of a Galactic black hole candidate such as GX 339-4 but with considerably higher peak X-ray luminosity. An additional seven sources lie outside the D25 diameter and are either foreground stars or background active galactic nuclei.

BROADBAND SPECTROSCOPY USING TWO SUZAKU OBSERVATIONS OF THE HMXB GX 301–2

International Nuclear Information System (INIS)

Suchy, Slawomir; Markowitz, Alex; Rothschild, Richard E.; Fürst, Felix; Kreykenbohm, Ingo; Wilms, Jörn; Pottschmidt, Katja; Caballero, Isabel

2012-01-01

We present the analysis of two Suzaku observations of GX 301–2 at two orbital phases after the periastron passage. Variations in the column density of the line-of-sight absorber are observed, consistent with accretion from a clumpy wind. In addition to a cyclotron resonance scattering feature (CRSF), multiple fluorescence emission lines were detected in both observations. The variations in the pulse profiles and the CRSF throughout the pulse phase have a signature of a magnetic dipole field. Using a simple dipole model we calculated the expected magnetic field values for different pulse phases and were able to extract a set of geometrical angles, loosely constraining the dipole geometry in the neutron star. From the variation of the CRSF width and energy, we found a geometrical solution for the dipole, making the inclination consistent with previously published values.

Search for a neutral particle of mass 33.9 MeV in pion decay

Energy Technology Data Exchange (ETDEWEB)

Daum, M [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

1996-11-01

We have measured the muon momentum distribution in charged pion decay in flight in order to search for a small branching fraction {eta} of pion decays {pi}{sup +}{yields}{mu}{sup +} 1 X, in which a heavy neutral particle X with a mass of 33.9 MeV would be emitted. Such a particle was postulated by the KARMEN collaboration as a possible explanation for an anomaly in their time-of-flight spectrum. In a first experiment we found an upper limit of {eta}{<=}2.6.10{sup -8} at a confidence level of 95%. (author) 4 figs., 9 refs.

Hydrology and modeling of flow conditions at Bridge 339 and Mile 38-43, Copper River Highway, Alaska

Science.gov (United States)

Brabets, Timothy P.

2012-01-01

The Copper River basin, the sixth largest watershed in Alaska, drains an area of 24,200 square miles in south-central Alaska. This large, glacier-fed river flows across a wide alluvial fan before it enters the Gulf of Alaska. The Copper River Highway, which traverses the alluvial fan, has been affected by channel planform reconfiguration. Currently (2012), two areas of the Copper River Highway are at risk: at Mile 38-43, the road grade is too low and the highway could be flooded by high flows of the Copper River, and at Mile 36, the main channel of the Copper River has migrated directly toward Bridge 339. Because Bridge 339 was not designed and built to convey the main flow of the Copper River, as much as 50 feet of scour occurred at the piers in 2011. The piers can no longer absorb the lateral or vertical loads, resulting in closure of the bridge and the Copper River Highway. The U.S. Geological Survey Flow and Sediment Transport with Morphologic Evolution of Channels (FaSTMECH) model was used to simulate the flow of the Copper River and produce simulations of depth, water-surface elevation, and velocity. At the Mile 38-43 area, FaSTMECH was used to analyze the effects of raising the road grade 5 feet, and at Mile 36, FaSTMECH was used to analyze the effects of constructing a channel to divert flow away from Bridge 339. Results from FaSTMECH indicate that if raising the road grade 5 feet in the Mile 38-43 area, a flood with an annual exceedance probability of 2 percent (400,000 cubic feet per second) would not overtop the highway. In the Bridge 339 area, results from FaSTMECH indicate that a design channel could divert flows as much as 100,000 cubic feet per second away from Bridge 339.

Spontaneous compactification of a (4+d)-dimensional Kaluza-Klein theory into M4xG/H for arbitrary G and H

International Nuclear Information System (INIS)

Randjbar-Daemi, S.; Percacci, R.

1982-05-01

Einstein-Yang-Mills theory in 4+d dimensions admits a solution of the form M 4 xG/H, where M 4 is Einstein and G/H is symmetric, if the gauge group is H (or larger). The gauge fields of this solution are topologically nontrivial. The symmetry group is G 4 xGxH, G 4 being the isometry group of M 4 ; M 4 could be Minkowski or anti-de-Sitter space. (author)

Application of the multi-dimensional surface water modeling system at Bridge 339, Copper River Highway, Alaska

Science.gov (United States)

Brabets, Timothy P.; Conaway, Jeffrey S.

2009-01-01

The Copper River Basin, the sixth largest watershed in Alaska, drains an area of 24,200 square miles. This large, glacier-fed river flows across a wide alluvial fan before it enters the Gulf of Alaska. Bridges along the Copper River Highway, which traverses the alluvial fan, have been impacted by channel migration. Due to a major channel change in 2001, Bridge 339 at Mile 36 of the highway has undergone excessive scour, resulting in damage to its abutments and approaches. During the snow- and ice-melt runoff season, which typically extends from mid-May to September, the design discharge for the bridge often is exceeded. The approach channel shifts continuously, and during our study it has shifted back and forth from the left bank to a course along the right bank nearly parallel to the road.Maintenance at Bridge 339 has been costly and will continue to be so if no action is taken. Possible solutions to the scour and erosion problem include (1) constructing a guide bank to redirect flow, (2) dredging approximately 1,000 feet of channel above the bridge to align flow perpendicular to the bridge, and (3) extending the bridge. The USGS Multi-Dimensional Surface Water Modeling System (MD_SWMS) was used to assess these possible solutions. The major limitation of modeling these scenarios was the inability to predict ongoing channel migration. We used a hybrid dataset of surveyed and synthetic bathymetry in the approach channel, which provided the best approximation of this dynamic system. Under existing conditions and at the highest measured discharge and stage of 32,500 ft3/s and 51.08 ft, respectively, the velocities and shear stresses simulated by MD_SWMS indicate scour and erosion will continue. Construction of a 250-foot-long guide bank would not improve conditions because it is not long enough. Dredging a channel upstream of Bridge 339 would help align the flow perpendicular to Bridge 339, but because of the mobility of the channel bed, the dredged channel would

Optical Spectroscopy of the Classical Novae V339 Del (2013) and V5668 Sgr (2015 No. 2)

Science.gov (United States)

Wagner, R. Mark; Woodward, Charles E.; Starrfield, Sumner; Ilyin, Ilya; Strassmeier, Klaus G.; Page, Kim; Osborne, Julian P.; Beardmore, Andrew P.

2016-01-01

We report the results of optical spectroscopy of the gamma-ray classical novae V339 Del (2013) and V5668 Sgr (PNV J18365700-2855420/Nova Sgr 2015 No. 2) supplemented by UV and X-ray observations obtained with Swift. Our spectra were obtained with the Steward Observatory Bok 2.3 m telescope (+B&C), the MDM 2.4 m Hiltner telescope (+OSMOS), the 6.5 m MMT (+BlueChannel), and the 2 x 8.4 m Large Binocular Telescope (+MODS1 and PEPSI) between 2013 August and 2015 September. The PEPSI spectra cover all or part of the 384-907 nm spectral region at a resolution of up to 270,000 (1 km/s). This is the highest resolution available on any 8-10 m class telescope. V339 Del was discovered on 2015 August 14.58 by Itagaki at V about 6.8. This nova reached a peak magnitude of about 4.3 making it one of the brightest novae of this century. Because of its exceptional brightness it has been observed at a variety of wavelengths and by a host of observatories both on the ground and in space. V5668 Sgr was discovered on 2015 March 15.634 by Seach at a magnitude of 6.0. It subsequently reached a maximum brightness of about 4.0 in late March. High resolution PEPSI spectra obtained in early April show dramatic variations in the multi-component P Cygni-type line profiles. V5668 Sgr was observed to form dust in June thereafter fading to about 13th magnitude. Our recent observations show that it has now evolved into the nebular phase. SS acknowledges partial support from NSF and NASA grants to ASU. CEW acknowledges support from NASA.

Connections Between Jet Formation and Multiwavelength Spectral Evolution in Black Hole Transients

Science.gov (United States)

Kakemci, Emrah; Chun, Yoon-Young; Dincer, Tolga; Buxton, Michelle; Tomsick, John A.; Corbel, Stephane; Kaaret, Philip

2011-01-01

Multiwavelength observations are the key to understand conditions of jet formation in Galactic black hole transient (GBHT) systems. By studying radio and optical-infrared evolution of such systems during outburst decays, the compact jet formation can be traced. Comparing this with X-ray spectral and timing evolution we can obtain physical and geometrical conditions for jet formation, and study the contribution of jets to X-ray emission. In this work, first X-ray evolution - jet relation for XTE J1752-223 will be discussed. This source had very good coverage in X-rays, optical, infrared and radio. A long exposure with INTEGRAL also allowed us to study gamma-ray behavior after the jet turns on. We will also show results from the analysis of data from GX 339-4 in the hard state with SUZAKU at low flux levels. The fits to iron line fluorescence emission show that the inner disk radius increases by a factor of greater than 27 with respect to radii in bright states. This result, along with other disk radius measurements in the hard state will be discussed within the context of conditions for launching and sustaining jets.

UPLC TOF MS for sensitive quantification of naturally occurring pyrrolizidine alkaloids in Petasites hybridus extract (Ze 339).

Science.gov (United States)

Schenk, Alexander; Siewert, Beate; Toff, Stephan; Drewe, Jürgen

2015-08-01

Due to increasing regulatory awareness of their hepatotoxic, genotoxic and possibly carcinogenic potential, pyrrolizidine alkaloid (PA) content has to be thoroughly monitored in herbal medicinal preparations. Recently, new very low PA regulatory threshold concentrations have been requested by the authorities. Therefore, a highly sensitive and reproducible UPLC TOF MS method for the quantification of the PAs senkirkine, senecionine, seneciphylline, senecionine-N-oxide and seneciphylline-N-oxide in a CO2-extract of Petasites hybridus leaves (Ze 339) has been developed. The limit of quantification (LOQ) was 2ppb for all PAs. Recovery at the LOQ was between 88.9 and 141.9%, the repeatability precision between 3.5 and 13.6%. Linearity of the five PAs showed correlation coefficients between 0.9995 and 0.9998 and coefficients of variation between 7.44 and 8.56%. A working range between 2 ppb and 200 ppb could be fixed. In the tested batches of the P. hybridus extract Ze 339, the absence of PAs could be demonstrated. In conclusion, this assay allows to determine trace PA concentrations in P. hybridus extract Ze 339, making it suitable for analytical PA monitoring in accordance with regulatory requirements. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

Rotation Determinations for 50 Virginia, 58 Concordia 307 Nike, and 339 Dorothea

Science.gov (United States)

Pilcher, Frederick

2016-10-01

Synodic rotation periods and amplitudes are found for 50 Virginia 14.320 ± 0.001 hours, amplitude 0.10 ± 0.01 magnitudes; 58 Concordia 9.895 ± 0.001 hours, 0.10 ± 0.01 magnitudes; 307 Nike 11.857 ± 0.001 hours, 0.20 ± 0.02 magnitudes; 339 Dorothea 5.9684 ± 0.0001 hours, 0.09 ± 0.01 magnitudes. Both 50 Virginia and 58 Concordia have irregular lightcurves.

[Accuracy of attenuation coefficient obtained by 137Cs single-transmission scanning in PET: comparison with conventional germanium line source].

Science.gov (United States)

Matsumoto, Keiichi; Kitamura, Keishi; Mizuta, Tetsuro; Shimizu, Keiji; Murase, Kenya; Senda, Michio

2006-02-20

Transmission scanning can be successfully performed with a Cs-137 single-photon-emitting point source for three-dimensional PET imaging. This method was effective for postinjection transmission scanning because of differences in physical energy. However, scatter contamination in the transmission data lowers measured attenuation coefficients. The purpose of this study was to investigate the accuracy of the influence of object scattering by measuring the attenuation coefficients on the transmission images. We also compared the results with the conventional germanium line source method. Two different types of PET scanner, the SET-3000 G/X (Shimadzu Corp.) and ECAT EXACT HR(+) (Siemens/CTI) , were used. For the transmission scanning, the SET-3000 G/X and ECAT HR(+) were the Cs-137 point source and Ge-68/Ga-68 line source, respectively. With the SET-3000 G/X, we performed transmission measurement at two energy gate settings, the standard 600-800 keV as well as 500-800 keV. The energy gate setting of the ECAT HR(+) was 350-650 keV. The effects of scattering in a uniform phantom with different cross-sectional areas ranging from 201 cm(2) to 314 cm(2) to 628 cm(2) (apposition of the two 20 cm diameter phantoms) and 943 cm(2) (stacking of the three 20 cm diameter phantoms) were acquired without emission activity. First, we evaluated the attenuation coefficients of the two different types of transmission scanning using region of interest (ROI) analysis. In addition, we evaluated the attenuation coefficients with and without segmentation for Cs-137 transmission images using the same analysis. The segmentation method was a histogram-based soft-tissue segmentation process that can also be applied to reconstructed transmission images. In the Cs-137 experiment, the maximum underestimation was 3% without segmentation, which was reduced to less than 1% with segmentation at the center of the largest phantom. In the Ge-68/Ga-68 experiment, the difference in mean attenuation

Accuracy of attenuation coefficient obtained by 137Cs single-transmission scanning in PET. Comparison with conventional germanium line source

International Nuclear Information System (INIS)

Matsumoto, Keiichi; Shimizu, Keiji; Senda, Michio; Kitamura, Keishi; Mizuta, Tetsuro; Murase, Kenya

2006-01-01

Transmission scanning can be successfully performed with a Cs-137 single-photon-emitting point source for three-dimensional PET imaging. This method was effective for postinjection transmission scanning because of differences in physical energy. However, scatter contamination in the transmission data lowers measured attenuation coefficients. The purpose of this study was to investigate the accuracy of the influence of object scattering by measuring the attenuation coefficients on the transmission images. We also compared the results with the conventional germanium line source method. Two different types of PET scanner, the SET-3000 G/X (Shimadzu Corp.) and ECAT EXACT HR + (Siemens/CTI), were used. For the transmission scanning, the SET-3000 G/X and ECAT HR + were the Cs-137 point source and Ge-68/Ga-68 line source, respectively. With the SET-3000 G/X, we performed transmission measurement at two energy gate settings, the standard 600-800 keV as well as 500-800 keV. The energy gate setting of the ECAT HR 2 + was 350-650 keV. The effects of scattering in a uniform phantom with different cross-sectional areas ranging from 201 cm 2 to 314 cm 2 to 628 cm 2 (apposition of the two 20 cm diameter phantoms) and 943 cm 2 (stacking of the three 20 cm diameter phantoms) were acquired without emission activity. First, we evaluated the attenuation coefficients of the two different types of transmission scanning using region of interest (ROI) analysis. In addition, we evaluated the attenuation coefficients with and without segmentation for Cs-137 transmission images using the same analysis. The segmentation method was a histogram-based soft-tissue segmentation process that can also be applied to reconstructed transmission images. In the Cs-137 experiment, the maximum underestimation was 3% without segmentation, which was reduced to less than 1% with segmentation at the center of the largest phantom. In the Ge-68/Ga-68 experiment, the difference in mean attenuation coefficients

4C radio sources in clusters of galaxies

International Nuclear Information System (INIS)

McHardy, I.M.

1979-01-01

Observations of a complete sample of 4C and 4CT radio sources in Abell clusters with the Cambridge One-Mile telescope are analysed. It is concluded that radio sources are strongly concentrated towards the cluster centres and are equally likely to be found in clusters of any richness. The probability of a galaxy of a given absolute magnitude producing a source above a given luminosity does not depend on cluster membership. 4C and 4CT radio sources in clusters, selected at 178 MHz, occur preferentially in Bautz-Morgan (BM) class 1 clusters, whereas those selected at 1.4 GHz do not. The most powerful radio source in the cluster is almost always associated with the optically brightest galaxy. The average spectrum of 4C sources in the range 408 to 1407 MHz is steeper in BM class 1 than in other classes. Spectra also steepen with cluster richness. the morphology of 4C sources in clusters depends strongly on BM class and, in particular, radio-trail sources occur only in BM classes II, II-III and III. (author)

Pleistocene calcareous nannofossil biochronology at IODP Site U1385 (Expedition 339)

Science.gov (United States)

Balestra, B.; Flores, J.-A.; Hodell, D. A.; Hernández-Molina, F. J.; Stow, D. A. V.

2015-12-01

During Integrated Ocean Drilling Program (IODP) Expedition 339, Site U1385 (37°34‧N, 10°7‧W, 2578 m below sea level) was drilled in the lower slope of the Portuguese margin, to provide a marine reference section of Pleistocene millennial-scale climate variability. Five holes were cored using the Advanced Piston Corer (APC) to a depth of ~ 151 m below sea floor (mbsf) recovering a continuous stratigraphic record covering the past 1.4 Ma. Here we present results of the succession of standard and unconventional calcareous nannofossil biostratigraphic events. The quantitative study of calcareous nannofossils showed well-preserved and abundant assemblages throughout the core. Most conventional Pleistocene events were recognized and the timing of bioevents were calibrated using correlation to the new oxygen isotope stratigraphy record developed for the Site U1385. The analyses provide further data on the stratigraphic distribution of selected species and genera, such as the large Emiliania huxleyi (> 4 μm), Gephyrocapsa caribbeanica, Helicosphaera inversa, Gephyrocapsa omega and Reticulofenestra asanoi (> 6 μm) and other circular-subcircular small reticulofenestrids, resulting in new insights into the environmental control of their stratigraphic patterns. Finally, the comparison between nannofossil datums and oxygen isotope stratigraphy on the same samples has resulted in an accurate revision of timing of the events, providing valuable biochronologic information.

Decay properties of {sup 256-339}Ds superheavy nuclei

Energy Technology Data Exchange (ETDEWEB)

Santhosh, K.P.; Nithya, C. [Kannur University, School of Pure and Applied Physics, Payyanur, Kerala (India)

2017-09-15

The decay properties of 84 isotopes of darmstadtium superheavy nuclei (Z = 110) have been studied using various theoretical models. The proton emission half-lives, the alpha decay half-lives, the spontaneous fission half-lives and the cluster decay half-lives of all the isotopes are evaluated. The one-proton emission half-lives and the alpha decay half-lives are predicted using the Coulomb and proximity potential model for deformed nuclei (CPPMDN). The calculated alpha half-lives are compared with the available experimental results as well as with the predictions of other theoretical models. The predicted half-lives matches well with the experimental results. The one-proton half-lives are also compared with the predictions using other formalisms. The shell-effect-dependent formula of Santhosh et al. has been employed for calculating the spontaneous fission half-lives. A theoretical comparison of spontaneous fission half-lives with four different formalisms is performed. By comparing the one-proton emission half-lives, the alpha decay half-lives and the spontaneous fission half-lives decay modes are predicted for all the isotopes of Ds. It is seen that the isotopes within the range 256 ≤ A ≤ 263 and 279 ≤ A ≤ 339 decay through spontaneous fission and the isotopes 264 ≤ A ≤ 278 exhibit alpha decay. Cluster decay half-lives are calculated using different models including the Coulomb and proximity potential (CPPM), for determining the magicities in the superheavy region. The effect of magicity at N = 184 and N = 202 were confirmed from the plot of log{sub 10}T{sub 1/2} versus neutron number of the daughter nuclei for the emission of different clusters. We hope that the systematic and detailed study of all the possible decay modes of {sup 256-339}Ds using various theoretical models will be helpful in the experimental identification of the isotopes of the element in the future. (orig.)

Qualitative and quantitative radiation protection analysis of mucosa of ICR strained mice using selected herbal extracts such as GC-2112 from garlic (Allium sativum) and GX-2137 from ginseng (Panax sp.)

International Nuclear Information System (INIS)

Bunagan, J.B.

2005-01-01

Full text: Earlier reports showed that ginseng has significant radioprotective and stimulatory effect on the recovery of the lymphocytes and leukocytes. Using graded absorbed doses of radiation (1.5, 5, 20, 50 Gy) applied in ICR strain male white mice which was injected with GX-2137 from ginseng (Panax sp.) and GC-2112 from garlic (Allium sativum) was tested to prove some radioprotective efficiency. The herbal extracts were injected intraperitoneally and the experimental mice were sacrificed 2 and 48 hrs post-irradiation. Factors such as analyzing kinetics of critical tissue parameters (length of villi, the number of crypt and villi cells and cell density) and determining the Relative Protection Efficiencies (RPE) using quantitative histopathological techniques were used to quantify the radiation protection assay in the duodenum of ICR strain mice. Results showed that GC-2112 and GX-2137 protected the villi structures. After 2 hrs. post irradiation, tissue degeneration was evident. RPE values of significant radioprotection of the crypts is demonstrated at absorbed dose. It was found that some villi cells are even viable at non-physiologic dose of 50 Gy. (author)

Genomic selection improves response to selection in resilience by exploiting genotype by environment interactions

NARCIS (Netherlands)

Mulder, Herman

2016-01-01

Genotype by environment interactions (GxE) are very common in livestock and hamper genetic improvement. On the other hand, GxE is a source of genetic variation: genetic variation in response to environment, e.g., environmental perturbations such as heat stress or disease. In livestock breeding,

H- ion sources for CERN's Linac4

Science.gov (United States)

Lettry, J.; Aguglia, D.; Coutron, Y.; Chaudet, E.; Dallocchio, A.; Gil Flores, J.; Hansen, J.; Mahner, E.; Mathot, S.; Mattei, S.; Midttun, O.; Moyret, P.; Nisbet, D.; O'Neil, M.; Paoluzzi, M.; Pasquino, C.; Pereira, H.; Arias, J. Sanchez; Schmitzer, C.; Scrivens, R.; Steyaert, D.

2013-02-01

The specifications set to the Linac4 ion source are: H- ion pulses of 0.5 ms duration, 80 mA intensity and 45 keV energy within a normalized emittance of 0.25 mmmrad RMS at a repetition rate of 2 Hz. In 2010, during the commissioning of a prototype based on H- production from the plasma volume, it was observed that the powerful co-extracted electron beam inherent to this type of ion source could destroy its electron beam dump well before reaching nominal parameters. However, the same source was able to provide 80 mA of protons mixed with a small fraction of H2+ and H3+ molecular ions. The commissioning of the radio frequency quadrupole accelerator (RFQ), beam chopper and H- beam diagnostics of the Linac4 are scheduled for 2012 and its final installation in the underground building is to start in 2013. Therefore, a crash program was launched in 2010 and reviewed in 2011 aiming at keeping the original Linac4 schedule with the following deliverables: Design and production of a volume ion source prototype suitable for 20-30 mA H- and 80 mA proton pulses at 45 keV by mid-2012. This first prototype will be dedicated to the commissioning of the low energy components of the Linac4. Design and production of a second prototype suitable for 40-50 mA H- based on an external RF solenoid plasma heating and cesiated-surface production mechanism in 2013 and a third prototype based on BNL's Magnetron aiming at reliable 2 Hz and 80 mA H- operations in 2014. In order to ease the future maintenance and allow operation with Ion sources based on three different production principles, an ion source "front end" providing alignment features, pulsed gas injection, pumping units, beam tuning capabilities and pulsed bipolar high voltage acceleration was designed and is being produced. This paper describes the progress of the Linac4 ion source program, the design of the Front end and first ion source prototype. Preliminary results of the summer 2012 commissioning are presented. The outlook on

Genome-wide search for gene-gene interactions in colorectal cancer.

Directory of Open Access Journals (Sweden)

Shuo Jiao

Full Text Available Genome-wide association studies (GWAS have successfully identified a number of single-nucleotide polymorphisms (SNPs associated with colorectal cancer (CRC risk. However, these susceptibility loci known today explain only a small fraction of the genetic risk. Gene-gene interaction (GxG is considered to be one source of the missing heritability. To address this, we performed a genome-wide search for pair-wise GxG associated with CRC risk using 8,380 cases and 10,558 controls in the discovery phase and 2,527 cases and 2,658 controls in the replication phase. We developed a simple, but powerful method for testing interaction, which we term the Average Risk Due to Interaction (ARDI. With this method, we conducted a genome-wide search to identify SNPs showing evidence for GxG with previously identified CRC susceptibility loci from 14 independent regions. We also conducted a genome-wide search for GxG using the marginal association screening and examining interaction among SNPs that pass the screening threshold (p<10(-4. For the known locus rs10795668 (10p14, we found an interacting SNP rs367615 (5q21 with replication p = 0.01 and combined p = 4.19×10(-8. Among the top marginal SNPs after LD pruning (n = 163, we identified an interaction between rs1571218 (20p12.3 and rs10879357 (12q21.1 (nominal combined p = 2.51×10(-6; Bonferroni adjusted p = 0.03. Our study represents the first comprehensive search for GxG in CRC, and our results may provide new insight into the genetic etiology of CRC.

Characteristics of prepared food sources in low-income neighborhoods of Baltimore City.

Science.gov (United States)

Lee, Seung Hee; Rowan, Megan T; Powell, Lisa M; Newman, Sara; Klassen, Ann Carroll; Frick, Kevin D; Anderson, Jennifer; Gittelsohn, Joel

2010-01-01

The food environment is associated with obesity risk and diet-related chronic diseases. Despite extensive research conducted on retail food stores, little is known about prepared food sources(PFSs). We conducted an observational assessment of all PFSs(N = 92) in low-income neighborhoods in Baltimore. The most common PFSs were carry-outs, which had the lowest availability of healthy food choices. Only a small proportion of these carry-outs offered healthy sides, whole wheat bread, or entrée salads (21.4%, 7.1%, and 33.9%, respectively). These findings suggest that carry-out-specific interventions are necessary to increase healthy food availability in low-income urban neighborhoods.

4th generation light source instrumentation

International Nuclear Information System (INIS)

Lumpkin, A.

1998-01-01

This working group on 4th Generation Light Source (4GLS) Instrumentation was a follow-up to the opening-discussion on Challenges in Beam Profiling. It was in parallel with the Feedback Systems session. We filled the SSRL Conference Room with about 25 participants. The session opened with an introduction by Lumpkin. The target beam parameter values for a few-angstrom, self-amplified spontaneous emissions (SASE) experiment and for a diffraction-limited soft x-ray storage ring source were addressed. Instrument resolution would of course need to be 2-3 times better than the value measured, if possible. The nominal targeted performance parameters are emittance (1-2π mm mrad), bunch length (100 fs), peak-current (l-5 kA), beam size (10 microm), beam divergence (1 microrad), energy spread (2 x 10 -4 ), and beam energy (10's of GeV). These are mostly the SASE values, and the possible parameters for a diffraction-limited soft x-ray source would be relaxed somewhat. Beam stability and alignment specifications in the sub-micron domain for either device are anticipated

Fatigue Resistance of GX12CrMoVNbN9-1 Cast Steel after Ageing Process

Directory of Open Access Journals (Sweden)

Stanisław MROZIŃSKI

2014-12-01

Full Text Available In the present paper, low cycle fatigue behaviour of GX12CrMoVNbN9-1 (GP91 cast steel is presented. Fatigue tests were performed under isothermal conditions at room temperature and at 550 and 600oC, on five levels of total strain amplitude value ɛac = 0.25÷0.60%. The cast steel subject to investigation was in the as-received condition (after heat treatment and after 8000 hours of ageing at the temperature of 600oC. Performed research has shown an insignificant influence of the ageing process on mechanical properties of GP91 cast steel, determined with the static test of tension. Analysis of the performed tests has proved that GP91 cast steel in the as-received condition and after ageing process was characterized by strong cyclic softening without a clear period of stabilization of the hysteresis loop parameters. The fatigue lifetime curves at each temperature were obtained based on Basquin and Coffin – Manson equations. The process of ageing of GP91 cast steel contributed to a decrease in its fatigue life Nf from a few to a few dozen percent, and the level of fatigue life was dependent on the value of strain amplitude ɛac. It has also been stated that the fatigue life Nf of GP91 cast steel is determined by its plastic properties, and the degree of changes in fatigue life Nf was dependent not only on the temperature of testing, but also on the value of strain amplitude ɛac. DOI: http://dx.doi.org/10.5755/j01.ms.20.4.6077

Linac4 H− ion sources

International Nuclear Information System (INIS)

Lettry, J.; Aguglia, D.; Andersson, P.; Bertolo, S.; Butterworth, A.; Coutron, Y.; Dallocchio, A.; David, N.; Chaudet, E.; Fink, D. A.; Garlasche, M.; Grudiev, A.; Guida, R.; Hansen, J.; Haase, M.; Jones, A.; Koszar, I.; Lallement, J.-B.; Lombardi, A. M.; Machado, C.

2016-01-01

CERN’s 160 MeV H − linear accelerator (Linac4) is a key constituent of the injector chain upgrade of the Large Hadron Collider that is being installed and commissioned. A cesiated surface ion source prototype is being tested and has delivered a beam intensity of 45 mA within an emittance of 0.3 π ⋅ mm ⋅ mrad. The optimum ratio of the co-extracted electron- to ion-current is below 1 and the best production efficiency, defined as the ratio of the beam current to the 2 MHz RF-power transmitted to the plasma, reached 1.1 mA/kW. The H − source prototype and the first tests of the new ion source optics, electron-dump, and front end developed to minimize the beam emittance are presented. A temperature regulated magnetron H − source developed by the Brookhaven National Laboratory was built at CERN. The first tests of the magnetron operated at 0.8 Hz repetition rate are described

Black-hole Binaries: Life Begins at 40 keV

Science.gov (United States)

Belloni, Tomaso M.; Motta, Sara

2009-05-01

In the study of black-hole transients, an important problem that still needs to be answered is how the high-energy part of the spectrum evolves from the low-hard to the high-soft state, given that they have very different properties. Recent results obtained with RXTE and INTEGRAL have given inconsistent results. With RXTE, we have found that the high-energy cutoff in GX 339-4 during the transition first decreases (during the low-hard state), then increases again across the Hard-Intermediate state, to become unmeasurable in the soft states (possibly because of statistical limitations). We show Simbol-X will be able to determine the spectral shape with superb accuracy. As the high-energy part of the spectrum is relatively less known than the one below 20 keV, Simbol-X will provide important results that will help out understanding of the extreme physical conditions in the vicinity of a stellar-mass black hole.

Influence of heat treatment on microstructure and properties of GX12CrMoVNbN9-1 cast steel

Directory of Open Access Journals (Sweden)

G. Golański

2010-07-01

Full Text Available The paper presents results of research on the influence of multistage heat treatment on microstructure and properties of high-chromiummartensitic GX12CrMoVNbN9 – 1 (GP91 steel. The material under investigation were samples taken out from a test coupon. Heattreatment of GP91 cast steel was performed at the parameters of temperature and time typical of treatment for multi-ton steel casts. The research has proved that in the as-received condition (as-cast state GP91 cast steel was characterized by a coarse grain, martensitic microstructure which provided the required standard mechanical properties. The heat treatment of GP91 cast steel contributed to obtainment of a fine grain microstructure of high tempered martensite with numerous precipitations of carbides of diverse size. The GP91 cast steel structure received through heat treatment made it possible to obtain high plastic properties, particularly impact strength, maintaining strength properties on the level of the required minimum.

On the Nature of the Compact Object in SS 433. Observational Evidence of X-Ray Photon Index Saturation

Science.gov (United States)

Seifina, Elena; Titarchuk, Lev

2010-01-01

We present an analysis of the X-ray spectral properties observed from black hole , candidate (BHC) binary SS 433. We have analyzed Rossi X-ray Time Explorer (RXTE) data from this source, coordinated with Green Bank Interferometer/RATAN-600. We show that SS 433 undergoes a X-ray spectral transition from the low hard state (LHS) to the intermediate state (IS). We show that the X-ray broad-band energy spectra during all spectral states are well fit by a sum of so called "Bulk Motion Comptonization (BMC) component" and by two (broad and narrow) Gaussians for the continuum and line emissions respectively. In addition to these spectral model components we also find a strong feature that we identify as a" blackbody-like (BB)" component which color temperature is in the range of 4-5 keV in 24 IS spectra during the radio outburst decay in SS 433. Our observational results on the "high temperature BB" bump leads us to suggest the presence of gravitationally redshifted annihilation line emission in this source. In fact this spectral feature has been recently reproduced in Monte Carlo simulations by Laurent and Titarchuk. We have also established the photon index saturation at about 2.3 in index vs mass accretion correlation. This index-mass accretion correlation allows us to evaluate the low limit of black hole (BH) mass of compact object in SS 433, M(sub bh) approximately > 2 solar masses, using the scaling method using BHC GX 339-4 as a reference source. Our estimate of the BH mass in SS 433 is consistent with recent BH mass measurement using the radial-velocity measurements of the binary system by Hillwig & Gies who find that M(sub x)( = (4.3 +/- 0.8) solar masses. This is the smallest BH mass found up to now among all BH sources. Moreover, the index saturation effect versus mass accretion rate revealed in SS 433, like in a number of other BH candidates, is the strong observational evidence for the presence of a BH in SS 433.

Repetitive patterns in rapid optical variations in the nearby black-hole binary V404 Cygni.

Science.gov (United States)

Kimura, Mariko; Isogai, Keisuke; Kato, Taichi; Ueda, Yoshihiro; Nakahira, Satoshi; Shidatsu, Megumi; Enoto, Teruaki; Hori, Takafumi; Nogami, Daisaku; Littlefield, Colin; Ishioka, Ryoko; Chen, Ying-Tung; King, Sun-Kun; Wen, Chih-Yi; Wang, Shiang-Yu; Lehner, Matthew J; Schwamb, Megan E; Wang, Jen-Hung; Zhang, Zhi-Wei; Alcock, Charles; Axelrod, Tim; Bianco, Federica B; Byun, Yong-Ik; Chen, Wen-Ping; Cook, Kem H; Kim, Dae-Won; Lee, Typhoon; Marshall, Stuart L; Pavlenko, Elena P; Antonyuk, Oksana I; Antonyuk, Kirill A; Pit, Nikolai V; Sosnovskij, Aleksei A; Babina, Julia V; Baklanov, Aleksei V; Pozanenko, Alexei S; Mazaeva, Elena D; Schmalz, Sergei E; Reva, Inna V; Belan, Sergei P; Inasaridze, Raguli Ya; Tungalag, Namkhai; Volnova, Alina A; Molotov, Igor E; de Miguel, Enrique; Kasai, Kiyoshi; Stein, William L; Dubovsky, Pavol A; Kiyota, Seiichiro; Miller, Ian; Richmond, Michael; Goff, William; Andreev, Maksim V; Takahashi, Hiromitsu; Kojiguchi, Naoto; Sugiura, Yuki; Takeda, Nao; Yamada, Eiji; Matsumoto, Katsura; James, Nick; Pickard, Roger D; Tordai, Tamás; Maeda, Yutaka; Ruiz, Javier; Miyashita, Atsushi; Cook, Lewis M; Imada, Akira; Uemura, Makoto

2016-01-07

How black holes accrete surrounding matter is a fundamental yet unsolved question in astrophysics. It is generally believed that matter is absorbed into black holes via accretion disks, the state of which depends primarily on the mass-accretion rate. When this rate approaches the critical rate (the Eddington limit), thermal instability is supposed to occur in the inner disk, causing repetitive patterns of large-amplitude X-ray variability (oscillations) on timescales of minutes to hours. In fact, such oscillations have been observed only in sources with a high mass-accretion rate, such as GRS 1915+105 (refs 2, 3). These large-amplitude, relatively slow timescale, phenomena are thought to have physical origins distinct from those of X-ray or optical variations with small amplitudes and fast timescales (less than about 10 seconds) often observed in other black-hole binaries-for example, XTE J1118+480 (ref. 4) and GX 339-4 (ref. 5). Here we report an extensive multi-colour optical photometric data set of V404 Cygni, an X-ray transient source containing a black hole of nine solar masses (and a companion star) at a distance of 2.4 kiloparsecs (ref. 8). Our data show that optical oscillations on timescales of 100 seconds to 2.5 hours can occur at mass-accretion rates more than ten times lower than previously thought. This suggests that the accretion rate is not the critical parameter for inducing inner-disk instabilities. Instead, we propose that a long orbital period is a key condition for these large-amplitude oscillations, because the outer part of the large disk in binaries with long orbital periods will have surface densities too low to maintain sustained mass accretion to the inner part of the disk. The lack of sustained accretion--not the actual rate--would then be the critical factor causing large-amplitude oscillations in long-period systems.

H- Ion Sources For CERN’s Linac4

CERN Document Server

Lettry, J; Coutron, Y; Chaudeta, E; Dallocchio, A; Gil Flores, J; Hansen, J; Mahner, E; Mathot, S; Mattei, S; Midttun, O; Moyret, P; Nisbet, D; O’Neil, M; Paoluzzi, M; Pasquino, C; Pereira, H; Sanchez Arias, J; Schmitzer, C; Scrivens, R; Steyaert, D

2013-01-01

The specifications set to the Linac4 ion source are: H- ion pulses of 0.5 ms duration, 80 mA intensity and 45 keV energy within a normalized emittance of 0.25 mmmrad RMS at a repetition rate of 2 Hz. In 2010, during the commissioning of a prototype based on H- production from the plasma volume, it was observed that the powerful co-extracted electron beam inherent to this type of ion source could destroy its electron beam dump well before reaching nominal parameters. However, the same source was able to provide 80 mA of protons mixed with a small fraction of H2+ and H3+ molecular ions. The commissioning of the radio frequency quadrupole accelerator (RFQ), beam chopper and H- beam diagnostics of the Linac4 are scheduled for 2012 and its final installation in the underground building is to start in 2013. Therefore, a crash program was launched in 2010 and reviewed in 2011 aiming at keeping the original Linac4 schedule with the following deliverables: Design and production of a volume ion source prototype suitabl...

Analysis of 3-panel and 4-panel microscale ionization sources

International Nuclear Information System (INIS)

Natarajan, Srividya; Parker, Charles B.; Glass, Jeffrey T.; Piascik, Jeffrey R.; Gilchrist, Kristin H.; Stoner, Brian R.

2010-01-01

Two designs of a microscale electron ionization (EI) source are analyzed herein: a 3-panel design and a 4-panel design. Devices were fabricated using microelectromechanical systems technology. Field emission from carbon nanotube provided the electrons for the EI source. Ion currents were measured for helium, nitrogen, and xenon at pressures ranging from 10 -4 to 0.1 Torr. A comparison of the performance of both designs is presented. The 4-panel microion source showed a 10x improvement in performance compared to the 3-panel device. An analysis of the various factors affecting the performance of the microion sources is also presented. SIMION, an electron and ion optics software, was coupled with experimental measurements to analyze the ion current results. The electron current contributing to ionization and the ion collection efficiency are believed to be the primary factors responsible for the higher efficiency of the 4-panel microion source. Other improvements in device design that could lead to higher ion source efficiency in the future are also discussed. These microscale ion sources are expected to find application as stand alone ion sources as well as in miniature mass spectrometers.

EVOLUTION OF THE CROSS-CORRELATION AND TIME LAG OF 4U 1735-44 ALONG THE BRANCHES

International Nuclear Information System (INIS)

Lei Yajuan; Zhang Haotong; Zhang Chengmin; Yuan Hailong; Dong Yiqiao; Zhao Yongheng; Zhang Yanxia; Qu Jinlu; Song Liming; Wang Dehua; Yin Hongxing

2013-01-01

We analyze the cross-correlation function between the soft and hard X-rays of atoll source 4U 1735-44 with RXTE data, and find anti-correlated soft and hard time lags of about a hecto-second. In the island state, the observations do not show any obvious correlations, and most observations of the banana branch show a positive correlation. However, anti-correlations are detected in the upper banana branch. These results are different from those of Z-sources (Cyg X-2, GX 5-1), where anti-correlations are detected in the horizontal branch and upper normal branch. In this case, the lag timescales of both this atoll and Z-sources are found to be similar, at a magnitude of several tens to hundreds of seconds. As a comparison, it is noted that anti-correlated lags lasting thousands of seconds have been reported from several black hole candidates in their intermediate states. In addition, for an observation containing four segments that show positive or anti-correlation, we analyze the spectral evolution with the hybrid model. In the observation, the anti-correlation is detected at the highest flux. The fitting results show that the Comptonized component is not the lowest at the highest flux, which suggests that the anti-correlation corresponds to the transition between the soft and hard states. Finally, we compare the corresponding results of atoll source 4U 1735-44 with those observed in Z-sources and black hole candidates, and the possible origins of the anti-correlated time lags are discussed

EVOLUTION OF THE CROSS-CORRELATION AND TIME LAG OF 4U 1735-44 ALONG THE BRANCHES

Energy Technology Data Exchange (ETDEWEB)

Lei Yajuan; Zhang Haotong; Zhang Chengmin; Yuan Hailong; Dong Yiqiao; Zhao Yongheng; Zhang Yanxia [Key Laboratory of Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Qu Jinlu; Song Liming [Particle Astrophysics Center, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Wang Dehua [Astronomy Department, Beijing Normal University, Beijing 100875 (China); Yin Hongxing, E-mail: leiyjcwmy@163.com [School of Space Science and Physics, Shandong University, Weihai 264209 (China)

2013-09-15

We analyze the cross-correlation function between the soft and hard X-rays of atoll source 4U 1735-44 with RXTE data, and find anti-correlated soft and hard time lags of about a hecto-second. In the island state, the observations do not show any obvious correlations, and most observations of the banana branch show a positive correlation. However, anti-correlations are detected in the upper banana branch. These results are different from those of Z-sources (Cyg X-2, GX 5-1), where anti-correlations are detected in the horizontal branch and upper normal branch. In this case, the lag timescales of both this atoll and Z-sources are found to be similar, at a magnitude of several tens to hundreds of seconds. As a comparison, it is noted that anti-correlated lags lasting thousands of seconds have been reported from several black hole candidates in their intermediate states. In addition, for an observation containing four segments that show positive or anti-correlation, we analyze the spectral evolution with the hybrid model. In the observation, the anti-correlation is detected at the highest flux. The fitting results show that the Comptonized component is not the lowest at the highest flux, which suggests that the anti-correlation corresponds to the transition between the soft and hard states. Finally, we compare the corresponding results of atoll source 4U 1735-44 with those observed in Z-sources and black hole candidates, and the possible origins of the anti-correlated time lags are discussed.

ATF4, A Novel Mediator of the Anabolic Actions of PTH on Bone

Science.gov (United States)

2012-01-01

poster) A5. Xiao G. Critical role of activating transcription factor 4 in parathyroid hormone-mediated bone formation. Military Health Research...C, Pittsburgh, Pennsylvania 15240. E-mail: xiaog@upmc.edu. This work was supported by National Institutes of Health Grants DK072230 (to G.X.) and...Ahn JD, Takeda S, Starbuck M, Yang X, Liu X, Kondo H, Richards WG, Bannon TW, Noda M, Clement K, Vaisse C, Karsenty G 2005 Leptin regulation of bone

PWG4 perspective on ex-vessel hydrogen sources

International Nuclear Information System (INIS)

2000-07-01

The purpose of this perspective document is to identify the potential ex-vessel hydrogen sources and to address the question whether, considered the uncertainties associated to these sources, further investigations are required. The statement is established with reference to the needs for safety evaluation of nuclear reactors under severe accident conditions. It is recognised that the views could be different if one looks at these issues from another standpoint. Since the TMI-2 accident in 1979, there had been a large interest in the nuclear reactor safety community for studying the behaviour of hydrogen in case of a severe accident. As a result, different 'state of the art' reports were produced. Examples of these documents are NUREG/CR-1561 and EUR 14307. In particular, they identified potential hydrogen sources during accidents, including ex-vessel sources. Various ex-vessel hydrogen sources, covering a variety of physical and chemical processes, were identified. Although their precise quantification and relative importance is to be established on a case by case basis with respect to the specific reactor design of interest, general trends can be formulated. The sources to be considered are the followings: - radiolysis of water; - corrosion reactions, - reaction of urania with steam and water; - core-concrete interaction; - debris-atmosphere interaction. These sources are discussed successively. The PWG4 (CSNI's Principal Working Group on the Confinement of Accidental Radioactive Releases) perspective on Ex-vessel Hydrogen Sources can be summarised in the following statements: 1. The issue of hydrogen sources must be considered as a whole and cannot be separated into in-vessel and ex-vessel issues. For significant sources that may not be accommodated by mitigation means associated to DBA, the uncertainty is largely dominated by the unknown extent of Zr oxidation during the in-vessel phase. 2. PWG4 notes that hydrogen production during corium quenching by water is

Confusion-limited extragalactic source survey at 4.755 GHz. I. Source list and areal distributions

International Nuclear Information System (INIS)

Ledden, J.E.; Broderick, J.J.; Condon, J.J.; Brown, R.L.

1980-01-01

A confusion-limited 4.755-GHz survey covering 0.00 956 sr between right ascensions 07/sup h/05/sup m/ and 18/sup h/ near declination +35 0 has been made with the NRAO 91-m telescope. The survey found 237 sources and is complete above 15 mJy. Source counts between 15 and 100 mJy were obtained directly. The P(D) distribution was used to determine the number counts between 0.5 and 13.2 mJy, to search for anisotropy in the density of faint extragalactic sources, and to set a 99%-confidence upper limit of 1.83 mK to the rms temperature fluctuation of the 2.7-K cosmic microwave background on angular scales smaller than 7.3 arcmin. The discrete-source density, normalized to the static Euclidean slope, falls off sufficiently rapidly below 100 mJy that no new population of faint flat-spectrum sources is required to explain the 4.755-GHz source counts

46 CFR 111.10-4 - Power requirements, generating sources.

Science.gov (United States)

2010-10-01

... ELECTRIC SYSTEMS-GENERAL REQUIREMENTS Power Supply § 111.10-4 Power requirements, generating sources. (a) The aggregate capacity of the electric ship's service generating sources required in § 111.10-3 must... or sources must be sufficient to supply those services necessary to provide normal operational...

Measurement of the electron density of a plasma by interferometry with a He - Ne laser ({lambda} = 3.39 {mu}); Mesure de la densite electronique d'un plasma par interferometrie avec un laser He - Ne ({lambda} = 3.39 {mu})

Energy Technology Data Exchange (ETDEWEB)

Belland, P [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1968-07-01

The characteristics of the He-Ne gas laser used in a simple interferometric technique have been studied. After passing through the plasma, the beam is reflected back into the laser cavity, and the intensity of the laser itself, modulated by this optical feedback, is used to observe the fringes. Furthermore, owing to the coupling of the two laser transitions 0.63{mu} (red) and 3.39{mu} (infra red), interferences in the infra red can be detected by a simple photomultiplier monitoring the red line. This method has been applied to two plasma machines (E.P.P.E. and SABLIER) for spatial and temporal measurements of the mean electron density. (author) [French] Nous avons etudie les caracteristiques d'un laser a gaz He-Ne utilise dans une technique simple d'interferometrie. La lumiere qui traverse le plasma est reinjectee dans le laser, et l'intensite propre de celui-ci, modulee par cette reinjection, sert a observer les franges. De plus, a cause du couplage des deux transitions laser: 0.63{mu} (rouge) et 3.39{mu} (infrarouge), les interferences dans l'infrarouge peuvent etre detectees par un simple photomultiplicateur sensible au rouge. Nous avons applique cette methode a deux machines a plasma (E.P.P.E. et SABLIER) pour la mesure de la densite electronique moyenne en fonction du temps et de l'espace. (auteur)

Is 4C+29.48 a γ-ray source?

Science.gov (United States)

Gabányi, K. É.; Frey, S.; An, T.

2018-05-01

Context. The Fermi Large Area Telescope revealed that the extragalactic γ-ray sky is dominated by blazars, active galactic nuclei (AGN) whose jet is seen at very small angle to the line of sight. To associate and then classify the γ-ray sources, data have been collected from lower frequency surveys and observations. Since those have superior angular resolution and positional accuracy compared to the γ-ray observations, some associations are not straightforward. Aims: The γ-ray source 3FGL J1323.0+2942 is associated with the radio source 4C+29.48 and classified as a blazar of unknown type, lacking optical spectrum and redshift. The higher-resolution radio data showed that 4C+29.48 comprises three bright radio-emitting features located within a 1'-diameter area. We aim to reveal their nature and pinpoint the origin of the γ-ray emission. Methods: We (re-)analyzed archival Very Large Array (VLA) and unpublished very long baseline interferometry (VLBI) observations conducted by the Very Long Baseline Array (VLBA) and the European VLBI Network of 4C+29.48. We also collected data form optical, infrared and X-ray surveys. Results: According to the VLBI data, the northernmost complex of 4C+29.48 contains a blazar with a high brightness temperature compact core and a steep-spectrum jet feature. The blazar is positionally coincident with an optical source at a redshift of 1.142. Its mid-infrared colors also support its association with a γ-ray emitting blazar. The two other radio complexes have steep radio spectra similar to AGN-related lobes and do not have optical or infrared counterparts in currently available surveys. Based on the radio morphology, they are unlikely to be related to the blazar. There is an optical source between the two radio features, also detected in infrared wavebands. We discuss the possibilities whether the two radio features are lobes of a radio galaxy, or gravitationally lensed images of a background source. Conclusions: We propose to

Dietary 2-oxoglutarate mitigates gastrectomy-evoked structural changes in cartilage of female rats.

Science.gov (United States)

Dobrowolski, Piotr; Tomaszewska, Ewa; Kurlak, Paulina; Pierzynowski, Stefan G

2016-01-01

Gastrectomy (Gx) leads to osteopenia/osteoporosis in humans and animals. However, little is known about the influence of Gx on the cartilage in this regard. Recent studies have demonstrated a protective effect of 2-oxoglutaric acid (2-Ox) on bone and cartilage. Hence, the purpose of this study was to investigate whether 2-Ox can mitigate eventual Gx-induced cartilage impairment. Twenty female Sprague-Dawley rats were subjected to Gx and randomly divided into two groups: Gx + 2-Ox and Gx. Another 20 rats were sham-operated (ShO) and randomly divided into two groups: ShO + 2-Ox and ShO. The daily dose of 2-Ox administered to the rats in the drinking water was 0.43 g per 100 g rat. After eight weeks, rats were euthanized and femora and tibiae were collected. Histology and histomorphometry analyses of the articular cartilage and the growth plate were done. Gx resulted in a 32% (±44.5 femur, ±35.8 tibia) decrease in overall thickness of articular cartilage in both bones (femur: ShO 279.1 ± 48.5 vs. Gx 190.2 ± 38.4 µm, tibia: ShO 222.9 ± 50.3 µm vs. Gx 151.3 ± 52.6 µm) (in some zones up to 58 ± 28.0%), and in the growth plate up to 20% (±22.4) (femur: ShO 243.0 ± 34.0 vs. Gx 207.0 ± 33.7 µm, tibia: ShO 220.0 ± 24.6 µm vs. Gx 171.1 ± 16.1 µm). Gx altered the spatial distribution of thick and thin collagen fibers, and chondrocyte shape and size. 2-Ox administration prevented the reduction in both cartilages thickness (Gx + 2-Ox: articular cartilage 265.2 ± 53.8 µm, 235.6 ± 42.7 µm, growth plate 236.7 ± 39.2 µm, 191.3 ± 16.5 µm in femur and tibia, respectively), and abolished the spatial changes in collagen distribution and structure induced by Gx. Gx affects cartilage structure and thickness, however, 2-Ox administration mitigates these effects and showed protective and stimulatory properties. Our observations suggest that dietary 2-Ox can be used to offset

miR-339-5p regulates the p53 tumor-suppressor pathway by targeting MDM2

DEFF Research Database (Denmark)

Jansson, M D; Djodji Damas, Nkerorema; Lees, M

2014-01-01

MicroRNAs (miRNAs) regulate many key cancer-relevant pathways and may themselves possess oncogenic or tumor-suppressor functions. Consequently, miRNA dysregulation has been shown to be a prominent feature in many human cancers. The p53 tumor suppressor acts as a negative regulator of cell prolife...... tumor cells. Furthermore, we show that a negative correlation between miR-339-5p and MDM2 expression exists in human cancer, implying that the interaction is important for cancer development.Oncogene advance online publication, 2 June 2014; doi:10.1038/onc.2014.130....

Genomic selection improves response to selection in resilience by exploiting genotype by environment interactions

Directory of Open Access Journals (Sweden)

Han Mulder

2016-10-01

Full Text Available Genotype by environment interactions (GxE are very common in livestock and hamper genetic improvement. On the other hand, GxE is a source of genetic variation: genetic variation in response to environment, e.g. environmental perturbations such as heat stress or disease. In livestock breeding, there is tendency to ignore GxE because of increased complexity of models for genetic evaluations and lack of accuracy in extreme environments. GxE, however, creates opportunities to increase resilience of animals towards environmental perturbations. The main aim of the paper is to investigate to which extent GxE can be exploited with traditional and genomic selection methods. Furthermore, we investigated the benefit of reaction norm models compared to conventional methods ignoring GxE. The questions were addressed with selection index theory. GxE was modelled according to a linear reaction norm model in which the environmental gradient is the contemporary group mean. Economic values were based on linear and non-linear profit equations.Accuracies of environment-specific (GEBV were highest in intermediate environments and lowest in extreme environments. Reaction norm models had higher accuracies of (GEBV in extreme environments than conventional models ignoring GxE. Genomic selection always resulted in higher response to selection in all environments than sib or progeny testing schemes. The increase in response was with genomic selection between 9% and 140% compared to sib testing and between 11% and 114% compared to progeny testing when the reference population consisted of 1 million animals across all environments. When the aim was to decrease environmental sensitivity, the response in slope of the reaction norm model with genomic selection was between 1.09 and 319 times larger than with sib or progeny testing and in the right direction in contrast to sib and progeny testing that still increased environmental sensitivity. This shows that genomic selection

Status and Operation of the Linac4 Ion Source Prototypes

CERN Document Server

Lettry, J; Andersson, P; Bertolo, S; Butterworth, A; Coutron, Y; Dallocchio, A; Chaudet, E; Gil-Flores, J; Guida, R; Hansen, J; Hatayama, A; Koszar, I; Mahner, E; Mastrostefano, C; Mathot, S; Mattei, S; Midttun, O; Moyret, P; Nisbet, D; Nishida, K; O’Neil, M; Ohta, M; Paoluzzi, M; Pasquino, C; Pereira, H; Rochez, J; Sanchez Alvarez, J; Sanchez Arias, J; Scrivens, R; Shibata, T; Steyaert, D; Thaus, N; Yamamoto, T

2014-01-01

CERN’s Linac4 45 kV H- ion sources prototypes are installed at a dedicated ion source test stand and in the Linac4 tunnel. The operation of the pulsed hydrogen injection, RF sustained plasma and pulsed high voltages are described. The first experimental results of two prototypes relying on 2MHz RF- plasma heating are presented. The plasma is ignited via capacitive coupling, and sustained by inductive coupling. The light emitted from the plasma is collected by viewports pointing to the plasma chamber wall in the middle of the RF solenoid and to the plasma chamber axis. Preliminary measurements of optical emission spectroscopy and photometry of the plasma have been performed. The design of a cesiated ion source is presented. The volume source has produced a 45 keV H- beam of 16-22 mA which has successfully been used for the commissioning of the Low Energy Beam Transport (LEBT), Radio Frequency Quadrupole (RFQ) accelerator and chopper of Linac4.

PROPERTIES OF THE 24 DAY MODULATION IN GX 13+1 FROM NEAR-INFRARED AND X-RAY OBSERVATIONS

International Nuclear Information System (INIS)

Corbet, Robin H. D.; Pearlman, Aaron B.; Buxton, Michelle; Levine, Alan M.

2010-01-01

A 24 day period for the low-mass X-ray binary (LMXB) GX 13+1 was previously proposed on the basis of seven years of RXTE All-Sky Monitor (ASM) observations and it was suggested that this was the orbital period of the system. This would make it one of the longest known orbital periods for a Galactic LMXB powered by Roche lobe overflow. We present here the results of (1) K-band photometry obtained with the SMARTS Consortium CTIO 1.3 m telescope on 68 nights over a 10 month interval; (2) continued monitoring with the RXTE ASM, analyzed using a semi-weighted power spectrum instead of the data filtering technique previously used; and (3) Swift Burst Alert Telescope (BAT) hard X-ray observations. Modulation near 24 days is seen in both the K band and additional statistically independent ASM X-ray observations. However, the modulation in the ASM is not strictly periodic. The periodicity is also not detected in the Swift BAT observations, but modulation at the same relative level as seen with the ASM cannot be ruled out. If the 24 day period is the orbital period of system, this implies that the X-ray modulation is caused by structure that is not fixed in location. A possible mechanism for the X-ray modulation is the dipping behavior recently reported from XMM-Newton observations.

Linac4 H{sup −} ion sources

Energy Technology Data Exchange (ETDEWEB)

Lettry, J., E-mail: Jacques.lettry@cern.ch; Aguglia, D.; Andersson, P.; Bertolo, S.; Butterworth, A.; Coutron, Y.; Dallocchio, A.; David, N.; Chaudet, E.; Fink, D. A.; Garlasche, M.; Grudiev, A.; Guida, R.; Hansen, J.; Haase, M.; Jones, A.; Koszar, I.; Lallement, J.-B.; Lombardi, A. M.; Machado, C. [CERN-ABP, 1211 Geneva 23 (Switzerland); and others

2016-02-15

CERN’s 160 MeV H{sup −} linear accelerator (Linac4) is a key constituent of the injector chain upgrade of the Large Hadron Collider that is being installed and commissioned. A cesiated surface ion source prototype is being tested and has delivered a beam intensity of 45 mA within an emittance of 0.3 π ⋅ mm ⋅ mrad. The optimum ratio of the co-extracted electron- to ion-current is below 1 and the best production efficiency, defined as the ratio of the beam current to the 2 MHz RF-power transmitted to the plasma, reached 1.1 mA/kW. The H{sup −} source prototype and the first tests of the new ion source optics, electron-dump, and front end developed to minimize the beam emittance are presented. A temperature regulated magnetron H{sup −} source developed by the Brookhaven National Laboratory was built at CERN. The first tests of the magnetron operated at 0.8 Hz repetition rate are described.

Nasu 1.4 GHz Interferometer Transient Radio Source Survey and Improvement in Detection of Radio Sources

International Nuclear Information System (INIS)

Matsumura, Nobuo; Kuniyoshi, Masaya; Takefuji, Kazuhiro; Niinuma, Kotaro; Kida, Sumiko; Takeuchi, Akihiko; Asuma, Kuniyuki; Daishido, Tsuneaki

2006-01-01

We have surveyed 1.4GHz transient radio sources in Nasu Pulsar Observatory. To investigate such sources, both immediacy and accuracy are severely maintained. We have developed Data Transfer System and improved antenna control system. Now we have received the fringe data from transient radio source candidates. To get reliable information, we carefully analyze with Fringe Band Pass Filter software and Fringe Fitting method

Preparation of source mounts for 4π counting

International Nuclear Information System (INIS)

Johnson, E.P.

1991-01-01

The 4πβ/γ counter in the ANSTO radioisotope standards laboratory at Lucas Heights constitutes part of the Australian national standard for radioactivity. Sources to be measured in the counter must be mounted on a substrate which is strong enough to withstand careful handling and transport. The substrate must also be electrically conducting to minimise counting errors caused by charging of the source, and it must have very low superficial density so that little or none of the radiation is absorbed. The entire process of fabrication of VYNS films, coating them with gold/palladium and transferring them to source mount rings, as carried out in the radioisotope standards laboratory, is documented. 3 refs., 2 tabs., 6 figs

78 FR 62676 - Anthony E. Wicks, M.D. Decision and Order

Science.gov (United States)

2013-10-22

... registration BW7987184, while listing his address as Pain Management of Winter Springs, 165 W. SR 434, Winter... practice address. Id. at 2, ] 5. \\2\\ Documentary evidence, which the Government acquired through... prescriptions for oxycodone,\\4\\ diazepam, and lorazepam.\\5\\ GX 15, at 2, ] 7; GX 13. \\3\\ The documentary...

Sealed source and device design safety testing. Volume 4: Technical report on the findings of Task 4, Investigation of sealed source for paper mill digester

International Nuclear Information System (INIS)

Benac, D.J.; Iddings, F.A.

1995-10-01

This report covers the Task 4 activities for the Sealed Source and Device Safety testing program. SwRI was contracted to investigate a suspected leaking radioactive source that was installed in a gauge that was on a paper mill digester. The actual source that was leaking was not available, therefore, SwRI examined another source. SwRI concluded that the encapsulated source examined by SwRI was not leaking. However, the presence of Cs-137 on the interior and exterior of the outer encapsulation and hending tube suggests that contamination probably occurred when the source was first manufactured, then installed in the handling tube

Identification of a Novel Enterovirus Species in Rhesus Macaque in China.

Science.gov (United States)

Ao, Yuan-Yun; Yu, Jie-Mei; Zhang, Cui-Yuan; Xin, Yun-Yun; Li, Li-Li; Duan, Zhao-Jun

2016-06-22

Recent studies of Enterovirus (EV) in nonhuman primates (NHPs), which could act as a source of future emerging human viral diseases, have boosted interest in the search for novel EVs. Here, a highly divergent strain of EV, tentatively named SEV-gx, was identified by viral metagenomic analysis from stool samples of rhesus macaques in China. In total, 27 of 280 (9.6%) faecal samples from rhesus macaques were positive for SEV-gx. Its complete genomic sequence is 7,367 nucleotide (nt). Genomic analyses showed that it has a standard genomic organisation for EVs, being more closely related to EV-J strains (approximately 54.0%, 43.0-44.1%, 52.3-55.2%, 61.1-62.7% and 64.0% amino acids identity in polyprotein, P1, P2 and P3 and combined 2C/3CD regions, respectively). It was also shown to have genome characteristics typical of EVs. Phylogenetic analysis of P1, 2C and 3CD aa indicated that SEV-gx can be classified as a distinct cluster in the EVs. All of this evidence demonstrates SEV-gx is a novel species (tentatively named EV-K) in the EV genus, which contributes to our understanding of the genetic diversity and evolution of EVs. Further studies are needed to investigate the potential pathogenicity of SEV-gx in NHPs and humans.

16 CFR Table 4 to Part 1512 - Relative Energy Distribution of Sources

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Relative Energy Distribution of Sources 4... SUBSTANCES ACT REGULATIONS REQUIREMENTS FOR BICYCLES Pt. 1512, Table 4 Table 4 to Part 1512—Relative Energy Distribution of Sources Wave length (nanometers) Relative energy 380 9.79 390 12.09 400 14.71 410 17.68 420 21...

10 CFR 4.33 - Access to sources of information.

Science.gov (United States)

2010-01-01

... report and shall set forth what efforts it has made to obtain the information. ... 10 Energy 1 2010-01-01 2010-01-01 false Access to sources of information. 4.33 Section 4.33 Energy... FEDERAL FINANCIAL ASSISTANCE FROM THE COMMISSION Regulations Implementing Title VI of the Civil Rights Act...

Armenian Expedition of Emperor Constantius II in 338/339 A.D. and Military Units of Thracian Expeditionary Army at the Near East: on the Late Roman Military Organization in the Mid-4th Century

Directory of Open Access Journals (Sweden)

10.15688/jvolsu4.2017.5.26

2017-11-01

Full Text Available The present paper deals with the history of military corps, which Roman emperor Constantius II sent to Great Armenia in 338/339 A.D. for to fight with the Persians. The main evidence on Constantius II’s Persian expedition are preserved in the works of prominent Armenian historians, that are Moses Khorenatsi and Pawstos Buzand. Constantius II held this campaign in order to free Armenia from the Persians and to bring back its state freedom. According to Moses Khorenatsi and Pawstos Buzand, Constantius II sent in Armenia bodyguards, who were representatives of Armenian noble families allied to the Romans, but the Roman regular forces themselves collected in Galatia (the Asia Minor, moved in Mesopotamia and Atropatene (south of modern Azerbaijan and Iranian Azerbaijan. As the author supposes, Roman troops arrived in Armenia and took part in fight with the Persians, strictly due to Roman military help Armenian naχarars could expel the Persians from Armenia. In this connection the author poses a question – which military units arrived at the Roman Near East (in Mesopotamia from the Asia Minor and how Constantius II’s military campaign in Armenia influenced on the further development of Roman-Persian frontier and its defence system. On the ground of epigraphic data (inscriptions from Mesopotamia and Arabia author made a conclusion that in 338/339 A.D. Constantius II moved at the Near East military units which previously were parts of Thracian expeditionary army and garrisoned in Thracia, since inscriptions under discussion mention soldiers who bear Thracian names that reveal their Thracian origin.

Antigen-specific and non-specific CD4+ T cell recruitment and proliferation during influenza infection

International Nuclear Information System (INIS)

Chapman, Timothy J.; Castrucci, Maria R.; Padrick, Ryan C.; Bradley, Linda M.; Topham, David J.

2005-01-01

To track epitope-specific CD4 + T cells at a single-cell level during influenza infection, the MHC class II-restricted OVA 323-339 epitope was engineered into the neuraminidase stalk of influenza/A/WSN, creating a surrogate viral antigen. The recombinant virus, influenza A/WSN/OVA II , replicated well, was cleared normally, and stimulated both wild-type and DO11.10 or OT-II TCR transgenic OVA-specific CD4 + T cells. OVA-specific CD4 T cells proliferated during infection only when the OVA epitope was present. However, previously primed (but not naive) transgenic CD4 + T cells were recruited to the infected lung both in the presence and absence of the OVA 323-339 epitope. These data show that, when primed, CD4 + T cells may traffic to the lung in the absence of antigen, but do not proliferate. These results also document a useful tool for the study of CD4 T cells in influenza infection

Tunable, continuous-wave, ultraviolet source based on intracavity sum-frequency-generation in an optical parametric oscillator using BiB₃O₆.

Science.gov (United States)

Devi, Kavita; Kumar, S Chaitanya; Ebrahim-Zadeh, M

2013-10-21

We report a continuous-wave (cw) source of tunable radiation across 333-345 nm in the ultraviolet (UV) using bismuth triborate, BiB₃O₆ (BIBO) as the nonlinear gain material. The source is based on internal sum-frequency-generation (SFG) in a cw singly-resonant optical parametric oscillator (OPO) pumped at 532 nm. The compact tunable source employs a 30-mm-long MgO:sPPLT crystal as the OPO gain medium and a 5-mm-long BIBO crystal for intracavity SFG of the signal and pump, providing up to 21.6 mW of UV power at 339.7 nm, with >15 mW over 64% of the SFG tuning range. The cw OPO is also tunable across 1158-1312 nm in the idler, delivering as much as 1.7 W at 1247 nm, with >1W over 65% of the tuning range. The UV output at maximum power exhibits passive power stability better than 3.4% rms and frequency stability of 193 GHz over more than one minute.

Excretome of the chitinolytic bacterium Clostridium paraputrificum J4

Czech Academy of Sciences Publication Activity Database

Šimůnek, Jiří; Koppová, Ingrid; Tiščenko, Galina; Dohnálek, Jan; Dušková, Jarmila

2012-01-01

Roč. 57, č. 4 (2012), s. 335-339 ISSN 0015-5632 R&D Projects: GA ČR GA310/09/1407 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z40500505 Keywords : chitinase * purification * enzymes Subject RIV: EE - Microbiology, Virology Impact factor: 0.791, year: 2012

Autopilot regulation for the Linac4 H- ion source

Science.gov (United States)

Voulgarakis, G.; Lettry, J.; Mattei, S.; Lefort, B.; Costa, V. J. Correia

2017-08-01

Linac4 is a 160 MeV H- linear accelerator part of the upgrade of the LHC injector chain. Its cesiated surface H- source is designed to provide a beam intensity of 40-50mA. It is operated with periodical Cs-injection at typically 30 days intervals [1] and this implies that the beam parameters will slowly evolve during operation. Autopilot is a control software package extending CERN developed Inspector framework. The aim of Autopilot is to automatize the mandatory optimization and cesiation processes and to derive performance indicators, thus keeping human intervention minimal. Autopilot has been developed by capitalizing on the experience from manually operating the source. It comprises various algorithms running in real-time, which have been devised to: • Optimize the ion source performance by regulation of H2 injection, RF power and frequency. • Describe the performance of the source with performance indicators, which can be easily understood by operators. • Identify failures, try to recover the nominal operation and send warning in case of deviation from nominal operation. • Make the performance indicators remotely available through Web pages.Autopilot is at the same level of hierarchy as an operator, in the CERN infrastructure. This allows the combination of all ion source devices, providing the required flexibility. Autopilot is executed in a dedicated server, ensuring unique and centralized control, yet allowing multiple operators to interact at runtime, always coordinating between them. Autopilot aims at flexibility, adaptability, portability and scalability, and can be extended to other components of CERN's accelerators. In this paper, a detailed description of the Autopilot algorithms is presented, along with first results of operating the Linac4 H- Ion Source with Autopilot.

Effects of Si content on microstructure and mechanical properties of TiAlN/Si3N4-Cu nanocomposite coatings

Science.gov (United States)

Feng, Changjie; Hu, Shuilian; Jiang, Yuanfei; Wu, Namei; Li, Mingsheng; Xin, Li; Zhu, Shenglong; Wang, Fuhui

2014-11-01

TiAlN/Si3N4-Cu nanocomposite coatings of various Si content (0-5.09 at.%) were deposited on AISI-304 stainless steel by DC reactive magnetron sputtering technique. The chemical composition, microstructure, mechanical and tribological properties of these coatings were systematically investigated by means of X-ray diffraction (XRD), field emission scanning electron microscope (FESEM), nanoindentation tester, a home-made indentation system, a scratch tester and a wear tester. Results indicated that with increasing Si content in these coatings, a reduction of grain size and surface roughness, a transformation of the (1 1 1) preferred orientation was detected by XRD and FESEM. Furthermore the hardness of these coatings increase from 9.672 GPa to 18.628 GPa, and the elastic modulus reveal the rising trend that increase from 224.654 GPa to 251.933 GPa. However, the elastic modulus of TiAlN/Si3N4-Cu coating containing 3.39 at.% Si content dropped rapidly and changed to about 180.775 GPa. The H3/E2 ratio is proportional to the film resistance to plastic deformation. The H3/E2 ratio of the TiAlN/Si3N4-Cu coating containing 3.39 at.% Si content possess of the maximum of 0.11 GPa, and the indentation test indicate that few and fine cracks were observed from its indentation morphologies. The growth pattern of cracks is mainly bending growing. The present results show that the best toughness is obtained for TiAlN/Si3N4-Cu nanocomposite coating containing 3.39 at.% Si content. In addition, the TiAlN/Si3N4-Cu coating containing 3.39 at.% Si content also has good adhesion property and superior wear resistance, and the wear mechanism is mainly adhesion wear.

Synthesis and hydrogen storage of La23Nd7.8Ti1.1Ni33.9Co32.9Al0.65 alloys

Directory of Open Access Journals (Sweden)

Priyanka Meena

2018-04-01

Full Text Available The present work investigates structural and hydrogen storage properties of first time synthesized La23Nd7.8Ti1.1Ni33.9Co32.9Al0.65 alloy by arc melting process and ball milled to get it in nano structure form. XRD analysis of as-prepared alloy showed single phased hexagonal LaNi5-type structure with 52 nm average particle size, which reduces to about 31 nm after hydrogenations. Morphological studies by SEM were undertaken to investigate the effect of hydrogenation of nanostructured alloy. EDX analysis confirmed elemental composition of the as-prepared alloy. Activation energy for hydrogen desorption was studied using TGA analysis and found to be −76.86 kJ/mol. Hydrogenation/dehydrogenation reactions and absorption kinetics were measured at temperature 100 °C. The equilibrium plateau pressure was determined to be 2 bar at 100 °C giving hydrogen storage capacity of about 2.1 wt%. Keywords: Hydrogen storage, La23Nd7.8Ti1.1Ni33.9Co32.9Al0.65 alloy, SEM, EDS, TGA, Hydrogenation/dehydrogenation

Polarization Study for NLC Positron Source Using EGS4

Energy Technology Data Exchange (ETDEWEB)

Liu, James C

2000-09-20

SLAC is exploring a polarized positron source to study new physics for the NLC project. The positron source envisioned in this paper consists of a polarized electron source, a 50-MeV electron accelerator, a thin target less-than-or-equal-to 0.2 radiation length for positron production, and a capture system for high-energy, small angular divergence positrons. The EGS4 code was used to study the yield, energy spectra, emission-angle distribution, and the mean polarization of the positrons emanating from W-Re and Ti targets hit by longitudinally polarized electron and photon beams. To account for polarization within the EGS4 code a method devised by Flottmann was used, which takes into account polarization transfer for pair production, bremsstrahlung, and Compton interactions. A mean polarization of 0.85 for positrons with energies greater than 25 MeV was obtained. Most of the high-energy positrons were emitted within a forward angle of 20 degrees. The yield of positrons above 25 MeV per incident photon was 0.034, which was about 70 times higher than that obtained with an electron beam.

High efficiency 4H-SiC betavoltaic power sources using tritium radioisotopes

Energy Technology Data Exchange (ETDEWEB)

Thomas, Christopher; Portnoff, Samuel [Widetronix Corp., Ithaca, New York 14850 (United States); Spencer, M. G. [Department of Electrical and Computer Engineering, Cornell University, Ithaca, New York 14850 (United States)

2016-01-04

Realization of an 18.6% efficient 4H-silicon carbide (4H-SiC) large area betavoltaic power source using the radioisotope tritium is reported. A 200 nm 4H-SiC P{sup +}N junction is used to collect high-energy electrons. The electron source is a titanium tritide (TiH{sup 3}{sub x}) foil, or an integrated titanium tritide region formed by the diffusion of tritium into titanium. The specific activity of the source is directly measured. Dark current measured under short circuit conditions was less than 6.1 pA/cm{sup 2}. Samples measured with an external tritium foil produced an open circuit voltage of 2.09 V, short circuit current of 75.47 nA/cm{sup 2}, fill factor of 0.86, and power efficiency of 18.6%. Samples measured with an integrated source produced power efficiencies of 12%. Simulations were done to determine the beta spectrum (modified by self absorption) exiting the source and the electron hole pair generation function in the 4H-SiC. The electron-hole pair generation function in 4H-SiC was modeled as a Gaussian distribution, and a closed form solution of the continuity equation was used to analyze the cell performance. The effective surface recombination velocity in our samples was found to be 10{sup 5}–10{sup 6 }cm/s. Our analysis demonstrated that the surface recombination dominates the performance of a tritium betavoltaic device but that using a thin P{sup +}N junction structure can mitigate some of the negative effects.

Evaluation of the homogeneity of reference flat sources used in calibration of surface contamination monitors

International Nuclear Information System (INIS)

Silva Junior, I.A.; Xavier, M.; Siqueira, P.T.D.; Potiens, M.P.A.

2014-01-01

The aim of this study was to re-evaluate the uniformity of the wide area reference sources of the Calibration Laboratory of Instruments (LCI-IPEN) used in the calibration of surface contamination monitors, according the recommendations of the ISO 8769 standard and the NRPB. In this work used six wide area reference sources of 150 cm 2 of 241 Am, 14 C, 36 Cl, 137 Cs, 90 Sr+ 90 Y and 99 Tc with reference dates between 1996 and 1997 and three sources of 100 cm 2 of 14 C, 137 Cs and 60 Co were used with reference dates 2007. Measurements were performed with a radiation monitor of the Thermo, model FH40GX with a pancake probe, model FHZ732GM. We also made several models on paper with the objective of define each measurement position and an aluminum plate with a square hole (6.25 cm 2 ) in its center, allowing the passage of the radiation only through the hole. Each wide area reference source was positioned in setup and measurements were performed in order to cover the entire surface of the source. The values of the uniformity obtained partially confirm previous data obtained in another study conducted by LCI-IPEN, showing that some wide area reference sources 150 cm 2 in disagree with ISO 8769. In the former work, just the source of 241 Am (7.3%) was within the range specified by the standard, now have sources of 241 Am (5.7%), 137 Cs (8.8%), 90 Sr+ 9 '0Y (8, 8%) and 99 Tc (9.2%) with values within the specified uniformity. The sources of 14 C (53.3%) and 36 Cl (16.6%) were outside the specified. The wide area reference sources of 100 cm 2 , show disagreement in values of uniformity of the sources 14 C (46.7%) and 60 Co (10.4%). The values of the uniformity of the wide area reference sources show that some fonts can not be used in calibrations, because not in accordance with the value of uniformity specified in ISO 8769:2010, this is a conditions to believe a laboratory according to ISO 17025, show the laboratory performs its services with a high quality. The

Current sources of carbon tetrachloride (CCl4) in our atmosphere

Science.gov (United States)

Sherry, David; McCulloch, Archie; Liang, Qing; Reimann, Stefan; Newman, Paul A.

2018-02-01

Carbon tetrachloride (CCl4 or CTC) is an ozone-depleting substance whose emissive uses are controlled and practically banned by the Montreal Protocol (MP). Nevertheless, previous work estimated ongoing emissions of 35 Gg year-1 of CCl4 into the atmosphere from observation-based methods, in stark contrast to emissions estimates of 3 (0-8) Gg year-1 from reported numbers to UNEP under the MP. Here we combine information on sources from industrial production processes and legacy emissions from contaminated sites to provide an updated bottom-up estimate on current CTC global emissions of 15-25 Gg year-1. We now propose 13 Gg year-1 of global emissions from unreported non-feedstock emissions from chloromethane and perchloroethylene plants as the most significant CCl4 source. Additionally, 2 Gg year-1 are estimated as fugitive emissions from the usage of CTC as feedstock and possibly up to 10 Gg year-1 from legacy emissions and chlor-alkali plants.

A novel mutation in the FGB: c.1105C>T turns the codon for amino acid Bβ Q339 into a stop codon causing hypofibrinogenemia.

Science.gov (United States)

Marchi, Rita; Brennan, Stephen; Meyer, Michael; Rojas, Héctor; Kanzler, Daniela; De Agrela, Marisela; Ruiz-Saez, Arlette

2013-03-01

Routine coagulation tests on a 14year-old male with frequent epistaxis showed a prolonged thrombin time together with diminished functional (162mg/dl) and gravimetric (122mg/dl) fibrinogen concentrations. His father showed similar aberrant results and sequencing of the three fibrinogen genes revealed a novel heterozygous nonsense mutation in the FGB gene c.1105C>T, which converts the codon for residue Bβ 339Q to stop, causing deletion of Bβ chain residues 339-461. Sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and RP-HPLC (reverse-phase high-pressure liquid chromatography) of purified fibrinogen showed only normal Aα, Bβ, and γ chains, indicating that molecules with the truncated 37,990Da β chain were not secreted into plasma. Functional analysis showed impaired fibrin polymerization, fibrin porosity, and elasticity compared to controls. By laser scanning confocal microscopy the patient's fibers were slightly thinner than normal. Electrospray ionization mass spectrometry (ESI MS) presented normal sialylation of the oligosaccharide chains, and liver function tests showed no evidence of liver dysfunction that might explain the functional abnormalities. Copyright © 2012 Elsevier Inc. All rights reserved.

CERN’s Linac4 H− sources: Status and operational results

International Nuclear Information System (INIS)

Lettry, J.; Aguglia, D.; Andersson, P.; Bertolo, S.; Butterworth, A.; Coutron, Y.; Dallocchio, A.; David, N.; Chaudet, E.; Fink, D.; Gil-Flores, J.; Garlasche, M.; Grudiev, A.; Guida, R.; Hansen, J.; Haase, M.; Jones, A.; Koszar, I.; Machado, C.; Mastrostefano, C.

2015-01-01

Two volume sources equipped with DESY and CERN plasma generators and a low voltage electron dump were operated at 45 kV in the Linac4 tunnel and on a dedicated test stand. These volume sources delivered approximately 20 mA and ensured the commissioning of the Radio Frequency Quadrupole accelerator and of the first section of the Drift Tube Linac. CERN’s prototype of a cesiated surface source equipped with this electron dump was operated continuously from November 2013 to April 2014 on the ion source test stand and is being commissioned in the Linac4 tunnel. Before cesiation, the prototype conditioned in volume mode provided up to 30 mA H − beam. Short cesiations, of the order of 10 mg effectively reduced the intensity of co-extracted electrons down to 2 - 8 times the H − current; this cesiated surface operation mode delivered up to 60 mA H − beam. An H − beam of the order of 40 mA was sustained up to four weeks operation with 500 μs pulses at 1.2s spacing. A new extraction was designed to match these beam properties. A copy of BNL’s magnetron produced at CERN was tested at BNL and delivered at 40 kV H − beam exceeding Linac4’s nominal intensity of 80 mA. In this contribution, the performances, dynamic response to cesiation, stability and availability of these prototypes are described. The needed optimization of the emittance of H − beam above 40 mA is presented, which requires an evolution of the front end that encompasses implementation of a large ceramic insulator

COMMON PATTERNS IN THE EVOLUTION BETWEEN THE LUMINOUS NEUTRON STAR LOW-MASS X-RAY BINARY SUBCLASSES

International Nuclear Information System (INIS)

Fridriksson, Joel K.; Homan, Jeroen; Remillard, Ronald A.

2015-01-01

The X-ray transient XTE J1701–462 was the first source observed to evolve through all known subclasses of low-magnetic-field neutron star low-mass X-ray binaries (NS-LMXBs), as a result of large changes in its mass accretion rate. To investigate to what extent similar evolution is seen in other NS-LMXBs we have performed a detailed study of the color–color and hardness–intensity diagrams (CDs and HIDs) of Cyg X-2, Cir X-1, and GX 13+1—three luminous X-ray binaries, containing weakly magnetized neutron stars, known to exhibit strong secular changes in their CD/HID tracks. Using the full set of Rossi X-ray Timing Explorer Proportional Counter Array data collected for the sources over the 16 year duration of the mission, we show that Cyg X-2 and Cir X-1 display CD/HID evolution with close similarities to XTE J1701–462. Although GX 13+1 shows behavior that is in some ways unique, it also exhibits similarities to XTE J1701–462, and we conclude that its overall CD/HID properties strongly indicate that it should be classified as a Z source, rather than as an atoll source. We conjecture that the secular evolution of Cyg X-2, Cir X-1, and GX 13+1—illustrated by sequences of CD/HID tracks we construct—arises from changes in the mass accretion rate. Our results strengthen previous suggestions that within single sources Cyg-like Z source behavior takes place at higher luminosities and mass accretion rates than Sco-like Z behavior, and lend support to the notion that the mass accretion rate is the primary physical parameter distinguishing the various NS-LMXB subclasses

COMMON PATTERNS IN THE EVOLUTION BETWEEN THE LUMINOUS NEUTRON STAR LOW-MASS X-RAY BINARY SUBCLASSES

Energy Technology Data Exchange (ETDEWEB)

Fridriksson, Joel K. [Anton Pannekoek Institute for Astronomy, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Homan, Jeroen; Remillard, Ronald A., E-mail: J.K.Fridriksson@uva.nl [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States)

2015-08-10

The X-ray transient XTE J1701–462 was the first source observed to evolve through all known subclasses of low-magnetic-field neutron star low-mass X-ray binaries (NS-LMXBs), as a result of large changes in its mass accretion rate. To investigate to what extent similar evolution is seen in other NS-LMXBs we have performed a detailed study of the color–color and hardness–intensity diagrams (CDs and HIDs) of Cyg X-2, Cir X-1, and GX 13+1—three luminous X-ray binaries, containing weakly magnetized neutron stars, known to exhibit strong secular changes in their CD/HID tracks. Using the full set of Rossi X-ray Timing Explorer Proportional Counter Array data collected for the sources over the 16 year duration of the mission, we show that Cyg X-2 and Cir X-1 display CD/HID evolution with close similarities to XTE J1701–462. Although GX 13+1 shows behavior that is in some ways unique, it also exhibits similarities to XTE J1701–462, and we conclude that its overall CD/HID properties strongly indicate that it should be classified as a Z source, rather than as an atoll source. We conjecture that the secular evolution of Cyg X-2, Cir X-1, and GX 13+1—illustrated by sequences of CD/HID tracks we construct—arises from changes in the mass accretion rate. Our results strengthen previous suggestions that within single sources Cyg-like Z source behavior takes place at higher luminosities and mass accretion rates than Sco-like Z behavior, and lend support to the notion that the mass accretion rate is the primary physical parameter distinguishing the various NS-LMXB subclasses.

We have much in common: the similar inter-generational work preferences and career satisfaction among practicing radiologists.

Science.gov (United States)

Moriarity, Andrew K; Brown, Manuel L; Schultz, Lonni R

2014-04-01

There are many reported generational differences regarding workplace motivators, but these have not been previously studied in radiologists. The aim of this study was to assess for generational differences in workplace satisfaction and desired workplace characteristics among practicing radiologists. An electronic survey distributed to ACR, Society of Chairs of Academic Radiology Departments, and Association of Program Directors in Radiology members generated 1,577 responses from baby boom (BG) and generation X (GX) radiologists in active practice. Nineteen workplace characteristics and their associations with workplace satisfaction were tested in a univariate analysis using χ(2) tests and in a multiple logistic regression model to test for associations with satisfaction. Workplace satisfaction among BG and GX radiologists was 78% and 80%, respectively. Both generations reported higher satisfaction if they were optimistic about the future of radiology (87% of BG vs 85% of GX radiologists), believed the difference in the desired versus expected age of retirement was narrow (1.5 ± 3.3 years for BG radiologists vs 3.0 ± 4.1 years for GX radiologists), felt that social interactions in the workplace were important (81% of BG vs 83% of GX radiologists), and believed that professionalism in their peers was important (79% of BG vs 82% of GX radiologists). BG radiologists were more satisfied if they valued staff diversity, while GX radiologists were more satisfied if they felt that job security and the amount of compensation were important. There was no significant association of satisfaction with generation, gender, practice setting, or additional administrative work. Workplace satisfaction among practicing radiologists remains high but has decreased compared with prior surveys. The two dominant generations of practicing radiologists have similar workplace satisfaction rates and desired workplace characteristics. Copyright © 2014 American College of Radiology. Published

The Freight Analysis Framework Verson 4 (FAF4) - Building the FAF4 Regional Database: Data Sources and Estimation Methodologies

Energy Technology Data Exchange (ETDEWEB)

Hwang, Ho-Ling [ORNL; Hargrove, Stephanie [ORNL; Chin, Shih-Miao [ORNL; Wilson, Daniel W [ORNL; Taylor, Rob D [ORNL; Davidson, Diane [ORNL

2016-09-01

The Freight Analysis Framework (FAF) integrates data from a variety of sources to create a comprehensive national picture of freight movements among states and major metropolitan areas by all modes of transportation. It provides a national picture of current freight flows to, from, and within the United States, assigns the flows to the transportation network, and projects freight flow patterns into the future. The FAF4 is the fourth database of its kind, FAF1 provided estimates for truck, rail, and water tonnage for calendar year 1998, FAF2 provided a more complete picture based on the 2002 Commodity Flow Survey (CFS) and FAF3 made further improvements building on the 2007 CFS. Since the first FAF effort, a number of changes in both data sources and products have taken place. The FAF4 flow matrix described in this report is used as the base-year data to forecast future freight activities, projecting shipment weights and values from year 2020 to 2045 in five-year intervals. It also provides the basis for annual estimates to the FAF4 flow matrix, aiming to provide users with the timeliest data. Furthermore, FAF4 truck freight is routed on the national highway network to produce the FAF4 network database and flow assignments for truck. This report details the data sources and methodologies applied to develop the base year 2012 FAF4 database. An overview of the FAF4 components is briefly discussed in Section 2. Effects on FAF4 from the changes in the 2012 CFS are highlighted in Section 3. Section 4 provides a general discussion on the process used in filling data gaps within the domestic CFS matrix, specifically on the estimation of CFS suppressed/unpublished cells. Over a dozen CFS OOS components of FAF4 are then addressed in Section 5 through Section 11 of this report. This includes discussions of farm-based agricultural shipments in Section 5, shipments from fishery and logging sectors in Section 6. Shipments of municipal solid wastes and debris from construction

VizieR Online Data Catalog: Classification of 2XMM variable sources (Lo+, 2014)

Science.gov (United States)

Lo, K. K.; Farrell, S.; Murphy, T.; Gaensler, B. M.

2017-06-01

The 2XMMi-DR2 catalog (Cat. IX/40) consists of observations made with the XMM-Newton satellite between 2000 and 2008 and covers a sky area of about 420 deg2. The observations were made using the European Photon Imaging Camera (EPIC) that consists of three CCD cameras - pn, MOS1, and MOS2 - and covers the energy range from 0.2 keV to 12 keV. There are 221012 unique sources in 2XMM-DR2, of which 2267 were flagged as variable by the XMM processing pipeline (Watson et al. 2009, J/A+A/493/339). The variability test used by the pipeline is a {Chi}2 test against the null hypothesis that the source flux is constant, with the probability threshold set at 10-5. (1 data file).

3β-Methyl-Neurosteroid Analogs are Preferential Positive Allosteric Modulators and Direct Activators of Extrasynaptic δGABA-A Receptors in the Hippocampus Dentate Gyrus Subfield.

Science.gov (United States)

Chuang, Shu-Hui; Reddy, Doodipala Samba

2018-03-30

Neurosteroids are powerful modulators of GABA-A receptors. Ganaxolone (3α-hydroxy-3β-methyl-5α-pregnan-20-one, GX) and synthetic analogs of the neurosteroid allopregnanolone (AP) are designed to treat epilepsy and related conditions. However, their precise mechanism of action in native neurons remains unclear. Here, we sought to determine the mode of action of GX and its analogs at GABA-A receptors in native hippocampal neurons by analyzing extrasynaptic receptor-mediated tonic currents and synaptic receptor-mediated phasic currents. Concentration-response profiles of GX were determined in two cell types: δ-containing dentate gyrus granule cells (DGGCs) and γ2-containing CA1 pyramidal cells (CA1PCs). GX produced significantly greater potentiation of the GABA-A receptor-activated chloride currents in DGGCs (500%) than CA1PCs (200%). In the absence of GABA, GX evoked 2-fold greater inward currents in DGGCs than CA1PCs, which were 2-fold greater than AP within DGGCs. In hippocampus slices, GX potentiated and directly activated tonic currents in DGGCs. These responses were significantly diminished in DGGCs from δ-subunit knockout (δKO) mice, confirming GX's selectivity for δGABA-A receptors. Like AP, GX potentiation of tonic currents was prevented by protein kinase C inhibition. Furthermore, GX's protection against hippocampus kindled seizures was significantly diminished in δKO mice. GX analogs exhibited greater potency and efficacy than GX on δGABA-A receptor-mediated tonic inhibition. In summary, these results provide strong evidence that GX and its analogs are preferential allosteric modulators and direct activators of extrasynaptic δGABA-A receptors regulating network inhibition and seizures in the dentate gyrus. Therefore, these findings provide a mechanistic rationale for the clinical use of synthetic neurosteroids in epilepsy and seizure disorders. The American Society for Pharmacology and Experimental Therapeutics.

Genetic moderation of child maltreatment effects on depression and internalizing symptoms by 5-HTTLPR, BDNF, NET, and CRHR1 genes in African-American children

Science.gov (United States)

Cicchetti, Dante; Rogosch, Fred A.

2014-01-01

Genetic moderation of the effects of child maltreatment on depression and internalizing symptoms was investigated in a sample of low-income maltreated and nonmaltreated African-American children (N = 1,096). Lifetime child maltreatment experiences were independently coded from Child Protective Services records and maternal report. Child depression and internalizing problems were assessed in the context of a summer research camp by self-report (Children’s Depression Inventory, CDI) and adult counselor-report (Teacher Report Form, TRF). DNA was obtained from buccal cell or saliva samples and genotyped for polymorphisms of the following genes: 5-HTTLPR, BDNF, NET, and CRHR1. ANCOVAs with age and gender as covariates were conducted, with maltreatment status and respective polymorphism as main effects and their GxE interactions. Maltreatment consistently was associated with higher CDI and TRF symptoms. Results for child self-report symptoms indicated a GxE interaction for BDNF and maltreatment. Additionally, BDNF and tri-allelic 5-HTTLPR interacted with child maltreatment in a GxGxE interaction. Analyses for counselor-report of child anxiety/depression symptoms on the TRF indicated moderation of child maltreatment effects by tri-allelic 5-HTTLPR. These effects were elaborated based on variation in developmental timing of maltreatment experiences. NET was found to further moderate the GxE interaction of 5-HTTLPR and maltreatment status revealing a GxGxE interaction. This GxGxE was extended by consideration of variation in maltreatment subtype experiences. Finally, GxGxE effects were observed for the co-action of BDNF and the CRHR1 haplotype. The findings illustrate the variable influence of specific genotypes in GxE interactions based on variation in maltreatment experiences and the importance of a multi-genic approach for understanding influences on depression and internalizing symptoms among African-American children. PMID:25422957

Journal of Astrophysics and Astronomy | Indian Academy of Sciences

Indian Academy of Sciences (India)

2016-01-27

-ray Timing Experiment (HEXTE) on board Rossi X-Ray Timing Explorer for Z source GX 17+2, we investigate the evolution of its PCA spectra and HEXTE spectra along a `Z' track on its hardness-intensity diagram. A hard ...

Results of a new ''OCTOPUS'' ECR ion source at 6.4 GHz

International Nuclear Information System (INIS)

Dupont, C.; Jongen, Y.; Arakawa, K.; Yokota, W.; Satoh, T.; Tachikawa, T.

1990-01-01

The first OCTOPUS electron cyclstron resonance (ECR) multicharged heavy ion source was built in 1985 at the Centre de Recherches du Cyclotron of the University of Louvain (Belgium). This first source used an ECR frequency of 14.3 GHz in the injector stage and 8.5 GHz in the main confinement stage. A new OCTOPUS source has now been built for a new cyclotron to be installed at the Japan Atomic Energy Research Institute (JAERI). The design of this new OCTOPUS source is identical to the first OCTOPUS source, but uses an ECR frequency of 6.4 GHz in the main confinement stage. The experimental results are described, and a comparison is made between the two sources. However, the available data does not allow any clear conclusion to be drawn on frequency scaling

Bowen emission from Aquila X-1: evidence for multiple components and constraint on the accretion disc vertical structure

Science.gov (United States)

Jiménez-Ibarra, F.; Muñoz-Darias, T.; Wang, L.; Casares, J.; Mata Sánchez, D.; Steeghs, D.; Armas Padilla, M.; Charles, P. A.

2018-03-01

We present a detailed spectroscopic study of the optical counterpart of the neutron star X-ray transient Aquila X-1 during its 2011, 2013 and 2016 outbursts. We use 65 intermediate resolution GTC-10.4 m spectra with the aim of detecting irradiation-induced Bowen blend emission from the donor star. While Gaussian fitting does not yield conclusive results, our full phase coverage allows us to exploit Doppler mapping techniques to independently constrain the donor star radial velocity. By using the component N III 4640.64/4641.84 Å, we measure Kem = 102 ± 6 km s-1. This highly significant detection (≳13σ) is fully compatible with the true companion star radial velocity obtained from near-infrared spectroscopy during quiescence. Combining these two velocities we determine, for the first time, the accretion disc opening angle and its associated error from direct spectroscopic measurements and detailed modelling, obtaining α = 15.5 ^{+ 2.5}_{-5} deg. This value is consistent with theoretical work if significant X-ray irradiation is taken into account and is important in the light of recent observations of GX339-4, where discrepant results were obtained between the donor's intrinsic radial velocity and the Bowen-inferred value. We also discuss the limitations of the Bowen technique when complete phase coverage is not available.

(CH4)-C-14 Measurements in Greenland Ice: Investigating Last Glacial Termination CH4 Sources

DEFF Research Database (Denmark)

Petrenko, V. V.; Smith, A. M.; Brook, E. J.

2009-01-01

by direct cosmogenic C-14 production in ice. C-14 of CO was measured to better understand this process and correct the sample (CH4)-C-14. Corrected results suggest that wetland sources were likely responsible for the majority of the Younger Dryas-Preboreal CH4 rise.......The cause of a large increase of atmospheric methane concentration during the Younger Dryas-Preboreal abrupt climatic transition (similar to 11,600 years ago) has been the subject of much debate. The carbon-14 (C-14) content of methane ((CH4)-C-14) should distinguish between wetland and clathrate...... contributions to this increase. We present measurements of (CH4)-C-14 in glacial ice, targeting this transition, performed by using ice samples obtained from an ablation site in west Greenland. Measured (CH4)-C-14 values were higher than predicted under any scenario. Sample (CH4)-C-14 appears to be elevated...

Closure report for CAU 339: Area 12 Fleet Operations steam-cleaning discharge area, Nevada Test Site

International Nuclear Information System (INIS)

1997-12-01

This Closure Report (CR) provides documentation of the completed corrective action at the Area 12 Fleet Operations site located in the southeast portion of the Area 12 Camp at the Nevada Test Site (NTS). Field work was performed in July 1997 as outlined in the Corrective Action Plan (CAP). The CAP was approved by the Nevada Division of Environmental Protection (NDEP) in June 1997. This site is identified in the Federal Facility Agreement and Consent Order (FFACO) as Corrective Action Site (CAS) Number 12-19-01 and is the only CAS in Corrective Action Unit (CAU) 339. The former Area 12 Fleet Operations Building 12-16 functioned as a maintenance facility for light- and heavy-duty vehicles from approximately 1965 to January 1993. Services performed at the site included steam-cleaning, tire service, and preventative maintenance on vehicles and equipment. Past activities impacted the former steam-cleaning discharge area with volatile organic compounds (VOCs) and total petroleum hydrocarbons (TPH) as oil

228Ra and 226Ra measurement on a BaSO4 co-precipitation source

International Nuclear Information System (INIS)

Medley, Peter; Martin, Paul; Bollhöfer, Andreas; Parry, David

2015-01-01

One of the most commonly-used methods for determination of 226 Ra, particularly in water samples, utilises co-precipitation of Ra with BaSO 4 , followed by microfiltration to produce a source for alpha counting. This paper describes two extensions to BaSO 4 co-precipitation methods which enable determination of 228 Ra using the same source. The adaptations presented here do not introduce any contaminants that will affect the separation of radium or alpha counting for 226 Ra, and can be used for re-analysis of already existing sources prepared by BaSO 4 co-precipitation. The first adaptation uses detection of 228 Ac on the source by gamma spectrometry. The detection efficiency is high, allowing analysis of water samples at sufficiently low activity to be suitable in testing for compliance with drinking water quality standards. As 228 Ac grows in quickly, taking less than 2 days to reach equilibrium with the 228 Ra parent, this can also be useful in radiological emergency response situations. The second adaptation incorporates a method for the digestion of BaSO 4 sources, allowing separation of thorium and subsequent determination of 228 Th activity. Although ingrowth periods for 228 Th can be lengthy, very low detection limits for 228 Ra can be achieved with this technique. - Highlights: • We developed two methods for 228 Ra measurement on Ba(Ra)SO 4 co-precipitation sources. • Measurement by gamma spectrometry using the daughter 228 Ac is rapid. • Detection limits are suitable for assessment of drinking water quality. • The second approach uses alpha spectrometry on a separated Th fraction. • This is more sensitive than gamma spectrometry after an ingrowth period greater than about 1 month

Full-length genome sequence analysis of four subgroup J avian leukosis virus strains isolated from chickens with clinical hemangioma.

Science.gov (United States)

Lin, Lulu; Wang, Peikun; Yang, Yongli; Li, Haijuan; Huang, Teng; Wei, Ping

2017-12-01

Since 2014, cases of hemangioma associated with avian leukosis virus subgroup J (ALV-J) have been emerging in commercial chickens in Guangxi. In this study, four strains of the subgroup J avian leukosis virus (ALV-J), named GX14HG01, GX14HG04, GX14LT07, and GX14ZS14, were isolated from chickens with clinical hemangioma in 2014 by DF-1 cell culture and then identified with ELISA detection of ALV group specific antigen p27, the detection of subtype specific PCR and indirect immunofluorescence assay (IFA) with ALV-J specific monoclonal antibody. The complete genomes of the isolates were sequenced and it was found that the gag and pol were relatively conservative, while env was variable especially the gp85 gene. Homology analysis of the env gene sequences showed that the env gene of all the four isolates had higher similarities with the hemangioma (HE)-type reference strains than that of the myeloid leukosis (ML)-type strains, and moreover, the HE-type strains' specific deletion of 205-bp sequence covering the rTM and DR1 in 3'UTR fragment was also found in the four isolates. Further analysis on the sequences of subunits of env gene revealed an interesting finding: the gp85 of isolates GX14ZS14 and GX14HG04 had a higher similarity with HPRS-103 and much lower similarity with the HE-type reference strains resulting in GX14ZS14, GX14HG04, and HPRS-103 being clustered in the same branch, while gp37 had higher similarities with the HE-type reference strains when compared to that of HPRS-103, resulted in GX14ZS14, GX14HG04, and HE-type reference strains being clustered in the same branch. The results suggested that isolates GX14ZS14 and GX14HG04 may be the recombinant strains of the foreign strain HPRS-103 with the local epidemic HE-type strains of ALV-J.

Calibrated radioactive sources - absolute measurements using a 4{pi} {beta}-{gamma} apparatus; Sources etalons de radioactivite - mesures absolues au moyen d'un ensemble 4{pi} {beta}-{gamma}

Energy Technology Data Exchange (ETDEWEB)

Benoit, P; Philis, C [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1965-07-01

In this paper, the principle of the standardization of the radioisotopes by the 4{pi} {beta} - {gamma} coincidence method is reminded. Some theoretical examples are given emphasizing on instrumental coincidences and their corrections. The experimental apparatus is described: one discusses the choice of the experimental conditions for the many isotopes measured. Results are given and discussed. In appendix we describe the preparation of the sources. (authors) [French] Dans ce rapport, nous rappelons d'abord le principe de la methode d'etalonnage 4{pi} {beta} - {gamma} en donnant quelques exemples theoriques et en insistant sur la correction des erreurs instrumentales. Une description critique de l'appareillage utilise est donnee. On discute le choix des conditions experimentales pour divers isotopes mesures et les resultats obtenus. En annexe, nous decrivons la fabrication des sources que nous mesurons.

On strongly J -clean rings associated with polynomial identity g ( x =0

Directory of Open Access Journals (Sweden)

Hamid Haj seyyed javadi

2014-05-01

Full Text Available In this paper‎, ‎we introduce the new notion of strongly $J $-clean rings associated with polynomial identity $g(x=0$‎, ‎as a generalization of strongly $ J $-clean rings‎. ‎We denote strongly $J $-clean rings associated with polynomial identity $g(x=0$ by strongly $ g(x $-$J $-clean rings‎. ‎Next‎, ‎we investigate some properties of strongly $ g(x $-$ J $-clean.

Use of remote sensing to identify waste sources at ORNL's SWSA 4

International Nuclear Information System (INIS)

Huff, D.D.; Doll, W.E.; Nyquist, J.E.

1995-01-01

Solid waste storage area (SWSA) 4, at Oak Ridge National Laboratory (ORNL), contributes 25% of the 90 Sr release from the ORNL complex. Disposal records were destroyed in a fire, thus limiting the ability to locate waste sources contributing to the releases. The use of remote sensing products, including photos and thermal spectra images, provided the needed information to allow field work to progress in an efficient and cost-effective manner. As a result, four major sources were identified. Preliminary estimates suggest that cost avoidance in excess of $5 million will be possible because of the detailed source location knowledge

Risk score modeling of multiple gene to gene interactions using aggregated-multifactor dimensionality reduction

Directory of Open Access Journals (Sweden)

Dai Hongying

2013-01-01

Full Text Available Abstract Background Multifactor Dimensionality Reduction (MDR has been widely applied to detect gene-gene (GxG interactions associated with complex diseases. Existing MDR methods summarize disease risk by a dichotomous predisposing model (high-risk/low-risk from one optimal GxG interaction, which does not take the accumulated effects from multiple GxG interactions into account. Results We propose an Aggregated-Multifactor Dimensionality Reduction (A-MDR method that exhaustively searches for and detects significant GxG interactions to generate an epistasis enriched gene network. An aggregated epistasis enriched risk score, which takes into account multiple GxG interactions simultaneously, replaces the dichotomous predisposing risk variable and provides higher resolution in the quantification of disease susceptibility. We evaluate this new A-MDR approach in a broad range of simulations. Also, we present the results of an application of the A-MDR method to a data set derived from Juvenile Idiopathic Arthritis patients treated with methotrexate (MTX that revealed several GxG interactions in the folate pathway that were associated with treatment response. The epistasis enriched risk score that pooled information from 82 significant GxG interactions distinguished MTX responders from non-responders with 82% accuracy. Conclusions The proposed A-MDR is innovative in the MDR framework to investigate aggregated effects among GxG interactions. New measures (pOR, pRR and pChi are proposed to detect multiple GxG interactions.

Estudio de la viabilidad de fabricación de un sistema codo (fundición inoxidable ferrítica, GX 260 Cr27-tubo composite (Incolloy 800 HT+Stal 2465 solidario por fusión

Directory of Open Access Journals (Sweden)

Gutiérrez de Solabarría, S.

1995-10-01

Full Text Available Flying ashes captured by ciclones in the experimental plant for combustion in pressure fluid bed, in Escatrón Power Plant (Zaragoza, Spain, circulate through the gas cleaning system and are evacuated by means of pneumatic transport. The temperature of these ashes is aprox. 800 °C and the relative pressure is up to 8 negative bars relating the outdoor pressure of the transport pipe. The configuration of the pneumatic transport lines is Incolloy 800 HT quality composite tubes lined with Stal 2465 in straight stretches. Regarding direction changes, ferritic stainless casting, quality GX 260 Cr 27 elbows are used. The aim of this work is to study the possibility of manufacturing a solidary system by means of melting between the ferritic stainless casting elbow and the composite pipe.

Las cenizas volantes captadas por ciclones en la planta experimental de combustión en lecho fluido a presión, de la central térmica de Escatrón (Zaragoza, circulan por el sistema de depuración de gases y son evacuadas mediante transporte neumático. Estas cenizas se encuentran a una temperatura aproximada de 800 °C y a una presión relativa de hasta 8 bares negativos con respecto a la presión en el exterior de la tubería de transporte. Para configurar las líneas de transporte neumático, se utilizan en los tramos rectos tubos composite de calidad Incolloy 800 HT recubiertos interiormente de material Stal 2465. Para los cambios de dirección, se utilizan codos de fundición inoxidable ferrítica de calidad GX 260 Cr 27. El objetivo del presente trabajo es estudiar la viabilidad de fabricación de un sistema solidario por fusión entre el codo de fundición inoxidable ferrítica y la tubería composite.

Pt Electrodes Enable the Formation of μ4-O Centers in MOF-5 from Multiple Oxygen Sources.

Science.gov (United States)

Li, Minyuan M; Dincă, Mircea

2017-10-04

The μ 4 -O 2- ions in the Zn 4 O(O 2 C-) 6 secondary building units of Zn 4 O(1,4-benzenedicarboxylate) 3 (MOF-5) electrodeposited under cathodic bias can be sourced from nitrate, water, and molecular oxygen when using platinum gauze as working electrodes. The use of Zn(ClO 4 ) 2 ·6H 2 O, anhydrous Zn(NO 3 ) 2 , or anhydrous Zn(CF 3 SO 3 ) 2 as Zn 2+ sources under rigorous control of other sources of oxygen, including water and O 2 , confirm that the source of the μ 4 -O 2- ions can be promiscuous. Although this finding reveals a relatively complicated manifold of electrochemical processes responsible for the crystallization of MOF-5 under cathodic bias, it further highlights the importance of hydroxide intermediates in the formation of the Zn 4 O(O 2 C-R) secondary building units in this iconic material and is illustrative of the complicated crystallization mechanisms of metal-organic frameworks in general.

Preparation of Films and Sources for 4{pi} Counting; Prigotovlenie dlya 4{pi}-scheta plenok i istochnikov

Energy Technology Data Exchange (ETDEWEB)

Konstantinov, A. A.; Sazonova, T. E. [Vsesojuznyj Nauchno - Isledovatel' skij Institut Im. D.I. Mendeleeva, Leningrad, SSSR (Russian Federation)

1967-03-15

To obtain a high degree of accuracy in determining the specific activity of sources by the absolute counting of particles with a 4{pi} counter, attention must be paid to the preparation of the radioactive sources. At the Mendeleev Institute of Metrology, celluloid films (surface density 8-10 {mu}/cm{sup 2}) coated on both sides with gold (10-15 {mu}g/cm{sup 2} ) or palladium (5-6 {mu}g/cm{sup 2}) are used as the bases of the radioactive sources. In order to reduce the correction for absorption of beta particles in the radioactive deposit, the base is specially treated with insulin. The authors present an extremely sensitive and effective method, employing the electron-capture nuclide {sup 54}Mn ({sup 54}Cr), for determining the uniform distribution of the active layer over the entire insulintreated surface. A solution of {sup 54}Mn ({sup 54}Cr) salt was applied to the insulin-tteated film, and the source of {sup 54}Cr ({sup 54}Mn) Auger K electrons thus obtained was investigated with the help of a proportional 4{pi} counter. The total number of {sup 54}Cr ({sup 54}Mn) Auger K electrons from the source was 8-12% less than the fluorescence coefficient (calculated from the number of {sup 54}Cr ({sup 54}Mn) K X-quanta emitted by the source) and the number of K electrons absorbed in the film (determined by the 'sandwich' method). From the differences, for insulintreated and untreated {sup 54}Mn ({sup 54}Cr) sources, between the calculated and recorded number of Auger electrons it is possible to reach a definite conclusion regarding the quality of the insulin treatment. (author) [Russian] Dlja poluchenija vysokoj tochnosti izmerenij pri opredelenii udel'noj aktivnosti istochnikov metodom absoljutnogo scheta chastic s pomoshh'ju 4{pi}- schetchika, bol'shoe vnimanie dolzhno byt' udeleno prigotovleniju radioaktivnyh istochnikov. Vo VNIIM v kachestve podlozhek radioaktivnyh istochnikov ispol'zujutsja celluloidnye plenki (poverhnostnaja plot- nost' 8-10 mkg/sm{sup 2

Genotype by energy expenditure interaction with metabolic syndrome traits: the Portuguese healthy family study.

Directory of Open Access Journals (Sweden)

Daniel M V Santos

Full Text Available Moderate-to-high levels of physical activity are established as preventive factors in metabolic syndrome development. However, there is variability in the phenotypic expression of metabolic syndrome under distinct physical activity conditions. In the present study we applied a Genotype X Environment interaction method to examine the presence of GxEE interaction in the phenotypic expression of metabolic syndrome. A total of 958 subjects, from 294 families of The Portuguese Healthy Family study, were included in the analysis. Total daily energy expenditure was assessed using a 3 day physical activity diary. Six metabolic syndrome related traits, including waist circumference, systolic blood pressure, glucose, HDL cholesterol, total cholesterol and triglycerides, were measured and adjusted for age and sex. GxEE examination was performed on SOLAR 4.3.1. All metabolic syndrome indicators were significantly heritable. The GxEE interaction model fitted the data better than the polygenic model (p<0.001 for waist circumference, systolic blood pressure, glucose, total cholesterol and triglycerides. For waist circumference, glucose, total cholesterol and triglycerides, the significant GxEE interaction was due to rejection of the variance homogeneity hypothesis. For waist circumference and glucose, GxEE was also significant by the rejection of the genetic correlation hypothesis. The results showed that metabolic syndrome traits expression is significantly influenced by the interaction established between total daily energy expenditure and genotypes. Physical activity may be considered an environmental variable that promotes metabolic differences between individuals that are distinctively active.

Comparison of LiFePO4 from different sources

OpenAIRE

Striebel, Kathryn; Shim, Joongpyo; Srinivasan, Venkat; Newman, John

2003-01-01

The lithium iron phosphate chemistry is plagued by the poor conductivity and slow lithium diffusion in the solid phase. In order to alleviate these problems, various research groups have adopted different strategies including decreasing the particle sizes, increasing the carbon content, and adding dopants. In this study we obtained LiFePO4 electrodes from six different sources and used a combined model-experimental approach to compare the performance. Samples ranged from one with no carb...

Vacuum simulation and characterization for the Linac4 H- source

Science.gov (United States)

Pasquino, C.; Chiggiato, P.; Michet, A.; Hansen, J.; Lettry, J.

2013-02-01

At CERN, the 160 MeV H- Linac4 will soon replace the 50 MeV proton Linac2. In the H- source two major sources of gas are identified. The first is the pulsed injection at about 0.1 mbar in the plasma chamber. The second is the constant H2 injection up to 10-5 mbar in the LEBT for beam space charge compensation. In addition, the outgassing of materials exposed to vacuum can play an important role in contamination control and global gas balance. To evaluate the time dependent partial pressure profiles in the H- ion source and the RFQ, electrical network - vacuum analogy and test particle Monte Carlo simulation have been used. The simulation outcome indicates that the pressure requirements are in the reach of the proposed vacuum pumping system. Preliminary results show good agreement between the experimental and the simulated pressure profiles; a calibration campaign is in progress to fully benchmark the implemented calculations. Systematic outgassing rate measurements are on-going for critical components in the ion source and RFQ. Amongst them those for the Cu-coated SmCo magnet located in the vacuum system of the biased electron dump electrode, show results lower to stainless steel at room temperature.

Monte Carlo model for a thick target T(D,n)4 He neutron source

International Nuclear Information System (INIS)

Webster, W.M.

1976-01-01

A brief description is given of a calculational model developed to simulate a T(D,n) 4 He neutron source which is anisotropic in energy and intensity. The model also provides a means for including the time dependency of the neutron source. Although the model has been applied specifically to the Lawrence Livermore Laboratory ICT accelerator, the technique is general and can be applied to any similar neutron source

Injeção epidural preventiva de xilazina ou amitraz em eqüinos: efeitos clínicos e comportamentais Pre-emptive epidural injection of xylazine or amitraz, in horses: clinical and behavioral effects

Directory of Open Access Journals (Sweden)

Erica Cristina Bueno do Prado Guirro

2009-04-01

Full Text Available A xilazina é o fármaco agonista adrenérgico α2 mais utilizado pela via epidural de eqüinos e sabe-se que o amitraz tem ação sobre esses receptores. Assim, foram avaliados os efeitos clínicos e comportamentais causados pela injeção epidural de 0,17mg kg-1 de xilazina (GX ou de 0,1mg kg-1 de amitraz diluído em emulsão lipídica (GA durante 24 horas, em doze eqüinos. A freqüência cardíaca e a altura de cabeça mantiveram-se inalteradas; a freqüência respiratória aumentou de T105 a T360 no GX; a temperatura retal elevou-se de T120 a T720 em GA e de T360 a T720 em GX. Não houve diferença no tempo de latência para urinar ou defecar em ambos os grupos. Em relação às alterações comportamentais, o amitraz provocou sedação (50%, ptose labial (33,4% e palpebral (16,7%, enquanto que a xilazina promoveu ataxia (50%, sudorese perineal (33,4%, ptose palpebral (16,6% e relaxamento do esfíncter anal (16,6%. Considera-se segura a injeção epidural de xilazina ou amitraz em eqüinos, pois as alterações clínicas e comportamentais promovidas são leves e não limitam seu uso.Xylazine is the α2-adrenergic agonist more employed by epidural route in horses and it is known that amitraz acts on these receptors. So, clinical and behavioral effects caused by epidural injection of 0.17mg kg-1 xylazine (GX or 0.1mg.kg-1 amitraz diluted in lipidic emulsion (GA were evaluated in 12 horses. Heart rate and height of the head didn't change; respiratory rate increased from T105 to T360 in GX; rectal temperature increased from T120 to T720 in GA and from T360 to T720 in GX. There is no difference in latency to urine or defecate in both groups. Concerning behavioral changes, amitraz promoted sedation (50%, lip (33.4% and eye (16.6% dropping, while xylazine caused ataxia (50%, perineal sweating (33.4%, eye dropping (16.6% and anal sphincter relaxation (16.6%. So, epidural injection of xylazine or amitraz was considered safe because the clinical and

OSS4EVA: Using Open-Source Tools to Fulfill Digital Preservation Requirements

Directory of Open Access Journals (Sweden)

Heidi Dowding

2016-10-01

Full Text Available This paper builds on the findings of a workshop held at the 2015 International Conference on Digital Preservation (iPRES, entitled, “Using Open-Source Tools to Fulfill Digital Preservation Requirements” (OSS4PRES hereafter. This day-long workshop brought together participants from across the library and archives community, including practitioners, proprietary vendors, and representatives from open-source projects. The resulting conversations were surprisingly revealing: while OSS’ significance within the preservation landscape was made clear, participants noted that there are a number of roadblocks that discourage or altogether prevent its use in many organizations. Overcoming these challenges will be necessary to further widespread, sustainable OSS adoption within the digital preservation community. This article will mine the rich discussions that took place at OSS4PRES to (1 summarize the workshop’s key themes and major points of debate, (2 provide a comprehensive analysis of the opportunities, gaps, and challenges that using OSS entails at a philosophical, institutional, and individual level, and (3 offer a tangible set of recommendations for future work designed to broaden community engagement and enhance the sustainability of open source initiatives, drawing on both participants’ experience as well as additional research.

In-Pile 4He Source for UCN Production at the ESS

International Nuclear Information System (INIS)

Zanini, Luca; Batkov, Konstantin; Takibayev, Alan; Mezei, Ferenc; Klinkby, Esben; Schönfeldt, Troels; Pitcher, Eric

2014-01-01

ESS will be a premier neutron source facility. Unprecedented neutron beam intensities are ensured by spallation reactions of a 5 MW, 2.0 GeV proton beam impinging on a tungsten target equipped with advanced moderators. The work presented here aims at investigating possibilities for installing an ultra cold neutron (UCN) source at the ESS. One consequence of using the recently proposed flat moderators is that they take up less space than the moderators originally foreseen and thus leave more freedom to design a UCN source, close to the spallation hotspot. One of the options studied is to place a large 4 He UCN source in a through-going tube which penetrates the shielding below the target. First calculations of neutron flux available for UCN production are given, along with heat-load estimates. It is estimated that the flux can give rise to a UCN production at a rate of up to 1.5·10 8 UCN/s. A production in this range potentially allows for a number of UCN experiments to be carried out at unprecedented precision, including, for example, quantum gravitational spectroscopy with UCNs which rely on high phase-space density

Network Graph Analysis of Gene-Gene Interactions in Genome-Wide Association Study Data

Directory of Open Access Journals (Sweden)

Sungyoung Lee

2012-12-01

Full Text Available Most common complex traits, such as obesity, hypertension, diabetes, and cancers, are known to be associated with multiple genes, environmental factors, and their epistasis. Recently, the development of advanced genotyping technologies has allowed us to perform genome-wide association studies (GWASs. For detecting the effects of multiple genes on complex traits, many approaches have been proposed for GWASs. Multifactor dimensionality reduction (MDR is one of the powerful and efficient methods for detecting high-order gene-gene (GxG interactions. However, the biological interpretation of GxG interactions identified by MDR analysis is not easy. In order to aid the interpretation of MDR results, we propose a network graph analysis to elucidate the meaning of identified GxG interactions. The proposed network graph analysis consists of three steps. The first step is for performing GxG interaction analysis using MDR analysis. The second step is to draw the network graph using the MDR result. The third step is to provide biological evidence of the identified GxG interaction using external biological databases. The proposed method was applied to Korean Association Resource (KARE data, containing 8838 individuals with 327,632 single-nucleotide polymorphisms, in order to perform GxG interaction analysis of body mass index (BMI. Our network graph analysis successfully showed that many identified GxG interactions have known biological evidence related to BMI. We expect that our network graph analysis will be helpful to interpret the biological meaning of GxG interactions.

Network graph analysis of gene-gene interactions in genome-wide association study data.

Science.gov (United States)

Lee, Sungyoung; Kwon, Min-Seok; Park, Taesung

2012-12-01

Most common complex traits, such as obesity, hypertension, diabetes, and cancers, are known to be associated with multiple genes, environmental factors, and their epistasis. Recently, the development of advanced genotyping technologies has allowed us to perform genome-wide association studies (GWASs). For detecting the effects of multiple genes on complex traits, many approaches have been proposed for GWASs. Multifactor dimensionality reduction (MDR) is one of the powerful and efficient methods for detecting high-order gene-gene (GxG) interactions. However, the biological interpretation of GxG interactions identified by MDR analysis is not easy. In order to aid the interpretation of MDR results, we propose a network graph analysis to elucidate the meaning of identified GxG interactions. The proposed network graph analysis consists of three steps. The first step is for performing GxG interaction analysis using MDR analysis. The second step is to draw the network graph using the MDR result. The third step is to provide biological evidence of the identified GxG interaction using external biological databases. The proposed method was applied to Korean Association Resource (KARE) data, containing 8838 individuals with 327,632 single-nucleotide polymorphisms, in order to perform GxG interaction analysis of body mass index (BMI). Our network graph analysis successfully showed that many identified GxG interactions have known biological evidence related to BMI. We expect that our network graph analysis will be helpful to interpret the biological meaning of GxG interactions.

Sustained Accelerated Idioventricular Rhythm in a Centrifuge-Simulated Suborbital Spaceflight.

Science.gov (United States)

Suresh, Rahul; Blue, Rebecca S; Mathers, Charles; Castleberry, Tarah L; Vanderploeg, James M

2017-08-01

Hypergravitational exposures during human centrifugation are known to provoke dysrhythmias, including sinus dysrhythmias/tachycardias, premature atrial/ventricular contractions, and even atrial fibrillations or flutter patterns. However, events are generally short-lived and resolve rapidly after cessation of acceleration. This case report describes a prolonged ectopic ventricular rhythm in response to high G exposure. A previously healthy 30-yr-old man voluntarily participated in centrifuge trials as a part of a larger study, experiencing a total of 7 centrifuge runs over 48 h. Day 1 consisted of two +Gz runs (peak +3.5 Gz, run 2) and two +Gx runs (peak +6.0 Gx, run 4). Day 2 consisted of three runs approximating suborbital spaceflight profiles (combined +Gx and +Gz). Hemodynamic data collected included blood pressure, heart rate, and continuous three-lead electrocardiogram. Following the final acceleration exposure of the last Day 2 run (peak +4.5 Gx and +4.0 Gz combined, resultant +6.0 G), during a period of idle resting centrifuge activity (resultant vector +1.4 G), the subject demonstrated a marked change in his three-lead electrocardiogram from normal sinus rhythm to a wide-complex ectopic ventricular rhythm at a rate of 91-95 bpm, consistent with an accelerated idioventricular rhythm (AIVR). This rhythm was sustained for 2 m, 24 s before reversion to normal sinus. The subject reported no adverse symptoms during this time. While prolonged, the dysrhythmia was asymptomatic and self-limited. AIVR is likely a physiological response to acceleration and can be managed conservatively. Vigilance is needed to ensure that AIVR is correctly distinguished from other, malignant rhythms to avoid inappropriate treatment and negative operational impacts.Suresh R, Blue RS, Mathers C, Castleberry TL, Vanderploeg JM. Sustained accelerated idioventricular rhythm in a centrifuge-simulated suborbital spaceflight. Aerosp Med Hum Perform. 2017; 88(8):789-793.

High performance AlGaN/GaN HEMTs with 2.4 μm source-drain spacing

International Nuclear Information System (INIS)

Wang Dongfang; Wei Ke; Yuan Tingting; Liu Xinyu

2010-01-01

This paper describes the performance of AlGaN/GaN HEMTs with 2.4 μm source-drain spacing. So far these are the smallest source-drain spacing AlGaN/GaN HEMTs which have been implemented with a domestic wafer and domestic process. This paper also compares their performance with that of 4 μm source-drain spacing devices. The former exhibit higher drain current, higher gain, and higher efficiency. It is especially significant that the maximum frequency of oscillation noticeably increased. (semiconductor integrated circuits)

Vitamin K2 improves femoral bone strength without altering bone mineral density in gastrectomized rats.

Science.gov (United States)

Iwamoto, Jun; Sato, Yoshihiro; Matsumoto, Hideo

2014-01-01

Gastrectomy (GX) induces osteopenia in rats. The present study examined the skeletal effects of vitamin K2 in GX rats. Thirty male Sprague-Dawley rats (12 wk old) were randomized by the stratified weight method into the following three groups of 10 animals each: sham operation (control) group; GX group; and GX+oral vitamin K2 (menatetrenone, 30 mg/kg, 5 d/wk) group. Treatment was initiated at 1 wk after surgery. After 6 wk of treatment, the bone mineral content (BMC), bone mineral density (BMD), and mechanical strength of the femoral diaphysis and distal metaphysis were determined by peripheral quantitative computed tomography and mechanical strength tests, respectively. GX induced decreases in the BMC, BMD, and ultimate force of the femoral diaphysis and distal metaphysis. Vitamin K2 did not significantly influence the BMC or BMD of the femoral diaphysis or distal metaphysis in GX rats, but attenuated the decrease in the ultimate force and increased the stiffness of the femoral diaphysis. The present study showed that administration of vitamin K2 to GX rats improved the bone strength of the femoral diaphysis without altering the BMC or BMD, suggesting effects of vitamin K2 on the cortical bone quality.

Glutathiolactaldehyde as a probe of the overall stereochemical course of glyoxalase-I catalyzed reactions

International Nuclear Information System (INIS)

Brush, E.J.; Kozarich, J.W.

1986-01-01

The overall stereochemical course of the reactions catalyzed by glyoxalase-I (GX-I) has remained elusive as the substrates are equilibrium mixtures of rapidly interconverting diastereomeric thiohemiacetals. However, with the discovery of inverse substrate processing by Kozarich and coworkers, it is possible to design GX-I substrate analogs that are intrinsically more stable than the thiohemiacetals. Hence, Chari and Kozarich reported that glutathiohydroxyacetone (GHA, GSCH 2 COCH 2 OH) undergoes GX-I catalyzed exchange of the pro-S hydroxymethyl proton with solvent deuterium. Their data suggest that GX-I processes a single diastereomeric thiohemiacetal, and are consistent with a cis-enediol intermediate. To test this hypothesis and to follow the overall stereochemistry on a single substrate, they have prepared glutathiolactaldehyde (GLA, GSCH 2 CHOHCHO) as a potential inverse substrate. Human erythrocyte GX-I catalyzes the isomerization of GLA to GHA as evidenced by UV and NMR spectra of the product. Solvent deuterium is incorporated into the hydroxymethyl position, and NMR data suggest that incorporation is stereospecific. Furthermore, 50% of the expected amount of GHA is produced indicating that only one diastereomer of GLA is processed by GX-I. Identification of the absolute stereochemistry of the substrate diastereomer will lead to a clarification of the overall stereochemical and mechanistic course of GX-I catalyzed reactions

The 100 strongest radio point sources in the field of the Large Magellanic Cloud at 1.4 GHz

Directory of Open Access Journals (Sweden)

Payne J.L.

2009-01-01

Full Text Available We present the 100 strongest 1.4 GHz point sources from a new mosaic image in the direction of the Large Magellanic Cloud (LMC. The observations making up the mosaic were made using Australia Telescope Compact Array (ATCA over a ten year period and were combined with Parkes single dish data at 1.4 GHz to complete the image for short spacing. An initial list of co-identifications within 1000 at 0.843, 4.8 and 8.6 GHz consisted of 2682 sources. Elimination of extended objects and artifact noise allowed the creation of a refined list containing 1988 point sources. Most of these are presumed to be background objects seen through the LMC; a small portion may represent compact H ii regions, young SNRs and radio planetary nebulae. For the 1988 point sources we find a preliminary average spectral index (α of -0.53 and present a 1.4 GHz image showing source location in the direction of the LMC.

The 100 Strongest Radio Point Sources in the Field of the Large Magellanic Cloud at 1.4 GHz

Directory of Open Access Journals (Sweden)

Payne, J. L.

2009-06-01

Full Text Available We present the 100 strongest 1.4~GHz point sources from a new mosaicimage in the direction of the Large Magellanic Cloud (LMC. The observationsmaking up the mosaic were made using Australia Telescope Compact Array (ATCAover a ten year period and were combined with Parkes single dish data at 1.4 GHz to complete the image for short spacing. An initial list of co-identifications within 10arcsec at 0.843, 4.8 and 8.6 GHz consisted of 2682 sources. Elimination of extended objects and artifact noise allowed the creation of a refined list containing 1988 point sources. Most of these are presumed to be background objects seen through the LMC; a small portion may represent compact HII regions, young SNRs and radio planetary nebulae. For the 1988 point sources we find a preliminary average spectral index ($alpha$ of -0.53 and present a 1.4 GHz image showing source locationin the direction of the LMC.

Measurement of Double Longitudinal Spin Asymmetry, ALL, for Inclusive 0̂ Production at Forward Rapidity in PHENIX for √s=200 and 500 GeV

Science.gov (United States)

Wolin, Scott

2010-11-01

The Relativistic Heavy Ion Collider (RHIC) is the world's only source of polarized proton-proton collisions which provides access at leading order to δ G(x), the gluon contribution to the proton spin. Previously, PHENIX has only been sensitive to truncated moments of δ G over the limited Bjorken-x range of 0.05 Piston Calorimeter (MPC) at forward rapidity, di-hadron measurements with hadrons at both forward and central rapidities are now possible in PHENIX. Two forward hadrons extend the kinematic coverage for gluons down to x˜10-3. Such an asymmetry measurement for di-hadrons and single hadrons at forward rapidity can be used to improve the constraints on δ G(x) at small x. Here, we discuss the status of these measurements at forward rapidity in PHENIX using the MPC.

Transformation of 2,2′,4,4′-tetrabromodiphenyl ether under UV irradiation: Potential sources of the secondary pollutants

International Nuclear Information System (INIS)

Wang, Ji-Zhong; Hou, Yuqing; Zhang, Jianshun; Zhu, Jiping; Feng, Yong-Lai

2013-01-01

Highlights: • 2,2′,4,4′-Tetrabromodiphenyl ether (BDE-47) was found transformed to six less brominated BDE analogs under UV irradiation. • BDE-47 was found degraded faster in liquid phase than in gas phase. • Two brominated phenols were formed in the transformation of BDE-47 in gas phase. • The bromine on the ortho positions of the phenyl rings was found lost first to form 2,4,4′-tribromodiphenyl ether (BDE-28). • The more volatile less brominated BDEs are a source of secondary pollutants in the environment. -- Abstract: A commercial brominated flame retardant 2,2′,4,4′-tetrabromodiphenyl ether (BDE-47) was used as the model chemical to investigate the degradation and transformation of polybrominated diphenyl ethers (PBDEs) in gas and liquid phases, respectively, under ultraviolet (UV) irradiation. The results showed that BDE-47 can be transformed to less-brominated BDE analogs. A total of six compounds that are less-brominated BDEs and two brominated phenols were observed as transformation products in the reaction mixtures. Different degradation rates of BDE-47 in n-nonane and in isooctane in the same chamber system were observed. Degradation rate of BDE-47 in n-nonane was faster than in isooctane. Under UV irradiation, the bromine on the ortho positions of the phenyl rings was lost first to form 2,4,4′-tribromodiphenyl ether (BDE-28), which then progressively lead to 4,4′-dibromodiphenyl ether (BDE-15) or 2,4′-dibromodiphenyl ether (BDE-8). An airborne transformation pathway has been proposed according to observed transformation products. The more volatile less-brominated BDEs from transformation of BDE-47 are easily evaporated into air to be a source of secondary pollutants in the environment

GENE X ENVIRONMENT INTERACTIONS IN SCHIZOPHRENIA AND BIPOLAR DISORDER:EVIDENCE FROM NEUROIMAGING

Directory of Open Access Journals (Sweden)

Pierre Alexis Geoffroy

2013-10-01

Full Text Available Introduction: Schizophrenia (SZ and Bipolar disorder (BD are considered as severe multifactorial diseases, stemming from genetic and environmental influences. Growing evidence supports gene x environment (GxE interactions in these disorders and neuroimaging studies can help us to understand how those factors mechanistically interact. No reviews synthesized the existing data of neuroimaging studies in these issues.Methods: We conduct a systematic review on the neuroimaging studies exploring GxE interactions relative to SZ or BD in PubMed.Results: First results of the influence of genetic and environmental risks on brain structures came from monozygotic twin pairs concordant and discordant for SZ or BD. Few structural magnetic resonance imaging (sMRI studies have explored the GxE interactions. No other imaging methods were found. Two main GxE interactions on brain volumes have arisen. First, an interaction between genetic liability to SZ and obstetric complications on gray matter, cerebrospinal fluid and hippocampal volumes. Second, cannabis use and genetic liability interaction effects on cortical thickness and white matter volumes.Conclusion: Combining GxE interactions and neuroimaging domains is a promising approach. Genetic risk and environmental exposures such as cannabis or obstetrical complications seem to interact leading to specific neuroimaging cerebral alterations in SZ. They are suggestive of GxE interactions that confer phenotypic abnormalities in SZ and possibly BD. We need further, larger neuroimaging studies of GxE interactions for which we may propose a framework focusing on GxE interactions data already known to have a clinical effect such as infections, early stress, urbanicity and substance abuse.

AUXIN BINDING PROTEIN 4 is involved in the Ca2+/auxin-regulated expression of ZCAX3 gene in maize (Zea mays)

Czech Academy of Sciences Publication Activity Database

Jurišić-Knežev, Dejana; Bergougnoux, Véronique; Milde, D.; Fellner, Martin

2014-01-01

Roč. 92, č. 5 (2014), s. 332-339 ISSN 1916-2790 R&D Projects: GA MŠk 1P05ME792 Institutional support: RVO:61389030 Keywords : auxin-binding protein * ABP4 * AtCAX1 Subject RIV: EF - Botanics Impact factor: 1.278, year: 2014

Developmentally Sensitive Interaction Effects of Genes and the Social Environment on Total and Subcortical Brain Volumes.

Directory of Open Access Journals (Sweden)

Jennifer S Richards

Full Text Available Smaller total brain and subcortical volumes have been linked to psychopathology including attention-deficit/hyperactivity disorder (ADHD. Identifying mechanisms underlying these alterations, therefore, is of great importance. We investigated the role of gene-environment interactions (GxE in interindividual variability of total gray matter (GM, caudate, and putamen volumes. Brain volumes were derived from structural magnetic resonance imaging scans in participants with (N = 312 and without ADHD (N = 437 from N = 402 families (age M = 17.00, SD = 3.60. GxE effects between DAT1, 5-HTT, and DRD4 and social environments (maternal expressed warmth and criticism; positive and deviant peer affiliation as well as the possible moderating effect of age were examined using linear mixed modeling. We also tested whether findings depended on ADHD severity. Deviant peer affiliation was associated with lower caudate volume. Participants with low deviant peer affiliations had larger total GM volumes with increasing age. Likewise, developmentally sensitive GxE effects were found on total GM and putamen volume. For total GM, differential age effects were found for DAT1 9-repeat and HTTLPR L/L genotypes, depending on the amount of positive peer affiliation. For putamen volume, DRD4 7-repeat carriers and DAT1 10/10 homozygotes showed opposite age relations depending on positive peer affiliation and maternal criticism, respectively. All results were independent of ADHD severity. The presence of differential age-dependent GxE effects might explain the diverse and sometimes opposing results of environmental and genetic effects on brain volumes observed so far.

Developmentally Sensitive Interaction Effects of Genes and the Social Environment on Total and Subcortical Brain Volumes.

Science.gov (United States)

Richards, Jennifer S; Arias Vásquez, Alejandro; Franke, Barbara; Hoekstra, Pieter J; Heslenfeld, Dirk J; Oosterlaan, Jaap; Faraone, Stephen V; Buitelaar, Jan K; Hartman, Catharina A

2016-01-01

Smaller total brain and subcortical volumes have been linked to psychopathology including attention-deficit/hyperactivity disorder (ADHD). Identifying mechanisms underlying these alterations, therefore, is of great importance. We investigated the role of gene-environment interactions (GxE) in interindividual variability of total gray matter (GM), caudate, and putamen volumes. Brain volumes were derived from structural magnetic resonance imaging scans in participants with (N = 312) and without ADHD (N = 437) from N = 402 families (age M = 17.00, SD = 3.60). GxE effects between DAT1, 5-HTT, and DRD4 and social environments (maternal expressed warmth and criticism; positive and deviant peer affiliation) as well as the possible moderating effect of age were examined using linear mixed modeling. We also tested whether findings depended on ADHD severity. Deviant peer affiliation was associated with lower caudate volume. Participants with low deviant peer affiliations had larger total GM volumes with increasing age. Likewise, developmentally sensitive GxE effects were found on total GM and putamen volume. For total GM, differential age effects were found for DAT1 9-repeat and HTTLPR L/L genotypes, depending on the amount of positive peer affiliation. For putamen volume, DRD4 7-repeat carriers and DAT1 10/10 homozygotes showed opposite age relations depending on positive peer affiliation and maternal criticism, respectively. All results were independent of ADHD severity. The presence of differential age-dependent GxE effects might explain the diverse and sometimes opposing results of environmental and genetic effects on brain volumes observed so far.

Isotopic source signatures: Impact of regional variability on the δ13CH4 trend and spatial distribution

Science.gov (United States)

Feinberg, Aryeh I.; Coulon, Ancelin; Stenke, Andrea; Schwietzke, Stefan; Peter, Thomas

2018-02-01

The atmospheric methane growth rate has fluctuated over the past three decades, signifying variations in methane sources and sinks. Methane isotopic ratios (δ13CH4) differ between emission categories, and can therefore be used to distinguish which methane sources have changed. However, isotopic modelling studies have mainly focused on uncertainties in methane emissions rather than uncertainties in isotopic source signatures. We simulated atmospheric δ13CH4 for the period 1990-2010 using the global chemistry-climate model SOCOL. Empirically-derived regional variability in the isotopic signatures was introduced in a suite of sensitivity simulations. These simulations were compared to a baseline simulation with commonly used global mean isotopic signatures. We investigated coal, natural gas/oil, wetland, livestock, and biomass burning source signatures to determine whether regional variations impact the observed isotopic trend and spatial distribution. Based on recently published source signature datasets, our calculated global mean isotopic signatures are in general lighter than the commonly used values. Trends in several isotopic signatures were also apparent during the period 1990-2010. Tropical livestock emissions grew during the 2000s, introducing isotopically heavier livestock emissions since tropical livestock consume more C4 vegetation than midlatitude livestock. Chinese coal emissions, which are isotopically heavy compared to other coals, increase during the 2000s leading to higher global values of δ13CH4 for coal emissions. EDGAR v4.2 emissions disagree with the observed atmospheric isotopic trend for almost all simulations, confirming past doubts about this emissions inventory. The agreement between the modelled and observed δ13CH4 interhemispheric differences improves when regional source signatures are used. Even though the simulated results are highly dependent on the choice of methane emission inventories, they emphasize that the commonly used

Expression and function of a CP339,818-sensitive K+ current in a subpopulation of putative nociceptive neurons from adult mouse trigeminal ganglia

Science.gov (United States)

Sforna, Luigi; D'Adamo, Maria Cristina; Servettini, Ilenio; Guglielmi, Luca; Pessia, Mauro; Franciolini, Fabio

2015-01-01

Trigeminal ganglion (TG) neurons are functionally and morphologically heterogeneous, and the molecular basis of this heterogeneity is still not fully understood. Here we describe experiments showing that a subpopulation of neurons expresses a delayed-rectifying K+ current (IDRK) with a characteristically high (nanomolar) sensitivity to the dihydroquinoline CP339,818 (CP). Although submicromolar CP has previously been shown to selectively block Kv1.3 and Kv1.4 channels, the CP-sensitive IDRK found in TG neurons could not be associated with either of these two K+ channels. It could neither be associated with Kv2.1 channels homomeric or heteromerically associated with the Kv9.2, Kv9.3, or Kv6.4 subunits, whose block by CP, tested using two-electrode voltage-clamp recordings from Xenopus oocytes, resulted in the low micromolar range, nor to the Kv7 subfamily, given the lack of blocking efficacy of 3 μM XE991. Within the group of multiple-firing neurons considered in this study, the CP-sensitive IDRK was preferentially expressed in a subpopulation showing several nociceptive markers, such as small membrane capacitance, sensitivity to capsaicin, and slow afterhyperpolarization (AHP); in these neurons the CP-sensitive IDRK controls the membrane resting potential, the firing frequency, and the AHP duration. A biophysical study of the CP-sensitive IDRK indicated the presence of two kinetically distinct components: a fast deactivating component having a relatively depolarized steady-state inactivation (IDRKf) and a slow deactivating component with a more hyperpolarized V1/2 for steady-state inactivation (IDRKs). PMID:25652918

1935 15' Quad #339 Aerial Photo Mosaic Index

Data.gov (United States)

Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

Transcriptional and Bioinformatic Analysis Provide a Relationship between Host Response Changes to Marek’s Disease Viruses Infection and an Integrated Long Terminal Repeat

Directory of Open Access Journals (Sweden)

Ning eCui

2016-04-01

Full Text Available GX0101, Marek’s disease virus (MDV strain with a long terminal repeat (LTR insert of reticuloendotheliosis virus (REV, was isolated from CVI988/Rispens vaccinated birds showing tumors. We have constructed a LTR deleted strain GX0101∆LTR in our previous study. To compare the host responses to GX0101 and GX0101∆LTR, chicken embryo fibroblasts (CEF cells were infected with two MDV strains and a gene-chip containing chicken genome was employed to examine gene transcription changes in host cells in the present study. Of the 42 368 chicken transcripts on the chip, there were 2199 genes that differentially expressed in CEF infected with GX0101 compared to GX0101∆LTR significantly. Differentially expressed genes were distributed to 25 possible gene networks according to their intermolecular connections and were annotated to 56 pathways. The insertion of REV LTR showed the greatest influence on cancer formation and metastasis, followed with immune changes, atherosclerosis and nervous system disorders in MDV-infected CEF cells. Based on these bio functions, GX0101 infection was predicated with a greater growth and survival inhibition but lower oncogenicity in chickens than GX0101∆LTR, at least in the acute phase of infection. In summary, the insertion of REV LTR altered the expression of host genes in response to MDV infection, possibly resulting in novel phenotypic properties in chickens. Our study has provided the evidence of retroviral insertional changes of host responses to herpesvirus infection for the first time, which will promote to elucidation of the possible relationship between the LTR insertion and the observed phenotypes.

Mechanics and composition of middle cerebral arteries from simulated microgravity rats with and without 1-h/d -Gx gravitation.

Directory of Open Access Journals (Sweden)

Jiu-Hua Cheng

Full Text Available BACKGROUND: To elucidate further from the biomechanical aspect whether microgravity-induced cerebral vascular mal-adaptation might be a contributing factor to postflight orthostatic intolerance and the underlying mechanism accounting for the potential effectiveness of intermittent artificial gravity (IAG in preventing this adverse effect. METHODOLOGY/PRINCIPAL FINDINGS: Middle cerebral arteries (MCAs were isolated from 28-day SUS (tail-suspended, head-down tilt rats to simulate microgravity effect, S+D (SUS plus 1-h/d -Gx gravitation by normal standing to simulate IAG, and CON (control rats. Vascular myogenic reactivity and circumferential stress-strain and axial force-pressure relationships and overall stiffness were examined using pressure arteriography and calculated. Acellular matrix components were quantified by electron microscopy. The results demonstrate that myogenic reactivity is susceptible to previous pressure-induced, serial constrictions. During the first-run of pressure increments, active MCAs from SUS rats can strongly stiffen their wall and maintain the vessels at very low strains, which can be prevented by the simulated IAG countermeasure. The strains are 0.03 and 0.14 respectively for SUS and S+D, while circumferential stress being kept at 0.5 (106 dyn/cm2. During the second-run pressure steps, both the myogenic reactivity and active stiffness of the three groups declined. The distensibility of passive MCAs from S+D is significantly higher than CON and SUS, which may help to attenuate the vasodilatation impairment at low levels of pressure. Collagen and elastin percentages were increased and decreased, respectively, in MCAs from SUS and S+D as compared with CON; however, elastin was higher in S+D than SUS rats. CONCLUSIONS: Susceptibility to previous myogenic constrictions seems to be a self-limiting protective mechanism in cerebral small resistance arteries to prevent undue cerebral vasoconstriction during orthostasis at 1-G

PARVUS affects aluminium sensitivity by modulating the structure of glucuronoxylan in Arabidopsis thaliana.

Science.gov (United States)

Zhu, Xiao Fang; Wan, Jiang Xue; Wu, Qi; Zhao, Xu Sheng; Zheng, Shao Jian; Shen, Ren Fang

2017-09-01

Glucuronoxylan (GX), an important component of hemicellulose in the cell wall, appears to affect aluminium (Al) sensitivity in plants. To investigate the role of GX in cell-wall-localized xylan, we examined the Arabidopsis thaliana parvus mutant in detail. This mutant lacks α-D-glucuronic acid (GlcA) side chains in GX and has greater resistance to Al stress than wild-type (WT) plants. The parvus mutant accumulated lower levels of Al in its roots and cell walls than WT despite having cell wall pectin content and pectin methylesterase (PME) activity similar to those of WT. Our results suggest that the altered properties of hemicellulose in the mutant contribute to its decreased Al accumulation. Although we observed almost no differences in hemicellulose content between parvus and WT under control conditions, less Al was retained in parvus hemicellulose than in WT. This observation is consistent with the finding that GlcA substitutions in WT GX, but not mutant GX, were increased under Al stress. Taken together, these results suggest that the modulation of GlcA levels in GX affects Al resistance by influencing the Al binding capacity of the root cell wall in Arabidopsis. © 2017 John Wiley & Sons Ltd.

Sources and behavior of perchlorate ions (ClO4-) in chalk aquifer of Champagne-Ardenne, France: preliminary results

Science.gov (United States)

Cao, Feifei; Jaunat, Jessy; Ollivier, Patrick; Cancès, Benjamin; Morvan, Xavier; Hubé, Daniel; Devos, Alain; Devau, Nicolas; Barbin, Vincent; Pannet, Pierre

2018-06-01

Perchlorate (ClO4-) is an environmental contaminant of growing concern due to its potential human health effects and widespread occurrence in surface water and groundwater. Analyses carried out in France have highlighted the presence of ClO4- in drinking water of Champagne-Ardenne (NW of France), with two potential sources suspected: a military source related to the First World War and an agricultural source related to the past use of Chilean nitrates. To determine the sources of ClO4- in groundwater, major and trace elements, 2H and 18O, ClO3- and ClO4- ions and a list of 39 explosives were analyzed from 35 surface water and groundwater sampling points in the east of the city of Reims. ClO4- ions were found in almost all sampling points (32 out of 35) with a max value of 33 µg L-1. ClO4- concentrations were highest in groundwater ranging from 0.7 to 33 µg L-1 (average value of about 6.2 µg L-1) against from 4 µg L-1) were collected near a military camp, where huge quantities of ammunitions have been used, stored and destroyed during and after the First World War.

Biodegradation and utilization of 4-n-nonylphenol by Aspergillus versicolor as a sole carbon and energy source

International Nuclear Information System (INIS)

Krupiński, Mariusz; Janicki, Tomasz; Pałecz, Bartłomiej; Długoński, Jerzy

2014-01-01

Highlights: • A. versicolor is able to degrade 4-n-NP as the sole source of carbon and energy. • 4-n-NP removal by A. versicolor was accompanied by the formation of metabolites. • Radioactive experiments show complete 4-n-NP mineralization by A. versicolor. • 4-n-NP initiates heat production in the A. versicolor spores. - Abstract: 4-n-Nonylphenol (4-n-NP) is an environmental pollutant with endocrine-disrupting activities that is formed during the degradation of nonylphenol polyethoxylates, which are widely used as surfactants. Utilization of 4-n-NP by the filamentous fungus Aspergillus versicolor as the sole carbon and energy source was investigated. By means of gas chromatography–mass spectrometry, we showed that in the absence of any carbon source other than 4-n-NP in the medium, A. versicolor completely removed the xenobiotic (100 mg L −1 ) after 3 d of cultivation. Moreover, mass spectrometric analysis of intracellular extracts led to the identification of eight intermediates. The mineralization of the xenobiotic in cultures supplemented with 4-n-NP [ring- 14 C(U)] as a growth substrate was also assessed. After 3 d of incubation, approximately 50% of the initially applied radioactivity was recovered in the form of 14 CO 2 , proving that this xenobiotic was completely metabolized and utilized by A. versicolor as a carbon source. Based on microscopic analysis, A. versicolor is capable of germinating spores under such conditions. To confirm these observations, a microcalorimetric method was used. The results show that even the highest amount of 4-n-NP initiates heat production in the fungal samples, proving that metabolic processes were affected by the use of 4-n-NP as an energetic substrate

Biodegradation and utilization of 4-n-nonylphenol by Aspergillus versicolor as a sole carbon and energy source

Energy Technology Data Exchange (ETDEWEB)

Krupiński, Mariusz; Janicki, Tomasz [Department of Industrial Microbiology and Biotechnology, University of Lodz, Banacha 12/16, 90-237 Łódź (Poland); Pałecz, Bartłomiej [Department of Physical Chemistry, University of Lodz, Pomorska 165, 90-236 Łódź (Poland); Długoński, Jerzy, E-mail: jdlugo@biol.uni.lodz.pl [Department of Industrial Microbiology and Biotechnology, University of Lodz, Banacha 12/16, 90-237 Łódź (Poland)

2014-09-15

Highlights: • A. versicolor is able to degrade 4-n-NP as the sole source of carbon and energy. • 4-n-NP removal by A. versicolor was accompanied by the formation of metabolites. • Radioactive experiments show complete 4-n-NP mineralization by A. versicolor. • 4-n-NP initiates heat production in the A. versicolor spores. - Abstract: 4-n-Nonylphenol (4-n-NP) is an environmental pollutant with endocrine-disrupting activities that is formed during the degradation of nonylphenol polyethoxylates, which are widely used as surfactants. Utilization of 4-n-NP by the filamentous fungus Aspergillus versicolor as the sole carbon and energy source was investigated. By means of gas chromatography–mass spectrometry, we showed that in the absence of any carbon source other than 4-n-NP in the medium, A. versicolor completely removed the xenobiotic (100 mg L{sup −1}) after 3 d of cultivation. Moreover, mass spectrometric analysis of intracellular extracts led to the identification of eight intermediates. The mineralization of the xenobiotic in cultures supplemented with 4-n-NP [ring-{sup 14}C(U)] as a growth substrate was also assessed. After 3 d of incubation, approximately 50% of the initially applied radioactivity was recovered in the form of {sup 14}CO{sub 2}, proving that this xenobiotic was completely metabolized and utilized by A. versicolor as a carbon source. Based on microscopic analysis, A. versicolor is capable of germinating spores under such conditions. To confirm these observations, a microcalorimetric method was used. The results show that even the highest amount of 4-n-NP initiates heat production in the fungal samples, proving that metabolic processes were affected by the use of 4-n-NP as an energetic substrate.

PVIS-4, Pressure vessel irradiation, source preparation

International Nuclear Information System (INIS)

Wasastjerna, Frej

2003-01-01

1 - Description of program or function: The program prepares a fixed neutron source distribution in radial, (r,θ), (r,z) or (r,θ,z) geometry for ANISN, DORT or TORT. The user can input the source distribution in some relatively compact form (typically a few variables defining the spectrum, 10 values for the axial source distribution and, for the horizontal distribution, the values at the center and corners of each of the outermost fuel bundles and the average value for each interior bundle). The program then creates the required source arrays, such as 96*, 97* and 98* arrays for DORT. 2 - Methods: Each required operation is performed by a separate module (a set of subprograms). HORIHX or HORISQ takes a source distribution in the transverse plane, given at the center and corners of each fuel bundle in hexagonal or square geometry, and transforms it into (r,θ) or radial geometry. In the latter case, the output distribution may be averaged in the azimuthal direction or azimuthal maxima may be obtained. FOUR takes an axial distribution, specified as a histogram, and approximates this with a Fourier series. This is then used to obtain a histogram distribution for a different axial mesh. SQPIN takes a 3-D pin-wise distribution in square geometry and transforms it into a radial, (r,θ), (r,z) or (r,θ,z) distribution. FISPEC calculates a group-wise energy spectrum from any of several different functional forms. Several components with different forms may be combined into one spectrum. COMBI combines the space and energy distributions prepared by the other modules and presents the result in a format appropriate for the SN programs in the DOORS system. 3 - Restrictions on the complexity of the problem: At present a reactor core of hexagonal fuel bundles must have 30- or 60-degree symmetry, a core of square bundles must have 45- or 90-degree symmetry (except if the sq-pin option is used). Other core geometries are not supported for the input distribution. Only cylindrical

The 4th Generation Light Source at Jefferson Lab

International Nuclear Information System (INIS)

Stephen Benson; George Biallas; James Boyce; Donald Bullard; James Coleman; David Douglas; H. Dylla; Richard Evans; Pavel Evtushenko; Albert Grippo; Christopher Gould; Joseph Gubeli; David Hardy; Carlos Hernandez-Garcia; Kevin Jordan; John Klopf; Steven Moore; George Neil; Thomas Powers; Joseph Preble; Daniel Sexton; Michelle Shinn; Christopher Tennant; Richard Walker; Shukui Zhang; Gwyn Williams

2007-01-01

A number of 'Grand Challenges' in Science have recently been identified in reports from The National Academy of Sciences, and the U.S. Dept. of Energy, Basic Energy Sciences. Many of these require a new generation of linac-based light source to study dynamical and non-linear phenomena in nanoscale samples. In this paper we present a summary of the properties of such light sources, comparing them with existing sources, and then describing in more detail a specific source at Jefferson Lab. Importantly, the JLab light source has developed some novel technology which is a critical enabler for other new light sources

Tolerance of centrifuge-simulated suborbital spaceflight by medical condition.

Science.gov (United States)

Blue, Rebecca S; Pattarini, James M; Reyes, David P; Mulcahy, Robert A; Garbino, Alejandro; Mathers, Charles H; Vardiman, Johnené L; Castleberry, Tarah L; Vanderploeg, James M

2014-07-01

We examined responses of volunteers with known medical disease to G forces in a centrifuge to evaluate how potential commercial spaceflight participants (SFPs) might tolerate the forces of spaceflight despite significant medical history. Volunteers were recruited based upon suitability for each of five disease categories (hypertension, cardiovascular disease, diabetes, lung disease, back or neck problems) or a control group. Subjects underwent seven centrifuge runs over 2 d. Day 1 consisted of two +G(z) runs (peak = +3.5 G(z), Run 2) and two +G(x), runs (peak = +6.0 G(x), Run 4). Day 2 consisted of three runs approximating suborbital spaceflight profiles (combined +G(x) and +G(z), peak = +6.0 G(x)/+4.0 G(z)). Data collected included blood pressure, electrocardiogram, pulse oximetry, neurovestibular exams, and post-run questionnaires regarding motion sickness, disorientation, grayout, and other symptoms. A total of 335 subjects registered for participation, of which 86 (63 men, 23 women, age 20-78 yr) participated in centrifuge trials. The most common causes for disqualification were weight and severe and uncontrolled medical or psychiatric disease. Five subjects voluntarily withdrew from the second day of testing: three for anxiety reasons, one for back strain, and one for time constraints. Maximum hemodynamic values recorded included HR of 192 bpm, systolic BP of 217 mmHg, and diastolic BP of 144 mmHg. Common subjective complaints included grayout (69%), nausea (20%), and chest discomfort (6%). Despite their medical history, no subject experienced significant adverse physiological responses to centrifuge profiles. These results suggest that most individuals with well-controlled medical conditions can withstand acceleration forces of launch and re-entry profiles of current commercial spaceflight vehicles.

The 1.4-2.7 micron spectrum of the point source at the galactic center

Science.gov (United States)

Treffers, R. R.; Fink, U.; Larson, H. P.; Gautier, T. N., III

1976-01-01

The spectrum of the 2-micron point source at the galactic center is presented over the range from 1.4 to 2.7 microns. The two-level-transition CO band heads are seen near 2.3 microns, confirming that the radiation from this source is due to a cool supergiant star. The heliocentric radial velocity is found to be - 173 (+ or -90) km/s and is consistent with the star being in orbit about a dense galactic nucleus. No evidence is found for Brackett-gamma emission, and no interstellar absorption features are seen. Upper limits for the column densities of interstellar H2, CH4, CO, and NH3 are derived.

Late Pliocene History of Mediterranean Outflow Water in the Gulf of Cadiz (IODP Expedition 339, Site U1389)

Science.gov (United States)

Grunert, P.; Balestra, B.; Flores, J. A.; Sierro, F. J.; García Gallardo, Á.; Piller, W. E.; Aubry, M. P.

2014-12-01

The opening and closure of ocean gateways play an important role amongst climate forcing mechanisms: surface and deep-water circulation are altered, and hence global heat transport. An important component of North Atlantic circulation patterns is the warm and saline Mediterranean Outflow Water (MOW) that enters the North Atlantic via the Gibraltar Strait. Its onset and early history after the opening of the Gibraltar Strait at 5.3 Ma are poorly constrained and its impact on oceanography and climate in the Pliocene are largely unexplored. Current research efforts in the scope of projects funded by the Austrian Science Fund (FWF-P25831-N29) and the Max Kade Foundation aim to improve our knowledge about this early phase of MOW. Research focuses on Sites U1387C (upper Miocene-lower Pliocene; ~5.8-3.8 Myrs) and U1389E (middle-upper Pliocene; ~3.7-2.8) drilled during IODP Expedition 339 in the northern Gulf of Cádiz close to the source area of MOW. At IODP Site U1389E, a 280m-thick sequence of upper Pliocene contourites is studied to reconstruct MOW behavior and potential paleoceanographic and paleoclimatic feedback mechanisms during the Mid-Pliocene Thermal Optimum. Currently, a reliable age model is developed for the studied interval based on bio-, chemo-, and cyclostratigraphy. Several biostratigraphic datums have been identified from analyses of calcareous nannoplankton and planktic foraminifera which indicate a depositional age between 3.65 Ma and 2.87 Ma. In some intervals of the record a further refinement of the age model at the millenial scale is complicated by poor recovery. However, preliminary results from high-resolution geochemical analyses of the bulk sediment (TOC, CaCO3 and S) and shells of the planktic foraminifer Globigerinoides ruber (δ18O, δ13C) reveal distinct cyclic patterns in several well recovered intervals. Based on an average sedimentation rate of ~25cm/ka, these cycles most likely reflect precessional forcing. Current paleoceanographic

Probing the Spatial Distribution of the Interstellar Dust Medium by High Angular Resolution X-ray Halos of Point Sources

Science.gov (United States)

Xiang, Jingen

X-rays are absorbed and scattered by dust grains when they travel through the interstellar medium. The scattering within small angles results in an X-ray ``halo''. The halo properties are significantly affected by the energy of radiation, the optical depth of the scattering, the grain size distributions and compositions, and the spatial distribution of dust along the line of sight (LOS). Therefore analyzing the X-ray halo properties is an important tool to study the size distribution and spatial distribution of interstellar grains, which plays a central role in the astrophysical study of the interstellar medium, such as the thermodynamics and chemistry of the gas and the dynamics of star formation. With excellent angular resolution, good energy resolution and broad energy band, the Chandra ACIS is so far the best instrument for studying the X-ray halos. But the direct images of bright sources obtained with ACIS usually suffer from severe pileup which prevents us from obtaining the halos in small angles. We first improve the method proposed by Yao et al to resolve the X-ray dust scattering halos of point sources from the zeroth order data in CC-mode or the first order data in TE mode with Chandra HETG/ACIS. Using this method we re-analyze the Cygnus X-1 data observed with Chandra. Then we studied the X-ray dust scattering halos around 17 bright X-ray point sources using Chandra data. All sources were observed with the HETG/ACIS in CC-mode or TE-mode. Using the interstellar grain models of WD01 model and MRN model to fit the halo profiles, we get the hydrogen column densities and the spatial distributions of the scattering dust grains along the line of sights (LOS) to these sources. We find there is a good linear correlation not only between the scattering hydrogen column density from WD01 model and the one from MRN model, but also between N_{H} derived from spectral fits and the one derived from the grain models WD01 and MRN (except for GX 301-2 and Vela X-1): N

Optimization of the beam extraction systems for the Linac4 H{sup −} ion source

Energy Technology Data Exchange (ETDEWEB)

Fink, D. A.; Lettry, J.; Scrivens, R.; Steyaert, D. [CERN, 1211 Geneva 23 (Switzerland); Midttun, Ø. [University of Oslo, P.O. Box 1048, 0316 Oslo (Norway); CERN, 1211 Geneva 23 (Switzerland); Valerio-Lizarraga, C. A. [Departamento de Investigación en Fisica, Universidad de Sonora, Hermosillo (Mexico); CERN, 1211 Geneva 23 (Switzerland)

2015-04-08

The development of the Linac 4 and its integration into CERN’s acceleration complex is part of the foreseen luminosity upgrade of the Large Hadron Collider (LHC). The goal is to inject a 160 MeV H{sup −} beam into the CERN PS Booster (PSB) in order to increase the beam brightness by a factor of 2 compared to the 50 MeV proton linac, Linac 2, that is currently in operation. The requirements for the ion source are a 45 keV H{sup −} beam of 80 mA intensity, 2 Hz repetition rate and 0.5 ms pulse length within a normalized rms-emittance of 0.25 mm· mrad. The previously installed beam extraction system has been designed for an H{sup −} ion beam intensity of 20 mA produced by an RF-volume source with an electron to H{sup −} ratio of up to 50. For the required intensity upgrades of the Linac4 ion source, a new beam extraction system is being produced and tested; it is optimized for a cesiated surface RF-source with a nominal beam current of 40 mA and an electron to H{sup −} ratio of 4. The simulations, based on the IBSIMU code, are presented. At the Brookhaven National Laboratory (BNL), a peak beam current of more than 100 mA was demonstrated with a magnetron H{sup −} source at an energy of 35 keV and a repetition rate of 2 Hz. A new extraction system is required to operate at an energy of 45 keV; simulation of a two stage extraction system dedicated to the magnetron is presented.

Genotype by energy expenditure interaction with metabolic syndrome traits: the Portuguese healthy family study.

Science.gov (United States)

Santos, Daniel M V; Katzmarzyk, Peter T; Diego, Vincent P; Souza, Michele C; Chaves, Raquel N; Blangero, John; Maia, José A R

2013-01-01

Moderate-to-high levels of physical activity are established as preventive factors in metabolic syndrome development. However, there is variability in the phenotypic expression of metabolic syndrome under distinct physical activity conditions. In the present study we applied a Genotype X Environment interaction method to examine the presence of GxEE interaction in the phenotypic expression of metabolic syndrome. A total of 958 subjects, from 294 families of The Portuguese Healthy Family study, were included in the analysis. Total daily energy expenditure was assessed using a 3 day physical activity diary. Six metabolic syndrome related traits, including waist circumference, systolic blood pressure, glucose, HDL cholesterol, total cholesterol and triglycerides, were measured and adjusted for age and sex. GxEE examination was performed on SOLAR 4.3.1. All metabolic syndrome indicators were significantly heritable. The GxEE interaction model fitted the data better than the polygenic model (pmetabolic syndrome traits expression is significantly influenced by the interaction established between total daily energy expenditure and genotypes. Physical activity may be considered an environmental variable that promotes metabolic differences between individuals that are distinctively active.

Improved beam extraction for a negative hydrogen ion source for the LHC injector chain upgrade, Linac4

CERN Document Server

Midttun, Øystein; Scrivens, Richard

In the scope of an upgrade of the injector chain of CERN’s accelerator complex, a new linear accelerator, Linac4, is under construction. This accelerator will replace the existing 50 MeV proton linac, Linac2. By increasing the beam energy to 160 MeV, Linac4 makes it possible to double the brightness in the PSB, and ultimately increase the luminosity in the LHC. Linac4 will accelerate beams of negative hydrogen (H-) to be injected into the PSB by multi-turn, charge exchange injection. The ion source was initially based on the non-caesiated RF-volume source from DESY. However, the beam extraction from this source could not handle the 45 keV beam energy required by the RFQ. A new beam extraction system has therefore been designed, via IBSimu simulations [1], to extract and transport the H- ion beam respecting the Linac4 requirements. Key features of the extraction system is a tuneable puller voltage to adapt the extraction field to the ion and electron beam currents, and a magnetized Einzel lens to dump the co...

Point X-ray sources in the SNR G 315.4-2.30 (MSH 14-63, RCW 86)

Science.gov (United States)

Gvaramadze, V. V.; Vikhlinin, A. A.

2003-04-01

We report the results of a search for a point X-ray source (stellar remnant) in the southwest protrusion of the supernova remnant G 315.4-2.30 (MSH 14-63, RCW 86) using the archival data of the Chandra X-ray Observatory. The search was motivated by a hypothesis that G 315.4-2.30 is the result of an off-centered cavity supernova explosion of a moving massive star, which ended its evolution just near the edge of the main-sequence wind-driven bubble. This hypothesis implies that the southwest protrusion in G 315.4-2.30 is the remainder of a pre-existing bow shock-like structure created by the interaction of the supernova progenitor's wind with the interstellar medium and that the actual location of the supernova blast center is near the center of this hemispherical structure. We have discovered two point X-ray sources in the ``proper" place. One of the sources has an optical counterpart with the photographic magnitude 13.38+/-0.40, while the spectrum of the source can be fitted with an optically thin plasma model. We interpret this source as a foreground active star of late spectral type. The second source has no optical counterpart to a limiting magnitude ~ 21. The spectrum of this source can be fitted almost equally well with several simple models (power law: photon index =1.87; two-temperature blackbody: kT1 =0.11 keV, R1 =2.34 km and kT2 =0.71 keV, R2 =0.06 km; blackbody plus power law: kT =0.07 keV, photon index =2.3). We interpret this source as a candidate stellar remnant (neutron star), while the photon index and non-thermal luminosity of the source (almost the same as those of the Vela pulsar and the recently discovered pulsar PSR J 0205+6449 in the supernova remnant 3C 58) suggest that it can be a young ``ordinary" pulsar.

Preliminary Tests of the DECRIS-4 Ion Source%DECRIS-4离子源的初步测试结果

Institute of Scientific and Technical Information of China (English)

V.Bekhterev; S.Bogomolov; A.Efremov; G.Gulbekian; Yu.Kostyukhov; A.Lebedev; M.Leporis; V.Loginov; N.Yazvitsky

2007-01-01

The ECR ion source DECRIS一4 has been designed and constructed at the FLNR JINR to be used as a second injector of heavy multiply charged ions for the U-400 cyclotron.The design of the magnetic structure of the source was based on the idea of the so-called"magnetic plateau".The axial magnetic field is formed by three independent solenoids enclosed in separated iron yokes.As a result the superposition of the coils and hexapole magnetic fields creates the enlarged resonance volume.The first experiments showed that the source was able to produce more than 300eμA of Ar8+ when only 100W of microwave power was used.During the last experiment almost 500eμA of Ar8+ was extracted with the same power.In this paper we will present the preliminary results with other gaseous ions,such as oxygen,krypton and xenon.

Determination of radium isotopes by BaSO4 coprecipitation for the preparation of alpha-spectrometric sources

International Nuclear Information System (INIS)

Lozano, J.C.; Fernandez, F.; Gomez, J.M.G.

1997-01-01

A coprecipitation procedure for the preparation of α-spectrometric sources for radium, using BaSO 4 as carrier, has been applied to the determination of alpha radium isotopes in water samples. The use of 133 Ba as a suitable tracer for radium determination and possible losses of radon isotopes from the sources are studied and discussed. (author)

The Stark effect of 1H and 4He+ in the beam foil source

International Nuclear Information System (INIS)

Doobov, M.H.; Hay, H.J.; Sofield, C.J.; Newton, C.S.

1974-01-01

The appearance of Stark patterns obtained with a beam-foil source differed from those characteristically obtained from gas discharge sources. In the former source excitation of the hydrogenic ions occurred in a brief time interval ( 14 s) during the passage of a high velocity unidirectional beam of ions which produces non-statistical population distributions for the Stark perturbed states. The relative intensities of Stark perturbed components of the Hsub(β) hydrogen line and the Fsub(α) ionized helium line have been measured in a beam-foil source. In each case an initial population of states of principal quantum number n = 4 due to radiative decay and Stark mixing, and comparing the resultant patterns with the observed patterns. The inferred population distributions indicate that the states of low orbital angular momentum (L) are preferentially populated, and alignment referred to the beam axis is produced such that states with lower z component of L are preferentially populated. (author)

48 CFR 3.104-4 - Disclosure, protection, and marking of contractor bid or proposal information and source...

Science.gov (United States)

2010-10-01

... otherwise authorized by law or regulation. Any release containing contractor bid or proposal information or..., and marking of contractor bid or proposal information and source selection information. 3.104-4... marking of contractor bid or proposal information and source selection information. (a) Except as...

Characterization of the rod-pinch diode at 2 to 4 Mv as a high-resolution source for flash radiography

International Nuclear Information System (INIS)

Commisso, R.J.; Allen, R.J.; Cooperstein, G.; Mosher, D.; Young, F.C.; Boller, J.R.; Swanekamp, S.B.; Bayol, F.; Charre, P.; Garrigues, A.; Gonzales, C.; Pompier, F.; Vezinet, R.

2002-01-01

The ASTERIX generator is used to evaluatate the rod-pinch electron-beam diode as an intense source of x-rays for high-resolution, pulsed (30- to 40-ns FWHM) radiography at peak diode voltages of voltages of 2.4 to 4.4 MV and peak diode currents of 55 to 135 kA. At 4 MV, tungsten anode rods of 1-mm or 2-mm diameter produce on-axis doses at 1 meter of 16 rad(Si) or 20 rad(Si), respectively. The on-axis source diameter based on the full-width at half-maximum (FWHM) of the line-spread-function (LSF) is 0.9 ± 0.1 mm for a 1-mm diameter rod and 1.4 ± 0.1 mm for a 2-mm diam rod, independent of voltage. The LANL source diameter is nearly twice the FWHM. The measured rod-pinch current is reproduced with a diode model that includes ions and accounts for anode and cathode plasma expansion. A composite diode with a large diameter carbon-rod anode followed by a smaller-diameter tungsten-tip converter shows promise for applications where a small central source feature is desired

A-Factor and Phosphate Depletion Signals Are Transmitted to the Grixazone Biosynthesis Genes via the Pathway-Specific Transcriptional Activator GriR▿ †

OpenAIRE

Higashi, Tatsuichiro; Iwasaki, Yuko; Ohnishi, Yasuo; Horinouchi, Sueharu

2007-01-01

Grixazone (GX), which is a diffusible yellow pigment containing a phenoxazinone chromophore, is one of the secondary metabolites under the control of A-factor (2-isocapryloyl-3R-hydroxymethyl-γ-butyrolactone) in Streptomyces griseus. GX production is also induced by phosphate starvation. The whole biosynthesis gene cluster for GX was cloned and characterized. The gene cluster consisting of 13 genes contained six transcriptional units, griT, griSR, griR, griAB, griCDEFG, and griJIH. During cul...

New Methods of Low-Field Magnetic Resonance Imaging for Application to Traumatic Brain Injury

Science.gov (United States)

2013-02-01

8217+-8! $-𔄂&#+! 8#$’+)&4! )*! W! /*! 5)+6! ’! GX! OSB ! 1�)8+6! 9Y?D#)*+! *’/,(-8<@! 3-7&4*+$#7+)&4! )*! ,-$.&$/-8! #*)4%! +6-! ’(%-1$’)7! $-7&4...F! OSB ! *-,’$’+)&4@!N6-!*?//-+$)7!:;2!9(-.+<!$&+’+-*!&>-$! ^R]! 56)(-! +6-! &..*-+! :;2! $&+’+-*! &>-$! GXR]! 󈧴! ,$&>)8-*!*/’((-$!>&0-(!*)B-*!)4!+6

Effect of carbon coating on cycle performance of LiFePO4/C composite cathodes using Tween80 as carbon source

International Nuclear Information System (INIS)

Huang, You-Guo; Zheng, Feng-Hua; Zhang, Xiao-Hui; Li, Qing-Yu; Wang, Hong-Qiang

2014-01-01

Highlights: • The Tween80 addition could enhance cycle stability of LiFePO 4 material. • The FTIR spectrum confirms Tween80 surfactant can bond with LiFePO 4 particles. • Some chemical bonds between material and carbon layer still exist after sintering. - Abstract: The influence of carbon coating on the cycle performance of LiFePO 4 /C composite cathodes using polyoxyethylenesorbitan monooleate (Tween80) as carbon source against lithium metal foil anode for Li-ion batteries was investigated in this paper. According to Infrared spectrum analysis (FTIR), the Tween80 surfactant molecules bond to the surface of LiFePO 4 and form an adsorption layer, which contribute to the formation of a homogeneous carbon layer tightly coating on the surface of LiFePO 4 particles in the process of sintering, due to a strong binding force provided by surface chemical bonds. The transmission electron microscopy (TEM) shows that the carbon layer around LiFePO 4 using Tween80 as carbon source still coating on the surface of LiFePO 4 after 200 cycles at 5 C rate while the carbon layer shed from the surface of LiFePO 4 using glucose as carbon source. As a result, the carbon-coated LiFePO 4 using Tween80 as carbon source exhibits much higher capacity retention than the sample using glucose as carbon source. Electrochemical impedance measurement (EIS) reveals that the carbon-coated LiFePO 4 electrode using Tween80 surfactant has a lower charge transfer resistance than the electrode using glucose as carbon source electrode after 100 and 200 cycles at 5 C rate

A magnetized Einzel lens electron dump for the Linac4 H− ion source

CERN Document Server

Midttun, O; Kronberger, M; Lettry, J; Pereira, H; Scrivens, R

2013-01-01

Linac4 is a 160 MeV linear accelerator which will inject negative hydrogen ions (H−) into CERN’s Proton Synchrotron Booster, a required upgrade to improve the beam brightness in the LHC injector chain. A volume production RF ion source, based on the design of the DESY RF source was implemented, but showed considerable electron dump ablation during operation at 45 keV beam energy. To reduce the electron beam power density in the dump, a magnetized Einzel lens is designed that reduces the beam energy to 10 keV before permanentmagnets dump the electrons on a tungsten surface. Presented in this paper are simulations of the design using IBSimu, the tunable range of parameters depending on the extracted H− and electron current, as well as details of the implementation, the choice of pulsed power converters and the electrode alignment system. In addition, simulations of proton extraction from this source will be shown.

По зимнему бездорожью на полном приводе / Велиматти Хонканен, Яри Питкаярви и Ярмо Сукава

Index Scriptorium Estoniae

Хонканен, Велиматти

2003-01-01

Audi A4 1,8 T Quattro, BMW 325Xi, Honda HR-V 1,6i, Jaguar X-Type 3,0 V6, Mercedes-Benz E 320 4matic, Renault Scenic RX4 2,0, Škoda Octavia Combi 2,0WD, Subaru Impreza 2,0 GX, Suzuki Liana 1,6 4WD, Volvo S60 AWD

[Phylogenetic analysis of human/swine/avian gene reassortant H1N2 influenza A virus isolated from a pig in China].

Science.gov (United States)

Chen, Yixiang; Meng, Xueqiong; Liu, Qi; Huang, Xia; Huang, Shengbin; Liu, Cuiquan; Shi, Kaichuang; Guo, Jiangang; Chen, Fangfang; Hu, Liping

2008-04-01

Our aim in this study was to determine the genetic characterization and probable origin of the H1N2 swine influenza virus (A/Swine/Guangxi/13/2006) (Sw/GX/13/06) from lung tissue of a pig in Guangxi province, China. Eight genes of Sw/GX/13/06 were cloned and genetically analyzed. The hemagglutinin (HA), nucleoprotein (NP), matrix (M) and non-structural (NS) genes of Sw/GX/13/06 were most closely related to genes from the classical swine H1N1 influenza virus lineage. The neuraminidase (NA) and PB1 genes were most closely related to the corresponding genes from the human influenza H3N2 virus lineage. The remaining two genes PA and PB2 polymerase genes were most closely related to the genes from avian influenza virus lineage. Phylogenetic analyses revealed that Sw/GX/13/06 was a human/swine/avian H1N2 virus, and closely related to H1N2 viruses isolated from pigs in United States (1999-2001) and Korea (2002). To our knowledge, Sw/GX/13/06 was the first triple-reassortant H1N2 influenza A virus isolated from a pig in China. Whether the Sw/GX/13/06 has a potential threat to breeding farm and human health remains to be further investigated.

Broadband upconversion imaging around 4 μm using an all-fiber supercontinuum source

Science.gov (United States)

Huot, Laurent; Moselund, Peter M.; Leick, Lasse; Tidemand-Lichtenberg, Peter; Pedersen, Christian

2017-02-01

We present a novel mid-infrared imaging system born from the combination of an all-fiber mid-IR supercontinuum source developed at NKT with ultra-sensitive upconversion detection technology from DTU Fotonik. The source delivers 100 mW of average power and its spectrum extends up to 4.5 μm. The infrared signal is passed through a sample and then focused into a bulk AgGaS2 crystal and subsequently mixed with a synchronous mixing signal at 1550 nm extracted from the pump laser of the supercontinuum. Through sum frequency generation, an upconverted signal ranging from 1030 nm to 1155 nm is generated and acquired using an InGaAs camera.

Painted surfaces - Important sources of polychlorinated biphenyls (PCBs) contamination to the urban and marine environment

International Nuclear Information System (INIS)

Jartun, Morten; Ottesen, Rolf Tore; Steinnes, Eiliv; Volden, Tore

2009-01-01

A study of a large number of samples of flaking old paint from various buildings in Bergen, Norway (N = 68) suggests that paint may be the most important contemporary source of PCBs in this urban environment with concentrations of PCB 7 up to 3.39 g/kg. Twenty-three of the samples were collected from a single building, and the concentrations were found to vary over 3 orders of magnitude. In addition, 16 concrete samples from a large bridge previously coated with PCB-containing paint were collected and separated into outer- and inner samples indicating that PCBs are still present in high concentrations subsequent to renovation. PCBs were found in several categories of paint from wooden and concrete buildings, potentially introduced to the environment by natural weathering, renovation, and volatilization. Consequently, this dispersion may lead to increased levels of PCBs in urban atmospheres, soils, and harbor sediments where high concentrations have resulted in Governmental advice against consumption of certain seafood. - Paint from structures built during the period 1950-1970 may be the most important source of PCBs in an urban environment

Effect of carbon source on the morphology and electrochemical performances of LiFePO4/C nanocomposites.

Science.gov (United States)

Liu, Shuxin; Wang, Haibin; Yin, Hengbo; Wang, Hong; He, Jichuan

2014-03-01

The carbon coated LiFePO4 (LiFePO4/C) nanocomposites materials were successfully synthesized by sol-gel method. The microstructure and morphology of LiFePO4/C nanocomposites were characterized by X-ray diffraction, Raman spectroscopy and scanning electron microscopy. The results showed that the carbon layers decomposed by different dispersant and carbon source had different graphitization degree, and the sugar could decompose to form more graphite-like structure carbon. The carbon source and heat-treatment temperature had some effect on the particle size and morphology, the sample LFP-S700 synthesized by adding sugar as carbon source at 700 degrees C had smaller particle size, uniform size distribution and spherical shape. The electrochemical behavior of LiFePO4/C nanocomposites was analyzed using galvanostatic measurements and cyclic voltammetry (CV). The results showed that the sample LFP-S700 had higher discharge specific capacities, higher apparent lithium ion diffusion coefficient and lower charge transfer resistance. The excellent electrochemical performance of sample LFP-S700 could be attributed to its high graphitization degree of carbon, smaller particle size and uniform size distribution.

Dysrhythmias in Laypersons During Centrifuge-Simulated Suborbital Spaceflight.

Science.gov (United States)

Suresh, Rahul; Blue, Rebecca S; Mathers, Charles H; Castleberry, Tarah L; Vanderploeg, James M

2017-11-01

There are limited data on cardiac dysrhythmias in laypersons during hypergravity exposure. We report layperson electrocardiograph (ECG) findings and tolerance of dysrhythmias during centrifuge-simulated suborbital spaceflight. Volunteers participated in varied-length centrifuge training programs of 2-7 centrifuge runs over 0.5-2 d, culminating in two simulated suborbital spaceflights of combined +Gz and +Gx (peak +4.0 Gz, +6.0 Gx, duration 5 s). Monitors recorded pre- and post-run mean arterial blood pressure (MAP), 6-s average heart rate (HR) collected at prespecified points during exposures, documented dysrhythmias observed on continuous 3-lead ECG, self-reported symptoms, and objective signs of intolerance on real-time video monitoring. Participating in the study were 148 subjects (43 women). Documented dysrhythmias included sinus pause (N = 5), couplet premature ventricular contractions (N = 4), bigeminy (N = 3), accelerated idioventricular rhythm (N = 1), and relative bradycardia (RB, defined as a transient HR drop of >20 bpm; N = 63). None were associated with subjective symptoms or objective signs of acceleration intolerance. Episodes of RB occurred only during +Gx exposures. Subjects had a higher post-run vs. pre-run MAP after all exposures, but demonstrated no difference in pre- and post-run HR. RB was more common in men, younger individuals, and subjects experiencing more centrifuge runs. Dysrhythmias in laypersons undergoing simulated suborbital spaceflight were well tolerated, though RB was frequently noted during short-duration +Gx exposure. No subjects demonstrated associated symptoms or objective hemodynamic sequelae from these events. Even so, heightened caution remains warranted when monitoring dysrhythmias in laypersons with significant cardiopulmonary disease or taking medications that modulate cardiac conduction.Suresh R, Blue RS, Mathers CH, Castleberry TL, Vanderploeg JM. Dysrhythmias in laypersons during centrifuge-stimulated suborbital

The Fruiting Bodies, Submerged Culture Biomass, and Acidic Polysaccharide Glucuronoxylomannan of Yellow Brain Mushroom Tremella mesenterica Modulate the Immunity of Peripheral Blood Leukocytes and Splenocytes in Rats with Impaired Glucose Tolerance

Directory of Open Access Journals (Sweden)

Tai-Hao Hsu

2014-01-01

Full Text Available The prevalence of diabetes mellitus (DM, a chronic disease with hyperglycemia and impaired immune function, is increasing worldwide. Progression from impaired glucose tolerance (IGT to type 2 DM has recently become a target for early intervention. The fruiting bodies (FB and submerged culture mycelium (CM of Tremella mesenterica, an edible and medicinal mushroom, have been demonstrated to have antihyperglycemic and immunomodulatory activities in type 1 DM rats. Herein, we investigated the effects of acidic polysaccharide glucuronoxylomannan (GX extracted from CM on the immunocyte responses. Male Wistar rats were injected with streptozotocin (65 mg/kg plus nicotinamide (200 mg/kg for the induction of IGT, and gavaged daily with vehicle, FB, CM, or GX (1 g/kg/day. Rats injected with saline and gavaged vehicle were used as controls. Two weeks later, peripheral blood leukocytes (PBLs and splenocytes were collected. Ingestion of FB, CM, and GX significantly decreased blood glucose levels in the postprandial period and in oral glucose tolerance test, and partially reversed T-splenocytic proliferation in IGT rats. CM significantly decreased T-helper lymphocytes in the PBLs and B-splenocytes. In addition, FB, CM, and GX significantly reversed the IGT-induced decreases in tumor necrosis factor-α production; GX significantly increased interleukin-6 production in T-lymphocytes in the PBLs and splenocytes; and CM and GX significantly reversed IGT-induced decrease in interferon-γ production in T-lymphocytes in the spleen. In conclusion, FB, CM, and acidic polysaccharide GX of T. mesenterica may increase T-cell immunity via the elevation of proinflammatory and T-helper cytokine production in rats with impaired glucose tolerance.

Experimental benchmark of the NINJA code for application to the Linac4 H- ion source plasma

Science.gov (United States)

Briefi, S.; Mattei, S.; Rauner, D.; Lettry, J.; Tran, M. Q.; Fantz, U.

2017-10-01

For a dedicated performance optimization of negative hydrogen ion sources applied at particle accelerators, a detailed assessment of the plasma processes is required. Due to the compact design of these sources, diagnostic access is typically limited to optical emission spectroscopy yielding only line-of-sight integrated results. In order to allow for a spatially resolved investigation, the electromagnetic particle-in-cell Monte Carlo collision code NINJA has been developed for the Linac4 ion source at CERN. This code considers the RF field generated by the ICP coil as well as the external static magnetic fields and calculates self-consistently the resulting discharge properties. NINJA is benchmarked at the diagnostically well accessible lab experiment CHARLIE (Concept studies for Helicon Assisted RF Low pressure Ion sourcEs) at varying RF power and gas pressure. A good general agreement is observed between experiment and simulation although the simulated electron density trends for varying pressure and power as well as the absolute electron temperature values deviate slightly from the measured ones. This can be explained by the assumption of strong inductive coupling in NINJA, whereas the CHARLIE discharges show the characteristics of loosely coupled plasmas. For the Linac4 plasma, this assumption is valid. Accordingly, both the absolute values of the accessible plasma parameters and their trends for varying RF power agree well in measurement and simulation. At varying RF power, the H- current extracted from the Linac4 source peaks at 40 kW. For volume operation, this is perfectly reflected by assessing the processes in front of the extraction aperture based on the simulation results where the highest H- density is obtained for the same power level. In surface operation, the production of negative hydrogen ions at the converter surface can only be considered by specialized beam formation codes, which require plasma parameters as input. It has been demonstrated that

An initial assessment of the Chernobyl-4 reactor accident release source

International Nuclear Information System (INIS)

Macdonald, H.F.; ApSimon, H.M.; Wilson, J.J.N.

1986-07-01

The long-range atmospheric dispersion model MESOS has been used to provide a preliminary evaluation of the effects over Western Europe of radioactivity released during the accident which occurred at the Chernobyl-4 reactor in the USSR in April 1986. The results of this analysis have been compared with observations during the first week or so following the accident of airborne contamination levels at a range of locations across Europe in order to obtain an estimate of accident release source. The work presented here was performed during the 6-8 weeks following the accident and the results obtained will be subject to refinement as more detailed data become available. However, at this early stage they indicate a release source for the Chernobyl accident, expressed as a fraction of the estimated reactor core inventory, of approx. 15-20% of the iodine and caesium isotopes, approx. 1% of the ruthenium and lesser amounts of the other fission products and actinides, together with an implied major fraction of the krypton and xenon noble gases. (author)

The Effects of Training on Anxiety and Task Performance in Simulated Suborbital Spaceflight.

Science.gov (United States)

Blue, Rebecca S; Bonato, Frederick; Seaton, Kimberly; Bubka, Andrea; Vardiman, Johnené L; Mathers, Charles; Castleberry, Tarah L; Vanderploeg, James M

2017-07-01

In commercial spaceflight, anxiety could become mission-impacting, causing negative experiences or endangering the flight itself. We studied layperson response to four varied-length training programs (ranging from 1 h-2 d of preparation) prior to centrifuge simulation of launch and re-entry acceleration profiles expected during suborbital spaceflight. We examined subject task execution, evaluating performance in high-stress conditions. We sought to identify any trends in demographics, hemodynamics, or similar factors in subjects with the highest anxiety or poorest tolerance of the experience. Volunteers participated in one of four centrifuge training programs of varied complexity and duration, culminating in two simulated suborbital spaceflights. At most, subjects underwent seven centrifuge runs over 2 d, including two +Gz runs (peak +3.5 Gz, Run 2) and two +Gx runs (peak +6.0 Gx, Run 4) followed by three runs approximating suborbital spaceflight profiles (combined +Gx and +Gz, peak +6.0 Gx and +4.0 Gz). Two cohorts also received dedicated anxiety-mitigation training. Subjects were evaluated on their performance on various tasks, including a simulated emergency. Participating in 2-7 centrifuge exposures were 148 subjects (105 men, 43 women, age range 19-72 yr, mean 39.4 ± 13.2 yr, body mass index range 17.3-38.1, mean 25.1 ± 3.7). There were 10 subjects who withdrew or limited their G exposure; history of motion sickness was associated with opting out. Shorter length training programs were associated with elevated hemodynamic responses. Single-directional G training did not significantly improve tolerance. Training programs appear best when high fidelity and sequential exposures may improve tolerance of physical/psychological flight stressors. The studied variables did not predict anxiety-related responses to these centrifuge profiles.Blue RS, Bonato F, Seaton K, Bubka A, Vardiman JL, Mathers C, Castleberry TL, Vanderploeg JM. The effects of training on anxiety

Short-term X-ray variability of the globular cluster source 4U 1820 - 30 (NGC 6624)

Science.gov (United States)

Stella, L.; Kahn, S. M.; Grindlay, J. E.

1984-01-01

Analytical techniques for improved identification of the temporal and spectral variability properties of globular cluster and galactic bulge X-ray sources are described in terms of their application to a large set of observations of the source 4U 1820 - 30 in the globular cluster NGC 6624. The autocorrelation function, cross-correlations, time skewness function, erratic periodicities, and pulse trains are examined. The results are discussed in terms of current models with particular emphasis on recent accretion disk models. It is concluded that the analyzed observations provide the first evidence for shot-noise variability in a globular cluster X-ray source.

A non-destructive method of determination of biomass of mango (Mangifera indica L.) and guava trees using principle of isotope dilution

International Nuclear Information System (INIS)

Kotur, S.C.; Keshava Murthy, S.V.

2004-01-01

Biomass of 4-year old trees 'Alphonso' mango was estimated by injecting carrier- free 32 P into the trunk followed by radioassay of the isotope after a complete dilution of 32 P in the tree (3 months after injection). The isotopically calculated plant volume (56.903 - 68.981 m 3 x10 3 ) and biomass (31.70 - 36.23 gx 10 -3 ) showed good agreement but generally overestimated both by about 19 per cent compared to the actual values determined physically (43.720 - 60.693 m 3 x10 3 and 22.88 - 34.78 gx 10 -3 , respectively). Application of the technique in a set of four 15-year old mango trees yielded volume estimates of 170.749 - 175.835 m 3 x10 3 (mean 173.512 ± 1.12 per cent) and biomass estimates of 73.0 - 87.4 gx10 -3 (mean = 80.32 ± 6.79 per cent). In another set of four 12-year old guava trees the corresponding values were 40.165 to 44.014 m 3 x10 3 (mean = 41.743 ± 3.42 per cent) and 22.252 gxl0 -3 (mean = 23.210 ± 2.95 per cent) respectively. The technique is of promise in fertilizer use efficiency and nutrient dynamics studies in tree crops. (author)

BL Lacertae: X-ray spectral evolution and a black-hole mass estimate

Science.gov (United States)

Titarchuk, Lev; Seifina, Elena

2017-06-01

We present an analysis of the spectral properties observed in X-rays from active galactic nucleus BL Lacertae using RXTE, Suzaku, ASCA, BeppoSAX, and Swift observations. The total time covered by these observations is approximately 20 yr. We show strong observational evidence that this source undergoes X-ray spectral transitions from the low hard state (LHS) through the intermediate state (IS) to the high soft state (HSS) during these observations. During the RXTE observations (1997-2001, 180 ks, for a total 145 datasets), the source was approximately 75%, 20% and only 5% of the time in the IS, LHS, and HSS, respectively. We also used Swift observations (470 datasets, for a total 800 ks), which occurred during 12 yr (2005-2016), the broadband (0.3-200 keV) data of BeppoSAX (1997-2000, 160 ks), and the low X-ray energy (0.3-10 keV) data of ASCA (1995-1999, 160 ks). Two observations of Suzaku (2006, 2013; 50 ks) in combinations with long-term RXTE and Swift data-sets fortunately allow us to describe all spectral states of BL Lac. The spectra of BL Lac are well fitted by the so-called bulk motion Comptonization (BMC) model for all spectral states. We have established the photon index saturation level, Γsat = 2.2 ± 0.1, in the Γ versus mass accretion rate (Ṁ) correlation. This Γ - Ṁ correlation allows us to estimate the black-hole (BH) mass in BL Lac to be MBH 3 × 107M⊙ for a distance of 300 Mpc. For the BH mass estimate, we use the scaling method taking stellar-mass Galactic BHs 4U 1543-47 and GX 339-4 as reference sources. The Γ - Ṁ correlation revealed in BL Lac is similar to those in a number of stellar-mass Galactic BHs and two recently studied intermediate-mass extragalactic BHs. It clearly shows the correlation along with the very extended Γ saturation at 2.2. This is robust observational evidence for the presence of a BH in BL Lac. We also reveal that the seed (disk) photon temperatures are relatively low, of order of 100 eV, which are consistent

30 CFR 75.339 - Seals records.

Science.gov (United States)

2010-07-01

... serve the purpose for which it is built. (3) Gas sampling records 75.336(e)(2) 1 year. (4) Record of... Services, or from the authorized representative of miners, mine operators shall promptly provide access to...

Open-Source Based Testbed for Multioperator 4G/5G Infrastructure Sharing in Virtual Environments

Directory of Open Access Journals (Sweden)

Ricardo Marco Alaez

2017-01-01

Full Text Available Fourth-Generation (4G mobile networks are based on Long-Term Evolution (LTE technologies and are being deployed worldwide, while research on further evolution towards the Fifth Generation (5G has been recently initiated. 5G will be featured with advanced network infrastructure sharing capabilities among different operators. Therefore, an open-source implementation of 4G/5G networks with this capability is crucial to enable early research in this area. The main contribution of this paper is the design and implementation of such a 4G/5G open-source testbed to investigate multioperator infrastructure sharing capabilities executed in virtual architectures. The proposed design and implementation enable the virtualization and sharing of some of the components of the LTE architecture. A testbed has been implemented and validated with intensive empirical experiments conducted to validate the suitability of virtualizing LTE components in virtual infrastructures (i.e., infrastructures with multitenancy sharing capabilities. The impact of the proposed technologies can lead to significant saving of both capital and operational costs for mobile telecommunication operators.

Image forming apparatus

DEFF Research Database (Denmark)

2005-01-01

An image H(x, y) for displaying a target image G(x, y) is displayed on a liquid-crystal display panel and illumination light from an illumination light source is made to pass therethrough to form an image on a PALSLM. Read light hv is radiated to the PALSLM and a phase-modulated light image alpha...... (x, y) read out of the PALSLM is subjected to Fourier transform by a lens. A phase contrast filter gives a predetermined phase shift to only the zero-order light component of Fourier light image alpha f(x, y). The phase-shifted light image is subjected to inverse Fourier transform by a lens...... to project an output image O(x, y) to an output plane. A light image O'(x, y) branched by a beam sampler is picked up by a pickup device and an evaluation value calculating unit evaluates conformity between the image O(x, y) and the image G(x, y).; A control unit performs feedback control of optical...

Source Lines Counter (SLiC) Version 4.0

Science.gov (United States)

Monson, Erik W.; Smith, Kevin A.; Newport, Brian J.; Gostelow, Roli D.; Hihn, Jairus M.; Kandt, Ronald K.

2011-01-01

Source Lines Counter (SLiC) is a software utility designed to measure software source code size using logical source statements and other common measures for 22 of the programming languages commonly used at NASA and the aerospace industry. Such metrics can be used in a wide variety of applications, from parametric cost estimation to software defect analysis. SLiC has a variety of unique features such as automatic code search, automatic file detection, hierarchical directory totals, and spreadsheet-compatible output. SLiC was written for extensibility; new programming language support can be added with minimal effort in a short amount of time. SLiC runs on a variety of platforms including UNIX, Windows, and Mac OSX. Its straightforward command-line interface allows for customization and incorporation into the software build process for tracking development metrics. T

Identification of soybean genotypes with high stability for the Brazilian macro-region 402 via biplot analysis.

Science.gov (United States)

Junior, E U Ramos; Brogin, R L; Godinho, V P C; Botelho, F J E; Tardin, F D; Teodoro, P E

2017-09-27

Biplot analysis has often been used to recommend genotypes from different crops in the presence of the genotype x environment interaction (GxE). The objective of this study was to verify the association between the AMMI and GGE biplot methods and to select soybean genotypes that simultaneously meet high grain yield and stability to the environments belonging to the Edaphoclimatic Region 402, from Soybean Cultivation Region 4 (Mid-West), which comprises the Center North and West of Mato Grosso, and the southern region of Rondônia. Grain yield of 12 soybean genotypes was evaluated in seven competition trials of soybean cultivars in the 2014/2015 harvest. Significant GxE interaction revealed the need to use methods for recommending genotypes with adaptability and yield stability. The methods were complementary regarding the recommendation of the best genotypes. The AMMI analysis recommended MG/BR46 (Conquista) (G10) widely for all environments evaluated, whereas the BRY23-55012 (G9) and BRAS11-0149 (G2) were the most indicated genotypes by the GGE biplot method. However, the methods were concordant as to Porto Velho (PV1) environment that contributed least to the GxE interaction.

Source biases in midlatitude magnetotelluric transfer functions due to Pc3-4 geomagnetic pulsations

Science.gov (United States)

Murphy, Benjamin S.; Egbert, Gary D.

2018-01-01

The magnetotelluric (MT) method for imaging the electrical conductivity structure of the Earth is based on the assumption that source magnetic fields can be considered quasi-uniform, such that the spatial scale of the inducing source is much larger than the intrinsic length scale of the electromagnetic induction process (the skin depth). Here, we show using EarthScope MT data that short spatial scale source magnetic fields from geomagnetic pulsations (Pc's) can violate this fundamental assumption. Over resistive regions of the Earth, the skin depth can be comparable to the short meridional range of Pc3-4 disturbances that are generated by geomagnetic field-line resonances (FLRs). In such cases, Pc's can introduce narrow-band bias in MT transfer function estimates at FLR eigenperiods ( 10-100 s). Although it appears unlikely that these biases will be a significant problem for data inversions, further study is necessary to understand the conditions under which they may distort inverse solutions.[Figure not available: see fulltext.

Enhanced thermal and structural properties of partially phosphorylated polyvinyl alcohol - Aluminum phosphate (PPVA-Alpo4) nanocomposites with aluminium nitrate source

Science.gov (United States)

Saat, Asmalina Mohamed; Johan, Mohd Rafie

2017-12-01

Synthesis of AlPO4 nanocomposite depends on the ratio of aluminum to phosphate, method of synthesis and the source for aluminum and phosphate source used. Variation of phosphate and aluminum source used will form multiple equilibria reactions and affected by ions variability and concentration, stoichiometry, temperature during reaction process and especially the precipitation pH. Aluminum nitrate was used to produce a partially phosphorylated poly vinyl alcohol-aluminum phosphate (PPVA-AlPO4) nanocomposite with various nanoparticle shapes, structural and properties. Synthesis of PPVA-AlPO4 nanocomposite with aluminum nitrate shows enhancement of thermal and structural in comparison with pure PVA and modified PPVA. Thermogravimetric (TGA) analysis shows that the weight residue of PPVA-AlPO4 composite was higher than PPVA and PVA. X-ray diffraction (XRD) pattern of PVA shows a single peak broadening after the addition of phosphoric acid. Meanwhile, XRD pattern of PPVA-AlPO4 demonstrates multiple phases of AlPO4 in the nanocomposite. Field Emission Scanning Electron Microscopy (FESEM) confirmed the existence of multiple geometrical phases and nanosize of spherical particles.

X-ray photoelectron spectroscopy studies of nitridation on 4H-SiC (0001) surface by direct nitrogen atomic source

International Nuclear Information System (INIS)

Chai, J. W.; Pan, J. S.; Zhang, Z.; Wang, S. J.; Chen, Q.; Huan, C. H. A.

2008-01-01

A Si 3 N 4 passivation layer has been successfully grown on the 4H-SiC (0001) surface by direct atomic source nitridation at various substrate temperatures. In situ x-ray photoelectron spectroscopy measurements show that higher substrate temperature leads to higher nitridation rate and good crystallinity of the passivation layer. A thin oxynitride layer on the top of the Si 3 N 4 was observed due to the residual O in the vacuum system, but was decomposed during annealing. In the meantime, excess C was found to be effectively removed by the reactive atomic N source

Evidence for inhomogeneous thermal sources of two spike events of 1978, May 5 and December 4

International Nuclear Information System (INIS)

Wiehl, H.J.; Desai, U.

1982-09-01

Two short duration single spike events of 1978 May 5 and December 4 exhibit similar time profiles in the microwave and hard X-ray ranges, indicating emission from compact sources. Microwave spectral observations exhibit inhomogeneieties present in the source parameters. The existence of fine time structures in the microwave time profiles at 10.4 GHz from Berne are interpreted as a signature of the dynamics of a disturbance travelling through the souce at the ion-sound speed. Stereoscopic observations with the hard X-ray detector on the solar orbiter, Helios-2, and the Berne microwave antennae do not indicate any time lag or differences in the time profiles during the impulsive phase. This is taken as evidence for the absence of directionality of emission making beam models unlikely for short duration single spike events

Impact parameter and source selected correlation functions with a 4π multidetector

International Nuclear Information System (INIS)

Gourio, D.; Reposeur, T.; Assenard, M.; Germain, M.; Ardouin, D.; Eudes, P.; Lautridou, P.; Laville, J.L.; Lebrun, C.; Metivier, V.

1997-01-01

For the first time in the domain of (light charged) particle interferometry in nuclear physics, a complete study of proton an deuteron correlation functions is presented with both impact parameter and emission source selections. The correlations were determined for the system 129 Xe + nat Sn at 45 and 50 AMeV using the 4π multidetector INDRA at GANIL as an event selector as well as a particle correlator. Very short emission times are found for all the selections indicating possible contributions from a fast and preequilibrium process. (author)

The Structure of the Silumin Coat on Alloy Cast Steels

Directory of Open Access Journals (Sweden)

T. Szymczak

2012-04-01

Full Text Available The work presents the analysis results of the structure of the coat obtained by dipping in silumin AlSi5 of two grades of alloy cast steel: GX6CrNiTi18-10 (LH18N9T and GX39Cr13 (LH14. The temperature of the silumin bath was 750±5°C, and the hold-up time of the cast steel element τ = 180 s. The absolute thickness of the coat obtained in the given conditions was g = 104 μm on cast steel GX6CrNiTi18-10 and g = 132 μm on GX39Cr13. The obtained coat consisted of three layers of different phase structure. The first layer from the base “g1`” was constructed of the phase AlFe including Si and alloy additives of the tested cast steel grades: Cr and Ni (GX6CrNiTi18-10 and Cr (GX39Cr13. The second layer “g1``” of intermetallic phases AlFe which also contains Si and Cr crystallizes on it. The last, external layer “g2” of the coat consists of the silumin containing the intermetallic phases AlFeSi which additionally can contain alloy additives of the cast steel. It was shown that there were no carbides on the coat of the tested cast steels which are the component of their microstructure, as it took place in the case of the coat on the high speed steels.

Neutrons Flux Distributions of the Pu-Be Source and its Simulation by the MCNP-4B Code

Science.gov (United States)

Faghihi, F.; Mehdizadeh, S.; Hadad, K.

Neutron Fluence rate of a low intense Pu-Be source is measured by Neutron Activation Analysis (NAA) of 197Au foils. Also, the neutron fluence rate distribution versus energy is calculated using the MCNP-4B code based on ENDF/B-V library. Theoretical simulation as well as our experimental performance are a new experience for Iranians to make reliability with the code for further researches. In our theoretical investigation, an isotropic Pu-Be source with cylindrical volume distribution is simulated and relative neutron fluence rate versus energy is calculated using MCNP-4B code. Variation of the fast and also thermal neutrons fluence rate, which are measured by NAA method and MCNP code, are compared.

Prediction of 4H–SiC betavoltaic microbattery characteristics based on practical Ni-63 sources

International Nuclear Information System (INIS)

Gui, Gui; Zhang, Kan; Blanchard, James P.; Ma, Zhenqiang

2016-01-01

We have investigated the performance of 4H–SiC betavoltaic microbatteries under exposure to the practical Ni-63 sources using the Monte Carlo method and Synopsys® Medici device simulator. A typical planar p–n junction betavoltaic device with the Ni-63 source of 20% purity on top is modeled in the simulation. The p–n junction structure includes a p+ layer, a p− layer, an n+ layer, and an n− layer. In order to obtain an accurate and valid predication, our simulations consider several practical factors, including isotope impurities, self-absorption, and full beta energy spectra. By simulating the effects of both the p–n junction configuration and the isotope source thickness on the battery output performance, we have achieved the optimal design of the device and maximum energy conversion efficiency. Our simulation results show that the energy conversion efficiency increases as the doping concentration and thickness of the p− layer increase, whereas it is independent of the total depth of the p–n junction. Furthermore, the energy conversion efficiency decreases as the thickness of the practical Ni-63 source increases, because of self-absorption in the isotope source. Therefore, we propose that a p–n junction betavoltaic cell with a thicker and heavily doped p− layer under exposure to a practical Ni-63 source with an appreciable thickness could produce the optimal energy conversion efficiency. - Highlights: • Different thicknesses of Ni-63 isotope sources with 20% purity were employed. • A self-absorption model was constructed for the beta energy spectra of Ni-63 sources. • The optimization strategies for betavoltaic microbatteries were outlined.

The serotonin transporter gene and functional and pathological adaptation to environmental variation across the life span

NARCIS (Netherlands)

Homberg, J.R.; van den Hove, D.L.

2012-01-01

In analogy with the accepted view that behaviour is shaped by genexenvironment (GxE) interactions, GxE studies are exponentially increasing in the field of psychiatry. Whereas research was primarily driven by the premature view that negative environmental stimuli can trigger psychopathology in those

Observing Compact Stars with AstroSat

Indian Academy of Sciences (India)

25

... of the Crab pulsar and an X-ray binary system GX 301-2 are presented to illustrate some of the capabilities of the mission. ...... vided online at the web portal of the AstroSat Science. Support Cell1. ... Library, Springer, 440, 61. [4] Bhalerao,V.

[Estimation of urban non-point source pollution loading and its factor analysis in the Pearl River Delta].

Science.gov (United States)

Liao, Yi-Shan; Zhuo, Mu-Ning; Li, Ding-Qiang; Guo, Tai-Long

2013-08-01

In the Pearl Delta region, urban rivers have been seriously polluted, and the input of non-point source pollution materials, such as chemical oxygen demand (COD), into rivers cannot be neglected. During 2009-2010, the water qualities at eight different catchments in the Fenjiang River of Foshan city were monitored, and the COD loads for eight rivulet sewages were calculated in respect of different rainfall conditions. Interesting results were concluded in our paper. The rainfall and landuse type played important roles in the COD loading, with greater influence of rainfall than landuse type. Consequently, a COD loading formula was constructed that was defined as a function of runoff and landuse type that were derived SCS model and land use map. Loading of COD could be evaluated and predicted with the constructed formula. The mean simulation accuracy for single rainfall event was 75.51%. Long-term simulation accuracy was better than that of single rainfall. In 2009, the estimated COD loading and its loading intensity were 8 053 t and 339 kg x (hm2 x a)(-1), and the industrial land was regarded as the main source of COD pollution area. The severe non-point source pollution such as COD in Fenjiang River must be paid more attention in the future.

RF Plasma modeling of the Linac4 H− ion source

CERN Document Server

Mattei, S; Hatayama, A; Lettry, J; Kawamura, Y; Yasumoto, M; Schmitzer, C

2013-01-01

This study focuses on the modelling of the ICP RF-plasma in the Linac4 H− ion source currently being constructed at CERN. A self-consistent model of the plasma dynamics with the RF electromagnetic field has been developed by a PIC-MCC method. In this paper, the model is applied to the analysis of a low density plasma discharge initiation, with particular interest on the effect of the external magnetic field on the plasma properties, such as wall loss, electron density and electron energy. The use of a multi-cusp magnetic field effectively limits the wall losses, particularly in the radial direction. Preliminary results however indicate that a reduced heating efficiency results in such a configuration. The effect is possibly due to trapping of electrons in the multi-cusp magnetic field, preventing their continuous acceleration in the azimuthal direction.

Group IV Materials for High Performance Methane Sensing in Novel Slot Optical Waveguides at 2.883 μm and 3.39 μm

Directory of Open Access Journals (Sweden)

Vittorio M. N. PASSARO

2012-03-01

Full Text Available In this paper a detailed investigation of novel photonic sensors based on slot waveguides has been carried out. Appropriate alloys of group IV materials, such as germanium (Ge, silicon (Si, carbon (C and tin (Sn, are applied in silicon-on-insulator (SOI technology for homogeneous optical sensing at 2.883 µm and 3.39 μm. Electronic and optical properties of group IV alloys have been investigated. In addition, we have designed novel group IV vertical slot waveguides in order to achieve ultra-high sensitivities, as well as good fabrication tolerances. All these features have been compared with well-known SOI slot waveguides for optical label-free homogeneous sensing at 1.55 µm. In conclusion, theoretical investigation of ring resonators based on these novel slot waveguides has revealed very good results in terms of ultra high sensing performance of methane gas, i.e., limit of detection ~ 3.6×10-5 RIU and wavelength sensitivity > 2×103 nm/RIU.

CD4 T cells remain the major source of HIV-1 during end stage disease.

NARCIS (Netherlands)

M.E. van der Ende (Marchina); M. Schutten (Martin); B. Raschdorff; G. Grosschupff; P. Racz; A.D.M.E. Osterhaus (Albert); K. Tenner-Racz

1999-01-01

textabstractOBJECTIVE: To assess the source of HIV-1 production in lymphoid tissue biopsies from HIV-infected patients, with no prior anti-retroviral protease inhibitor treatment, with a CD4 cell count > 150 x 10(6)/l (group I) or < 50 x 10(6)/l (group II), co-infected with Mycobacterium

Monte Carlo simulation using MCNP4B for an optimal shielding design of a 252 Cf source

International Nuclear Information System (INIS)

Silva, Ademir X. da; Crispim, Verginia R.

2001-01-01

This study aim to investigate an optimum shielding design against neutrons and gamma-rays from a source of 252 Cf, using Monte Carlo simulation. The shielding materials studied were: borated polyethylene, borated-lead polyethylene and stainless steel. The Monte Carlo code MCNP, version 4B, was used to design shielding for 252 Cf based neutron irradiator systems. By normalizing the dose equivalent rate values presented to the neutron production rate of the source, the resulting calculations are independents of the intensity of actual 252 Cf source. The results shown what the total dose equivalent rates were reduced significantly by the shielding system optimization. (author)

Evolution of the 1984 outburst of the transient X-ray source 4U 1630 - 47

International Nuclear Information System (INIS)

Parmar, A.N.; Stella, L.; White, N.E.

1986-01-01

The results of a series of EXOSAT observations of the X-ray transient 4U 1630 - 47 during an outburst in 1984 are presented. The source decayed over an interval of about 100 days from a maximum 1-50 keV luminosity of about 2.8 x 10 to the 38th to about 4 x 10 to the 36th erg/s (for an assumed distance of 10 kpc). The 1-50 keV spectrum was best represented by a soft Wien-like spectrum with a temperature about 1 keV and a high-energy power-law tail. The relative contribution of the soft component to that of the high-energy power law decreased by atleast a factor of about 2 as the overall luminosity decreased. When the source was at its maximum observed luminosity, short time scale 7 percent intensity variations (1-7 keV) were seen with a characteristic time scale of about 20 s. The shortest time scale variability detected was about 50 ms. A 10-arcsec position obtained using an imaging telescope excludes a previously suggested optical counterpart. The spectral properties of 4U 1630 - 47 are reminiscent of those of the black hole candidate Cyg X-1 when it evolves from a high to a low state. 28 references

Synthesis of lithium mangan dioxide (LiMn2O4) for lithium-ion battery cathode from various lithium sources

Science.gov (United States)

Priyono, S.; Ginting, N. R.; Humaidi, S.; Subhan, A.; Prihandoko, B.

2018-03-01

LiMn2O4 as a cathode material has been synthesized via solid state reaction. The synthesis has been done by varying lithium sources such as LiOH.H2O and Li2CO3 while MnO2 was used as Mn sources. All raw materials were mixed stoichiometrically to be the precursors of LiMn2O4. The precursors were sintered using high temperature furnace at 800 °C for 4 hours in atmospheric condition to form final product. The final products were sieved to separate the finer and smoother particles from the coarse ones. The products were characterized by X-Ray Diffractometer (XRD) to identify phases and crystal structure. The peak wave number was also determined using Fourier Transform Infra Red (FTIR) to find functional group. LiMn2O4 sheets were prepared by mixing active material with polyvinylidene fluoride (PVdF) and acetylene black (AB) in mass ratio of 85:10:5 wt.% in N,N-Dimethylacetamide (DMAc) solvents to form slurry. The slurry was then coated onto Al foil with thickness of about 0.15 mm and dried in an oven. LiMn2O4 sheet was cut into circular discs and arranged with separator, metallic lithium, and electrolyte in a coin cell. Automatic battery cycler was used to measure electrochemical performance and specific capacity of the cell. XRD analysis showed that sample synthesized with Li2CO3 has higher crystallinity and more pristine than sample synthesized with LiOH.H2O. FTIR analysis revealed that both of samples have identical functional group but sample with Li2CO3 source tend to degrade. Cyclic voltammetry data gave information that sample with LiOH.H2O source has better electrochemical performance. It showed double oxidation/reduction peaks more clearly but sample with Li2CO3 source has higher specific capacity (64.78 mAh/g) than sample with LiOH.H2O (50 mAh/g).

Analysis of the Arabidopsis IRX9/IRX9-L and IRX14/IRX14-L pairs of glycosyltransferase genes reveals critical contributions to biosynthesis of the hemicellulose glucuronoxylan.

Science.gov (United States)

Wu, Ai-Min; Hörnblad, Emma; Voxeur, Aline; Gerber, Lorenz; Rihouey, Christophe; Lerouge, Patrice; Marchant, Alan

2010-06-01

The hemicellulose glucuronoxylan (GX) is a major component of plant secondary cell walls. However, our understanding of GX synthesis remains limited. Here, we identify and analyze two new genes from Arabidopsis (Arabidopsis thaliana), IRREGULAR XYLEM9-LIKE (IRX9-L) and IRX14-LIKE (IRX14-L) that encode glycosyltransferase family 43 members proposed to function during xylan backbone elongation. We place IRX9-L and IRX14-L in a genetic framework with six previously described glycosyltransferase genes (IRX9, IRX10, IRX10-L, IRX14, FRAGILE FIBER8 [FRA8], and FRA8 HOMOLOG [F8H]) and investigate their function in GX synthesis. Double-mutant analysis identifies IRX9-L and IRX14-L as functional homologs of IRX9 and IRX14, respectively. Characterization of irx9 irx10 irx14 fra8 and irx9-L irx10-L irx14-L f8h quadruple mutants allows definition of a set of genes comprising IRX9, IRX10, IRX14, and FRA8 that perform the main role in GX synthesis during vegetative development. The IRX9-L, IRX10-L, IRX14-L, and F8H genes are able to partially substitute for their respective homologs and normally perform a minor function. The irx14 irx14-L double mutant virtually lacks xylan, whereas irx9 irx9-L and fra8 f8h double mutants form lowered amounts of GX displaying a greatly reduced degree of backbone polymerization. Our findings reveal two distinct sets of four genes each differentially contributing to GX biosynthesis.

Monte Carlo dose calculations of beta-emitting sources for intravascular brachytherapy: a comparison between EGS4, EGSnrc, and MCNP.

Science.gov (United States)

Wang, R; Li, X A

2001-02-01

The dose parameters for the beta-particle emitting 90Sr/90Y source for intravascular brachytherapy (IVBT) have been calculated by different investigators. At a distant distance from the source, noticeable differences are seen in these parameters calculated using different Monte Carlo codes. The purpose of this work is to quantify as well as to understand these differences. We have compared a series of calculations using an EGS4, an EGSnrc, and the MCNP Monte Carlo codes. Data calculated and compared include the depth dose curve for a broad parallel beam of electrons, and radial dose distributions for point electron sources (monoenergetic or polyenergetic) and for a real 90Sr/90Y source. For the 90Sr/90Y source, the doses at the reference position (2 mm radial distance) calculated by the three code agree within 2%. However, the differences between the dose calculated by the three codes can be over 20% in the radial distance range interested in IVBT. The difference increases with radial distance from source, and reaches 30% at the tail of dose curve. These differences may be partially attributed to the different multiple scattering theories and Monte Carlo models for electron transport adopted in these three codes. Doses calculated by the EGSnrc code are more accurate than those by the EGS4. The two calculations agree within 5% for radial distance <6 mm.

The F8H Glycosyltransferase is a Functional Paralog of FRA8 Involved in Glucuronoxylan Biosynthesis in Arabidopsis

Science.gov (United States)

The FRAGILE FIBER8 gene was previously shown to be required for the biosynthesis of the reducing end tetrasaccharide sequence of glucuronoxylan (GX) in Arabidopsis thaliana. Here, we demonstrate that F8H, a close homolog of FRA8, is a functional ortholog of FRA8 involved in GX bi...

The electron-dose distribution surrounding an 192Ir wire bracytherapy source investigated using EGS4 simulations and GafChromic film

International Nuclear Information System (INIS)

Cheung, Y.C.; Yu, P.K.N.; Young, E.C.M.; Wong, T.P.Y.

1997-01-01

The steep dose gradient around 192 Ir brachytherapy wire implants is predicted by the EGS4 (PRESTA version) Monte Carlo simulation. When considering radiation absorbing regions close to the wire source, the accurate dose distribution cannot be calculated by the GE Target II Sun Sparc treatment-planning system. Experiments using GafChromic TM film have been performed to prove the validity of the EGS4 user code when calculating the dose close to the wire source in a low energy range. (Author)

Effects of gas to melt ratio on the microstructure of an Al–10.83Zn–3.39Mg–1.22Cu alloy produced by spray atomization and deposition

Energy Technology Data Exchange (ETDEWEB)

Guo, S. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Center of Analysis Measurement, Harbin Institute of Technology, Harbin 150001 (China); Ning, Z.L. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); National Key laboratory for Precision Hot Processing of Metals, Harbin Institute of Technology, Harbin 150001 (China); Zhang, M.X. [School of Mechanical and Mining Engineering, The University of Queensland, St Lucia, QLD 4072 (Australia); Cao, F.Y. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); National Key laboratory for Precision Hot Processing of Metals, Harbin Institute of Technology, Harbin 150001 (China); Sun, J.F., E-mail: jfsun@hit.edu.cn [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); National Key laboratory for Precision Hot Processing of Metals, Harbin Institute of Technology, Harbin 150001 (China)

2014-01-15

Various gas to melt ratios (GMR) that govern the cooling rate of spray forming can be achieved through controlling the atomizer form and the atomization pressure. The effect of the GMR on microstructures of an Al–10.83Zn–3.39Mg–1.22Cu alloy produced through spray forming has been studied using electron microscopy. When the GMR is high at 3.5, dendritic structure and quasi-crystalline i-Mg{sub 32}(AlZn){sub 49} particles inherited from the original powders can be observed. Spray forming at medium GMR of 2.3 produces equiaxed α-Al grains and MgZn{sub 2} phase that discontinuously distributes along the grain boundaries and within the grains as small particles. The low GMR of 1.4 corresponds to low cooling rate. Coarse and equiaxed α-Al grains together with eutectic structure consisting of b.c.c.-Mg{sub 32}(AlZn){sub 49} and α-Al phases along the grain boundaries are obtained. - Highlights: • At high GMR, the broken fragments and i-Mg{sub 32}(AlZn){sub 49} quasicrystal are observed. • At medium GMR, microstructure consists of α-Al equiaxed grains and MgZn{sub 2} phase. • At low GMR, the coarsened α-Al grains and bcc-Mg{sub 32}(AlZn){sub 49} eutectic appear.

Infiltration Kinetics and Interfacial Bond Strength of Metal Matrix Composites

Science.gov (United States)

1992-07-01

and M. Kohyama [29] used X-ray and ultra violet photoelectron spectroscopy to monitor the in situ electronic structure changes of the alumina surface...in terms of Gibbs excess energy, G". Therefore, AGUa A- A GR Gx- (3) The procedure established to estimate GX" involves the use of the experimentally

Determination of efficiency curves for HPGE detector in different counting geometries

International Nuclear Information System (INIS)

Rodrigues, Josianne L.; Kastner, Geraldo F.; Ferreira, Andrea V.

2011-01-01

This paper presents the first experimental results related to determination of efficiency curves for HPGe detector in different counting geometries. The detector is a GX2520 Canberra belonging to CDTN/CNEN. Efficiency curves for punctual were determined by using a certified set of gamma sources. These curves were determined for three counting geometries. Following that, efficiency curves for non punctual samples were determined by using standard solutions of radionuclides in 500 ml and 1000 ml wash bottle Marinelli

Identifying sources of methane sampled in the Arctic using δ13C in CH4 and Lagrangian particle dispersion modelling.

Science.gov (United States)

Cain, Michelle; France, James; Pyle, John; Warwick, Nicola; Fisher, Rebecca; Lowry, Dave; Allen, Grant; O'Shea, Sebastian; Illingworth, Samuel; Jones, Ben; Gallagher, Martin; Welpott, Axel; Muller, Jennifer; Bauguitte, Stephane; George, Charles; Hayman, Garry; Manning, Alistair; Myhre, Catherine Lund; Lanoisellé, Mathias; Nisbet, Euan

2016-04-01

An airmass of enhanced methane was sampled during a research flight at ~600 m to ~2000 m altitude between the North coast of Norway and Svalbard on 21 July 2012. The largest source of methane in the summertime Arctic is wetland emissions. Did this enhancement in methane come from wetland emissions? The airmass was identified through continuous methane measurements using a Los Gatos fast greenhouse gas analyser on board the UK's BAe-146 Atmospheric Research Aircraft (ARA) as part of the MAMM (Methane in the Arctic: Measurements and Modelling) campaign. A Lagrangian particle dispersion model (the UK Met Office's NAME model) was run backwards to identify potential methane source regions. This was combined with a methane emission inventory to create "pseudo observations" to compare with the aircraft observations. This modelling was used to constrain the δ13C CH4 wetland source signature (where δ13C CH4 is the ratio of 13C to 12C in methane), resulting in a most likely signature of -73‰ (±4‰7‰). The NAME back trajectories suggest a methane source region of north-western Russian wetlands, and -73‰ is consistent with in situ measurements of wetland methane at similar latitudes in Scandinavia. This analysis has allowed us to study emissions from remote regions for which we do not have in situ observations, giving us an extra tool in the determination of the isotopic source variation of global methane emissions.

Charged particle equilibrium corrections for photon sources from 400 keV to 1.4 MeV

Science.gov (United States)

Vasudevan, Latha

Lack of charged particle equilibrium (CPE) has practical importance in radiological health protection, in nuclear medicine, and radiobiology where small radioactive point sources irradiate the human body accidentally or may be introduced into the body for diagnostic, therapeutic, or analytical purposes. The absorbed dose under CPE is readily calculated from knowledge of the photon energy fluence and mass-absorption coefficient of the material. When estimating absorbed dose rates at points close to the source, the primary radiation field varies appreciably over the region within the range of secondary particles. Under such conditions, CPE does not exist and prediction of absorbed dose becomes difficult. However, if one applies correction factors for non-CPE conditions, absorbed dose rates can be calculated fairly easily. In this dissertation, a CPE model was developed for non-CPE conditions to predict the fraction of charged particle equilibrium (GammaCPE) attained in a water medium for point sources of energies in the range from 400 keV to 1.4 MeV using EGS4-DOSRZ Monte Carlo calculation. A new methodology to calculate absorbed dose and kerma along the central axis of the cylindrical phantom was presented and the results were found to be in excellent agreement with published values. In order to corroborate with the EGS4-DOSRZ calculation, another model based on the Klein-Nishina single scattering cross section was developed to quantify the GammaCPE attained in water for point sources. A CPE path length coefficient (mu cm-1) was found for each photon energy and compared with published values. This coefficient was used to determine dose rates averaged over 1 cm2 at depths that are of interest in skin dose exposures. Experimental measurements of CPE were carried out for a Co-60 point source using GAFCHROMICRTM MD-55 film (1990) as the dosimetry media. The films were read using a document scanner. Dose rates obtained using the scanner method were compared with those

Air density dependence of the response of the PTW SourceCheck 4pi ionization chamber for 125I brachytherapy seeds.

Science.gov (United States)

Torres Del Río, J; Tornero-López, A M; Guirado, D; Pérez-Calatayud, J; Lallena, A M

2017-06-01

To analyze the air density dependence of the response of the new SourceCheck 4pi ionization chamber, manufactured by PTW. The air density dependence of three different SourceCheck 4pi chambers was studied by measuring 125 I sources. Measurements were taken by varying the pressure from 746.6 to 986.6hPa in a pressure chamber. Three different HDR 1000 Plus ionization chambers were also analyzed under similar conditions. A linear and a potential-like function of the air density were fitted to experimental data and their achievement in describing them was analyzed. SourceCheck 4pi chamber response showed a residual dependence on the air density once the standard pressure and temperature factor was applied. The chamber response was overestimated when the air density was below that under normal atmospheric conditions. A similar dependence was found for the HDR 1000 Plus chambers analyzed. A linear function of the air density permitted a very good description of this residual dependence, better than with a potential function. No significant variability between the different specimens of the same chamber model studied was found. The effect of overestimation observed in the chamber responses once they are corrected for the standard pressure and temperature may represent a non-negligible ∼4% overestimation in high altitude cities as ours (700m AMSL). This overestimation behaves linearly with the air density in all cases analyzed. Copyright © 2017 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

Uso de polímeros em formulações para preservação de Pectobacterium atrosepticum e Ralstonia solanacearum Formulation with polymers for the Pectobacterium atrosepticum e Ralstonia solanacearum

Directory of Open Access Journals (Sweden)

Andréia Iraci Tumelero

2008-02-01

Full Text Available A sobrevivência de Pectobacterium atrosepticum e de Ralstonia solanacearum foi avaliada em veículo à base de goma xantana (GX, um polímero biológico, e de goma xantana acrescida de polivinilpirrolidona (PVP, um polímero sintético. As culturas, após crescimento até 10(11 ufc mL-1 foram injetadas junto a essas formulações e a sobrevivência avaliada em diferentes condições de armazenamento: em temperatura ambiente, em refrigerador (4ºC e em freezer (-20ºC, por 36 meses. A concentração de células viáveis foi realizada através de diluições seriadas. A patogenicidade foi avaliada em plantas hospedeiras e em iscas. Os resultados permitem observar que a concentração de células viáveis decresceu ao longo do tempo, mantendo-se entre 10³ e 10(4 ufc mL-1 ao final de três anos, exceto para a formulação à base de GX e armazenamento à -20°C, que se mostrou ineficiente para ambas as bactérias. Conclui-se, que os polímeros avaliados mostraram-se eficientes em preservar e manter as características bioquímicas e fisiológicas das bactérias Pectobacterium atrosepticum e de Ralstonia solanacearum.The survival of Pectobacterium atrosepticum and Ralstonia solanacearum was evaluated in biopolymer carrier xanthan gum (GX and xanthan gum together with polymer synthetic polyvinylpyrrolidone (PVP. The cultures after growing up to 10(11 ufc mL-1 were injected into the plolymers carriers. The survival of the bacteria was evaluated at room temperature, refrigerator (4ºC and freezer (-20ºC for 36 months. The evaluation of viability of the preserved bacteria was carried through seriate dilutions using drop method. The pathogenicity was observed in plant hosts and through baits. The results allow observing that the concentration of viable cells decreased along the time mainting to 10³ and 10(4 ufc mL-1 for three years with exception, of the formulation to the base of GX and storage the -20°C, that was inefficient for preservation of

OSSMETER D3.4 – Language-Specific Source Code Quality Analysis

NARCIS (Netherlands)

J.J. Vinju (Jurgen); A. Shahi (Ashim); H.J.S. Basten (Bas)

2014-01-01

htmlabstractThis deliverable is part of WP3: Source Code Quality and Activity Analysis. It provides descriptions and prototypes of the tools that are needed for source code quality analysis in open source software projects. It builds upon the results of: • Deliverable 3.1 where infra-structure and

Synchrotron light source data book: Version 4, Revision 05/96

International Nuclear Information System (INIS)

Murphy, J.B.

1996-05-01

This book is as its name implies a collection of data on existing and planned synchrotron light sources. The intention was to provide a compendium of tools for the design of electron storage rings as synchrotron radiation sources. The slant is toward the accelerator physicist as other booklets such as the X-Ray Data Booklet address the use of synchrotron radiation. It is hoped that the booklet serves as a pocket sized reference to facilitate back of the envelope type calculations. It contains some useful formulae in practical units and a brief description of many of the existing and planned light source lattices

Synchrotron light source data book: Version 4, Revision 05/96

Energy Technology Data Exchange (ETDEWEB)

Murphy, J.B.

1996-05-01

This book is as its name implies a collection of data on existing and planned synchrotron light sources. The intention was to provide a compendium of tools for the design of electron storage rings as synchrotron radiation sources. The slant is toward the accelerator physicist as other booklets such as the X-Ray Data Booklet address the use of synchrotron radiation. It is hoped that the booklet serves as a pocket sized reference to facilitate back of the envelope type calculations. It contains some useful formulae in practical units and a brief description of many of the existing and planned light source lattices.

77 FR 33770 - Pharmboy Ventures Unlimited, Inc., Decision and Order

Science.gov (United States)

2012-06-07

... also alleged that on January 20, 2011, Mr. McFadden had pled no contest to seven state law counts of... proposed registered location. GX C. As evidenced by the signed return receipt card, service was...'s terminated Mr. McFadden. GX J. In addition, Mr. McFadden was charged with seven felony counts of...

Airborne spectrophotometry of Eta Carinae from 4.5 to 7.5 microns and a model for source morphology

Science.gov (United States)

Russell, Ray W.; Lynch, David K.; Hackwell, John A.; Rudy, Richard J.; Rossano, George S.; Castelaz, M. W.

1987-01-01

Spectrophotometric observations of Eta Car between 4.5 and 7.5 microns show a featureless thermal-like spectrum with no fine-structure lines or broad emission or absorption features. The color temperature of the spectrum is approximately 375 K. High spatial resolution maps at 3.5, 4.8, and 10 microns obtained from the ground are used to discuss the dust distribution and temperature structure, and to present a model for general source morphology. The upper limit to the brightness of the forbidden Ar II fine-structure emission line at 6.98 microns is less than 7 x 10 to the -16th W/sq cm, which still allows for a significant overabundance of argon and is consistent with the evolved nature of the source.

Gas Injection And Fast Pressure-Rise Measurements For The Linac4 H− Source

CERN Document Server

Mahner, E; Lettry, J; Mattei, S; O'Neil, M; Neupert, H; Pasquino, C; Schmitzer, C

2013-01-01

In the era of the Large Hadron Collider, the CERN injector complex comprising the 34 years old Linac2 with its primary proton source, is presently upgraded with a new linear accelerator for H− (Linac4). The design, construction, and test of volume production and cesiated RF-driven H− ion sources is presently ongoing with the final goal of producing an H− beam with 80 mA beam current, 45 keV beam energy, 500 s pulse length, and a repetition rate of 2 Hz. In order to have quantitative information of the hydrogen gas density at the moment of plasma ignition the dynamic vacuum properties of the plasma generator were studied experimentally. We describe the experimental setup and present fast pressure-rise measurements for different parameters of the gas injection system, such as gas species (H2, He, N2, Ar), piezo valve voltage pulse length (200 - 500 s), and injection pressure (400 - 2800 mbar). The obtained data are compared with a conductance model of the plasma generator.

Recent developments at 3rd generation storage ring light sources (4/4)

CERN Multimedia

CERN. Geneva

2009-01-01

Over the last decade, many 3rd generation storage ring light sources have been built and put into operation. Progressively, significant improvements have been brought to the machine performances and experiences developed at the first facilities have benefited to the most recently built ones. Most of the recent facilities are now featuring small emittances, high current together with high position stability. The small sizes of the electron beam at the source points impose achieving position stabilities in the sub micron range. The technology to build the insertion devices that produce the photon beams has reached a very mature state and enables 3 GeV medium energy /medium size machines to produce high brilliance beams up to the hard X-Ray range (10 - 30 keV). The designing of the optical set-up of a beamline includes now the choice of the best suited undulator. All these facilities are operated as “photon factories” and deliver their beams to many beamlines over several thousands hours per year. Some re...

Phylogenetic and genomic characterization of a novel atypical porcine pestivirus in China.

Science.gov (United States)

Zhang, H; Wen, W; Hao, G; Hu, Y; Chen, H; Qian, P; Li, X

2018-02-01

Atypical porcine pestivirus (APPV) has been considered a novel pestivirus and causative agent of congenital tremor type A-II. An APPV CH-GX2016 strain was characterized from newly born piglets with clinical symptoms of congenital tremor in Guangxi, China. The genome of APPV CH-GX 2016 strain was 11,475 bp in length and encoded a polyprotein composed of the 3,635 amino acids. This genome sequence exhibited 88.0% to 90.8% nucleotide sequence homology with other APPV reference sequences in GenBank. Phylogenetic analysis further showed that APPV CH-GX is a novel pestivirus compared with previously described classical pestivirus strains. Therefore, APPV is present in pigs in China. © 2017 Blackwell Verlag GmbH.

A Source Term for Wave Attenuation by Sea Ice in WAVEWATCH III (registered trademark): IC4

Science.gov (United States)

2017-06-07

blue and 4 locations in the ice: 1, 2, 5, and 10 km. Notice the steepening of the high frequency face and the shift of the peak to slightly lower...Term for Wave Attenuation by Sea Ice in WAVEWATCH III®: IC4 ClarenCe O. COllins iii W. eriCk rOgers Ocean Dynamics and Prediction Branch Oceanography...Wave model Sea ice Ocean surface waves Arctic Ocean WAVEWATCH III Spectral wave modeling Source terms Wave hindcasting 73-N2K2-07-5 Naval Research

Atmospheric observations for quantifying emissions of point-source synthetic greenhouse gases (CF4, NF3 and HFC-23)

Science.gov (United States)

Arnold, Tim; Manning, Alistair J.; Li, Shanlan; Kim, Jooil; Park, Sunyoung; Fraser, Paul J.; Mitrevski, Blagoj; Steele, L. Paul; Krummel, Paul B.; Mühle, Jens; Weiss, Ray F.

2016-04-01

The fluorinated species carbon tetrafluoride (CF4; PFC-14), nitrogen trifluoride (NF3) and trifluoromethane (CHF3; HFC-23) are potent greenhouse gases with 100-year global warming potentials of 6,630, 16,100 and 12,400, respectively. Unlike the majority of CFC-replacement compounds that are emitted from fugitive and mobile emission sources, these gases are largely emitted from large single point sources - semiconductor manufacturing facilities (all three), aluminium smelting plants (CF4) and chlorodifluoromethane factories (HFC-23). In this work we show the potential for atmospheric measurements to understand regional sources of these gases and to highlight emission 'hotspots'. We target our analysis on measurements from two Advanced Global Atmospheric Gases Experiment (AGAGE) long term monitoring sites that are particularly sensitive to regional emissions of these gases: Gosan on Jeju Island in the Republic of Korea and Cape Grim on Tasmania in Australia. These sites measure CF4, NF3 and HFC-23 alongside a suite of greenhouse and stratospheric ozone depleting gases every two hours using automated in situ gas-chromatography mass-spectrometry instrumentation. We couple each measurement to an analysis of air history using the regional atmospheric transport model NAME (Numerical Atmospheric dispersion Modelling Environment) driven by 3D meteorology from the Met Office's Unified Model, and use a Bayesian inverse method (InTEM - Inversion Technique for Emission Modelling) to calculate yearly emission changes over a decade (2005-2015) at high spatial resolution. At present these gases make a small contribution to global radiative forcing, however, given that their impact could rise significantly and that point sources of such gases can be mitigated, atmospheric monitoring could be an important tool for aiding emissions reduction policy.

High-efficient, bicolor-emitting GdVO_4:Dy"3"+ phosphor under near ultraviolet excitation

International Nuclear Information System (INIS)

Lu, Jinjin; Zhou, Jia; Jia, Huayu; Tian, Yue

2015-01-01

Bicolor emitting GdVO_4:Dy"3"+ phosphor with short columniation-shape was prepared via a simple co-precipitation process. The optimal doping concentration for obtaining maximal luminescent intensity was confirmed to be 0.3 mol% and the electric dipole–dipole interaction is responsible for concentration quenching of Dy"3"+ emission in GdVO_4 phosphor. In order to evaluate the luminescent performance of as-prepared phosphor, the luminescent efficiency and color coordinates were studied. The results show that luminescent efficiency of this phosphor is very high under near UV excitation and twice times higher than commercial Y_2O_2S:Eu"3"+ phosphor. In addition, the color coordinates for optimal Dy"3"+ concentration are (0.339, 0.379), which are close to equal energy point. Therefore, the GdVO_4:Dy"3"+ phosphor may have potential application for solid state lighting.

The Effects of Gx, Gy and Gz Forces on Cone Mesopic Vision

Science.gov (United States)

1983-10-01

of duration less than 1.0 seconds (time frame may vary depending on the source referred to). macular degeneration - Atrophy of the macula of the...rela- 7 tive number of cones itrcreases. In the macula , the visual center of the eye, there is virtually only cones. There are other anatomic...the cones in the center of the macula having a 1:1 synaptic ratio). These features allow small stimuli with minimal separated distances to activate

78 FR 52787 - Kevin Dennis, M.D., Decision and Order

Science.gov (United States)

2013-08-26

... phentermine to family members, including his sister, wife and mother-in-law. Id. at 41. However, the ALJ also... May 23, 2008. GX 15, at 9-16. Each of the prescriptions included Respondent's cell-phone number, id... phentermine 37.5mg, to family members including his wife, sister, and mother-in-law. See GX 19, at 12-13, 17...

Operation REDWING

Science.gov (United States)

1956-08-10

Complete ...................................... 2-59 O ld Station (L eft ) .......................................................................... 2-44...TE~M V. HT.CKY. 2 - iSAY.806] EQUIP, TAP T AFSAM-339 AIif--/ F-G- - CKT. 11 T___AV-4 IN ELMER AREA FiT-5/001 CKT. 5a-- CKT. 5 b- Figure 2-164...AFSAM-339 A 4a NAN-AV-4 UNCLASSIFIED VOICE ANIC46 NAN-AV- 4 UNCLASSIFIED VOICE ANTC AN/ICC 50AV-4- TAP UNCLASSIFIED VOICE [ 3AWYTR-C]5 AV.4-IAP

Single crystal structures of the new vanadates CuMgVO{sub 4} and AgMgVO{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Ben Yahia, Hamdi, E-mail: Hyahia@qf.org.qa [Research Institute of Electrochemical Energy, National Institute of Advanced Industrial Science and Technology (AIST), 1-8-31 Midorigaoka, Ikeda, Osaka 563-8577 (Japan); Qatar Environment and Energy Research Institute, Hamad Bin Khalifa University, Qatar Foundation, PO Box 5825, Doha (Qatar); Shikano, Masahiro, E-mail: shikano.masahiro@aist.go.jp [Research Institute of Electrochemical Energy, National Institute of Advanced Industrial Science and Technology (AIST), 1-8-31 Midorigaoka, Ikeda, Osaka 563-8577 (Japan); Essehli, Rachid; Belharouak, Ilias [Qatar Environment and Energy Research Institute, Hamad Bin Khalifa University, Qatar Foundation, PO Box 5825, Doha (Qatar)

2016-08-01

The new compounds CuMgVO{sub 4} and AgMgVO{sub 4} have been synthesized by a solid state reaction route. Their crystal structures were determined from single-crystal X-ray diffraction data. CuMgVO{sub 4} crystallizes with Na{sub 2}CrO{sub 4}-type structure with space group Cmcm, a = 5.6932 (10), b = 8.7055 (15), c = 6.2789 (10) Å, V = 311.20 (9) Å{sup 3}, and Z = 4, whereas AgMgVO{sub 4} crystallizes in the maricite-type structure with space group Pnma, a = 9.4286 (14), b = 6.7465 (10), c = 5.3360 (8) Å, V = 339.42 (9) Å{sup 3}, and Z = 4. Both structures of CuMgVO{sub 4}, and AgMgVO{sub 4} contain MgO{sub 4} chains made up of edge-sharing MgO{sub 6} octahedra. In CuMgVO{sub 4} the MgO{sub 4} chains are interconnected through CuVO{sub 4} double chains made up of VO{sub 4} and CuO{sub 4} tetrahedra sharing corners and edges, however in AgMgVO{sub 4} the chains are interlinked by the VO{sub 4} and AgO{sub 4} tetrahedra sharing only corners. - Highlights: • We have been able to grow CuMgVO{sub 4} and AgMgVO{sub 4} single crystals. • We solved their crystal structures using single crystal data. • We compared the crystal structures of CuMgVO{sub 4} and AgMgVO{sub 4}.

RTNS-II: experience at 14-MeV source strengths between 1 x 1013 and 4 x 1013 n/s

International Nuclear Information System (INIS)

Davis, J.C.

1986-05-01

The design concepts, operational experience, and modifications of the two RTNS-II (Rotating Target Neutron Source-II) 14 MeV neutron sources are reviewed. The original design called for operation at a peak neutron source strength of 4 x 10 13 n/cm 2 s. The facility was to operate at high plant factor and at an acceptable cost in both dose delivered to operating staff and releases to the environment. The possibilities of higher source strengths are discussed in light of the operating experience to date and of new technologies that may be applied to the problems of high flux generators of this type. Changes in ancillary equipment that would provide more efficient or safe operation are also indicated

Indirect solar wind geothermal: Alternative energy sources 4, volume 4

Science.gov (United States)

Veziroglu, T. N.

The utilities are obliged to provide electricity in a reliable and cost effective manner. Some unique problems posed by large scale wind turbines as an electricity source have to be considered. A value model is presented which is based upon the fuel displacement capability and the capacity displacement capability of wind turbines. The amount of fossil fuels which is saved by wind turbines depends on the forecasted wind power output, the actual power output fluctuations of the wind turbines and on system operation. The highly controversial capacity credit of wind turbines is discussed under the aspect of system reliability. It is shown that calculations of the capacity credit should be based upon detailed investigations with regard to the time dependence of the hourly wind power output.

Electric protection of the ion sources of the Ogra-4 device

International Nuclear Information System (INIS)

Matveev, N.V.; Obysov, V.A.

1984-01-01

Electric circuit of an ion source power supply comprising elements for protection from damages in case of discharges inside the source, has been described. The possibility of protection against discharge and subsequent reclosing switching of the ion source using consecutive protective key element in the circuit of power supply emission electrode, electron commutator being used as one, has been studied. Results of the use of commutators on the basis of electron-beam valves as the main commutating element are presented. Application of the circuit described permitted to achieve voltage restoration on the ion source electrodes when the valve reclosing switching time delay constituted 200 μs

Investigation of practical approaches to evaluating cumulative dose for cone beam computed tomography (CBCT) from standard CT dosimetry measurements: a Monte Carlo study.

Science.gov (United States)

Abuhaimed, Abdullah; Martin, Colin J; Sankaralingam, Marimuthu; Gentle, David J

2015-07-21

A function called Gx(L) was introduced by the International Commission on Radiation Units and Measurements (ICRU) Report-87 to facilitate measurement of cumulative dose for CT scans within long phantoms as recommended by the American Association of Physicists in Medicine (AAPM) TG-111. The Gx(L) function is equal to the ratio of the cumulative dose at the middle of a CT scan to the volume weighted CTDI (CTDIvol), and was investigated for conventional multi-slice CT scanners operating with a moving table. As the stationary table mode, which is the basis for cone beam CT (CBCT) scans, differs from that used for conventional CT scans, the aim of this study was to investigate the extension of the Gx(L) function to CBCT scans. An On-Board Imager (OBI) system integrated with a TrueBeam linac was simulated with Monte Carlo EGSnrc/BEAMnrc, and the absorbed dose was calculated within PMMA, polyethylene (PE), and water head and body phantoms using EGSnrc/DOSXYZnrc, where the body PE body phantom emulated the ICRU/AAPM phantom. Beams of width 40-500 mm and beam qualities at tube potentials of 80-140 kV were studied. Application of a modified function of beam width (W) termed Gx(W), for which the cumulative dose for CBCT scans f (0) is normalized to the weighted CTDI (CTDIw) for a reference beam of width 40 mm, was investigated as a possible option. However, differences were found in Gx(W) with tube potential, especially for body phantoms, and these were considered to be due to differences in geometry between wide beams used for CBCT scans and those for conventional CT. Therefore, a modified function Gx(W)100 has been proposed, taking the form of values of f (0) at each position in a long phantom, normalized with respect to dose indices f 100(150)x measured with a 100 mm pencil ionization chamber within standard 150 mm PMMA phantoms, using the same scanning parameters, beam widths and positions within the phantom. f 100(150)x averages the dose resulting from

Numerical modeling of the Linac4 negative ion source extraction region by 3D PIC-MCC code ONIX

CERN Document Server

Mochalskyy, S; Minea, T; Lifschitz, AF; Schmitzer, C; Midttun, O; Steyaert, D

2013-01-01

At CERN, a high performance negative ion (NI) source is required for the 160 MeV H- linear accelerator Linac4. The source is planned to produce 80 mA of H- with an emittance of 0.25 mm mradN-RMS which is technically and scientifically very challenging. The optimization of the NI source requires a deep understanding of the underling physics concerning the production and extraction of the negative ions. The extraction mechanism from the negative ion source is complex involving a magnetic filter in order to cool down electrons’ temperature. The ONIX (Orsay Negative Ion eXtraction) code is used to address this problem. The ONIX is a selfconsistent 3D electrostatic code using Particles-in-Cell Monte Carlo Collisions (PIC-MCC) approach. It was written to handle the complex boundary conditions between plasma, source walls, and beam formation at the extraction hole. Both, the positive extraction potential (25kV) and the magnetic field map are taken from the experimental set-up, in construction at CERN. This contrib...

[Determination of lidocaine and its metabolites in human plasma by liquid chromatography in combination with tandem mass spectrometry].

Science.gov (United States)

Xiang, Jin; Zhang, Cheng; Yu, Qin; Liang, Mao-Zhi; Qin, Yong-Ping; Nan, Feng

2010-07-01

To establish a liquid chromatography tandem mass spectrometry (HPLC-MS/MS) method for the determination of lidocaine (LDC) and its metabolites, monoethylglycinexylidide (MEGX) and glycinexylidide (GX), in human plasma. METHODS; The assay was conducted with an API 3000 HPLC-MS/MS system consisted of a Ultimate C18 column (50 x 4.6 mm, 5 microm). The mobile phase consisted of methanol: 5 mmol/ L ammonium acetate (50:50, pH was adjusted to 5.0 by formic acid) and the flow rate was set at 0.2 mL/min. The alkalinized sample was extracted with ethyl acetate. After evaporation of the organic layer, the residue was dissolved in mobile phase and the drug was determined by HPLC-MS/MS using electrospray ionization. The calibration curve was linear in a range from 15.625 to 2000 ng/mL for LDC. Linear calibration curves were obtained in the range of 1.5625 to 200 ng/mL for both for MEGX and GX. The limit of quantification for LDC, MEGX and GX was set at 15.625, 1.5625 and 1.5625 ng/mL. This method for the quantitative determination of lidocaine and its metabolites in human plasma is simple, rapid, sensitive and accurate. Therefore it can be used for the determination of lidocaine and its metabolites in clinical practice.

Improved Electrochemical Performance of LiFePO4@N-Doped Carbon Nanocomposites Using Polybenzoxazine as Nitrogen and Carbon Sources.

Science.gov (United States)

Wang, Ping; Zhang, Geng; Li, Zhichen; Sheng, Wangjian; Zhang, Yichi; Gu, Jiangjiang; Zheng, Xinsheng; Cao, Feifei

2016-10-03

Polybenzoxazine is used as a novel carbon and nitrogen source for coating LiFePO 4 to obtain LiFePO 4 @nitrogen-doped carbon (LFP@NC) nanocomposites. The nitrogen-doped graphene-like carbon that is in situ coated on nanometer-sized LiFePO 4 particles can effectively enhance the electrical conductivity and provide fast Li + transport paths. When used as a cathode material for lithium-ion batteries, the LFP@NC nanocomposite (88.4 wt % of LiFePO 4 ) exhibits a favorable rate performance and stable cycling performance.

Interleukin-4 (IL4 and Interleukin-4 receptor (IL4RA polymorphisms in asthma: a case control study

Directory of Open Access Journals (Sweden)

Lorente Félix

2005-11-01

simulations = 0.0016, OR:3.39; 95% CI:1.50–7.66]. Conclusion Our results show a trend of association between the genetic combination of the T allele of -33C>TIL4 and the A allele of 576Q>RIL4RA with asthma. This genetic variant was more frequently observed in patients with persistent asthma. As long as this study was performed in a small population, further studies in other populations are needed to confirm these results.

Influence of Nitrogen Source on 2,4-diacetylphloroglucinol Production by the Biocontrol Strain Pf-5

OpenAIRE

M, Hultberg; B, Alsanius

2008-01-01

The production of 2,4-diacetylphloroglucinol (DAPG) by the biocontrol agent Pseudomonas fluorescens Pf-5 was studied in nutrient-solution based media with varying nitrogen content. No production of DAPG was observed when organic nitrogen was omitted from the media, regardless of the inorganic nitrogen source used. Furthermore, a micromolar concentration range of organic nitrogen was insufficient to sustain production. When a millimolar concentration range of organic nitrogen was used, DAPG pr...

Sources of optical distortion in rapidly grown crystals of KH2PO4

International Nuclear Information System (INIS)

De Yoreo, J.J.; Zaitseva, N.P.; Woods, B.W.; Land, T.A.; Rek, Z.U.

1995-01-01

We report results of x-ray topographic and optical measurements on KH 2 PO 4 crystals grown at rates of 5 to 30mm/day. We show that optical distortion in these crystals is caused primarily by 3 sources: dislocations, differences in composition between adjacent growth sectors of the crystal, and differences in composition between adjacent sectors of vicinal growth hillocks within a single growth sector of the crystal. We find that the compositional heterogeneities cause spatial variations in the refractive index and induced distortion of the transmitted wave front while large groups of dislocations are responsible for strain induced birefringence which leads to beam depolarization

Application of the 4 pigammaMethod to the Absolute Standardization of Radioactive Sources of Positron Emitters

International Nuclear Information System (INIS)

Peyres Medina, V.; Garcia-Torano Martinez, E.; Roteta Ibarra, M.

2006-01-01

We discuss the application of the method known as 4 p i g amma c ounting t o the standardization of positron emitters. Monte Carlo simulations are used to calculate the detection efficiency of positrons emitted by the nuclides 22Na and 18F. Two experimental setups are used, both based on a NaI(Tl) well detector. The results of the standardizations are in good agreement with those obtained by other methods. It is shown that the 4 p i g amma m ethod can be successfully used for the absolute standardization of sources of positron emitters. (Author) 23 refs

Dendritic chelating agents. 1. Cu(II) binding to ethylene diamine core poly (amidoamine) denderimers in aqueous solutions

International Nuclear Information System (INIS)

Diallo, Mamadou S.; Christie, Simone; Swaminathan, Pirabalini; Balogh, Lajos; Shi, XIANGYANG; Um, Wooyong; Papelis, Charalambos; Goddard, William A.; Johnson, J. H.

2004-01-01

The overall results of the proton and metal ion binding measurements suggest that the uptake of Cu(II) by EDA core PAMAM dendrimers involves both the dendrimer tertiary amine and terminal groups. However, the extents of protonation of these groups control the ability of the dentrimers to bind Cu(II). Analysis of the EXAFS spectra suggests that Cu(II) forms octahedral complexes involving the tertiary amine groups of Gx-NH2 EDA core PAMAM dendrimers at pH 7.0. The central Cu(II) metal ion of each of these complexes appears to be coordinated to 2-4 dendrimer tertiary amine groups located in the equatorial plane and 2 axial water molecules. Finally, we combine the results of our experiments with literature data to formulate and evaluate a phenomenological model of Cu(II) uptake by Gx-NH2 PAMAM dendrimers in aqueous solutions. At low metal ion-dendrimer loadings, the model provides a good fit of the measured extent of binding of Cu(II) in aqueous solutions of G4-NH2 PAMAM dendrimers at pH 7.0

40 CFR Table 4 to Subpart Dd of... - Tank Control Levels for Tanks at New Affected Sources as Required by 40 CFR 63.685(b)(2)

Science.gov (United States)

2010-07-01

... Affected Sources as Required by 40 CFR 63.685(b)(2) 4 Table 4 to Subpart DD of Part 63 Protection of... Hazardous Air Pollutants from Off-Site Waste and Recovery Operations Pt. 63, Subpt. DD, Table 4 Table 4 to Subpart DD of Part 63—Tank Control Levels for Tanks at New Affected Sources as Required by 40 CFR 63.685(b...

A delayed transition to the hard state for 4U 1630-47 at the end of its 2010 outburst

Energy Technology Data Exchange (ETDEWEB)

Tomsick, John A. [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720-7450 (United States); Yamaoka, Kazutaka [Solar-Terrestrial Environment Laboratory, Department of Particles and Astronomy, Nagoya University, Furocho, Chikusa-ku, Nagoya, Aichi 464-8601 (Japan); Corbel, Stephane [AIM - Unité Mixte de Recherche CEA - CNRS - Université Paris VII - UMR 7158, CEA-Saclay, Service d' Astrophysique, F-91191 Gif-sur-Yvette Cedex (France); Kalemci, Emrah [Sabanci University, Orhanli-Tuzla, Istanbul 34956 (Turkey); Migliari, Simone [Department d' Astronomia i Meteorologia, Universitat de Barcelona, Marti I Franques 1, E-08028 Barcelona (Spain); Kaaret, Philip, E-mail: jtomsick@ssl.berkeley.edu [Department of Physics and Astronomy, University of Iowa, Van Allen Hall, Iowa City, IA 52242 (United States)

2014-08-10

Here we report on Swift and Suzaku observations near the end of an outburst from the black hole transient 4U 1630-47 and Chandra observations when the source was in quiescence. 4U 1630-47 made a transition from a soft state to the hard state ∼50 days after the main outburst ended. During this unusual delay, the flux continued to drop, and one Swift measurement found the source with a soft spectrum at a 2-10 keV luminosity of L = 1.07 × 10{sup 35} erg s{sup –1} for an estimated distance of 10 kpc. While such transients usually make a transition to the hard state at L/L{sub Edd} = 0.3%-3%, where L{sub Edd} is the Eddington luminosity, the 4U 1630-47 spectrum remained soft at L/L{sub Edd} = 0.008 M{sub 10}{sup −1}% (as measured in the 2-10 keV band), where M{sub 10} is the mass of the black hole in units of 10 M{sub ☉}. An estimate of the luminosity in the broader 0.5-200 keV bandpass gives L/L{sub Edd} = 0.03 M{sub 10}{sup −1}%, which is still an order of magnitude lower than typical. We also measured an exponential decay of the X-ray flux in the hard state with an e-folding time of 3.39 ± 0.06 days, which is much less than previous measurements of 12-15 days during decays by 4U 1630-47 in the soft state. With the ∼100 ks Suzaku observation, we do not see evidence for a reflection component, and the 90% confidence limits on the equivalent width of a narrow iron Kα emission line are <40 eV for a narrow line and <100 eV for a line of any width, which is consistent with a change of geometry (either a truncated accretion disk or a change in the location of the hard X-ray source) in the hard state. Finally, we report a 0.5-8 keV luminosity upper limit of <2 × 10{sup 32} erg s{sup –1} in quiescence, which is the lowest value measured for 4U 1630-47 to date.

Design and field configuration for a 14.4 GHz ECR ion source in Kolkata

International Nuclear Information System (INIS)

Rashid, M.H.; Bose, D.K.; Mallik, C.; Bhandari, R.K.

2001-01-01

The K500 cyclotron under construction will be capable of accelerating ions like O 6+ , Ne 4+ , Ar 16+ , Kr 27+ etc. We aim to get ∼200 euA maximum intensity of the extracted beam of O 6+ from the ion source and decided to have >2B ECR magnetic field on the cylindrical surface and the injection ends of the plasma chamber (P Ch) and slightly less than this at the extraction end. The success of the high field operation of ECRs at other places (U-AECR at LBL) suggests generation of proper magnetic field configuration for the 14.4 GHz microwave heating. The absolute composite magnetic field have been evaluated due to the coils (C1,C2) at the two ends and a -ve coil (NC) at the mid-length and a Halbach type sextupole (PM-Hex)

Single photon sources in 4H-SiC metal-oxide-semiconductor field-effect transistors

Science.gov (United States)

Abe, Y.; Umeda, T.; Okamoto, M.; Kosugi, R.; Harada, S.; Haruyama, M.; Kada, W.; Hanaizumi, O.; Onoda, S.; Ohshima, T.

2018-01-01

We present single photon sources (SPSs) embedded in 4H-SiC metal-oxide-semiconductor field-effect transistors (MOSFETs). They are formed in the SiC/SiO2 interface regions of wet-oxidation C-face 4H-SiC MOSFETs and were not found in other C-face and Si-face MOSFETs. Their bright room-temperature photoluminescence (PL) was observed in the range from 550 to 750 nm and revealed variable multi-peak structures as well as variable peak shifts. We characterized a wide variety of their PL spectra as the inevitable variation of local atomic structures at the interface. Their polarization dependence indicates that they are formed at the SiC side of the interface. We also demonstrate that it is possible to switch on/off the SPSs by a bias voltage of the MOSFET.

The Railgun and Its Power Source,

Science.gov (United States)

1987-06-01

inductor 66 3.1.3 The ANU homopolar generator power source 67 3.1.4 Features of an ideal power source 69 3.1.5 Desirable power source pulse energy...3.3.2 Homopolar generators 75 3.3.3 Ordinary large alternators 77 3.3.4 The compulsator 77 3.4 Explosive magnetic flux compression 80 3.5 Minimum mass of...discharge of lead-acid batteries 99 4.4.4 Design and performance of a high rate lead-acid cell 101 4.5 Motor -generator instead of batteries 103 4.5.1

ZnCl 2- and NH 4Cl-hydroponics gel electrolytes for zinc-carbon batteries

Science.gov (United States)

Khalid, N. H.; Ismail, Y. M. Baba; Mohamad, A. A.

Absorbency testing is used to determine the percentage of ZnCl 2 or NH 4Cl solution absorbed by a hydroponics gel (HPG). It is found that the absorbency of ZnCl 2 or NH 4Cl solution decreases with increasing solution concentration. The conductivity of ZnCl 2- and NH 4Cl-HPG electrolytes is dependent on the solution concentration. A mixture of salt solution with HPG yields excellent gel polymer electrolytes with conductivities of 0.026 and 0.104 S cm -1 at 3 M ZnCl 2 and 7 M NH 4Cl, respectively. These gel electrolytes are then used to produce zinc-carbon cells. The fabricated cells give capacities of 8.8 and 10.0 mAh, have an internal resistance of 25.4 and 19.8 Ω, a maximum power density of 12.7 and 12.2 mW cm -2, and a short-circuit current density of 29.1 and 33.9 mA cm -2 for ZnCl 2- and NH 4Cl-HPG electrolytes, respectively.

GEANT4 simulations of the n{sub T}OF spallation source and their benchmarking

Energy Technology Data Exchange (ETDEWEB)

Lo Meo, S. [Research Centre ' ' Ezio Clementel' ' , ENEA, Bologna (Italy); Section of Bologna, INFN, Bologna (Italy); Cortes-Giraldo, M.A.; Lerendegui-Marco, J.; Guerrero, C.; Quesada, J.M. [Universidad de Sevilla, Facultad de Fisica, Sevilla (Spain); Massimi, C.; Vannini, G. [Section of Bologna, INFN, Bologna (Italy); University of Bologna, Physics and Astronomy Dept. ' ' Alma Mater Studiorum' ' , Bologna (Italy); Barbagallo, M.; Colonna, N. [INFN, Section of Bari, Bari (Italy); Mancusi, D. [CEA-Saclay, DEN, DM2S, SERMA, LTSD, Gif-sur-Yvette CEDEX (France); Mingrone, F. [Section of Bologna, INFN, Bologna (Italy); Sabate-Gilarte, M. [Universidad de Sevilla, Facultad de Fisica, Sevilla (Spain); European Organization for Nuclear Research (CERN), Geneva (Switzerland); Vlachoudis, V. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Collaboration: The n_TOF Collaboration

2015-12-15

Neutron production and transport in the spallation target of the n{sub T}OF facility at CERN has been simulated with GEANT4. The results obtained with different models of high-energy nucleon-nucleus interaction have been compared with the measured characteristics of the neutron beam, in particular the flux and its dependence on neutron energy, measured in the first experimental area. The best agreement at present, within 20% for the absolute value of the flux, and within few percent for the energy dependence in the whole energy range from thermal to 1 GeV, is obtained with the INCL++ model coupled with the GEANT4 native de-excitation model. All other available models overestimate by a larger factor, of up to 70%, the n{sub T}OF neutron flux. The simulations are also able to accurately reproduce the neutron beam energy resolution function, which is essentially determined by the moderation time inside the target/moderator assembly. The results here reported provide confidence on the use of GEANT4 for simulations of spallation neutron sources. (orig.)

Interaction between FKBP5 variability and recent life events in the anxiety spectrum: Evidence for the differential susceptibility model.

Directory of Open Access Journals (Sweden)

Beatriz Pérez-Pérez

Full Text Available Gene-environment interaction (GxE research has highlighted the importance of investigating the FK506 binding protein 51 (FKBP5 gene as a sensitivity gene. However, previous GxE studies with FKBP5 have not measured the full environmental spectrum or applied statistical tests to discern whether the GxE interaction fits better with the differential-susceptibility or diathesis-stress hypotheses. This study examined whether single nucleotide polymorphisms (SNPs on FKBP5 gene moderate the association of positive and negative recent life events (LEs with depressive symptoms, state-anxiety, neuroticism, and social anxiety traits.A total of 86 nonclinical young adults were administered psychological measures and were genotyped for five FKBP5 SNPs (rs3800373, rs9296158, rs1360780, rs9470080 and rs4713916.Regression analyses indicated significant GxE interactions for social anxiety and neuroticism. The interactions predicting neuroticism fit different models for different SNPs, although the overall effect indicated by the haplotype was consistent with the differential-susceptibility hypothesis: the risk-haplotype group presented higher neuroticism in the presence of more negative LEs and lower neuroticism in the presence of more positive LEs. The GxE interactions for social anxiety were consistent with the diathesis-stress model. The lack of significance in the for-better side for social anxiety might be related to the fact that it mapped onto low extraversion, which is associated with a lower permeability to positive experiences.Findings underscore the importance of testing the differential-susceptibility model in relation to FKBP5 to adequately characterize its role in healthy and pathological developmental processes.

Study of cold neutron sources: Implementation and validation of a complete computation scheme for research reactor using Monte Carlo codes TRIPOLI-4.4 and McStas

International Nuclear Information System (INIS)

Campioni, Guillaume; Mounier, Claude

2006-01-01

The main goal of the thesis about studies of cold neutrons sources (CNS) in research reactors was to create a complete set of tools to design efficiently CNS. The work raises the problem to run accurate simulations of experimental devices inside reactor reflector valid for parametric studies. On one hand, deterministic codes have reasonable computation times but introduce problems for geometrical description. On the other hand, Monte Carlo codes give the possibility to compute on precise geometry, but need computation times so important that parametric studies are impossible. To decrease this computation time, several developments were made in the Monte Carlo code TRIPOLI-4.4. An uncoupling technique is used to isolate a study zone in the complete reactor geometry. By recording boundary conditions (incoming flux), further simulations can be launched for parametric studies with a computation time reduced by a factor 60 (case of the cold neutron source of the Orphee reactor). The short response time allows to lead parametric studies using Monte Carlo code. Moreover, using biasing methods, the flux can be recorded on the surface of neutrons guides entries (low solid angle) with a further gain of running time. Finally, the implementation of a coupling module between TRIPOLI- 4.4 and the Monte Carlo code McStas for research in condensed matter field gives the possibility to obtain fluxes after transmission through neutrons guides, thus to have the neutron flux received by samples studied by scientists of condensed matter. This set of developments, involving TRIPOLI-4.4 and McStas, represent a complete computation scheme for research reactors: from nuclear core, where neutrons are created, to the exit of neutrons guides, on samples of matter. This complete calculation scheme is tested against ILL4 measurements of flux in cold neutron guides. (authors)

Assessment of protocols in cone beam CT with symmetric and asymmetric beam using effective dose and Pka

International Nuclear Information System (INIS)

Batista, W. O.; Linhares de O, M. V.; Soares, M. R.; Maia, A. F.; Caldas, L. V. E.

2014-08-01

The cone beam CT is an emerging technology in dental radiology with significant differences the point of view of design technology between the various manufacturers on the world market. This study aims to evaluate and compare protocols with similar purposes in a cone beam CT scanner using TLDs and air kerma - area product (P ka ) as kerma index. Measurements were performed on two protocols used to obtain the image the maxilla-mandible in equipment Gendex GXCB 500: Protocol [GX1] extended diameter and asymmetric beam (14 cm x 8.5 cm - maxilla / mandible) and protocol [GX2] symmetrical beam (8.5 cm x 8.5 cm - maxillary / mandible). Was used LiF dosimeters (TLD 100) inserted into a female anthropomorphic phantom manufactured by Radiology Support Devices. For all protocols evaluated the value of P ka using a meter Diamentor E2 and PTW system Radcal Rapidose. The results obtained for Effective Dose / P ka these measurements were separated by protocol image. Protocol [GX1]: 44.5 μSv/478 mGy cm 2 ; protocol [GX2]: 54.8 μSv/507 mGy cm 2 . These values indicate that the relationship between the diameter of the image acquired in the protocol [GX1] and the diameter of the image in the protocol [GX2] is equal to 1.65, the Effective Dose for the first protocol has lower value at 18%. P ka values reveal very similar results between the two protocols, although, common sense leads to the interpretation that imaging protocols with field of view (Fov) of large diameters imply high values of effective dose when compared to small diameters. However, in this particular case, this is not true due to the asymmetrical beam technology. Conclude that for the cases where the scanner uses asymmetric beam to obtain images with large diameters that cover the entire face there are advantages from the point of view of reducing the exposure of patients with respect to the use of symmetrical beam and / or to Fov images with a smaller diameter. (Author)

H$^{-}$ ion source for CERN's Linac4 accelerator: simulation, experimental validation and optimization of the hydrogen plasma

CERN Document Server

Mattei, Stefano; Lettry, Jacques

2017-07-25

Linac4 is the new negative hydrogen ion (H$^-$) linear accelerator of the European Organization for Nuclear Research (CERN). Its ion source operates on the principle of Radio-Frequency Inductively Coupled Plasma (RF-ICP) and it is required to provide 50~mA of H$^-$ beam in pulses of 600~$\\mu$s with a repetition rate up to 2 Hz and within an RMS emittance of 0.25~$\\pi$~mm~mrad in order to fullfil the requirements of the accelerator. This thesis is dedicated to the characterization of the hydrogen plasma in the Linac4 H$^-$ ion source. We have developed a Particle-In-Cell Monte Carlo Collision (PIC-MCC) code to simulate the RF-ICP heating mechanism and performed measurements to benchmark the fraction of the simulation outputs that can be experimentally accessed. The code solves self-consistently the interaction between the electromagnetic field generated by the RF coil and the resulting plasma response, including a kinetic description of charged and neutral species. A fully-implicit implementation allowed to si...

Commercial spaceflight participant G-force tolerance during centrifuge-simulated suborbital flight.

Science.gov (United States)

Blue, Rebecca S; Riccitello, Jon M; Tizard, Julia; Hamilton, Richard J; Vanderploeg, James M

2012-10-01

Medical knowledge of the human body in microgravity and hypergravity is based upon studies of healthy individuals well-conditioned for such environments. Little data exist regarding the effects of spaceflight on untrained commercial passengers. We examined the responses of potential spaceflight participants (SFP) to centrifuge G-force exposure. There were 77 individuals (65 men, 12 women), 22-88 yr old, who underwent 6 centrifuge runs over 48 h. Day 1 consisted of two +Gz runs (peak = 3.5+Gz, run 2) and two +Gx runs (peak = 6.0+Gx, run 4). Day 2 consisted of two runs approximating a suborbital spaceflight profile. Data included blood pressure, electrocardiogram, and postrun questionnaires regarding motion sickness, disorientation, greyout, and other symptoms. Of the 77 participants, average age was 50.4 +/- 12.7 yr. Average heart rate (HR) varied by sex and direction of G-exposure (+Gz: F 150 +/- 19, M 123 +/- 27; +Gx: F 135 +/- 30, M 110 +/- 27). Age and peak HR were inversely related (HR 120: 47.1 +/- 10.9 yr). HR during peak G-exposure for the final run was associated with post-run imbalance (no imbalance: HR 126 +/- 26, imbalance: HR 145 +/- 21); no other significant hemodynamic change, sex, or age variation was associated with imbalance. Age and greyout were inversely associated; there was no association between greyout and vital sign change, sex, or G-force magnitude. Baseline/pretrial mean arterial pressure (MAP) was not associated with any symptoms. The results suggest that most individuals with well-controlled medical conditions can withstand acceleration forces involved in launch/landing profiles of commercial spaceflight vehicles. Further investigation will help refine which conditions present significant risk during suborbital flight and beyond.

MINERAL NITROGEN SOURCES (N-NO3- AND N-NH4+ ON GROWTH OF GRÁPIA (Apuleia leiocarpa (Vog. Macbride SEEDLINGS

Directory of Open Access Journals (Sweden)

Fernando Teixeira Nicoloso

2010-08-01

Full Text Available Grápia (Apuleia leiocarpa (Vog. Macbride is an important native forest species that has been in extinction process. The aim of this study was to evaluate the effect of mineral nitrogen source on growth of grápia seedlings. Five variations in the concentration of N-NO3- and N-NH4+ (5:0, 4:1, 2,5:2,5, 1:4, and 0:5 mM of N were tested in an entirely random statistical design with 16 replicates. The experimental unity consisted of a vessel containing 3,0 kg of a Paleudalf soil and two plants, under glasshouse conditions. From 60 to 150 days after fertilization (DAF, the plant growth and soil pH were monthly analyzed from four replicates randomly taken. Independently of the nitrogen source used, the soil pH decreased, and on 150 DAF the smallest pH variation was 0.33 and the largest one was 0.47 pH units, respectively, on treatments with 5 N-NO3-:0 N-NH4+ and 0 N-NO3-:5 N-NH4+ ratios. The presence of N-NH4+, from 1 to 5 mM, induced necrosis in old leaves and their ulterior abscission. To 150 DAF, in the presence of 5 mM N-NH4+, the plant survival was reduced to 31%. The effect of nitrogen sources on plant growth appeared to be depended on plant age and/or of their transformations in the soil. To 120 DAF, the presence of N-NH4+ from 2,5 to 5 mM reduced the number of stalk nodes, plant height, stem diameter, dry weight of leaves, of stem, of roots, and of the whole plant. However, to 150 DAF, because of the regain on the growth rate, these differences were not observed, with exception of the root/shoot dry weight ratio that was reduced on the exclusive presence of N-NH4+. The suitable N-NO3-:N-NH4+ ratio in the fertilization to grow grápia seedlings, can not exceed, respectively, 4:1.

Characterization of Aldehyde Crosslinked Kenaf Regenerated Cellulose Film

Directory of Open Access Journals (Sweden)

Hatika Kaco

2015-08-01

Full Text Available Regenerated cellulose film with better mechanical properties was successfully produced by introducing aldehyde crosslinker during the regeneration process. The cellulose source material was derived from kenaf core powder and dissolved in LiOH/urea solvent at −13 °C to form a cellulose solution. The cellulose solution was cast and coagulated in a crosslinker bath at different percentages of glutaraldehyde (GA and glyoxal (GX to form a regenerated cellulose film. According to Fourier transform infrared spectroscopy (FTIR spectra, the hydroxyl group of the cellulose was reduced, reducing the percentage of swelling as the percentage of crosslinker was increased. X-ray diffraction (XRD patterns showed that the crystallinity index of the crosslinked film was decreased. The pore size of the films decreased as the percentage of crosslinker was increased, resulting in decreased film transparency. The pore volume and percentage of swelling in water of the films also increased with decreases in the pore size as the percentage of crosslinker was increased. The tensile strengths of the GA- and GX-crosslinked films increased by 20 and 15% with the addition of 20% of each crosslinker, respectively.

Investigation of the Effects of Tissue Inhomogeneities on the Dosimetric Parameters of a Cs-137 Brachytherapy Source using the MCNP4C Code

Directory of Open Access Journals (Sweden)

Mehdi Zehtabian

2010-09-01

Full Text Available Introduction: Brachytherapy is the use of small encapsulated radioactive sources in close vicinity of tumors. Various methods are used to obtain the dose distribution around brachytherapy sources. TG-43 is a dosimetry protocol proposed by the AAPM for determining dose distributions around brachytherapy sources. The goal of this study is to update this protocol for presence of bone and air inhomogenities.  Material and Methods: To update the dose rate constant parameter of the TG-43 formalism, the MCNP4C simulations were performed in phantoms composed of water-bone and water-air combinations. The values of dose at different distances from the source in both homogeneous and inhomogeneous phantoms were estimated in spherical tally cells of 0.5 mm radius using the F6 tally. Results: The percentages of dose reductions in presence of air and bone inhomogenities for the Cs-137 source were found to be 4% and 10%, respectively. Therefore, the updated dose rate constant (Λ will also decrease by the same percentages.   Discussion and Conclusion: It can be easily concluded that such dose variations are more noticeable when using lower energy sources such as Pd-103 or I-125.

Structural and electrochemical characterization of 0.7LiFePO4·0.3Li3V2(PO4)3/C cathode materials using PEG and glucose as carbon sources

International Nuclear Information System (INIS)

Ma, Pingping; Hu, Pu; Liu, Zhijian; Xia, Jianhua; Xia, Dingguo; Chen, Yu; Liu, Zhengang; Lu, Zhichao

2013-01-01

0.7LiFePO 4 ·0.3Li 3 V 2 (PO 4 ) 3 /C composites (LFVP/C) were synthesized via spray-drying technique followed by solid-state reaction approach using polyethylene glycol (PEG) and glucose as carbon sources. The samples were characterized by X-ray diffraction (XRD), X-ray absorption fine-structure spectroscopy (XAFS) and Raman spectroscopy. The results show that the bi-phase composite structure of LFVP/C contains olivine LiFePO 4 (LFP) and monoclinic Li 3 V 2 (PO 4 ) 3 (LVP). The lower intensity ratio of the I D /I G and A sp 3 /A sp 2 for PEG-200 indicates the formation of higher degree of graphitized carbon during the process, which would enhance the electronic conductivity. The composite obtained using PEG-200 as carbon source show excellent rate performance, delivering the discharge capacity of 120 mAh/g at the current density of 1.5 A/g

Slutrapport for Implementering af energibesparelser ved benyttelse af  højkvalitets LED belysning PSO 339‐025

DEFF Research Database (Denmark)

Dam-Hansen, Carsten; Thorseth, Anders; Poulsen, Peter Behrensdorff

2010-01-01

Denne rapport indeholder en beskrivelse af forsknings og udviklingsprojektet ”Implementering af energibesparelser ved benyttelse af højkvalitets LED belysning”. Projektet er udført i et samarbejde imellem DTU Fotonik, Teknologisk Institut, De Danske Kongers Kronologiske Samling (DKKS), Lumodan, Osram, Thermex og DONG Energy under ledelse af Carsten Dam-Hansen, DTU Fotonik. Projektet er finansieret af Dansk Energi under Elforsk’s PSO...... program, indsatsområde 3a. LED belysning. Projektet har projekt nr. PSO 339‐025 og blev startet i februar 2007 og er afsluttet i marts 2010.   I...

Effects of the thickness of gold deposited on a source backing film in the 4πβ-counting

International Nuclear Information System (INIS)

Miyahara, Hiroshi; Yoshida, Makoto; Watanabe, Tamaki

1976-01-01

A gold deposited VYNS film as a source backing in the 4πβ-counting has generally been used for reducing the absorption of β-rays. The thickness of the film with the gold is usually a few times thicker than the VYNS film itself. However, Because the appropriate thickness of gold has not yet been determined, the effects of gold thickness on electrical resistivity, plateau characteristics and β-ray counting efficiency were studied. 198 Au (960 keV), 60 Co(315 keV), 59 Fe(273 keV) and 95 Nb(160 keV), which were prepared as sources by the aluminium chloride treatment method, were used. Gold was evaporated under a deposition rate of 1 - 5 μg/cm 2 /min at a pressure less than 1 x 10 -5 Torr. Results show that the gold deposition on the side opposite the source after source preparation is essential. In this case, a maximum counting efficiency is obtained at the mean thickness of 2 μg/cm 2 . When gold is deposited only on the same side as the source, a maximum counting efficiency, which is less than that in the former case, is obtained at the mean thickness of 20 μg/cm 2 . (Evans, J.)

Online coupling of pure O_2 thermo-optical methods – "1"4C AMS for source apportionment of carbonaceous aerosols

International Nuclear Information System (INIS)

Agrios, Konstantinos; Salazar, Gary; Zhang, Yan-Lin; Uglietti, Chiara; Battaglia, Michael; Luginbühl, Marc; Ciobanu, Viorela Gabriela; Vonwiller, Matthias; Szidat, Sönke

2015-01-01

This paper reports on novel separation methods developed for the direct determination of "1"4C in organic carbon (OC) and elemental carbon (EC), two sub-fractions of total carbon (TC) of atmospheric air particulate matter. Until recently, separation of OC and EC has been performed off-line by manual and time-consuming techniques that relied on the collection of massive CO_2 fractions. We present here two on-line hyphenated techniques between a Sunset OC/EC analyzer and a MICADAS (MIni radioCArbon DAting System) accelerator mass spectrometer (AMS) equipped with a gas ion source. The first implementation facilitates the direct measurement in the low sample size range (<10 μg C) with high throughput on a routine basis, while the second explores the potential for a continuous-flow real-time CO_2 gas feed into the ion source. The performance achieved with reference materials and real atmospheric samples will be discussed to draw conclusions on the improvement offered in the field of "1"4C aerosol source apportionment.

Cycles through subsets with large degree sums

NARCIS (Netherlands)

Broersma, Haitze J.; Li, Hao; Li, Jianping; Tian, Feng; Veldman, H.J.

1997-01-01

Let G be a 2-connected graph on n vertices and let X V(G). We say that G is X-cyclable if G has an X-cycle, i.e., a cycle containing all vertices of X. We denote by ¿(X) the maximum number of pairwise nonadjacent vertices in the subgraph G[X] of G induced by X. If G[X] is not complete, we denote by

The superluminal radio source 4c 39. 25 as relativistic jet prototype. El cuasar superluminal 4C 93. 25 como prototipo de jet relativistia

Energy Technology Data Exchange (ETDEWEB)

Alberdi, A.; Gomez, J.L.; Marcaide, J.M.

1993-01-01

We have developed a numerical code which solves the synchrotron radiation transfer equations to compute the total and polarized emission of bent shocked relativistic jets, and we have applied it to reproduce the compact structure, kinematic evolution of the superluminal radio source 4C 39.25 contains a bent relativistic jet which is misaligned relative to the observer near the core region, leading to a relatively low core brightness. (Author) 12 refs.

Highly Stable, All-fiber, High Power ZBLAN Supercontinuum Source Reaching 4.75 µm used for Nanosecond mid-IR Spectroscopy

DEFF Research Database (Denmark)

Moselund, Peter M.; Petersen, Christian; Leick, Lasse

2013-01-01

We demonstrate compact all-fiber mid-IR supercontinuum generation up to 4.75 μm with 1.2 W output power during hundreds of hours. This source is applied to upconversion spectroscopy using the energy corresponding to a single pulse....

Second-hand smoke exposure in 4-year-old children in Spain: Sources, associated factors and urinary cotinine.

Science.gov (United States)

Aurrekoetxea, Juan José; Murcia, Mario; Rebagliato, Marisa; Guxens, Mònica; Fernández-Somoano, Ana; López, María José; Lertxundi, Aitana; Castilla, Ane Miren; Espada, Mercedes; Tardón, Adonina; Ballester, Ferran; Santa-Marina, Loreto

2016-02-01

Second-hand smoke exposure (SHS) in children remains as a major pollution problem, with important consequences for children's health. This study aimed to identify the sources of exposure to SHS among 4-year-old children, comparing self-reports to a urinary biomarker of exposure, and characterize the most important variables related to SHS exposure in this population. 4-year-old children's exposure to SHS was assessed by a parental-reported questionnaire and by urinary cotinine (UC) measurements in 1757 participants from 4 different areas of the Spanish INMA (INfancia y Medio Ambiente - Environment and Childhood) Project. The questionnaire about SHS included information about smoking habits at home by household members, and about exposure to SHS in other places including other homes, bars, restaurants or transportation. The association between quantified UC levels (>4ng/ml) and sociodemographic variables and the different sources of SHS exposure was examined using logistic regression. Based on parental reports, 21.6% of the children were exposed to SHS at home and 47.1% elsewhere; making a total 55.9% of the children exposed to SHS. In addition, 28.2% of the children whose parents reported being not regularly exposed to SHS had quantified UC values. Children from younger mothers (<34 vs. ≥39.4 y) had a higher odds of exposure to SHS [OR (95% CI): 2.28 (1.70-3.05) per year], as well as from families with a lower educational level [OR secondary: 2.12 (1.69-2.65); primary or less: 2.91 (2.19-3.88)]. The odds of quantifiable UC in children dropped after the smoking ban in public places [OR=0.59 (0.42-0.83)]. Regarding the sources of SHS exposure we observed that quantifiable UC odds was increased in children whose parents smoked at home in their presence [OR mother occasionally: 13.39 (7.03-25.50); mother often: 18.48 (8.40-40.66); father occasionally: 10.98 (6.52-18.49); father often: 11.50 (5.96-22.20)] or in children attending other confined places, mainly other

Plasma ignition and steady state simulations of the Linac4 H$^{-}$ ion source

CERN Document Server

Mattei, S; Yasumoto, M; Hatayama, A; Lettry, J; Grudiev, A

2014-01-01

The RF heating of the plasma in the Linac4 H- ion source has been simulated using an Particle-in-Cell Monte Carlo Collision method (PIC-MCC). This model is applied to investigate the plasma formation starting from an initial low electron density of 1012 m-3 and its stabilization at 1018 m-3. The plasma discharge at low electron density is driven by the capacitive coupling with the electric field generated by the antenna, and as the electron density increases the capacitive electric field is shielded by the plasma and induction drives the plasma heating process. Plasma properties such as e-/ion densities and energies, sheath formation and shielding effect are presented and provide insight to the plasma properties of the hydrogen plasma.

Innovative Ways of Visualising Meta Data in 4D Using Open Source Libaries

Science.gov (United States)

Balhar, Jakub; Valach, Pavel; Veselka, Jonas; Voumard, Yann

2016-08-01

There are more and more data being measured by different Earth Observation satellites around the world. Ever increasing amount of these data present new challenges and opportunities for their visualization.In this paper we propose how to visualize the amount, distribution and the structure of the data in a transparent way, which will take into account time-dimensions as well. Our approach allows us to get a global overview as well detailed regional information about distribution of the products from EO observation missions.We focus on introducing our mobile-friendly and easy- to-use web mapping application for 4D visualization of the data. Apart from that we also present the Java application which can read and process the data from various data sources.

Correlated Radial Velocity and X-Ray Variations in HD 154791/4U 1700+24

Science.gov (United States)

Galloway, Duncan K.; Sokoloski, J. L.; Kenyon, Scott J.

2002-12-01

We present evidence for approximately 400 day variations in the radial velocity of HD 154791 (V934 Her), the suggested optical counterpart of 4U 1700+24. The variations are correlated with the previously reported ~400 day variations in the X-ray flux of 4U 1700+24, which supports the association of these two objects, as well as the identification of this system as the second known X-ray binary in which a neutron star accretes from the wind of a red giant. The HD 154791 radial velocity variations can be fitted with an eccentric orbit with period 404+/-3 days, amplitude K=0.75+/-0.12kms-1, and eccentricity e=0.26+/-0.15. There are also indications of variations on longer timescales >~2000 days. We have reexamined all available All-Sky Monitor (ASM) data following an unusually large X-ray outburst in 1997-1998 and confirm that the 1 day averaged 2-10 keV X-ray flux from 4U 1700+24 is modulated with a period of 400+/-20 days. The mean profile of the persistent X-ray variations was approximately sinusoidal, with an amplitude of 0.108+/-0.012 ASM counts s-1 (corresponding to 31% rms). The epoch of X-ray maximum was approximately 40 days after the time of periastron, according to the eccentric orbital fit. If the 400 day oscillations from HD 154791/4U 1700+24 are due to orbital motion, then the system parameters are probably close to those of the only other neutron star symbiotic-like binary, GX 1+4. We discuss the similarities and differences between these two systems.

Centrifuge-Simulated Suborbital Spaceflight in a Subject with Cardiac Malformation.

Science.gov (United States)

Blue, Rebecca S; Blacher, Eric; Castleberry, Tarah L; Vanderploeg, James M

2015-11-01

Commercial spaceflight participants (SFPs) will introduce new medical challenges to the aerospace community, with unique medical conditions never before exposed to the space environment. This is a case report regarding the response of a subject with multiple cardiac malformations, including aortic insufficiency, pulmonary atresia, pulmonary valve replacement, ventricular septal defect (post-repair), and pulmonary artery stenosis (post-dilation), to centrifuge acceleration simulating suborbital flight. A 23-yr-old man with a history of multiple congenital cardiac malformations underwent seven centrifuge runs over 2 d. Day 1 consisted of two +G(z) runs (peak = +3.5 G(z), run 2) and two +G(x) runs (peak = +6.0 G(x), run 4). Day 2 consisted of three runs approximating suborbital spaceflight profiles (combined +G(x) and +G(z)). Data collected included blood pressure, electrocardiogram, pulse oximetry, neurovestibular exams, and post-run questionnaires regarding motion sickness, disorientation, greyout, and other symptoms. Despite the subject's significant medical history, he tolerated the acceleration profiles well and demonstrated no significant abnormal physiological responses. Potential risks to SFPs with aortic insufficiency, artificial heart valves, or valvular insufficiency include lower +G(z) tolerance, earlier symptom onset, and ineffective mitigation strategies such as anti-G straining maneuvers. There are no prior studies of prolonged accelerations approximating spaceflight in such individuals. This case demonstrates tolerance of acceleration profiles in an otherwise young and healthy individual with significant cardiac malformations, suggesting that such conditions may not necessarily preclude participation in commercial spaceflight.

Interaction between FKBP5 variability and recent life events in the anxiety spectrum: Evidence for the differential susceptibility model

Science.gov (United States)

Sheinbaum, Tamara; Kwapil, Thomas R.; Ballespí, Sergi; Peña, Elionora; de Castro-Catala, Marta; Riba, Maria Dolors; Rosa, Araceli

2018-01-01

Background Gene-environment interaction (GxE) research has highlighted the importance of investigating the FK506 binding protein 51 (FKBP5) gene as a sensitivity gene. However, previous GxE studies with FKBP5 have not measured the full environmental spectrum or applied statistical tests to discern whether the GxE interaction fits better with the differential-susceptibility or diathesis-stress hypotheses. This study examined whether single nucleotide polymorphisms (SNPs) on FKBP5 gene moderate the association of positive and negative recent life events (LEs) with depressive symptoms, state-anxiety, neuroticism, and social anxiety traits. Methods A total of 86 nonclinical young adults were administered psychological measures and were genotyped for five FKBP5 SNPs (rs3800373, rs9296158, rs1360780, rs9470080 and rs4713916). Results Regression analyses indicated significant GxE interactions for social anxiety and neuroticism. The interactions predicting neuroticism fit different models for different SNPs, although the overall effect indicated by the haplotype was consistent with the differential-susceptibility hypothesis: the risk-haplotype group presented higher neuroticism in the presence of more negative LEs and lower neuroticism in the presence of more positive LEs. The GxE interactions for social anxiety were consistent with the diathesis-stress model. The lack of significance in the for-better side for social anxiety might be related to the fact that it mapped onto low extraversion, which is associated with a lower permeability to positive experiences. Discussion Findings underscore the importance of testing the differential-susceptibility model in relation to FKBP5 to adequately characterize its role in healthy and pathological developmental processes. PMID:29466454

Measurements of Linac4 H$^{-}$ ion source beam with a magnetized Einzel lens electron dump

CERN Document Server

Midttun, O; Scrivens, R

2014-01-01

Linac4 is a part of the upgrade of CERN’s accelerator complex for increased luminosity in the LHC. A new system to extract the ion beam from the plasma generator has been designed and tested, in order to improve the reliability and beam optics of the pulsed H- ion source. This paper presents the successfully implemented extraction system and three different beam measurements. The simulations compare well to the measurements and show that the plasma density was too low for the extraction system design during the measurements.

A statistical perspective on association studies of psychiatric disorders

DEFF Research Database (Denmark)

Foldager, Leslie

2014-01-01

Gene-gene (GxG) and gene-environment (GxE) interactions likely play an important role in the aetiology of complex diseases like psychiatric disorders. Thus, we aim at investigating methodological aspects of and apply methods from statistical genetics taking interactions into account. In addition we...... genes and maternal infection by virus. Paper 3 presents the initial steps (mainly data construction) of an ongoing simulation study aiming at guiding decisions by comparing methods for GxE interaction analysis including both traditional two-step logistic regression, exhaustive searches using efficient...... these markers. However, the validity of the identified haplotypes is also checked by inferring phased haplotypes from genotypes. Haplotype analysis is also used in paper 5 which is otherwise an example of a focused approach to narrow down a previously found signal to search for more precise positions of disease...

A study of light hydrocarbons (C{sub 4}-C{sub 1}3) in source rocks and petroleum fluid

Energy Technology Data Exchange (ETDEWEB)

Odden, Wenche

2000-07-01

This thesis consists of an introduction and five included papers. Of these, four papers are published in international journals and the fifth was submitted for review in April 2000. Emphasis has been placed on both naturally and artificially generated light hydrocarbons in petroleum fluids and their proposed source rocks as well as direct application of light hydrocarbons to oil/source rock correlations. Collectively, these papers describe a strategy for interpreting the source of the light hydrocarbons in original oils and condensates as well as the source of the asphaltene fractions from the reservoir fluids. The influence of maturity on light hydrocarbon composition has also been evaluated. The papers include (1) compositional data on the light hydrocarbons from thermal extracts and kerogen pyrolysates of sediment samples, (2) light hydrocarbon data of oils and condensates as well as the pyrolysis products of the asphaltenes from these fluids, (3) assessment of compositional alteration effects, such as selective losses of light hydrocarbons due to evaporation, thermal maturity, phase fractionation and biodegradation, (4) comparison of naturally and artificially generated light hydrocarbons, and (5) compound-specific carbon isotope analysis of the whole range of hydrocarbons of all sample types. (author)

Genetic and phylogenetic analysis of a novel parvovirus isolated from chickens in Guangxi, China.

Science.gov (United States)

Feng, Bin; Xie, Zhixun; Deng, Xianwen; Xie, Liji; Xie, Zhiqin; Huang, Li; Fan, Qin; Luo, Sisi; Huang, Jiaoling; Zhang, Yanfang; Zeng, Tingting; Wang, Sheng; Wang, Leyi

2016-11-01

A previously unidentified chicken parvovirus (ChPV) strain, associated with runting-stunting syndrome (RSS), is now endemic among chickens in China. To explore the genetic diversity of ChPV strains, we determined the first complete genome sequence of a novel ChPV isolate (GX-CH-PV-7) identified in chickens in Guang Xi, China, and showed moderate genome sequence similarity to reference strains. Analysis showed that the viral genome sequence is 86.4 %-93.9 % identical to those of other ChPVs. Genetic and phylogenetic analyses showed that this newly emergent GX-CH-PV-7 is closely related to Gallus gallus enteric parvovirus isolate ChPV 798 from the USA, indicating that they may share a common ancestor. The complete DNA sequence is 4612 bp long with an A+T content of 56.66 %. We determined the first complete genome sequence of a previously unidentified ChPV strain to elucidate its origin and evolutionary status.

Physiological performance of the soybean crosses in salinity stress

Science.gov (United States)

Wibowo, F.; Armaniar

2018-02-01

Plants grown in saline soils will experience salinity stress. Salinity stresses, one of which causes oxidative stress, that cause an imbalance in the production ROS compounds (Reactive Oxygen Species), antioxidants and chlorophyll. Where the reaction of this compound can affect plant growth and plant production. This study aims to inform performance and action gene to soybean physiological character that potential to tolerant from salinity soil that characterized by the presence of SOD and POD antioxidant compounds and chlorophyll. This research used a destructive analysis from crossbred (AxN) and (GxN). A = Anjasmoro varieties and G = Grobogan varieties as female elders and N = Grobogan varieties as male elders (N1, N2, N3, N4, N5) that have been through the stage of saline soil selection. Research result can be concluded that GxN cross is more potential for Inheritance of the offspring. This can be seen from the observed skewness of character SOD, POD compounds, Chlorophyll a and chlorophyll b.

Optimising carbon and nitrogen sources for Azotobacter ...

African Journals Online (AJOL)

The present work deals with selecting and optimization of carbon and nitrogen sources for producing biomass from Azotobacter chroococcum. Four carbon sources (glucose, sucrose, manitol and sodium benzoate) and four nitrogen sources (yeast extract, meat extract, NH4Cl and (NH4)2SO4) were evaluated during the first ...

Hepatitis E Virus in Cambodia: Prevalence among the General Population and Complete Genome Sequence of Genotype 4.

Science.gov (United States)

Yamada, Hiroko; Takahashi, Kazuaki; Lim, Olline; Svay, Somana; Chuon, Channarena; Hok, Sirany; Do, Son Huy; Fujimoto, Mayumi; Akita, Tomoyuki; Goto, Noboru; Katayama, Keiko; Arai, Masahiro; Tanaka, Junko

2015-01-01

Hepatitis E virus (HEV) is a growing public health problem in many countries. In this study, we investigated HEV seroprevalence among the general population in the Siem Reap province, Cambodia, and performed HEV genetic analysis with the aim to develop an HEV prevention strategy. This seroepidemiological cross-sectional study conducted from 2010 to 2014 included 868 participants from four different locations in Siem Reap province, Cambodia. They answered questionnaires and provided blood samples for the analysis of hepatitis virus infections. Among the participants (360 men and 508 women; age range, 7-90 years), the prevalence of anti-HEV IgG was 18.4% (95% confidence interval: 15.9-21.0); HEV RNA was detected in two participants (0.23%) and was classified as genotype 3 and 4. Full-length genome of the genotype 4 isolate, CVS-Sie10, was sequenced; it contained 7,222 nucleotides and three ORFs and demonstrated high sequence identity with the swine China isolates swGX40 (95.57%), SS19 (94.37%), and swDQ (91.94%). Multivariate logistic regression analysis revealed that men, elderly people, and house workers were risk groups significantly associated with the positivity for anti-HEV IgG. This is the first report on the detection of HEV genotype 4 in humans in Cambodia and on the complete genome sequence of HEV genotype 4 from this country. Our study demonstrates that new HEV infection cases occur frequently among the general population in Cambodia, and effective preventive measures are required.

Hepatitis E Virus in Cambodia: Prevalence among the General Population and Complete Genome Sequence of Genotype 4.

Directory of Open Access Journals (Sweden)

Hiroko Yamada

Full Text Available Hepatitis E virus (HEV is a growing public health problem in many countries. In this study, we investigated HEV seroprevalence among the general population in the Siem Reap province, Cambodia, and performed HEV genetic analysis with the aim to develop an HEV prevention strategy. This seroepidemiological cross-sectional study conducted from 2010 to 2014 included 868 participants from four different locations in Siem Reap province, Cambodia. They answered questionnaires and provided blood samples for the analysis of hepatitis virus infections. Among the participants (360 men and 508 women; age range, 7-90 years, the prevalence of anti-HEV IgG was 18.4% (95% confidence interval: 15.9-21.0; HEV RNA was detected in two participants (0.23% and was classified as genotype 3 and 4. Full-length genome of the genotype 4 isolate, CVS-Sie10, was sequenced; it contained 7,222 nucleotides and three ORFs and demonstrated high sequence identity with the swine China isolates swGX40 (95.57%, SS19 (94.37%, and swDQ (91.94%. Multivariate logistic regression analysis revealed that men, elderly people, and house workers were risk groups significantly associated with the positivity for anti-HEV IgG. This is the first report on the detection of HEV genotype 4 in humans in Cambodia and on the complete genome sequence of HEV genotype 4 from this country. Our study demonstrates that new HEV infection cases occur frequently among the general population in Cambodia, and effective preventive measures are required.

Synthesis of LiFePO{sub 4}/polyacenes using iron oxyhydroxide as an iron source

Energy Technology Data Exchange (ETDEWEB)

Yang, Guiling; Zhang, Xianfa; Liu, Jing; He, Xingguang; Wang, Jiawei; Xie, Haiming; Wang, Rongshun [Institute of Functional Materials, Department of Chemistry, Northeast Normal University, Changchun, Jilin 130024 (China); LIB Engineering Laboratory, Materials Science and Technology Center, Changchun, Jilin 130024 (China)

2010-02-15

LiFePO{sub 4}/polyacenes (PAS) composite is synthesized by iron oxyhydroxide as a new raw material and phenol-formaldehyde resin as both reducing agent and carbon source. The mechanism of the reaction is outlined by the analysis of XRD, FTIR as well as TG/DSC. The results show that the formation of LiFePO{sub 4} is started at 300 C, and above 550 C, the product can be mainly ascribed to olivine LiFePO{sub 4}. The electrochemical properties of the synthesized composites are investigated by charge-discharge tests. It is found that the prepared sample at 750 C (S750) has a better electrochemical performance than samples prepared at other temperatures. A discharge capacity of 158 mAh g{sup -1} is delivered at 0.2 C. Under high discharge rate of 10 C, a discharge capacity of 145 mAh g{sup -1} and good capacity retention of 93% after 800 cycles are achieved. The morphology of S750 and PAS distribution in it are investigated by SEM and TEM. (author)

Design of a 4D emittance measurement device for high charge state ECR ion sources

International Nuclear Information System (INIS)

Zhao Yangyang; Yang Yao; Zhao Hongwei; Sun Liangting; Cao Yun; Wang Yun

2013-01-01

For the purpose of on-line beam quality diagnostics and transverse emittance coupling investigation of the ion beams delivered by an Electron Cyclotron Resonance (ECR) ion source, a real-time 4D Pepper Pot type emittance scanner is under development at IMP (Institute of Moden Physics, Chinese Academy of Sciences). The high charge state ECR ion source at IMP could produce CW or pulsed heavy ion beam intensities in the range of 1 eμA∼1 emA with the kinetic energy of 10∼35 keV/q, which needs the design of the Pepper Pot scanner to be optimized accordingly. The Pepper Pot scanner has many features, such as very short response time and wide dynamic working range that the device could be applied. Since intense heavy ion beam bombardment is expected for this device, the structure and the material selection for the device is specially considered during the design, and a feasible solution to analyze the pictures acquired after the data acquisition is also made. (authors)

The Z accelerator as a source of > 100 kJ of x-rays above 4.8 keV

International Nuclear Information System (INIS)

Deeney, C.; Coverdale, C.A.; Spielman, R.B.

1998-01-01

Recent K-shell scaling experiments on the 20 MA Z accelerator at Sandia National Laboratories have shown that large diameter (40 and 55 mm) arrays can be imploded with 80 to 210 wires of titanium or stainless steel. These implosions have produced up to 150 kJ of > 4.5 keV x-rays and 65 kJ of > 6.0 keV x-rays in 7 to 18 ns FWHM pulses. This is a major advance in plasma radiation source (PRS) capability since there is presently limited test capability above 3 keV. In fact, Z produces more > 4.5 keV x-rays than previous aboveground simulators produced at 1.5 keV. Z also produces some 200 kJ of x-rays between 1 and 3 keV in a continuous spectrum for these loads. The measured spectra and yields are consistent with 1-dimensional MHD calculations performed by NRL. Thermoelastic calorimeters, PVDF gauges, and optical impulse gauges have been successfully fielded with these sources

X-ray diving in the center of Sh2-129: looking for the driving source of Ou4

Science.gov (United States)

Grosso, Nicolas

2012-10-01

The outflow phenomenon is associated both with the early and the last phase of the stellar evolution. Recently, a unique bipolar outflow with an angular size of 1.2 degrees was discovered in the blister HII region Sh2-129. Ou4, nicknamed "The Giant Squid", is to our knowledge the bipolar outflow with the largest angular size ever found. We propose joint XMM-Newton/EPIC (35 ks) and Chandra/HRC-I (16 ks) observations to look for the driving source of Ou4 and to clarify the nature of this object.

A targeted search for point sources of EeV neutrons

Czech Academy of Sciences Publication Activity Database

Aab, A.; Abreu, P.; Aglietta, M.; Boháčová, Martina; Chudoba, Jiří; Ebr, Jan; Mandát, Dušan; Nečesal, Petr; Palatka, Miroslav; Pech, Miroslav; Prouza, Michael; Řídký, Jan; Schovánek, Petr; Trávníček, Petr; Vícha, Jakub

2014-01-01

Roč. 789, č. 2 (2014), s. 1-7 ISSN 2041-8205 R&D Projects: GA ČR(CZ) GA14-17501S; GA MŠk(CZ) 7AMB14AR005; GA MŠk(CZ) LG13007 Institutional support: RVO:68378271 Keywords : cosmic rays * Galaxy * disk * methods * data analysis Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 5.339, year: 2014 http://iopscience.iop.org/2041-8205/789/2/L34/pdf/2041-8205_789_2_L34.pdf

Detection of Serum IgG4 Levels in Patients with IgG4-Related Disease and Other Disorders

Science.gov (United States)

Wang, Chenqiong; Wu, Xuefen; Miao, Ye; Xiong, Hui; Bai, Lin; Dong, Lingli

2015-01-01

Objective Elevated serum IgG4 levels are an important hallmark for diagnosing IgG4-related disease (IgG4-RD), but can also be observed in other diseases. This study aimed to compare two different testing methods for IgG4: ELISA and nephelometric assay. Both assays were used to measure serum IgG4 concentrations, and to assess the prevalence of high serum IgG4 levels in both IgG4-RD and non-IgG4-RD diseases. Methods A total of 80 serum samples were tested using the nephelometric assay and ELISA method that we established. Serum IgG4 concentrations were determined by ELISA for 957 patients with distinct diseases, including 12 cases of IgG4-RD and 945 cases of non-IgG4-RD. Results IgG4 levels from 80 selected serum samples examined by ELISA were in agreement with those detected using the nephelometry assay. Meanwhile, the serum IgG4 concentrations measured by ELISA were also consistent with the clinical diagnoses of patients with IgG4-RD during the course of disease. The Elevated levels of serum IgG4 (>1.35 g/L) were detected in all IgG4-RD (12/12) patients, and the prevalence of high IgG4 serum levels was 3.39% in non-IgG4-RD cases. Among them, the positive rates of serum IgG4 were 2.06% in patients with carcinoma and 6.3% in patients with other non-IgG4 autoimmune diseases. Conclusion Our established ELISA method is a reliable and convenient technique, which could be extensively used in the clinic to measure serum IgG4 levels. High levels of IgG4 were observed in IgG4-RD. However, this phenomenon could also be observed in other diseases, such as carcinomas and other autoimmune diseases. Thus, a diagnosis of IgG4 disease cannot only be dependent on the detection of elevated serum IgG4 levels. PMID:25885536

SU-E-T-212: Comparison of TG-43 Dosimetric Parameters of Low and High Energy Brachytherapy Sources Obtained by MCNP Code Versions of 4C, X and 5

Energy Technology Data Exchange (ETDEWEB)

Zehtabian, M; Zaker, N; Sina, S [Shiraz University, Shiraz, Fars (Iran, Islamic Republic of); Meigooni, A Soleimani [Comprehensive Cancer Center of Nevada, Las Vegas, Nevada (United States)

2015-06-15

Purpose: Different versions of MCNP code are widely used for dosimetry purposes. The purpose of this study is to compare different versions of the MCNP codes in dosimetric evaluation of different brachytherapy sources. Methods: The TG-43 parameters such as dose rate constant, radial dose function, and anisotropy function of different brachytherapy sources, i.e. Pd-103, I-125, Ir-192, and Cs-137 were calculated in water phantom. The results obtained by three versions of Monte Carlo codes (MCNP4C, MCNPX, MCNP5) were compared for low and high energy brachytherapy sources. Then the cross section library of MCNP4C code was changed to ENDF/B-VI release 8 which is used in MCNP5 and MCNPX codes. Finally, the TG-43 parameters obtained using the MCNP4C-revised code, were compared with other codes. Results: The results of these investigations indicate that for high energy sources, the differences in TG-43 parameters between the codes are less than 1% for Ir-192 and less than 0.5% for Cs-137. However for low energy sources like I-125 and Pd-103, large discrepancies are observed in the g(r) values obtained by MCNP4C and the two other codes. The differences between g(r) values calculated using MCNP4C and MCNP5 at the distance of 6cm were found to be about 17% and 28% for I-125 and Pd-103 respectively. The results obtained with MCNP4C-revised and MCNPX were similar. However, the maximum difference between the results obtained with the MCNP5 and MCNP4C-revised codes was 2% at 6cm. Conclusion: The results indicate that using MCNP4C code for dosimetry of low energy brachytherapy sources can cause large errors in the results. Therefore it is recommended not to use this code for low energy sources, unless its cross section library is changed. Since the results obtained with MCNP4C-revised and MCNPX were similar, it is concluded that the difference between MCNP4C and MCNPX is their cross section libraries.

Different Covalent Immobilizations Modulate Lipase Activities of Hypocrea pseudokoningii

Directory of Open Access Journals (Sweden)

Marita G. Pereira

2017-09-01

Full Text Available Enzyme immobilization can promote several advantages for their industrial application. In this work, a lipase from Hypocrea pseudokoningii was efficiently linked to four chemical supports: agarose activated with cyanogen bromide (CNBr, glyoxyl-agarose (GX, MANAE-agarose activated with glutaraldehyde (GA and GA-crosslinked with glutaraldehyde. Results showed a more stable lipase with both the GA-crosslinked and GA derivatives, compared to the control (CNBr, at 50 °C, 60 °C and 70 °C. Moreover, all derivatives were stabilized when incubated with organic solvents at 50%, such as ethanol, methanol, n-propanol and cyclohexane. Furthermore, lipase was highly activated (4-fold in the presence of cyclohexane. GA-crosslinked and GA derivatives were more stable than the CNBr one in the presence of organic solvents. All derivatives were able to hydrolyze sardine, açaí (Euterpe oleracea, cotton seed and grape seed oils. However, during the hydrolysis of sardine oil, GX derivative showed to be 2.3-fold more selectivity (eicosapentaenoic acid (EPA/docosahexaenoic acid (DHA ratio than the control. Additionally, the types of immobilization interfered with the lipase enantiomeric preference. Unlike the control, the other three derivatives preferably hydrolyzed the R-isomer of 2-hydroxy-4-phenylbutanoic acid ethyl ester and the S-isomer of 1-phenylethanol acetate racemic mixtures. On the other hand, GX and CNBr derivatives preferably hydrolyzed the S-isomer of butyryl-2-phenylacetic acid racemic mixture while the GA and GA-crosslink derivatives preferably hydrolyzed the R-isomer. However, all derivatives, including the control, preferably hydrolyzed the methyl mandelate S-isomer. Moreover, the derivatives could be used for eight consecutive cycles retaining more than 50% of their residual activity. This work shows the importance of immobilization as a tool to increase the lipase stability to temperature and organic solvents, thus enabling the possibility of

The hydro-climatic history of the Gulf of Cadiz throughout the last ~570 kyr from IODP 339 Site U1386

Science.gov (United States)

Kaboth, Stefanie; de Boer, Bas; Bahr, Andrè; Zeeden, Christian; Lourens, Lucas

2016-04-01

Here we present the first continuous and high-resolution (~ 1 kyr) benthic δ18O record from IODP Site U1386 (Gulf of Cadiz, IODP Exp. 339) representing the last 570 kyr. We find distinct and periodic δ18O enrichment events overimposed on patterns of global ice volume change as inferred from the global mean δ18O signal (i.e. LR04). These events occur most prominently during glacials, and are characterized by a relative increase of up to 1‰. The observed glacial δ18O enrichment represents a striking difference to deep-sea benthic δ18O records worldwide but is not without precedent as similar δ18O variability can be observed in the planktic signal of the Red Sea (Sites KL11 and KL23). There, similar glacial δ18O enrichment events have not raised particular interest since their occurrence was attributed to sea level induced salinity increase within this virtually landlocked basin. Our results suggest that the glacial δ18O enrichment at Site U1386 present salinity and/or temperature variability related to changes in the position of the frontal zone between subpolar and subtropical water masses within the Gulf of Cadiz. Interestingly, the δ18O enrichments at Site U1386 strongly reflect precession and semi-precession patterns. Since similar patterns can be observed in the Red Sea isotopic records, we argue that part of the inferred sea level reconstructions are biased by a regional and precession controlled mechanism.

Communicating Science to Impact Learning? A Phenomenological Inquiry into 4th and 5th Graders' Perceptions of Science Information Sources

Science.gov (United States)

Gelmez Burakgazi, Sevinc; Yildirim, Ali; Weeth Feinstein, Noah

2016-04-01

Rooted in science education and science communication studies, this study examines 4th and 5th grade students' perceptions of science information sources (SIS) and their use in communicating science to students. It combines situated learning theory with uses and gratifications theory in a qualitative phenomenological analysis. Data were gathered through classroom observations and interviews in four Turkish elementary schools. Focus group interviews with 47 students and individual interviews with 17 teachers and 10 parents were conducted. Participants identified a wide range of SIS, including TV, magazines, newspapers, internet, peers, teachers, families, science centers/museums, science exhibitions, textbooks, science books, and science camps. Students reported using various SIS in school-based and non-school contexts to satisfy their cognitive, affective, personal, and social integrative needs. SIS were used for science courses, homework/project assignments, examination/test preparations, and individual science-related research. Students assessed SIS in terms of the perceived accessibility of the sources, the quality of the content, and the content presentation. In particular, some sources such as teachers, families, TV, science magazines, textbooks, and science centers/museums ("directive sources") predictably led students to other sources such as teachers, families, internet, and science books ("directed sources"). A small number of sources crossed context boundaries, being useful in both school and out. Results shed light on the connection between science education and science communication in terms of promoting science learning.

Assessment of protocols in cone beam CT with symmetric and asymmetric beam using effective dose and P{sub ka}

Energy Technology Data Exchange (ETDEWEB)

Batista, W. O.; Linhares de O, M. V. [Instituto Federal da Bahia, Rua Emidio dos Santos s/n, Barbalho, Salvador, 40301015 Bahia (Brazil); Soares, M. R.; Maia, A. F. [Universidade Federal de Sergipe, Departamento de Fisica, Cidade Universitaria Prof. Jose Aloisio de Campos, Marechal Rondon s/n, Jardim Rosa Elze, 49-100000 Sao Cristovao, Sergipe (Brazil); Caldas, L. V. E., E-mail: wilsonottobatista@gmail.com [Instituto de Pesquisas Energeticas e Nucleares / CNEN, Av. Lineu Prestes 2242, Cidade Universitaria, 05508-000 Sao Paulo (Brazil)

2014-08-15

The cone beam CT is an emerging technology in dental radiology with significant differences the point of view of design technology between the various manufacturers on the world market. This study aims to evaluate and compare protocols with similar purposes in a cone beam CT scanner using TLDs and air kerma - area product (P{sub ka}) as kerma index. Measurements were performed on two protocols used to obtain the image the maxilla-mandible in equipment Gendex GXCB 500: Protocol [GX1] extended diameter and asymmetric beam (14 cm x 8.5 cm - maxilla / mandible) and protocol [GX2] symmetrical beam (8.5 cm x 8.5 cm - maxillary / mandible). Was used LiF dosimeters (TLD 100) inserted into a female anthropomorphic phantom manufactured by Radiology Support Devices. For all protocols evaluated the value of P{sub ka} using a meter Diamentor E2 and PTW system Radcal Rapidose. The results obtained for Effective Dose / P{sub ka} these measurements were separated by protocol image. Protocol [GX1]: 44.5 μSv/478 mGy cm{sup 2}; protocol [GX2]: 54.8 μSv/507 mGy cm{sup 2}. These values indicate that the relationship between the diameter of the image acquired in the protocol [GX1] and the diameter of the image in the protocol [GX2] is equal to 1.65, the Effective Dose for the first protocol has lower value at 18%. P{sub ka} values reveal very similar results between the two protocols, although, common sense leads to the interpretation that imaging protocols with field of view (Fov) of large diameters imply high values of effective dose when compared to small diameters. However, in this particular case, this is not true due to the asymmetrical beam technology. Conclude that for the cases where the scanner uses asymmetric beam to obtain images with large diameters that cover the entire face there are advantages from the point of view of reducing the exposure of patients with respect to the use of symmetrical beam and / or to Fov images with a smaller diameter. (Author)

Experimental study of self magnetic pinch diode as flash radiography source at 4 megavolt

International Nuclear Information System (INIS)

Etchessahar, Bertrand; Bicrel, Béatrice; Cassany, Bruno; Desanlis, Thierry; Voisin, Luc; Maisonny, Rémi; Toury, Martial; Hourdin, Laurent; Cartier, Frédéric; Cartier, Stéphanie; D'Almeida, Thierry; Delbos, Christophe; Garrigues, Alain; Plouhinec, Damien; Ritter, Sandra; Sol, David; Zucchini, Frédéric; Caron, Michel

2013-01-01

The Self Magnetic Pinch (SMP) diode is a potential high-brightness X-ray source for high voltage generators (2–10 MV) that has shown good reliability for flash radiography applications [D. D. Hinchelwood et al., “High power self-pinch diode experiments for radiographic applications” IEEE Trans. Plasma Sci. 35(3), 565–572 (2007)]. We have studied this diode at about 4 MV, driven by the ASTERIX generator operated at the CEA/GRAMAT [G. Raboisson et al., “ASTERIX, a high intensity X-ray generator,” in Proceedings of the 7th IEEE Pulsed Power Conference (1989), pp. 567–570]. This generator, made up of a capacitor bank and a Blumlein line, was initially designed to test the behavior of electronic devices under irradiation. In our experiments, the vacuum diode is modified in order to set up flash radiographic diodes. A previous set of radiographic experiments was carried out on ASTERIX with a Negative Polarity Rod Pinch (NPRP) diode [B. Etchessahar et al., “Study and optimization of negative polarity rod pinch diode as flash radiography source at 4.5 MV,” Phys. Plasmas 19(9), 093104 (2012)]. The SMP diode which is examined in the present study provides an alternative operating point on the same generator and a different radiographic performance: 142 ± 11 rad at 1 m dose (Al) for a 3.46 ± 0.42 mm spot size (1.4× FWHM of the LSF). This performance is obtained in a reproducible and robust nominal configuration. However, several parametric variations were also tested, such as cathode diameter and anode/cathode gap. They showed that an even better performance is accessible after optimization, in particular, a smaller spot size (<3 mm). Numbers of electrical, optical, and X-ray diagnostics have been implemented in order to gain more insight in the diode physics and to optimize it further. For the first time in France, visible and laser imaging of the SMP diode has been realized, from a radial point of view, thus, providing key information on the electrode

Green-Schwarz superstring as an asymmetric chiral field sigma model

International Nuclear Information System (INIS)

Isaev, A.P.; Ivanov, E.A.

1988-01-01

A new class of two-dimensional σ-models of the Wess-Zumino-Witten type is constructed. The target manifold of these models is coset space GxG/G - , where supergroup G is obtained by contraction from an arbitrary semisimple Lie supergroup and G - is some abelian supergroup of translations in GxG. It is shown that the equations of motion following from the Wess-Zumino-Witten type action of these models admit a zero-curvature representation. 16 refs

Adsorption of 2,4,6-trinitrotoluene on carboxylated porous polystyrene microspheres

International Nuclear Information System (INIS)

Ye Zhengfang; Meng Qingqiang; Lu Shengtao

2012-01-01

Large-pore-size (150 nm) polystyrene (PSt) microspheres were carboxylated with phthalic anhydride (PA) through Friedel-Crafts acetylation to study the adsorption of 2,4,6-trinitrotoluene (TNT) on this material from aqueous solution. The scanning electron microscope (SEM) images and mercury porosimetry measurements (MPM) of the microspheres showed that the pore structure was unchanged during the reaction. High adsorption capacity (11.2 mg g -1 of suction-dried adsorbent) and adsorption rate (33.9 mg g -1 h -1 ) for TNT were observed during the study. As shown by the adsorption isotherm, the adsorption of TNT on PA-PSt can be described by the Freundlich adsorption equation, indicating heterogeneous adsorption process. On-column adsorption of TNT on PA-PSt and elution indicated that TNT can be completely removed from aqueous solution and condensed into acetone.

Cesium glass irradiation sources

International Nuclear Information System (INIS)

Plodinec, M.J.

1982-01-01

The precipitation process for the decontamination of soluble SRP wastes produces a material whose radioactivity is dominated by 137 Cs. Potentially, this material could be vitrified to produce irradiation sources similar to the Hanford CsCl sources. In this report, process steps necessary for the production of cesium glass irradiation sources (CGS), and the nature of the sources produced, are examined. Three options are considered in detail: direct vitrification of precipitation process waste; direct vitrification of this waste after organic destruction; and vitrification of cesium separated from the precipitation process waste. Direct vitrification is compatible with DWPF equipment, but process rates may be limited by high levels of combustible materials in the off-gas. Organic destruction would allow more rapid processing. In both cases, the source produced has a dose rate of 2 x 10 4 rads/hr at the surface. Cesium separation produces a source with a dose rate of 4 x 10 5 at the surface, which is nearer that of the Hanford sources (2 x 10 6 rads/hr). Additional processing steps would be required, as well as R and D to demonstrate that DWPF equipment is compatible with this intensely radioactive material

Nanostructured gellan and xanthan hydrogel depot integrated within a baghdadite scaffold augments bone regeneration.

Science.gov (United States)

Sehgal, Rekha R; Roohani-Esfahani, S I; Zreiqat, Hala; Banerjee, Rinti

2017-04-01

Controlled delivery of biological cues through synthetic scaffolds to enhance the healing capacity of bone defects is yet to be realized clinically. The purpose of this study was development of a bioactive tissue-engineered scaffold providing the sustained delivery of an osteoinductive drug, dexamethasone disodium phosphate (DXP), encapsulated within chitosan nanoparticles (CN). Porous baghdadite (BD; Ca 3 ZrSi 2 O 9 ) scaffolds, a zirconia-modified calcium silicate ceramic, was coated with DXP-encapsulated CN nanoparticles (DXP-CN) using nanostructured gellan and xanthan hydrogel (GX). Crosslinker and GX polymer concentrations were optimized to achieve a homogeneous distribution of hydrogel coating within BD scaffolds. Dynamic laser scattering indicated an average size of 521 ± 21 nm for the DXP-CN nanoparticles. In vitro drug-release studies demonstrated that the developed DXP-CN-GX hydrogel-coated BD scaffolds (DXP-CN-GX-BD) resulted in a sustained delivery of DXP over the 5 days (78 ± 6% of drug release) compared with burst release over 1 h, seen from free DXP loaded in uncoated BD scaffolds (92 ± 8% release in 1 h). To estimate the influence of controlled delivery of DXP from the developed scaffolds, the effect on MG 63 cells was evaluated using various bone differentiation assays. Cell culture within DXP-CN-GX-BD scaffolds demonstrated a significant increase in the expression of early and late osteogenic markers of alkaline phosphatase activity, collagen type 1 and osteocalcin, compared to the uncoated BD scaffold. The results suggest that the DXP-releasing nanostructured hydrogel integrated within the BD scaffold caused sustained release of DXP, improving the potential for osteogenic differentiation. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.

Lipid droplets induced by secreted phospholipase A2 and unsaturated fatty acids protect breast cancer cells from nutrient and lipotoxic stress.

Science.gov (United States)

Jarc, Eva; Kump, Ana; Malavašič, Petra; Eichmann, Thomas O; Zimmermann, Robert; Petan, Toni

2018-03-01

Cancer cells driven by the Ras oncogene scavenge unsaturated fatty acids (FAs) from their environment to counter nutrient stress. The human group X secreted phospholipase A 2 (hGX sPLA 2 ) releases FAs from membrane phospholipids, stimulates lipid droplet (LD) biogenesis in Ras-driven triple-negative breast cancer (TNBC) cells and enables their survival during starvation. Here we examined the role of LDs, induced by hGX sPLA 2 and unsaturated FAs, in protection of TNBC cells against nutrient stress. We found that hGX sPLA 2 releases a mixture of unsaturated FAs, including ω-3 and ω-6 polyunsaturated FAs (PUFAs), from TNBC cells. Starvation-induced breakdown of LDs induced by low micromolar concentrations of unsaturated FAs, including PUFAs, was associated with protection from cell death. Interestingly, adipose triglyceride lipase (ATGL) contributed to LD breakdown during starvation, but it was not required for the pro-survival effects of hGX sPLA 2 and unsaturated FAs. High micromolar concentrations of PUFAs, but not OA, induced oxidative stress-dependent cell death in TNBC cells. Inhibition of triacylglycerol (TAG) synthesis suppressed LD biogenesis and potentiated PUFA-induced cell damage. On the contrary, stimulation of LD biogenesis by hGX sPLA 2 and suppression of LD breakdown by ATGL depletion reduced PUFA-induced oxidative stress and cell death. Finally, lipidomic analyses revealed that sequestration of PUFAs in LDs by sPLA 2 -induced TAG remodelling and retention of PUFAs in LDs by inhibition of ATGL-mediated TAG lipolysis protect from PUFA lipotoxicity. LDs are thus antioxidant and pro-survival organelles that guard TNBC cells against nutrient and lipotoxic stress and emerge as attractive targets for novel therapeutic interventions. Copyright © 2017 Elsevier B.V. All rights reserved.

Kv2 Channel Regulation of Action Potential Repolarization and Firing Patterns in Superior Cervical Ganglion Neurons and Hippocampal CA1 Pyramidal Neurons

Science.gov (United States)

Liu, Pin W.

2014-01-01

Kv2 family “delayed-rectifier” potassium channels are widely expressed in mammalian neurons. Kv2 channels activate relatively slowly and their contribution to action potential repolarization under physiological conditions has been unclear. We explored the function of Kv2 channels using a Kv2-selective blocker, Guangxitoxin-1E (GxTX-1E). Using acutely isolated neurons, mixed voltage-clamp and current-clamp experiments were done at 37°C to study the physiological kinetics of channel gating and action potentials. In both rat superior cervical ganglion (SCG) neurons and mouse hippocampal CA1 pyramidal neurons, 100 nm GxTX-1E produced near-saturating block of a component of current typically constituting ∼60–80% of the total delayed-rectifier current. GxTX-1E also reduced A-type potassium current (IA), but much more weakly. In SCG neurons, 100 nm GxTX-1E broadened spikes and voltage clamp experiments using action potential waveforms showed that Kv2 channels carry ∼55% of the total outward current during action potential repolarization despite activating relatively late in the spike. In CA1 neurons, 100 nm GxTX-1E broadened spikes evoked from −70 mV, but not −80 mV, likely reflecting a greater role of Kv2 when other potassium channels were partially inactivated at −70 mV. In both CA1 and SCG neurons, inhibition of Kv2 channels produced dramatic depolarization of interspike voltages during repetitive firing. In CA1 neurons and some SCG neurons, this was associated with increased initial firing frequency. In all neurons, inhibition of Kv2 channels depressed maintained firing because neurons entered depolarization block more readily. Therefore, Kv2 channels can either decrease or increase neuronal excitability depending on the time scale of excitation. PMID:24695716

Motion of the sources for type 2 and type 4 radio bursts and flare-associated interplanetary disturbances

Science.gov (United States)

Sakurai, K.; Chao, J. K.

1973-01-01

Shock waves are indirectly observed as the source of type 2 radio brusts, whereas magnetic bottles are identified as the source of moving metric type 4 radio bursts. The difference between the expansion speeds of these waves bottles is examined during their generation and propagation near the flare regions. It is shown that, although generated in the explosive phase of flares, the behavior of the bottles is quite different from that of the waves and that the speed of the former is generally much lower. It is shown that the transit times of disturbances between the sun and the earth give information about the deceleration of shock waves to their local speeds observed near the earth's orbit. A brief discussion is given on the relationship among magnetic bottles, shock waves near the sun, and flare-associated disturbances in interplanetary space.

High-performance Li3V2(PO4)3/C cathode materials prepared via a sol–gel route with double carbon sources

International Nuclear Information System (INIS)

Zhang Lulu; Li Ying; Peng Gang; Wang Zhaohui; Ma Jun; Zhang Wuxing; Hu Xianluo; Huang Yunhui

2012-01-01

Graphical abstract: Double carbon sources were employed to prepare core–shell Li 3 V 2 (PO 4 ) 3 /C composites, giving rise to uniform carbon coating and high conducting network. The as-obtained composites showed remarkably enhanced capacity and rate capability. Highlights: ► Double carbon sources were used to prepare core–shell Li 3 V 2 (PO 4 ) 3 /C composites. ► An improved oxalic acid-based sol–gel method was developed. ► Uniform carbon coating and high conducting network were attained for Li 3 V 2 (PO 4 ) 3 . ► Remarkably enhanced capacity and rate capability were obtained. - Abstract: Li 3 V 2 (PO 4 ) 3 /C (LVP/C) composites have been successfully synthesized via an oxalic acid-based sol–gel process assisted by glucose, in which oxalic acid and glucose serve as double carbon sources. X-ray diffraction patterns show that all samples are well crystallized. Transmission electron microscopy images reveal that the LVP/C sample prepared with 15 wt% glucose is uniformly coated by carbon layer with an appropriate thickness of 8–10 nm, resulting in a high electrical conductivity and a fast kinetics. The Li + -ion diffusion coefficient in the LVP/C sample prepared with glucose is ∼10 −10 cm 2 s −1 , which is larger than that of the LVP/C sample prepared without glucose. The LVP/C sample prepared with 15 wt% glucose exhibits the best electrochemical performance with discharge capacity as high as 171 mAh g −1 at 0.1 C and 119 mAh g −1 at 10 C. The present work provides a valuable route for preparing lithium metal phosphates with double carbon sources to improve the conductivity and hence the electrochemical performance.

Dynamic Accuracy of Inertial Magnetic Sensor Modules

Science.gov (United States)

2016-12-01

xiii LIST OF ACRONYMS AND ABBREVIATIONS AHRS attitude and heading reference system AKF adaptive Kalman filter AUV autonomous underwater vehicle CF...attitude and heading reference system (AHRS) estimation filter (EF) microprocessor with an adaptive Kalman filter (AKF). The 3DM-GX4-25 houses a...separate processor in which temperature compensated measurements are processed through a complementary filter (CF) in order to maintain backwards

VizieR Online Data Catalog: Flaring gamma-ray sources; LAT 7.4yr (2FAV) (Abdollahi+, 2017)

Science.gov (United States)

Abdollahi, S.; Ackermann, M.; Ajello, M.; Albert, A.; Baldini, L.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Becerra Gonzalez, J.; Bellazzini, R.; Bissaldi, E.; Blandford, R. D.; Bloom, E. D.; Bonino, R.; Bottacini, E.; Bregeon, J.; Bruel, P.; Buehler, R.; Buson, S.; Cameron, R. A.; Caragiulo, M.; Caraveo, P. A.; Cavazzuti, E.; Cecchi, C.; Chekhtman, A.; Cheung, C. C.; Chiaro, G.; Ciprini, S.; Conrad, J.; Costantin, D.; Costanza, F.; Cutini, S.; D'Ammando, F.; de Palma, F.; Desai, A.; Desiante, R.; Digel, S. W.; di Lalla, N.; di Mauro, M.; di Venere, L.; Donaggio, B.; Drell, P. S.; Favuzzi, C.; Fegan, S. J.; Ferrara, E. C.; Focke, W. B.; Franckowiak, A.; Fukazawa, Y.; Funk, S.; Fusco, P.; Gargano, F.; Gasparrini, D.; Giglietto, N.; Giomi, M.; Giordano, F.; Giroletti, M.; Glanzman, T.; Green, D.; Grenier, I. A.; Grove, J. E.; Guillemot, L.; Guiriec, S.; Hays, E.; Horan, D.; Jogler, T.; Johannesson, G.; Johnson, A. S.; Kocevski, D.; Kuss, M.; La Mura, G.; Larsson, S.; Latronico, L.; Li, J.; Longo, F.; Loparco, F.; Lovellette, M. N.; Lubrano, P.; Magill, J. D.; Mal! Dera, S.; Manfreda, A.; Mayer, M.; Mazziotta, M. N.; Michelson, P. F.; Mitthumsiri, W.; Mizuno, T.; Monzani, M. E.; Morselli, A.; Moskalenko, I. V.; Negro, M.; Nuss, E.; Ohsugi, T.; Omodei, N.; Orienti, M.; Orlando, E.; Paliya, V. S.; Paneque, D.; Perkins, J. S.; Persic, M.; Pesce-Rollins, M.; Petrosian, V.; Piron, F.; Porter, T. A.; Principe, G.; Raino, S.; Rando, R.; Razzano, M.; Razzaque, S.; Reimer, A.; Reimer, O.; Sgro, C.; Simone, D.; Siskind, E. J.; Spada, F.; Spandre, G.; Spinelli, P.; Stawarz, L.; Suson, D. J.; Takahashi, M.; Tanaka, K.; Thayer, J. B.; Thompson, D. J.; Torres, D. F.; Torresi, E.; Tosti, G.; Troja, E.; Vianello, G.; Wood, K. S.

2018-04-01

To build the second catalog of flaring gamma-ray sources (2FAV) catalog, we apply the Fermi All-sky Variability Analysis (FAVA; Ackermann+ 2013, J/ApJ/771/57) to the first 387 weeks of Fermi observations, from Mission Elapsed Time (MET) 239557418 to 473615018, or Modified Julian Date (MJD) from 54682 (2008 August 4) to 57391 (2016 January 4). In this time range, a total of 7106 seed flares were found, roughly 18 per week. As for the previous catalog, FAVA uses weekly time bins. Two independent energy bands are used, 0.1-0.8GeV and 0.8-300GeV, to enhance the sensitivity to spectrally soft and hard flares, respectively. (2 data files).

Dispel4py: An Open-Source Python library for Data-Intensive Seismology

Science.gov (United States)

Filgueira, Rosa; Krause, Amrey; Spinuso, Alessandro; Klampanos, Iraklis; Danecek, Peter; Atkinson, Malcolm

2015-04-01

Scientific workflows are a necessary tool for many scientific communities as they enable easy composition and execution of applications on computing resources while scientists can focus on their research without being distracted by the computation management. Nowadays, scientific communities (e.g. Seismology) have access to a large variety of computing resources and their computational problems are best addressed using parallel computing technology. However, successful use of these technologies requires a lot of additional machinery whose use is not straightforward for non-experts: different parallel frameworks (MPI, Storm, multiprocessing, etc.) must be used depending on the computing resources (local machines, grids, clouds, clusters) where applications are run. This implies that for achieving the best applications' performance, users usually have to change their codes depending on the features of the platform selected for running them. This work presents dispel4py, a new open-source Python library for describing abstract stream-based workflows for distributed data-intensive applications. Special care has been taken to provide dispel4py with the ability to map abstract workflows to different platforms dynamically at run-time. Currently dispel4py has four mappings: Apache Storm, MPI, multi-threading and sequential. The main goal of dispel4py is to provide an easy-to-use tool to develop and test workflows in local resources by using the sequential mode with a small dataset. Later, once a workflow is ready for long runs, it can be automatically executed on different parallel resources. dispel4py takes care of the underlying mappings by performing an efficient parallelisation. Processing Elements (PE) represent the basic computational activities of any dispel4Py workflow, which can be a seismologic algorithm, or a data transformation process. For creating a dispel4py workflow, users only have to write very few lines of code to describe their PEs and how they are

Calibration and check light source

Energy Technology Data Exchange (ETDEWEB)

Nejedla, B; Krotil, J

1979-02-15

The light source is designed for calibrating photomultipliers and checking the function of the thermoluminescent dosemeters evaluation equipment. The check light source consists of a polymer material-based (polyvinyl toluene) plastic scintillator and a 2-phenyl-5-(4-bisphenyl)-1,3,4-oxadiazol and/or paraterphenyl activator, and of emission spectrum shifters for response in the green and the blue light regions. The plastic scintillator is sealed in a case to whose bottom a radiation source is fixed, such as a /sup 90/Sr-/sup 90/Y source of an activity of 1.85x10/sup 3/s/sup -1/ to 0.74x10/sup 9/s/sup -1/.

Dynamic Euler-Bernoulli Beam Equation: Classification and Reductions

Directory of Open Access Journals (Sweden)

R. Naz

2015-01-01

Full Text Available We study a dynamic fourth-order Euler-Bernoulli partial differential equation having a constant elastic modulus and area moment of inertia, a variable lineal mass density g(x, and the applied load denoted by f(u, a function of transverse displacement u(t,x. The complete Lie group classification is obtained for different forms of the variable lineal mass density g(x and applied load f(u. The equivalence transformations are constructed to simplify the determining equations for the symmetries. The principal algebra is one-dimensional and it extends to two- and three-dimensional algebras for an arbitrary applied load, general power-law, exponential, and log type of applied loads for different forms of g(x. For the linear applied load case, we obtain an infinite-dimensional Lie algebra. We recover the Lie symmetry classification results discussed in the literature when g(x is constant with variable applied load f(u. For the general power-law and exponential case the group invariant solutions are derived. The similarity transformations reduce the fourth-order partial differential equation to a fourth-order ordinary differential equation. For the power-law applied load case a compatible initial-boundary value problem for the clamped and free end beam cases is formulated. We deduce the fourth-order ordinary differential equation with appropriate initial and boundary conditions.

A cool-temperate young larch plantation as a net methane source - A 4-year continuous hyperbolic relaxed eddy accumulation and chamber measurements

Science.gov (United States)

Ueyama, Masahito; Yoshikawa, Kota; Takagi, Kentaro

2018-07-01

Upland forests are thought to be methane (CH4) sinks due to oxidation by methanotrophs in aerobic soils. However, CH4 budget for upland forests are not well quantified at the ecosystem scale, when possible CH4 sources, such as small wet areas, exists in the ecosystem. Here, we quantified CH4 fluxes in a cool-temperate larch plantation based on four-year continuous measurements using the hyperbolic relaxed eddy accumulation (HREA) method and dynamic closed chambers with a laser-based analyzer. After filling data gaps for half-hourly data using machine-learning-based regressions, we found that the forest acted as a net CH4 source at the canopy scale: 30 ± 11 mg CH4 m-2 yr-1 in 2014, 56 ± 8 mg CH4 m-2 yr-1 in 2015, 154 ± 5 mg CH4 m-2 yr-1 in 2016, and 132 ± 6 mg CH4 m-2 yr-1 in 2017. Hotspot emissions from the edge of the pond could strongly contribute to the canopy-scale emissions. The magnitude of the hotspot emissions was 10-100 times greater than the order of the canopy-scale and chamber-based CH4 fluxes at the dry soils. The high temperatures with wet conditions stimulated the hotspot emissions, and thus induced canopy-scale CH4 emissions in the summer. Understanding and modeling the dynamics of hotspot emissions are important for quantifying CH4 budgets of upland forests. Micrometeorological measurements at various forests are required for revisiting CH4 budget of upland forests.

Radiological protection on interstitial brachytherapy and dose determination and exposure rate of an Ir-192 source through the MCNP-4B

International Nuclear Information System (INIS)

Morales L, M.E.

2006-01-01

The present work was carried out in the Neurological Sciences Institute having as objective to determine the dose and the rate of exhibition of the sources of Iridium 192, Iodine 125 and Palladium 103; which are used to carry out implant in the Interstitial Brachytherapy according to the TG43. For it we carry out a theoretical calculation, its are defined in the enter file: the geometry, materials of the problem and the radiation source, etc; in the MCNP-4B Monte Carlo code, considering a punctual source and for the dose determination we simulate thermoluminescent dosemeters (TLD): at 5 cm, 50 cm, 100 cm and 200 cm of the source. Our purpose is to analyze the radioprotection measures that should take into account in this Institute in which are carried out brain biopsies using a Micro mar stereotactic mark, and in a near future with the collaboration of a doctor and a cuban physique seeks to be carried out the Interstitial Brachytherapy technique with sources of Ir-192 for patient with tumors like glioblastoma, astrocytoma, etc. (Author)

Rare-Earth Oxide Ion (Tm3+, Ho3+, and U3+) Doped Glasses and Fibres for 1.8 to 4 Micrometer Coherent and Broadband Sources

Science.gov (United States)

2006-07-24

oxide ( TeO2 ) , fluorine- containing silicate (SiOF2) and germanate (GeOF2) glass hosts for each dopant by characterising the spectroscopic properties...Earth Oxide Ion (Tm3+, Ho3+, And U3+) Doped Glasses And Fibres For 1.8 To 4 Micrometer Coherent And Broadband Sources 5c. PROGRAM ELEMENT NUMBER 5d...Rare-earth oxide ion (Tm3+, Ho3+, and U3+) doped glasses and fibres for 1.8 to 4 micrometer coherent and broadband sources Report prepared

Tolerance of centrifuge-simulated suborbital spaceflight in subjects with implanted insulin pumps.

Science.gov (United States)

Levin, Dana R; Blue, Rebecca S; Castleberry, Tarah L; Vanderploeg, James M

2015-04-01

With commercial spaceflight comes the possibility of spaceflight participants (SFPs) with significant medical conditions. Those with previously untested medical conditions, such as diabetes mellitus (DM) and the use of indwelling medical devices, represent a unique challenge. It is unclear how SFPs with such devices will react to the stresses of spaceflight. This case report describes two subjects with Type I DM using insulin pumps who underwent simulated dynamic phases of spaceflight via centrifuge G force exposure. Two Type I diabetic subjects with indwelling Humalog insulin pumps, a 23-yr-old man averaging 50 u of Humalog daily and a 27-yr-old man averaging 60 u of Humalog daily, underwent seven centrifuge runs over 48 h. Day 1 consisted of two +Gz runs (peak = +3.5 Gz, run 2) and two +Gx runs (peak = +6.0 Gx, run 4). Day 2 consisted of three runs approximating suborbital spaceflight profiles (combined +Gx and +Gz). Data collected included blood pressure, electrocardiogram, pulse oximetry, neurovestibular evaluation, and questionnaires regarding motion sickness, disorientation, greyout, and other symptoms. Neither subject experienced adverse clinical responses to the centrifuge exposure. Both maintained blood glucose levels between 110-206 mg · dl(-1). Potential risks to SFPs with insulin pump dependent DM include hypo/hyperglycemia, pump damage, neurovestibular dysfunction, skin breakdown, and abnormal stress responses. A search of prior literature did not reveal any previous studies of individuals with DM on insulin pumps exposed to prolonged accelerations. These cases suggest that individuals with conditions dependent on continuous medication delivery might tolerate the accelerations anticipated for commercial spaceflight.

Centrifuge-simulated suborbital spaceflight in subjects with cardiac implanted devices.

Science.gov (United States)

Blue, Rebecca S; Reyes, David P; Castleberry, Tarah L; Vanderploeg, James M

2015-04-01

Future commercial spaceflight participants (SFPs) with conditions requiring personal medical devices represent a unique challenge. The behavior under stress of cardiac implanted devices (CIDs) such as pacemakers is of special concern. No known data currently exist on how such devices may react to the stresses of spaceflight. We examined the responses of two volunteer subjects with CIDs to G forces in a centrifuge to evaluate how similar potential commercial SFPs might tolerate the forces of spaceflight. Two subjects, 75- and 79-yr-old men with histories of atrial fibrillation and implanted dual-lead, rate-responsive pacemakers, underwent seven centrifuge runs over 2 d. Day 1 consisted of two +Gz runs (peak = +3.5 Gz, run 2) and two +Gx runs (peak = +6.0 Gx, run 4). Day 2 consisted of three runs approximating suborbital spaceflight profiles (combined +Gx/+Gz). Data collected included blood pressures, electrocardiograms, pulse oximetry, neurovestibular exams, and postrun questionnaires regarding motion sickness, disorientation, greyout, and other symptoms. Despite both subjects' significant medical histories, neither had abnormal physiological responses. Post-spin analysis demonstrated no lead displacement, damage, or malfunction of either CID. Potential risks to SFPs with CIDs include increased arrhythmogenesis, lead displacement, and device damage. There are no known prior studies of individuals with CIDs exposed to accelerations anticipated during the dynamic phases of suborbital spaceflight. These cases demonstrate that even individuals with significant medical histories and implanted devices can tolerate the acceleration exposures of commercial spaceflight. Further investigation will determine which personal medical devices present significant risks during suborbital flight and beyond.

A Neutron Diffraction Study of the Nuclear and Magnetic Structure of MnNb2O6

DEFF Research Database (Denmark)

Nielsen, Oliver Vindex; Lebech, Bente; Krebs Larsen, F.

1976-01-01

A neutron diffraction study was made of the nuclear and the magnetic structure of MnNb2O6 single crystals. The thirteen nuclear parameters (space group Pbcn) were determined from 304 reflections at room temperature. The antiferromagnetic structure (Neel temperature=4.4K), determined at 1.2K, is a......, is a superposition of G- and A-type structures of the form 0.90 Gx+0.34 Gy+0.28 Az. The corresponding magnetic space group is P2'1/c....

26 CFR 1.857-4 - Tax imposed by reason of the failure to meet certain source-of-income requirements.

Science.gov (United States)

2010-04-01

..., DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Real Estate Investment Trusts § 1.857-4 Tax imposed by reason of the failure to meet certain source-of-income requirements. Section 857... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Tax imposed by reason of the failure to meet...

The ARC-EN-CIEL French 4th Generation Light Source

International Nuclear Information System (INIS)

Bruni, C.; Couprie, M. E.; Chubar, O.; Loulergue, A.; Nahon, L.; Carre, B.; Garzella, D.; Labat, M.; Lambert, G.; Monot, P.; Jablonka, M.; Meot, F.; Mosnier, A.; Marques, J. R.; Ortega, J. M.; Nutarelli, D.

2007-01-01

ARC-EN-CIEL (Accelerator-Radiation Complex for Enhanced Coherent Intense Extended Light) proposal is based on a CW 1 GeV superconducting linear accelerator delivering high charge, subpicosecond, low emittance electron bunches with a high repetition rate (1 kHz). The FEL uses High Harmonics Generation in gases in a High Gain Harmonic Generation scheme, leading to a rather compact solution. The radiation extends down to 0.8 nm with the non-linear harmonics and reproduces the good longitudinal and transverse coherence of the harmonics generated in gas. Optional beam loops, foreseen to increase the beam current or the energy, will accommodate infrared CSR source, femtosecond undulator sources in the VUV and X-ray ranges, and a FEL oscillator in the 10 nm range. An important synergy is expected between accelerator and laser communities, in particular for electron plasma acceleration tests

Monte Carlo simulations of the detailed iron absorption line profiles from thermal winds in X-ray binaries

Science.gov (United States)

Tomaru, Ryota; Done, Chris; Odaka, Hirokazu; Watanabe, Shin; Takahashi, Tadayuki

2018-05-01

Blueshifted absorption lines from highly ionized iron are seen in some high inclination X-ray binary systems, indicating the presence of an equatorial disc wind. This launch mechanism is under debate, but thermal driving should be ubiquitous. X-ray irradiation from the central source heats disc surface, forming a wind from the outer disc where the local escape velocity is lower than the sound speed. The mass-loss rate from each part of the disc is determined by the luminosity and spectral shape of the central source. We use these together with an assumed density and velocity structure of the wind to predict the column density and ionization state, then combine this with a Monte Carlo radiation transfer to predict the detailed shape of the absorption (and emission) line profiles. We test this on the persistent wind seen in the bright neutron star binary GX 13+1, with luminosity L/LEdd ˜ 0.5. We approximately include the effect of radiation pressure because of high luminosity, and compute line features. We compare these to the highest resolution data, the Chandra third-order grating spectra, which we show here for the first time. This is the first physical model for the wind in this system, and it succeeds in reproducing many of the features seen in the data, showing that the wind in GX13+1 is most likely a thermal-radiation driven wind. This approach, combined with better streamline structures derived from full radiation hydrodynamic simulations, will allow future calorimeter data to explore the detail wind structure.

MicroRNA expression changes during human leukemic HL-60 cell differentiation induced by 4-hydroxynonenal, a product of lipid peroxidation.

Science.gov (United States)

Pizzimenti, Stefania; Ferracin, Manuela; Sabbioni, Silvia; Toaldo, Cristina; Pettazzoni, Piergiorgio; Dianzani, Mario Umberto; Negrini, Massimo; Barrera, Giuseppina

2009-01-15

4-Hydroxynonenal (HNE) is one of several lipid oxidation products that may have an impact on human pathophysiology. It is an important second messenger involved in the regulation of various cellular processes and exhibits antiproliferative and differentiative properties in various tumor cell lines. The mechanisms by which HNE affects cell growth and differentiation are only partially clarified. Because microRNAs (miRNAs) have the ability to regulate several cellular processes, we hypothesized that HNE, in addition to other mechanisms, could affect miRNA expression. Here, we present the results of a genome-wide miRNA expression profiling of HNE-treated HL-60 leukemic cells. Among 470 human miRNAs, 10 were found to be differentially expressed between control and HNE-treated cells (at p<0.05). Six miRNAs were down-regulated (miR-181a*, miR-199b, miR-202, miR-378, miR-454-3p, miR-575) and 4 were up-regulated (miR-125a, miR-339, miR-663, miR-660). Three of these regulated miRNAs (miR-202, miR-339, miR-378) were further assayed and validated by quantitative real-time RT-PCR. Moreover, consistent with the down-regulation of miR-378, HNE also induced the expression of the SUFU protein, a tumor suppressor recently identified as a target of miR-378. The finding that HNE could regulate the expression of miRNAs and their targets opens new perspectives on the understanding of HNE-controlled pathways. A functional analysis of 191 putative gene targets of miRNAs modulated by HNE is discussed.

Determination of discharge parameters via OES at the Linac4 H− ion source

International Nuclear Information System (INIS)

Briefi, S.; Fink, D.; Mattei, S.; Lettry, J.; Fantz, U.

2016-01-01

Optical emission spectroscopy (OES) measurements of the atomic Balmer series and the molecular Fulcher transition have been carried out at the Linac4 ion source in order to determine plasma parameters. As the spectroscopic system was only relatively calibrated, the data evaluation only yielded rough estimates of the plasma parameters (T e ≈ 1.2 eV, n e ≈ 1 × 10 19 m −3 , and n H /n H 2 ≈ 0.5 at standard operational parameters). The analysis of the Fulcher transition revealed a non-thermal “hockey-stick” rotational population of the hydrogen molecules. At varying RF power, the measurements at the on-axis line of sight (LOS) showed a peak in the rotational temperatures between 25 and 40 kW of RF power, whereas a steady decrease with power was observed at a tilted LOS, indicating the presence of strong plasma parameter gradients

Investigation of Anisotropy Caused by Cylinder Applicator on Dose Distribution around Cs-137 Brachytherapy Source using MCNP4C Code

Directory of Open Access Journals (Sweden)

Sedigheh Sina

2011-06-01

Full Text Available Introduction: Brachytherapy is a type of radiotherapy in which radioactive sources are used in proximity of tumors normally for treatment of malignancies in the head, prostate and cervix. Materials and Methods: The Cs-137 Selectron source is a low-dose-rate (LDR brachytherapy source used in a remote afterloading system for treatment of different cancers. This system uses active and inactive spherical sources of 2.5 mm diameter, which can be used in different configurations inside the applicator to obtain different dose distributions. In this study, first the dose distribution at different distances from the source was obtained around a single pellet inside the applicator in a water phantom using the MCNP4C Monte Carlo code. The simulations were then repeated for six active pellets in the applicator and for six point sources.  Results: The anisotropy of dose distribution due to the presence of the applicator was obtained by division of dose at each distance and angle to the dose at the same distance and angle of 90 degrees. According to the results, the doses decreased towards the applicator tips. For example, for points at the distances of 5 and 7 cm from the source and angle of 165 degrees, such discrepancies reached 5.8% and 5.1%, respectively.  By increasing the number of pellets to six, these values reached 30% for the angle of 5 degrees. Discussion and Conclusion: The results indicate that the presence of the applicator causes a significant dose decrease at the tip of the applicator compared with the dose in the transverse plane. However, the treatment planning systems consider an isotropic dose distribution around the source and this causes significant errors in treatment planning, which are not negligible, especially for a large number of sources inside the applicator.

Coccolith concentrations in the Gulf of Cadiz at the IODP Site U1390 (Exp 339), in the last ~20,000 years

Science.gov (United States)

Angulo, M.; Balestra, B.

2013-12-01

Our project is dedicated to the study of sediment samples gathered from the Gulf of Cadiz during the Integrated Ocean Drilling Project (IODP), Expedition 339 at Site U1390. The Gulf of Cadiz is an area of the Atlantic Ocean located directly south of Portugal and the western end of the Strait of Gibraltar. We analyzed the sediment samples to obtain the numbers of coccoliths per gram of sediment in each sample. Coccolithophores (from which the coccoliths are the fossils that remain in the sediments) are one of the most abundant groups of living phytoplankton and they are significant components of marine sediment. In order to prepare our samples for counting (the process by which we determined the number of coccoliths in our samples) we utilized about 23 samples from the uppermost 17 meters of the sediment core. This process involved collecting subsamples of each individual sample and then oven drying them. Then we weighted them by utilizing a microbalance to collect the desired amount of sample we needed (between 2 and 4 mg). Several of our samples were slightly below and above this desired amount due to human error. Once we gathered the desired amount of samples for our project, we proceeded to use a filtration system to obtain filters. Then we put the filters into an oven to dry them. After the samples were dried over the course of a day, we proceeded to prepare them for viewing through the microscope. To do this, we cut the filter and placed it upon a microscope slide. Then, we applied oil to the slide, cover and placed it under the Light Microscope (LM). We looked at five different views in each filters under the microscope, counting the number of coccoliths in each view. The counting has been expressed in terms of numbers of coccoliths per gram of sediment (total coccolith concentration). Our results showed us that the amount of coccoliths in the sediment samples receded during the cold periods of time, such as an ice age, and fluctuated in an upward pattern as

Parallel and series 4 switch Z-source converters in induction motor drives

DEFF Research Database (Denmark)

Baba, Mircea; Lascu, Cristian; Boldea, Ion

2014-01-01

This paper presents a control strategy for four switch three-phase Z-source Inverter with parallel and series Z-source network fed 0.5 kW induction motor drive with V/f control and the algorithm to control the dc boost, split capacitor voltage balance and the ac output voltage. The proposed control...... algorithm is validated through simulation and experiment....

Full-length genome sequence analysis of an avian leukosis virus subgroup J (ALV-J) as contaminant in live poultry vaccine: The commercial live vaccines might be a potential route for ALV-J transmission.

Science.gov (United States)

Wang, P; Lin, L; Li, H; Shi, M; Gu, Z; Wei, P

2018-02-25

One avian leukosis virus subgroup J (ALV-J) strain was isolated from 67 commercial live poultry vaccines produced by various manufacturers during 2013-2016 in China. The complete genomes of the isolate were sequenced and it was found that the genes gag and pol of the strain were relatively conservative, while the gp85 gene of the strain GX14YYA1 had the highest similarities with a field strain GX14ZS14, which was isolated from the chickens of a farm that had once used the same vaccine as the one found to be contaminated with the GX14YYA1. This is the first report of ALV-J contaminant in live poultry vaccine in China. Our finding demonstrates that vaccination of the commercial live vaccines might be a potential new route for ALV-J transmission in chickens and highlights the need for more extensive monitoring of the commercial live vaccines in China. © 2018 Blackwell Verlag GmbH.

Calculations with the quasirelativistic local-spin-density-functional theory for high-Z atoms

International Nuclear Information System (INIS)

Guo, Y.; Whitehead, M.A.

1988-01-01

The generalized-exchange local-spin-density-functional theory (LSD-GX) with relativistic corrections of the mass velocity and Darwin terms has been used to calculate statistical total energies for the neutral atoms, the positive ions, and the negative ions for high-Z elements. The effect of the correlation and relaxation correction on the statistical total energy is discussed. Comparing the calculated results for the ionization potentials and electron affinities for the atoms (atomic number Z from 37 to 56 and 72 to 80) with experiment, shows that for the atoms rubidium to barium both the LSD-GX and the quasirelativistic LSD-GX, with self-interaction correction, Gopinathan, Whitehead, and Bogdanovic's Fermi-hole parameters [Phys. Rev. A 14, 1 (1976)], and Vosko, Wilk, and Nusair's correlation correction [Can. J. Phys. 58, 1200 (1980)], are very good methods for calculating ionization potentials and electron affinities. For the atoms hafnium to mercury the relativistic effect has to be considered

Parental divorce and disordered eating: an investigation of a gene-environment interaction.

Science.gov (United States)

Suisman, Jessica L; Burt, S Alexandra; McGue, Matt; Iacono, William G; Klump, Kelly L

2011-03-01

We investigated gene-environment interactions (GxE) for associations between parental divorce and disordered eating (DE). Participants were 1,810 female twins from the Michigan State University Twin Registry and the Minnesota Twin Family Study. The Minnesota Eating Behaviors Survey was used to assess DE. We tested for GxE by comparing the heritability of DE in twins from divorced versus intact families. It was hypothesized that divorce would moderate the heritability of DE, in that heritability would be higher in twins from divorced than twins from intact families. As expected, the heritability of body dissatisfaction was significantly higher in twins from divorced than intact families. However, genetic influences were equal in twins from divorced and intact families for all other forms of DE. Although divorce did not moderate heritability of most DE symptoms, future research should replicate GxEs for body dissatisfaction and identify factors underlying this unique relationship. Copyright © 2010 Wiley Periodicals, Inc.

Interaction of CD38 Variant and Chronic Interpersonal Stress Prospectively Predicts Social Anxiety and Depression Symptoms Over Six Years

Science.gov (United States)

Tabak, Benjamin A.; Vrshek-Schallhorn, Suzanne; Zinbarg, Richard E.; Prenoveau, Jason M.; Mineka, Susan; Redei, Eva E.; Adam, Emma K.; Craske, Michelle G.

2015-01-01

Variation in the CD38 gene, which regulates secretion of the neuropeptide oxytocin, has been associated with several social phenotypes. Specifically, rs3796863 A allele carriers have demonstrated increased social sensitivity. In 400 older adolescents, we used trait-state-occasion modeling to investigate how rs3796863 genotype, baseline ratings of chronic interpersonal stress, and their gene-environment (GxE) interaction predicted trait social anxiety and depression symptoms over six years. We found significant GxE effects for CD38 A-carrier genotypes and chronic interpersonal stress at baseline predicting greater social anxiety and depression symptoms. A significant GxE effect of smaller magnitude was also found for C/C genotype and chronic interpersonal stress predicting greater depression; however, this effect was small compared to the main effect of chronic interpersonal stress. Thus, in the context of chronic interpersonal stress, heightened social sensitivity associated with the rs3796863 A allele may prospectively predict risk for social anxiety and (to a lesser extent) depression. PMID:26958455

Properties of neutron sources

International Nuclear Information System (INIS)

1987-03-01

The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

Open-source implementation of an algorithm for photopeaks search and analysis in gamma-ray spectrometry with semiconductor detectors

International Nuclear Information System (INIS)

Maduar, Marcelo F.; Pecequilo, Brigitte R.S.

2009-01-01

Radioactivity quantification of gamma-ray emitter radionuclides in samples measured by HPGe gamma spectrometers relies on the analysis of the photopeaks present in the spectra, especially on the accurate determination of their net areas. This paper presents a methodology and an algorithm description for the peak search and analysis in order to obtain the relevant peaks parameters and their uncertainties. The procedure is performed on a three step approach: a preliminary search is done by using the second-difference method; experimental peaks widths are assessed in order to obtain a width vs. channel relationship and to define regions with single or overlapping peaks; a non-linear fit is applied to each region of the spectrum with candidate peaks. The final target function is in the form G(x) = B(x) + F(x), where B(x) is the baseline composed by a sum of a weighed left-side B L (x) and right-side B R (x) base-line quadratic functions and the photopeaks term F(x) is a sum of Gaussian functions. The computational implementation is released entirely in open-source license. The code was developed in C++ language and the interface was developed with Qt GUI software toolkit. GNU scientific library, GSL, was employed to perform linear and non-linear fitting procedures as needed. Spectra previously generated at our laboratories were analyzed with the presented methodology and with the commercial software package WinnerGamma. Results obtained are consistent with those obtained with the aforementioned package, suggesting that it could be safely used in general-purpose gamma-ray spectrometry. (author)

ZnCl{sub 2}- and NH{sub 4}Cl-hydroponics gel electrolytes for zinc-carbon batteries

Energy Technology Data Exchange (ETDEWEB)

Khalid, N.H.; Ismail, Y.M. Baba; Mohamad, A.A. [School of Materials and Mineral Resources Engineering, Universiti Sains Malaysia, 14300 Nibong Tebal, Penang (Malaysia)

2008-01-21

Absorbency testing is used to determine the percentage of ZnCl{sub 2} or NH{sub 4}Cl solution absorbed by a hydroponics gel (HPG). It is found that the absorbency of ZnCl{sub 2} or NH{sub 4}Cl solution decreases with increasing solution concentration. The conductivity of ZnCl{sub 2}- and NH{sub 4}Cl-HPG electrolytes is dependent on the solution concentration. A mixture of salt solution with HPG yields excellent gel polymer electrolytes with conductivities of 0.026 and 0.104 S cm{sup -1} at 3 M ZnCl{sub 2} and 7 M NH{sub 4}Cl, respectively. These gel electrolytes are then used to produce zinc-carbon cells. The fabricated cells give capacities of 8.8 and 10.0 mAh, have an internal resistance of 25.4 and 19.8 {omega}, a maximum power density of 12.7 and 12.2 mW cm{sup -2}, and a short-circuit current density of 29.1 and 33.9 mA cm{sup -2} for ZnCl{sub 2}- and NH{sub 4}Cl-HPG electrolytes, respectively. (author)

The wave equation in Friedmann-Robertson-Walker space-times and asymptotics of the intensity and distance relationship of a localised source

Science.gov (United States)

Starko, Darij; Craig, Walter

2018-04-01

Variations in redshift measurements of Type 1a supernovae and intensity observations from large sky surveys are an indicator of a component of acceleration in the rate of expansion of space-time. A key factor in the measurements is the intensity-distance relation for Maxwell's equations in Friedmann-Robertson-Walker (FRW) space-times. In view of future measurements of the decay of other fields on astronomical time and spatial scales, we determine the asymptotic behavior of the intensity-distance relationship for the solution of the wave equation in space-times with an FRW metric. This builds on previous work done on initial value problems for the wave equation in FRW space-time [Abbasi, B. and Craig, W., Proc. R. Soc. London, Ser. A 470, 20140361 (2014)]. In this paper, we focus on the precise intensity decay rates of the special cases for curvature k = 0 and k = -1, as well as giving a general derivation of the wave solution for -∞ 0} where t0 represents the time of an initial emission source, relative to the Big Bang singularity at t = 0. The initial data [g(x), h(x)] are assumed to be compactly supported; supp(g, h) ⊆ BR(0) and terms in the expression for the fundamental solution for the wave equation with the slowest decay rate are retained. The intensities calculated for coordinate time {t : t > 0} contain correction terms proportional to the ratio of t0 and the time differences ρ = t - t0. For the case of general curvature k, these expressions for the intensity reduce by scaling to the same form as for k = -1, from which we deduce the general formula. We note that for typical astronomical events such as Type 1a supernovae, the first order correction term for all curvatures -∞ < k < 0 is on the order of 10-4 smaller than the zeroth order term. These correction terms are small but may be significant in applications to alternative observations of cosmological space-time expansion rates.

Communicating Science to Impact Learning? A Phenomenological Inquiry into 4th and 5th Graders' Perceptions of Science Information Sources

Science.gov (United States)

Gelmez Burakgazi, Sevinc; Yildirim, Ali; Weeth Feinstein, Noah

2016-01-01

Rooted in science education and science communication studies, this study examines 4th and 5th grade students' perceptions of science information sources (SIS) and their use in communicating science to students. It combines situated learning theory with uses and gratifications theory in a qualitative phenomenological analysis. Data were gathered…

Radial dose functions for 103Pd, 125I, 169Yb and 192Ir brachytherapy sources: an EGS4 Monte Carlo study

International Nuclear Information System (INIS)

Mainegra, E.

2000-01-01

Radial dose functions g(r) in water around 103 Pd, 125 I, 169 Yb and 192 Ir brachytherapy sources were estimated by means of the EGS4 simulation system and extensively compared with experimental as well as with theoretical results. The DLC-136/PHOTX cross section library, water molecular form factors, bound Compton scattering and Doppler broadening of the Compton-scattered photon energy were considered in the calculations. Use of the point source approach produces reasonably accurate values of the radial dose function only at distances beyond 0.5 cm for 103 Pd sources. It is shown that binding corrections for Compton scattering have a negligible effect on radial dose function for 169 Yb and 192 Ir seeds and for 103 Pd seeds under 5.0 cm from the source centre and for the 125 I seed model 6702 under 8.0 cm. Beyond those limits there is an increasing influence of binding corrections on radial dose function for 103 Pd and 125 I sources. Results in solid water medium underestimate radial dose function for low-energy sources by as much as 6% for 103 Pd and 2.5% for 125 I already at 2 cm from source centre resulting in a direct underestimation of absolute dose rate values. It was found necessary to consider medium boundaries when comparing results for the radial dose function of 169 Yb and 192 Ir sources to avoid discrepancies due to the backscattering contribution in the phantom medium. Values of g(r) for all source types studied are presented. Uncertainties lie under 1% within one standard deviation. (author)

Validation of a virtual source model of medical linac for Monte Carlo dose calculation using multi-threaded Geant4

Science.gov (United States)

Aboulbanine, Zakaria; El Khayati, Naïma

2018-04-01

The use of phase space in medical linear accelerator Monte Carlo (MC) simulations significantly improves the execution time and leads to results comparable to those obtained from full calculations. The classical representation of phase space stores directly the information of millions of particles, producing bulky files. This paper presents a virtual source model (VSM) based on a reconstruction algorithm, taking as input a compressed file of roughly 800 kb derived from phase space data freely available in the International Atomic Energy Agency (IAEA) database. This VSM includes two main components; primary and scattered particle sources, with a specific reconstruction method developed for each. Energy spectra and other relevant variables were extracted from IAEA phase space and stored in the input description data file for both sources. The VSM was validated for three photon beams: Elekta Precise 6 MV/10 MV and a Varian TrueBeam 6 MV. Extensive calculations in water and comparisons between dose distributions of the VSM and IAEA phase space were performed to estimate the VSM precision. The Geant4 MC toolkit in multi-threaded mode (Geant4-[mt]) was used for fast dose calculations and optimized memory use. Four field configurations were chosen for dose calculation validation to test field size and symmetry effects, , , and for squared fields, and for an asymmetric rectangular field. Good agreement in terms of formalism, for 3%/3 mm and 2%/3 mm criteria, for each evaluated radiation field and photon beam was obtained within a computation time of 60 h on a single WorkStation for a 3 mm voxel matrix. Analyzing the VSM’s precision in high dose gradient regions, using the distance to agreement concept (DTA), showed also satisfactory results. In all investigated cases, the mean DTA was less than 1 mm in build-up and penumbra regions. In regards to calculation efficiency, the event processing speed is six times faster using Geant4-[mt] compared to sequential

Advanced neutron source project

International Nuclear Information System (INIS)

Gorynina, L.V.; Proskuryakov, S.F.; Tishchenko, V.A.; Uzhanova, V.V.

1991-01-01

The project of the ANS improved neutron source intended for fundamental researches in nuclear physics and materials testing is considered. New superhigh-flux heavy-water 350 MW reactor is used for the source creation. The standard fuel is uranium silicide (U 3 Si 2 ). Reactor core volume equals 67.4 l and average power density is 4.9 MW/l. Neutron flux density is 10 16 neutron/(cm 2 xs). The facility construction begin is planned for 1996. The first experiments should be accomplished in 2000

Estimates of genetics and phenotypics parameters for the yield and quality of soybean seeds.

Science.gov (United States)

Zambiazzi, E V; Bruzi, A T; Guilherme, S R; Pereira, D R; Lima, J G; Zuffo, A M; Ribeiro, F O; Mendes, A E S; Godinho, S H M; Carvalho, M L M

2017-09-27

Estimating genotype x environment (GxE) parameters for quality and yield in soybean seed grown in different environments in Minas Gerais State was the goal of this study, as well as to evaluate interaction effects of GxE for soybean seeds yield and quality. Seeds were produced in three locations in Minas Gerais State (Lavras, Inconfidentes, and Patos de Minas) in 2013/14 and 2014/15 seasons. Field experiments were conducted in randomized blocks in a factorial 17 x 6 (GxE), and three replications. Seed yield and quality were evaluated for germination in substrates paper and sand, seedling emergence, speed emergency index, mechanical damage by sodium hypochlorite, electrical conductivity, speed aging, vigor and viability of seeds by tetrazolium test in laboratory using completely randomized design. Quadratic component genotypic, GXE variance component, genotype determination coefficient, genetic variation coefficient and environmental variation coefficient were estimated using the Genes software. Percentage analysis of genotypes contribution, environments and genotype x environment interaction were conducted by sites combination two by two and three sites combination, using the R software. Considering genotypes selection of broad adaptation, TMG 1179 RR, CD 2737 RR, and CD 237 RR associated better yield performance at high physical and physiological potential of seed. Environmental effect was more expressive for most of the characters related to soybean seed quality. GxE interaction effects were expressive though genotypes did not present coincidental behavior in different environments.

OMNIDIRECTIONAL SOUND SOURCE

DEFF Research Database (Denmark)

1996-01-01

A sound source comprising a loudspeaker (6) and a hollow coupler (4) with an open inlet which communicates with and is closed by the loudspeaker (6) and an open outlet, said coupler (4) comprising rigid walls which cannot respond to the sound pressures produced by the loudspeaker (6). According...

Study of the high energy emission of accreting compact objects with SPI/INTEGRAL

International Nuclear Information System (INIS)

Droulans, R.

2011-01-01

The study of the high energy emission is essential for understanding the radiative processes inherent to accretion flows onto compact objects (black holes and neutron stars). The X/γ-ray continuum of these systems is successfully interpreted in terms of two components. The first component corresponds to blackbody emission from a geometrically thin optically thick accretion disk while the second component is generally associated to Compton scattering of the thermal disk flux off hot electrons. Despite considerable advances throughout the years, the heating mechanisms as well as the structure of the hot Comptonizing plasma remain poorly understood. In order to shed light on the physical processes that govern the innermost regions of the accretion flow, we take advantage of the data archive accumulated by the SPI instrument, a high energy spectrometer (20 keV - 8 MeV) developed at the CESR (now IRAP, Toulouse, France) for the INTEGRAL mission. Above 150 keV, SPI combines a unique spectral resolution with unequalled sensitivity, being thus an ideal tool to study the high energy emission of accreting compact objects. The thesis manuscript reports on the results of timing and spectral studies of three particular systems. First, I address the high energy emission of the enigmatic micro-quasar GRS 1915+105, a source characterized by colossal luminosity and strong chaotic variability in X-rays. On a timescale of about one day, the photon index of the 20 - 200 keV spectrum varies between 2.7 and 3.5; at higher energies (≥150 keV), SPI unveils the systematic presence of an additional emission component, extending without folding energy up to ∼ 500 keV. Second, I study the high energy emission of GX 339-4, a source whose spectral properties are representative of black hole transients. The spectrum of the luminous hard state of this system shows a variable high energy tail (≥150 keV), with significant flux changes on a short timescale (several hours). I explain the

SOFTWARE OPEN SOURCE, SOFTWARE GRATIS?

Directory of Open Access Journals (Sweden)

Nur Aini Rakhmawati

2006-01-01

Full Text Available Normal 0 false false false IN X-NONE X-NONE MicrosoftInternetExplorer4 Berlakunya Undang – undang Hak Atas Kekayaan Intelektual (HAKI, memunculkan suatu alternatif baru untuk menggunakan software open source. Penggunaan software open source menyebar seiring dengan isu global pada Information Communication Technology (ICT saat ini. Beberapa organisasi dan perusahaan mulai menjadikan software open source sebagai pertimbangan. Banyak konsep mengenai software open source ini. Mulai dari software yang gratis sampai software tidak berlisensi. Tidak sepenuhnya isu software open source benar, untuk itu perlu dikenalkan konsep software open source mulai dari sejarah, lisensi dan bagaimana cara memilih lisensi, serta pertimbangan dalam memilih software open source yang ada. Kata kunci :Lisensi, Open Source, HAKI

Zhou et al., Afr J Tradit Complement Altern Med. (2010) 7(4):339-349

African Journals Online (AJOL)

USER

Thirdly, pharmacokinetics analysis of Scutellaria baicalensis and Curcuma .... All the plasma samples were stored at −20°C until analysis. ... After centrifugation at 3,000 rpm for 10 min, the supernatant was filtered through a 0.45 μm membrane filter unit. ..... traditional Chinese herbs and vegetables for chemoprevention.

The SLC polarized electron source

International Nuclear Information System (INIS)

Clendenin, J.E.

1990-10-01

A polarized electron source consisting of a 3-electrode photocathode gun and a flashlamp-pumped dye laser has been designed and built for the SLC and is currently undergoing commissioning. The source is described, and the operating configuration is discussed. The present status of the source and future plans are briefly indicated. 7 refs., 4 figs

[The spectra of a laser-produced plasma source with CO2, O2 and CF4 liquid aerosol spray target].

Science.gov (United States)

Ni, Qi-Liang; Chen, Bo

2008-11-01

A laser-produced plasma (LPP) source with liquid aerosol spray target and nanosecond laser was developed, based on both soft X-ray radiation metrology and extreme ultraviolet projection lithography (EUVL). The LPP source is composed of a stainless steel solenoid valve whose temperature can be continuously controlled, a Nd : YAG laser with pulse width, working wavelength and pulse energy being 7 ns, 1.064 microm and 1J respectively, and a pulse generator which can synchronously control the valve and the laser. A standard General Valve Corporation series 99 stainless steel solenoid valve with copper gasket seals and a Kel-F poppet are used in order to minimize leakage and poppet deformation during high-pressure cryogenic operation. A close fitting copper cooling jacket surrounds the valve body. The jacket clamps a copper coolant carrying tube 3 mm in diameter, which is fed by an automatically pressurized liquid nitrogen-filled dewar. The valve temperature can be controlled between 77 and 473 K. For sufficiently high backing pressure and low temperature, the valve reservoir gas can undergo a gas-to-liquid phase transition. Upon valve pulsing, the liquid is ejected into a vacuum and breaks up into droplets, which is called liquid aerosol spray target. For the above-mentioned LPP source, firstly, by the use of Cowan program on the basis of non-relativistic quantum mechanics, the authors computed the radiative transition wavelengths and probabilities in soft X-ray region for O4+, O5+, O6+, O7+, F5+, F6+ and F7+ ions which were correspondingly produced from the interaction of the 10(11)-10(12) W x cm(-2) power laser with liquid O2, CO2 and CF4 aerosol spray targets. Secondly, the authors measured the spectra of liquid O2, CO2 and CF4 aerosol spray target LPP sources in the 6-20 nm band for the 8 x 10(11) W x cm(-2) laser irradiance. The measured results were compared with the Cowan calculated results ones, and the radiative transition wavelength and probability for the

Effects of carbon source and carbon content on electrochemical performances of Li{sub 4}Ti{sub 5}O{sub 12}/C prepared by one-step solid-state reaction

Energy Technology Data Exchange (ETDEWEB)

Hu Xuebu [College of Chemistry and Materials Science, Sichuan Normal University, Chengdu, Sichuan 610066 (China); Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu, Sichuan 610041 (China); Lin Ziji [China National Quality Supervision and Inspection Center for Alcoholic Beverage Products and Processed Food, Luzhou, Sichuan 646100 (China); Yang Kerun [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu, Sichuan 610041 (China); Hua, Yongjian [China Aviation Lithium Battery Co. Ltd., Luoyang, Henan 471009 (China); Deng Zhenghua, E-mail: zhdeng@cioc.ac.cn [Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu, Sichuan 610041 (China)

2011-05-30

Highlights: > A simple route to prepare the Li{sub 4}Ti{sub 5}O{sub 12}/C by one-step solid-state reaction. > Carbon source and carbon content are two important factors on the electrochemical performances of Li{sub 4}Ti{sub 5}O{sub 12}/C. > As-prepared Li{sub 4}Ti{sub 5}O{sub 12}/C under optimized conditions shows excellent electrochemical performances. - Abstract: Li{sub 4}Ti{sub 5}O{sub 12}/C composites were synthesized by one-step solid-state reaction method using four commonly used organic compounds or organic polymers as carbon source, i.e., polyacrylate acid (PAA), citric acid (CA), maleic acid (MA) and polyvinyl alcohol (PVA). The physical characteristics of Li{sub 4}Ti{sub 5}O{sub 12}/C composites were investigated by X-ray diffraction, electron microscopy, Raman spectroscopy, particle size distribution and thermogravimetry-derivative thermogravimetry techniques. Their electrochemical properties were characterized by cyclic voltammograms, electrochemical impedance spectra, constant current charge-discharge and rate charge-discharge. These analyses indicated that the carbon source and carbon content have a great effect on the physical and electrochemical performances of Li{sub 4}Ti{sub 5}O{sub 12}/C composites. An ideal carbon source and appropriate carbon content effectively improved the electrical contact between the Li{sub 4}Ti{sub 5}O{sub 12} particles, which enhanced the discharge capacity and rate capability of Li{sub 4}Ti{sub 5}O{sub 12}/C composites. PAA was the best carbon source for the synthesis of Li{sub 4}Ti{sub 5}O{sub 12}/C composites. When the carbon content was 3.49 wt.% (LiOH.H{sub 2}O/PAA molar ratio of 1), as-prepared Li{sub 4}Ti{sub 5}O{sub 12}/C showed the maximum discharge capacity. At 0.2 C, initial capacity of the optimized sample was 168.6 mAh g{sup -1} with capacity loss of 2.8% after 50 cycles. At 8 and 10 C, it showed discharge capacities of 143.5 and 132.7 mAh g{sup -1}, with capacity loss of 8.7 and 9.9% after 50 cycles

UHE point source survey at Cygnus experiment

International Nuclear Information System (INIS)

Lu, X.; Yodh, G.B.; Alexandreas, D.E.; Allen, R.C.; Berley, D.; Biller, S.D.; Burman, R.L.; Cady, R.; Chang, C.Y.; Dingus, B.L.; Dion, G.M.; Ellsworth, R.W.; Gilra, M.K.; Goodman, J.A.; Haines, T.J.; Hoffman, C.M.; Kwok, P.; Lloyd-Evans, J.; Nagle, D.E.; Potter, M.E.; Sandberg, V.D.; Stark, M.J.; Talaga, R.L.; Vishwanath, P.R.; Zhang, W.

1991-01-01

A new method of searching for UHE point source has been developed. With a data sample of 150 million events, we have surveyed the sky for point sources over 3314 locations (1.4 degree <δ<70.4 degree). It was found that their distribution is consistent with a random fluctuation. In addition, fifty two known potential sources, including pulsars and binary x-ray sources, were studied. The source with the largest positive excess is the Crab Nebula. An excess of 2.5 sigma above the background is observed in a bin of 2.3 degree by 2.5 degree in declination and right ascension respectively

RF H-minus ion source development in China spallation neutron source

Science.gov (United States)

Chen, W.; Ouyang, H.; Xiao, Y.; Liu, S.; Lü, Y.; Cao, X.; Huang, T.; Xue, K.

2017-08-01

China Spallation Neutron Source (CSNS) phase-I project currently uses a Penning surface plasma H- ion source, which has a life time of several weeks with occasional sparks between high voltage electrodes. To extend the life time of the ion source and prepare for the CSNS phase-II, we are trying to develop a RF negative hydrogen ion source with external antenna. The configuration of the source is similar to the DESY external antenna ion source and SNS ion source. However several changes are made to improve the stability and the life time. Firstly, Si3N4 ceramic with high thermal shock resistance, and high thermal conductivity is used for plasma chamber, which can endure an average power of 2000W. Secondly, the water-cooled antenna is brazed on the chamber to improve the energy efficiency. Thirdly, cesium is injected directly to the plasma chamber if necessary, to simplify the design of the converter and the extraction. Area of stainless steel exposed to plasma is minimized to reduce the sputtering and degassing. Instead Mo, Ta, and Pt coated materials are used to face the plasma, which makes the self-cleaning of the source possible.

Shallow Aquifer Methane Gas Source Assessment

Science.gov (United States)

Coffin, R. B.; Murgulet, D.; Rose, P. S.; Hay, R.

2014-12-01

Shale gas can contribute significantly to the world's energy demand. Hydraulic fracturing (fracking) on horizontal drill lines developed over the last 15 years makes formerly inaccessible hydrocarbons economically available. From 2000 to 2035 shale gas is predicted to rise from 1% to 46% of the total natural gas for the US. A vast energy resource is available in the United States. While there is a strong financial advantage to the application of fracking there is emerging concern about environmental impacts to groundwater and air quality from improper shale fracking operations. Elevated methane (CH4) concentrations have been observed in drinking water throughout the United States where there is active horizontal drilling. Horizontal drilling and hydraulic-fracturing can increase CH4 transport to aquifers, soil and the vadose zone. Seepage can also result from casing failure in older wells. However, there is strong evidence that elevated CH4 concentrations can be associated with topographic and hydrogeologic features, rather than shale-gas extraction processes. Carbon isotope geochemistry can be applied to study CH4source(s) in shallow vadose zone and groundwater systems. A preliminary TAMU-CC isotope data set from samples taken at different locations in southern Texas shows a wide range of CH4 signatures suggesting multiple sources of methane and carbon dioxide. These data are interpreted to distinguish regions with methane contributions from deep-sourced horizontal drilling versus shallow system microbial production. Development of a thorough environmental assessment using light isotope analysis can provide understanding of shallow anthropogenic versus natural CH4sources and assist in identifying regions that require remedial actions.

Variability in GPS sources

NARCIS (Netherlands)

Jauncey, DL; King, EA; Bignall, HE; Lovell, JEJ; Kedziora-Chudczer, L; Tzioumis, AK; Tingay, SJ; Macquart, JP; McCulloch, PM

2003-01-01

Flux density monitoring data at 2.3 and 8.4 GHz is presented for a sample of 33 southern hemisphere GPS sources, drawn from the 2.7 GHz Parkes survey. This monitoring data, together with VLBI monitoring data, shows that a small fraction of these sources, similar to10%, vary. Their variability falls

Carbon source for fermentation

Energy Technology Data Exchange (ETDEWEB)

1977-11-25

Molasses is hydrolyzed and treated with Ca/sup 2 +/ to produce fructose and a good C-source for glutamic acid and lysine fermentation. Thus, sugarcane molasses was diluted with H/sub 2/O, adjusted to pH 1.5, and kept at 60/sup 0/ for 4 hr. Three liters of this solution was cooled to 0/sup 0/ and 262 g Ca(OH)/sub 2/ in a 30% solution was added, along with seed crystals of Ca-fructose additional product. Crystal addition product was recovered and dissolved; the solution contained 6.4g glucose and 168 g fructose, a 50% yield of fructose. The mother liquor was neutralized with H/sub 2/SO/sub 4/ to precipitate the Ca. The supernatant contained 284 g glucose and 159 g fructose and was used as the C source in a fermentation medium in which Coryne-bacterium lilum produced glutamic acid. Yield was 49.0 g/L compared to 48.3 g/L when molasses was used as the C source.

The impacts of source structure on geodetic parameters demonstrated by the radio source 3C371

Science.gov (United States)

Xu, Ming H.; Heinkelmann, Robert; Anderson, James M.; Mora-Diaz, Julian; Karbon, Maria; Schuh, Harald; Wang, Guang L.

2017-07-01

Closure quantities measured by very-long-baseline interferometry (VLBI) observations are independent of instrumental and propagation instabilities and antenna gain factors, but are sensitive to source structure. A new method is proposed to calculate a structure index based on the median values of closure quantities rather than the brightness distribution of a source. The results are comparable to structure indices based on imaging observations at other epochs and demonstrate the flexibility of deriving structure indices from exactly the same observations as used for geodetic analysis and without imaging analysis. A three-component model for the structure of source 3C371 is developed by model-fitting closure phases. It provides a real case of tracing how the structure effect identified by closure phases in the same observations as the delay observables affects the geodetic analysis, and investigating which geodetic parameters are corrupted to what extent by the structure effect. Using the resulting structure correction based on the three-component model of source 3C371, two solutions, with and without correcting the structure effect, are made. With corrections, the overall rms of this source is reduced by 1 ps, and the impacts of the structure effect introduced by this single source are up to 1.4 mm on station positions and up to 4.4 microarcseconds on Earth orientation parameters. This study is considered as a starting point for handling the source structure effect on geodetic VLBI from geodetic sessions themselves.

Subject anxiety and psychological considerations for centrifuge-simulated suborbital spaceflight.

Science.gov (United States)

Mulcahy, Robert A; Blue, Rebecca S; Vardiman, Johnené L; Mathers, Charles H; Castleberry, Tarah L; Vanderploeg, James M

2014-08-01

Anxiety and psychological concerns may pose a challenge to future commercial spaceflight. To help identify potential measures of anxiousness and indicators of flight-related stress, the psychiatric histories and anxiousness responses of volunteers exposed to G forces in centrifuge-simulated spaceflight acceleration profiles were examined. Over 2 d, 86 individuals (63 men, 23 women), 20-78 yr old, underwent up to 7 centrifuge runs. Day 1 consisted of two +G(z) runs (peak = +3.5 G(z)) and two +Gx runs (peak = +6.0 G(x)). Day 2 consisted of three runs approximating suborbital spaceflight profiles (combined +G(x) and +G(z)). Hemodynamic data were collected during the profiles. Subjects completed a retrospective self-report anxiety questionnaire. Medical monitors identified individuals exhibiting varying degrees of anxiousness during centrifuge exposure, medical histories of psychiatric disease, and other potential indicators of psychological intolerance of spaceflight. The retrospective survey identified 18 individuals self-reporting anxiousness, commonly related to unfamiliarity with centrifuge acceleration and concerns regarding medical history. There were 12 individuals (5 men, 7 women, average age 46.2 yr) who were observed to have anxiety that interfered with their ability to complete training; of these, 4 reported anxiousness on their questionnaire and 9 ultimately completed the centrifuge profiles. Psychiatric history was not significantly associated with anxious symptoms. Anxiety is likely to be a relevant and potentially disabling problem for commercial spaceflight participants; however, positive psychiatric history and self-reported symptoms did not predict anxiety during centrifuge performance. Symptoms of anxiousness can often be ameliorated through training and coaching. Even highly anxious individuals are likely capable of tolerating commercial spaceflight.

A compact sup 3 H(p,gamma) sup 4 He 19.8 MeV gamma-ray source for energy calibration at the Sudbury Neutrino Observatory

CERN Document Server

Poon, A W P; Waltham, C E; Browne, M C; Robertson, R G H; Kherani, N P; Mak, H B

2000-01-01

The Sudbury Neutrino Observatory (SNO) is a new 1000-t D sub 2 O Cherenkov solar neutrino detector. A high-energy gamma-ray source is needed to calibrate SNO beyond the sup 8 B solar neutrino endpoint of 15 MeV. This paper describes the design and construction of a source that generates 19.8 MeV gamma rays using the sup 3 H(p,gamma) sup 4 He reaction (''pT''), and demonstrates that the source meets all the physical, operational and lifetime requirements for calibrating SNO. An ion source was built into this unit to generate and to accelerate protons up to 30 keV, and a high-purity scandium tritide target with a scandium-tritium atomic ratio of 1 : 2.0+-0.2 was included. This pT source is the first self-contained, compact, and portable high-energy gamma-ray source (E subgamma>10 MeV). (authors)

Design of a 4.8-m ring for inverse Compton scattering x-ray source

Directory of Open Access Journals (Sweden)

H. S. Xu

2014-07-01

Full Text Available In this paper we present the design of a 50 MeV compact electron storage ring with 4.8-meter circumference for the Tsinghua Thomson scattering x-ray source. The ring consists of four dipole magnets with properly adjusted bending radii and edge angles for both horizontal and vertical focusing, and a pair of quadrupole magnets used to adjust the horizontal damping partition number. We find that the dynamic aperture of compact storage rings depends essentially on the intrinsic nonlinearity of the dipole magnets with small bending radius. Hamiltonian dynamics is found to agree well with results from numerical particle tracking. We develop a self-consistent method to estimate the equilibrium beam parameters in the presence of the intrabeam scattering, synchrotron radiation damping, quantum excitation, and residual gas scattering. We also optimize the rf parameters for achieving a maximum x-ray flux.

Formas de potássio em solos de várzea e sua disponibilidade para o feijoeiro Potassium forms in lowland soils and availability to common bean

Directory of Open Access Journals (Sweden)

M. R. Villa

2004-08-01

Full Text Available O presente estudo teve como objetivos caracterizar as formas de K em solos de várzea e o aproveitamento dessas formas pela planta, avaliar a resposta do feijoeiro à aplicação desse nutriente nesses solos e determinar os seus níveis críticos nos solos e nas plantas. O delineamento experimental utilizado foi o inteiramente casualizado, em esquema fatorial 4 x 5, com quatro repetições, sendo quatro solos de várzea [Gleissolo Melânico (GM, Gleissolo Háplico (GX, Neossolo Flúvico (RU e Organossolo Méssico (OY] e cinco níveis de saturação por K da CTC potencial (natural, 4, 6, 8 e 10 %. Foram cultivadas quatro plantas de feijoeiro (Phaseolus vulgaris L. por vaso até a produção de grãos. Amostras dos solos foram coletadas para a determinação do K total, não-trocável, trocável, em solução, disponível pelos extratores Mehlich-1 e Resina e medidas da relação Quantidade/Intensidade de K. Os teores de K total e K não-trocável foram maiores nos solos OY e RU, enquanto os teores de K trocável e K em solução foram maiores nos solos OY e GM. As saturações críticas por K da CTC potencial foram de 5,0, 4,1, 8,7 e 5,3 %, enquanto os níveis críticos de K foliar foram de 17,9, 30,5, 16,8 e 14,6 mg kg-1, para os solos OY, GM, GX e RU, respectivamente.The present study had as objectives to characterize K forms, plant use of these forms and to evaluate the common bean (Phaseolus vulgaris L. response to K application in four lowland soils. It was also sought to determine the critical levels for K in soils and plant. The experimental design was completely randomized in a 4 x 5 factorial scheme with four replications. The treatments were a combination of four lowland soils [Mesic Organosoil (OY, Melanic Gleysoil (GM, Haplic Gleysoil (GX, and Fluvic Neosoil (RU] and five K CEC saturation levels (native, 4, 6, 8, and 10 %. Four bean plants per pot were cultivated until grain production. Soil samples were analyzed for total K, non

Spray drying of spherical Li{sub 4}Ti{sub 5}O{sub 12}/C powders using polyvinyl pyrrolidone as binder and carbon source

Energy Technology Data Exchange (ETDEWEB)

Liu, Wei [Research Center for New Energy Technology, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); University of Chinese Academy of Sciences, Beijing 110049 (China); Shanghai Nanotechnology Promotion Center, Shanghai 200237 (China); Wang, Qian; Cao, Chunhui [Research Center for New Energy Technology, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); University of Chinese Academy of Sciences, Beijing 110049 (China); Han, Xuewu [Research Center for New Energy Technology, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Zhang, Jian, E-mail: zjskycn@163.com [Research Center for New Energy Technology, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Xie, Xiaohua, E-mail: xiaohuaxie@126.com [Research Center for New Energy Technology, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Xia, Baojia [Research Center for New Energy Technology, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); University of Chinese Academy of Sciences, Beijing 110049 (China)

2015-02-05

Highlights: • The spherical Li{sub 4}Ti{sub 5}O{sub 12}/C granules were prepared by spray drying. • Polyvinyl pyrrolidone (PVP) was used as binder and carbon source. • Tap density and spherical structure increase with the increase of PVP content. • Li{sub 4}Ti{sub 5}O{sub 12}/C granules exhibits better rate capability and excellent cyclability. - Abstract: Polyvinyl pyrrolidone (PVP) was used as binder and carbon source to synthesize stable and spherical Li{sub 4}Ti{sub 5}O{sub 12}/C granules by spray drying. The effects of PVP content and atmospheres on the properties of Li{sub 4}Ti{sub 5}O{sub 12} were investigated. The obtained samples were characterized by X-ray diffraction, scanning electron microscopy, Raman spectroscopy, and electrochemical tests, respectively. The results indicate that the average particle size, tap density and degree of spherical structure increase accordingly to the increase of PVP content. However, the large secondary particle would deteriorate the rate capacity at high current density. The carbon coating could significantly improve the rate capacity, which is attributed to the smaller primary particle and higher electrical conductivity.

Effects of N source concentration and NH4(+)/NO3(-) ratio on phenylethanoid glycoside pattern in tissue cultures of Plantago lanceolata L.: a metabolomics driven full-factorial experiment with LC-ESI-MS(3.).

Science.gov (United States)

Gonda, Sándor; Kiss-Szikszai, Attila; Szűcs, Zsolt; Máthé, Csaba; Vasas, Gábor

2014-10-01

Tissue cultures of a medicinal plant, Plantago lanceolata L. were screened for phenylethanoid glycosides (PGs) and other natural products (NPs) with LC-ESI-MS(3). The effects of N source concentration and NH4(+)/NO3(-) ratio were evaluated in a full-factorial (FF) experiment. N concentrations of 10, 20, 40 and 60mM, and NH4(+)/NO3(-) ratios of 0, 0.11, 0.20 and 0.33 (ratio of NH4(+) in total N source) were tested. Several peaks could be identified as PGs, of which, 16 could be putatively identified from the MS/MS/MS spectra. N source concentration and NH4(+)/NO3(-) ratio had significant effects on the metabolome, their effects on individual PGs were different despite these metabolites were of the same biosynthethic class. Chief PGs were plantamajoside and acteoside (verbascoside), their highest concentrations were 3.54±0.83% and 1.30±0.40% of dry weight, on media 10(0.33) and 40(0.33), respectively. NH4(+)/NO3(-) ratio and N source concentration effects were examined on a set of 89 NPs. For most NPs, high increases in abundance were observed compared to Murashige-Skoog medium. Abundances of 42 and 10 NPs were significantly influenced by the N source concentration and the NH4(+)/NO3(-) ratio, respectively. Optimal media for production of different NP clusters were 10(0), 10(0.11) and 40(0.33). Interaction was observed between NH4(+)/NO3(-) ratio and N source concentration for many NPs. It was shown in simulated experiments, that one-factor at a time (OFAT) experimental designs lead to sub-optimal media compositions for production of many NPs, and alternative experimental designs (e.g. FF) should be preferred when optimizing medium N source for optimal yield of NPs. If using OFAT, the N source concentration is to be optimized first, followed by NH4(+)/NO3(-) ratio, as this reduces the likeliness of suboptimal yield results. Copyright © 2014 Elsevier Ltd. All rights reserved.

Modelling, Design, Growth and Characterization of Strain Balanced Quantum Cascade Lasers (3-11mum), grown by Gas Source Molecular Beam Epitaxy

Science.gov (United States)

Bandyopadhyay, Neelanjan

Quantum Cascade Laser (QCL) is a compact room temperature (RT) source of mid-infrared radiation, which can be used for spectroscopic detection of trace amount of chemicals. The mid-infrared spectral range between (3-11 microm), has a dense array of absorption lines of numerous molecules, due to the presence of fundamental vibrational modes. The goal of this thesis can be subdivided into two parts. Firstly, short wavelength QCLs, emitting below 4microm, perform poorly at RT, due to inter-valley Gamma --- L carrier scattering, carrier escape to the continuum, heat removal from the core region at high power density corresponding to short wavelength operation, and large interface scattering due to highly strained materials. Secondly, it is desirable to have a single QCL based source emitting between 6-10microm, which be used to detect multiple molecules having their peak absorptions far apart, inside this spectral range. However, gain bandwidth of a single core QCL is relatively small, so laser emission cannot be tuned over a wide spectral range. This thesis describes the working principle of a QCL based on superlattice transport, rate equations, scattering mechanism, and waveguide design. The choice of the material system for this work and the fundamentals of band structure engineering has been derived. Gas source molecular beam epitaxy - growth optimization and characterization is one of the most important features of this work, especially for short wavelength QCLs, and has been explained in depth. Different strategies for design of active region design of short wavelength QCL and heterogeneous broadband QCL has been explored. The major milestones, of this research was the world's first watt level continuous wave (CW), RT demonstration at 3.76 microm, which was followed by another milestone of the first CW, RT demonstration at 3.39microm and 3.55microm, and finally the elusive result of QCL emitting at CW, RT at a wavelength as short as lambda ~3microm, a record. In

Standard light source utilizing spontaneous radiation

International Nuclear Information System (INIS)

Yamamoto, O.; Takenaga, M.; Tsujimoto, Y.

1975-01-01

A standard light source is described utilizing spontaneous radiation made by mixing a fluorescent substance LnVO 4 :X (wherein Ln is Y or Gd, and X is Dy or Eu) with a radioactive substance containing a radioactive isotope which is less in the degree of temperature variation of the intensity of emitted light and excellent in stability. Particularly when used in a light-receiving device having photomultiplier tubes, the said light source emits light quite similar to that of a thermoluminescent substance such as CaSO 4 :X (wherein X is Im, Dy, Sm or Mn), LiF or Mg 2 SiO 4 :Tb, and is excellent as a calibration high-stability standard light source for use in the above-mentioned light-receiving device. (auth)

Bonding in d9 complexes derived from EPR: Application to CuCl2-4, CuBr2-4, and CdCl2:Cu2+

Science.gov (United States)

Aramburu, J. A.; Moreno, M.

1985-12-01

In this work are reported the theoretical expressions for the [g], hyperfine, and superhyperfine (shf) tensors of a d9 square-planar complex within a molecular orbital (MO) scheme. These expressions include contributions arising from crystal field and charge transfer excitations calculated up to third and second order perturbations, respectively. This makes the present framework more general than those previously used. Through those expressions we have derived from the experimental EPR and optical data the MO coefficients corresponding to the valence b1g(x2-y2), b2g(xy), and eg(xz,yz) levels and also the core polarization contribution K to the hyperfine tensor for the systems CuCl2-4, CuBr2-4, and CdCl2:Cu2+. The 3d charge obtained for CuCl2-4 is equal to 0.61, 0.83, and 0.85 for the antibonding 3b1g, 2b2g, and 2eg levels, respectively. These figures are much closer to the Xα results by Bencini and Gatteschi [J. Am. Chem. Soc. 105, 5535 (1983)] than to those by Desjardins et al. [J. Am. Chem. Soc. 105, 4590 (1983)]. The σ and π covalency for CuBr2-4 are both higher than for CuCl2-4 in accord to the lower electronegativity for bromine. However, only for the antibonding 3b1g level of CuBr2-4 have we obtained an electronic charge lying mainly on ligands. The covalency of CdCl2:Cu2+ is smaller than that found for CuCl2-4, a fact associated to a higher metal-ligand distance for the former. Evidence of this statement are also given from the analysis of crystal-field spectra and isotropic shf constant. The values of K derived for CuCl2-4 (128.1×10-4 cm-1), CuBr2-4 (103.6×10-4 cm-1), and CdCl2:Cu2+ (123.9×10-4 cm-1) point out the dependence of K on the equatorial covalency but also on the existence of axial ligands. The [g] tensor of CuBr2-4 is dominated by the charge transfer contribution while the crystal field one is negative. Finally an analysis of the importance of each one of the involved contributions to the spin-Hamiltonian parameters is reported for the

Gene x environment interactions in conduct disorder: Implications for future treatments.

Science.gov (United States)

Holz, Nathalie E; Zohsel, Katrin; Laucht, Manfred; Banaschewski, Tobias; Hohmann, Sarah; Brandeis, Daniel

2016-08-18

Conduct disorder (CD) causes high financial and social costs, not only in affected families but across society, with only moderately effective treatments so far. There is consensus that CD is likely caused by the convergence of many different factors, including genetic and adverse environmental factors. There is ample evidence of gene-environment interactions in the etiology of CD on a behavioral level regarding genetically sensitive designs and candidate gene-driven approaches, most prominently and consistently represented by MAOA. However, conclusive indications of causal GxE patterns are largely lacking. Inconsistent findings, lack of replication and methodological limitations remain a major challenge. Likewise, research addressing the identification of affected brain pathways which reflect plausible biological mechanisms underlying GxE is still very sparse. Future research will have to take multilevel approaches into account, which combine genetic, environmental, epigenetic, personality, neural and hormone perspectives. A better understanding of relevant GxE patterns in the etiology of CD might enable researchers to design customized treatment options (e.g. biofeedback interventions) for specific subgroups of patients. Copyright © 2016 Elsevier Ltd. All rights reserved.

Implicit function with natural behavior over entire domain

International Nuclear Information System (INIS)

Itoh, Taku; Saitoh, Ayumu; Kamitani, Atsushi; Nakamura, Hiroaki

2012-01-01

To generate a smooth implicit function that behaves naturally over an entire domain, a method to smoothly combine an implicit function f(x) with a global support function g(x) has been proposed. The proposed method can be applied to large scattered point data, since the implicit function f(x) is generated by a partition-of-unity-based method. The global support function g(x) is generated by a radial basis function-based method or by the least-squares method. To ensure a smooth combination of f(x) and g(x), an appropriate weight function is employed. In numerical experiments, the proposed method is applied to large point data. The results illustrate that the proposed method can generate a smooth implicit function F(x) with natural behavior over the entire domain. In addition, on the given points, the accuracy of F(x) is exactly the same as that of f(x). Furthermore, the computational cost for generation of F(x) is almost the same as that of f(x). (author)

Interaction of genotype and environment: Effect of strain and housing condition on cognitive behaviour in rodent models of schizophrenia

Directory of Open Access Journals (Sweden)

Karly M. Turner

2013-07-01

Full Text Available Schizophrenia is associated with many genetic and environmental risk factors and there is growing evidence that the interactions between genetic and environmental ‘hits’ are critical for disease onset. Animal models of schizophrenia have traditionally used specific strain and housing conditions to test potential risk factors. As the field moves towards testing gene (G x environment (E interactions the impact of these choices should be considered. Given the surge of research focused on cognitive deficits, we have examined studies of cognition in rodents from the perspective of GxE interactions, in which strain or housing manipulations have been varied. Behaviour is clearly altered by these factors, yet few animal models of schizophrenia have investigated cognitive deficits using different strain and housing conditions. It is important to recognise the large variation in behaviour observed when using different strain and housing combinations because GxE interactions may mask or exacerbate cognitive outcomes. Further consideration will improve our understanding of GxE interactions and the underlying neurobiology of cognitive impairments in neuropsychiatric disorders.

Simple rules for ultrasonographic subcategorization of BI-RADS®-US 4 breast masses

International Nuclear Information System (INIS)

Jales, Rodrigo Menezes; Sarian, Luís Otavio; Torresan, Renato; Marussi, Emílio Francisco; Álvares, Beatriz Regina; Derchain, Sophie

2013-01-01

Objectives: To evaluate an objective method for ultrasonographic (US) subcategorization of BI-RADS ® -US 4 breast masses based on clear and simple rules in order for woman to benefit from a more complete and homogeneous breast mass analysis. Methods: In this cross-sectional study, we selected 330 women, with 339 US breast masses, classified as BI-RADS ® -US 4. Three physicians experienced in breast imaging independently reviewed all US images, assessing mass shape, margins, orientation, echo texture and vascularity. These experts further subdivided the masses into subcategories 4a, 4b and 4c, according to simple US rules. Inter-observer agreement was calculated for US features categories and for final subcategory assessment. We also estimated the positive predictive value (PPV) for BI-RADS ® -US subcategories 4a, 4b and 4c assigned by each of the three observers. Results: Pathological examination of all masses confirmed 144 (42%) malignant and 195 (58%) benign tumors. Moderate agreement was obtained for mass shape, margins, vascularity and for final BI-RADS ® -US 4 subcategory. Substantial agreement was obtained for the description of mass orientation and echo texture. The PPV for subcategories 4a, 4b and 4c were, 17%, 45% and 85%, respectively, for the first observer and 20%, 38% and 79% and 17%, 40% and 85% for the other two observers. Conclusion: Standardization of a US subcategorization of BI-RADS ® -US 4 breast masses seems to be feasible, with substantial inter-observer agreement and progressive increase in the PPV in the subcategories 4a, 4b and 4c, provided that clear and simple classification rules are defined

LC-MS/MS analytical procedure to quantify tris(nonylphenyl)phosphite, as a source of the endocrine disruptors 4-nonylphenols, in food packaging materials.

Science.gov (United States)

Mottier, Pascal; Frank, Nancy; Dubois, Mathieu; Tarres, Adrienne; Bessaire, Thomas; Romero, Roman; Delatour, Thierry

2014-01-01

Tris(nonylphenyl)phosphite, an antioxidant used in polyethylene resins for food applications, is problematic since it is a source of the endocrine-disrupting chemicals 4-nonylphenols (4NP) upon migration into packaged foods. As a response to concerns surrounding the presence of 4NP-based compounds in packaging materials, some resin producers and additive suppliers have decided to eliminate TNPP from formulations. This paper describes an analytical procedure to verify the "TNPP-free" statement in multilayer laminates used for bag-in-box packaging. The method involves extraction of TNPP from laminates with organic solvents followed by detection/quantification by LC-MS/MS using the atmospheric pressure chemical ionisation (APCI) mode. A further acidic treatment of the latter extract allows the release of 4NP from potentially extracted TNPP. 4NP is then analysed by LC-MS/MS using electrospray ionisation (ESI) mode. This two-step analytical procedure ensures not only TNPP quantification in laminates, but also allows the flagging of other possible sources of 4NP in such packaging materials, typically as non-intentionally added substances (NIAS). The limits of quantification were 0.50 and 0.48 µg dm⁻² for TNPP and 4NP in laminates, respectively, with recoveries ranging between 87% and 114%. Usage of such analytical methodologies in quality control operations has pointed to a lack of traceability at the packaging supplier level and cross-contamination of extrusion equipment at the converter level, when TNPP-containing laminates are processed on the same machine beforehand.

WHAT IS THE REDSHIFT OF THE GAMMA-RAY BL LAC SOURCE S4 0954+65?

Energy Technology Data Exchange (ETDEWEB)

Landoni, M. [INAF—Istituto Nazionale di Astrofisica, Osservatorio Astronomico di Brera, Via E. Bianchi 46, I-23807 Merate (Italy); Falomo, R. [INAF—Istituto Nazionale di Astrofisica, Osservatorio Astronomico di Padova, Vicolo dell’Osservatorio 5, I-35122 Padova (Italy); Treves, A. [Universita’ degli Studi dell’Insubria, Via Valleggio 11, I-22100 (Italy); Scarpa, R.; Payá, D. Reverte, E-mail: marco.landoni@brera.inaf.it [Instituto de Astrofsica de Canarias, C/O Via Lactea, s/n E38205—La Laguna (Tenerife) (Spain)

2015-12-15

High signal-to-noise ratio spectroscopic observations of the BL Lac object S4 0954+65 at the alleged redshift z = 0.367 are presented. This source was detected at gamma frequencies by the MAGIC (TeV) and FERMI (GeV) telescopes during a remarkable outburst that occurred in 2015 February, making the determination of its distance particularly relevant for our understanding of the properties of the extragalactic background light. Contrary to previous reports on the redshift, we found that the optical spectrum is featureless at an equivalent width limit of ∼0.1 Å. A critical analysis of the existing observations indicates that the redshift is still unknown. Based on the new data we estimate a lower limit to the redshift at z ≥ 0.45.

NASA World Wind, Open Source 4D Geospatial Visualization Platform: *.NET & Java*

Science.gov (United States)

Hogan, P.; Coughlan, J.

2006-12-01

NASA World Wind has only one goal, to provide the maximum opportunity for geospatial information to be experienced, be it education, science, research, business, or government. The benefits to understanding for information delivered in the context of its 4D virtual reality are extraordinary. The NASA World Wind visualization platform is open source and therefore lends itself well to being extended to service *any* requirements, be they proprietary and commercial or simply available. Data accessibility is highly optimized using standard formats including internationally certified open standards (W*S). Although proprietary applications can be built based on World Wind, and proprietary data delivered that leverage World Wind, there is nothing proprietary about the visualization platform itself or the multiple planetary data sets readily available, including global animations of live weather. NASA World Wind is being used by NASA research teams as well as being a formal part of high school and university curriculum. The National Guard uses World Wind for emergency response activities and State governments have incorporated high resolution imagery for GIS management as well as for their cross-agency emergency response activities. The U.S. federal government uses NASA World Wind for a myriad of GIS and security-related issues (NSA, NGA, DOE, FAA, etc.).

US EPA's SPECIATE 4.4 Database: Development and Uses

Science.gov (United States)

SPECIATE is the U.S. Environmental Protection Agency’s (EPA) repository of volatile organic gas and particulate matter (PM) speciation profiles of air pollution sources. EPA released SPECIATE 4.4 in early 2014 and, in total, the SPECIATE 4.4 database includes 5,728 PM, volatile o...

EPA’s SPECIATE 4.4 Database:Development and Uses

Science.gov (United States)

SPECIATE is the U.S. Environmental Protection Agency's (EPA)repository of volatile organic gas and particulate matter (PM) speciation profiles for air pollution sources. EPA released SPECIATE 4.4 in early 2014 and, in total, the SPECIATE 4.4 database includes 5,728 PM, VOC, total...

Application of trajectory clustering and source attribution methods for investigating regional CO2 and CH4 concentrations at Germany's highest mountain site

Science.gov (United States)

Giemsa, Esther; Jacobeit, Jucundus; Ries, Ludwig; Frank, Gabriele; Hachinger, Stephan; Meyer-Arnek, Julian

2017-04-01

Carbon dioxide (CO2) and methane (CH4) represent the most important contributors to increased radiative forcing enhancing it together by contemporary 2.65 W/m2 on the global average (IPCC 2013). The unbroken increase of atmospheric greenhouse gases (GHG) has been unequivocally attributed to human emissions mainly coming from fossil fuel burning and land-use changes, while the oceans and terrestrial ecosystems slightly attenuate this rise with seasonally varying strength. Short-term fluctuations in the GHG concentrations that superimpose the seasonal cycle and the climate change driven trend reflect the presence of regional sources and sinks. A perfect place for investigating the comprehensive influence of these regional emissions is provided by the Environmental Research Station Schneefernerhaus (47.42°N, 10.98°E, 2.650m a.s.l.) situated in the eastern Alps at the southern side of Zugspitze mountain. Located just 300m below the highest peak of the German Alps, the exposed site is one of the currently 30 global core sites of the World Meteorological Organisation (WMO) Global Atmosphere Watch (GAW) programme and thus provides ideal conditions to study source-receptor relationships for greenhouse gases. We propose a stepwise statistical methodology for examining the relationship between synoptic-scale atmospheric transport patterns and climate gas mole fractions to finally receive a characterization of the sampling site with regard to the key processes driving CO2 and CH4 concentration levels. The first step entails a reliable radon-based filtering approach to subdivide the detected air masses according to their regional or 'background' origin. Simultaneously, a large number of ten-day back-trajectories from Schneefernerhaus every two hours over the entire study period 2011 - 2015 is calculated with the Lagrangian transport and dispersion model FLEXPART (Stohl et al. 2005) and subjected to cluster analysis. The weather- and emission strength-related (short

Molecular strain typing of Brucella abortus isolates from Italy by two VNTR allele sizing technologies.

Science.gov (United States)

De Santis, Riccardo; Ancora, Massimo; De Massis, Fabrizio; Ciammaruconi, Andrea; Zilli, Katiuscia; Di Giannatale, Elisabetta; Pittiglio, Valentina; Fillo, Silvia; Lista, Florigio

2013-10-01

Brucellosis, one of the most important re-emerging zoonoses in many countries, is caused by bacteria belonging to the genus Brucella. Furthermore these bacteria represent potential biological warfare agents and the identification of species and biovars of field strains may be crucial for tracing back source of infection, allowing to discriminate naturally occurring outbreaks instead of bioterrorist events. In the last years, multiple-locus variable-number tandem repeat analysis (MLVA) has been proposed as complement of the classical biotyping methods and it has been applied for genotyping large collections of Brucella spp. At present, the MLVA band profiles may be resolved by automated or manual procedures. The Lab on a chip technology represents a valid alternative to standard genotyping techniques (as agarose gel electrophoresis) and it has been previously used for Brucella genotyping. Recently, a new high-throughput genotyping analysis system based on capillary gel electrophoresis, the QIAxcel, has been described. The aim of the study was to evaluate the ability of two DNA sizing equipments, the QIAxcel System and the Lab chip GX, to correctly call alleles at the sixteen loci including one frequently used MLVA assay for Brucella genotyping. The results confirmed that these technologies represent a meaningful advancement in high-throughput Brucella genotyping. Considering the accuracy required to confidently resolve loci discrimination, QIAxcel shows a better ability to measure VNTR allele sizes compared to LabChip GX.

Bifunctional NaYF4:Er3+/Yb3+ submicron rods, implemented in quantum dot sensitized solar cell(Conference Presentation)

Science.gov (United States)

Guerrero, J. Pablo; Cerdán Pasarán, Andrea; López-Luke, Tzarara; Ramachari, D.; Esparza, Diego; De la Rosa Cruz, Elder; Romero Arellano, Victor Hugo

2016-09-01

In this work are presented the results obtained with solar cells sensitized with quantum dots of cadmium sulphide (CdS) incorporating luminescent materials (NaYF4:Yb/Er). The study revealed that through using a bifunctional layer of NaYF4:Yb/Er submicron rods, the infrared radiation is absorbed in 980nm to generate luminescence in the visible region to 530nm, under the UP-conversion process, in the same way simultaneously, NaYF4:Yb/Er layer causes scattering toward the quantum dots, the emission and scattering generated by this material is reabsorbed by the QD-CdS, and these in turn are absorbing in its range of solar radiation absorption, Thus generates an increase in the electron injection into the semiconductor of TiO2. The results of a cell incorporating NaYF4: Yb/Er at 0.07M shown photoconversion efficiencies of 3.39% improving efficiency with respect to the reference solar cell without using NaYF4: Yb/Er of 1.99%. The obtained values of current and voltage showed a strong dependence of the percentage of NaYF4 Yb/Er, and the mechanism of incorporation of this material.

Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

Science.gov (United States)

Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

2009-01-01

One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

A combined H2/CH4 cold moderator for a short pulsed neutron source

International Nuclear Information System (INIS)

Williamson, K.D.; Lucas, A.T.

1989-01-01

Both the ISIS (Rutherford-Appleton Laboratory) spallation source and the Los Alamos Neutron Scattering Center (LANSCE) were designed to produce neutrons as a result of an 800-MeV proton beam being incident on a target. Both systems are intended to accept beam intensities up to 200 μA. Cryogenic moderators of liquid hydrogen and methane are either in use or are planned for service at both facilities. Very low temperature methane would be an ideal moderating material as it has a high hydrogen density and many low frequency modes, which facilitate thermalization. Such moderators are in service at two major world facilities, KEK (Japan) and Argonne National Laboratory (USA). Unfortunately, solid methane has very low thermal conductivity and is subject to radiation damage making a moderator of this type impractical for use in high-intensity beam, such as indicated above. This report outlines a possible alternative using small spheres of solid methane in a matrix of supercritical hydrogen at 25 K. 4 figs

Effect of the Ionosphere on Space and Terrestrial Systems

Science.gov (United States)

1978-01-01

coordinates: with degree of precision 2m-1. If we let 25 x1 , 7r..xn be the zeros of g(x), i.e., Pa(a)=f ° pao( acosO ,asine)ad (10) g)’ (X-X-)( ..x2...abscissas x and y (11) weights Wk are obtained. It is stated hat there is no guarantee that the zeros of g(x) -ap( acosO ,aain6),8ɘɚv,o<a<-. will be...of the ionospheric conditions along the path. shown schematically in Figure 1. The energetic par- ticle data were obtained by the Space Sciences Labor

Tandem Terminal Ion Source

International Nuclear Information System (INIS)

Harper, G.C.; Lindner, C.E.; Myers, A.W.; Wechel, T.D. van

2000-01-01

OAK-B135 Tandem Terminal Ion Source. The terminal ion source (TIS) was used in several experiments during this reporting period, all for the 7 Be(γ) 8 B experiment. Most of the runs used 1 H + at terminal voltages from 0.3 MV to 1.5 MV. One of the runs used 2 H + at terminal voltage of 1.4 MV. The other run used 4 He + at a terminal voltage of 1.37 MV. The list of experiments run with the TIS to date is given in table 1 below. The tank was opened four times for unscheduled source repairs. On one occasion the tank was opened to replace the einzel lens power supply which had failed. The 10 kV unit was replaced with a 15 kV unit. The second time the tank was opened to repair the extractor supply which was damaged by a tank spark. On the next occasion the tank was opened to replace a source canal which had sputtered away. Finally, the tank was opened to replace the discharge bottle which had been coated with aluminum sputtered from the exit canal

Tandem Terminal Ion Source

International Nuclear Information System (INIS)

None

2000-01-01

OAK-B135 Tandem Terminal Ion Source. The terminal ion source (TIS) was used in several experiments during this reporting period, all for the(sup 7)Be((gamma))(sup 8)B experiment. Most of the runs used(sup 1)H(sup+) at terminal voltages from 0.3 MV to 1.5 MV. One of the runs used(sup 2)H(sup+) at terminal voltage of 1.4 MV. The other run used(sup 4)He(sup+) at a terminal voltage of 1.37 MV. The list of experiments run with the TIS to date is given in table 1 below. The tank was opened four times for unscheduled source repairs. On one occasion the tank was opened to replace the einzel lens power supply which had failed. The 10 kV unit was replaced with a 15 kV unit. The second time the tank was opened to repair the extractor supply which was damaged by a tank spark. On the next occasion the tank was opened to replace a source canal which had sputtered away. Finally, the tank was opened to replace the discharge bottle which had been coated with aluminum sputtered from the exit canal

Laser ion source with solenoid field

Science.gov (United States)

Kanesue, Takeshi; Fuwa, Yasuhiro; Kondo, Kotaro; Okamura, Masahiro

2014-11-01

Pulse length extension of highly charged ion beam generated from a laser ion source is experimentally demonstrated. The laser ion source (LIS) has been recognized as one of the most powerful heavy ion source. However, it was difficult to provide long pulse beams. By applying a solenoid field (90 mT, 1 m) at plasma drifting section, a pulse length of carbon ion beam reached 3.2 μs which was 4.4 times longer than the width from a conventional LIS. The particle number of carbon ions accelerated by a radio frequency quadrupole linear accelerator was 1.2 × 1011, which was provided by a single 1 J Nd-YAG laser shot. A laser ion source with solenoid field could be used in a next generation heavy ion accelerator.

Sources of type III solar microwave bursts

Directory of Open Access Journals (Sweden)

Zhdanov D.A.

2016-06-01

Full Text Available Microwave fine structures allow us to study plasma evolution in an energy release region. The Siberian Solar Radio Telescope (SSRT is a unique instrument designed to examine fine structures at 5.7 GHz. A complex analysis of data from RATAN-600, 4–8 GHz spectropolarimeter, and SSRT, simultaneously with EUV data, made it possible to localize sources of III type microwave bursts in August 10, 2011 event within the entire frequency band of burst occurrence, as well as to determine the most probable region of primary energy release. To localize sources of III type bursts from RATAN-600 data, an original method for data processing has been worked out. At 5.7 GHz, the source of bursts was determined along two coordinates, whereas at 4.5, 4.7, 4.9, 5.1, 5.3, 5.5, and 6.0 GHz, their locations were identified along one coordinate. The size of the burst source at 5.1 GHz was found to be maximum as compared to those at other frequencies.

EPAs SPECIATE 4.4 Database: Development and Uses

Science.gov (United States)

SPECIATE is the U.S. Environmental Protection Agency’s (EPA) repository of source category-specific particulate matter (PM), volatile organic gas, and other gas speciation profiles of air pollutant emissions. Abt Associates, Inc. developed SPECIATE 4.4 through a collaborat...

On the methane paradox: Transport from shallow water zones rather than in situ methanogenesis is the major source of CH4 in the open surface water of lakes

Science.gov (United States)

Encinas Fernández, Jorge; Peeters, Frank; Hofmann, Hilmar

2016-10-01

Estimates of global methane (CH4) emissions from lakes and the contributions of different pathways are currently under debate. In situ methanogenesis linked to algae growth was recently suggested to be the major source of CH4 fluxes from aquatic systems. However, based on our very large data set on CH4 distributions within lakes, we demonstrate here that methane-enriched water from shallow water zones is the most likely source of the basin-wide mean CH4 concentrations in the surface water of lakes. Consistently, the mean surface CH4 concentrations are significantly correlated with the ratio between the surface area of the shallow water zone and the entire lake, fA,s/t, but not with the total surface area. The categorization of CH4 fluxes according to fA,s/t may therefore improve global estimates of CH4 emissions from lakes. Furthermore, CH4 concentrations increase substantially with water temperature, indicating that seasonally resolved data are required to accurately estimate annual CH4 emissions.

MgAl_2O_4 foams obtained by combustion synthesis

International Nuclear Information System (INIS)

Moraes, G.G.; Rosa, M.A.; Kronbauer, D.P.; Pozzobom, I.F.; Fernandes, C.P.; Oliveira, A.P. Novaes de

2014-01-01

This work aims to study magnesium aluminate (MgAl_2O_4) ceramic foams obtained by combustion synthesis in solution without the need of surfactants to stabilize bubbles. The precursors, Al(NO_3)_3_.9H_2O and Mg(NO_3)_2_.6H_2_O, dispersed in distilled water (20 wt%) were magnetically stirred under heating (70°C). At the beginning of the reaction, a fuel composed by a mixture of residual glycerins from the production of biodiesel was added. The foams were produced by controlling the stirring speed and temperature. The applied thermal cycle to consolidate the foams consisted of heating at 1°C/min to 600°C/120 min and subsequently raising the temperature at 10°C/min to 1600°C/120 min. The obtained materials were characterized by SEM,TEM and from tomographic images. The results showed that the obtained magnesium aluminate foams have a high porosity (97%), a high connectivity and pore sizes (diameters) between 30 and 1200 μm. (author)

Analysis of the source term in the Chernobyl-4 accident

International Nuclear Information System (INIS)

Alonso, A.; Lopez Montero, J.V.; Pinedo Garrido, P.

1990-01-01

The report presents the analysis of the Chernobyl accident and of the phenomena with major influence on the source term, including the chemical effects of materials dumped over the reactor, carried out by the Chair of Nuclear Technology at Madrid University under a contract with the CEC. It also includes the comparison of the ratio (Cs-137/Cs-134) between measurements performed by Soviet authorities and countries belonging to the Community and OECD area. Chapter II contains a summary of both isotope measurements (Cs-134 and Cs-137), and their ratios, in samples of air, water, soil and agricultural and animal products collected by the Soviets in their report presented in Vienna (1986). Chapter III reports on the inventories of cesium isotopes in the core, while Chapter IV analyses the transient, especially the fuel temperature reached, as a way to deduce the mechanisms which took place in the cesium escape. The cesium source term is analyzed in Chapter V. Normal conditions have been considered, as well as the transient and the post-accidental period, including the effects of deposited materials. The conclusion of this study is that Chernobyl accidental sequence is specific of the RBMK type of reactors, and that in the Western world, basic research on fuel behaviour for reactivity transients has already been carried out

New renewable energy sources

International Nuclear Information System (INIS)

2001-06-01

This publication presents a review of the technological, economical and market status in the field of new renewable energy sources. It also deals briefly with the present use of energy, external conditions for new renewable energy sources and prospects for these energy sources in a future energy system. The renewable energy sources treated here are ''new'' in the sense that hydroelectric energy technology is excluded, being fully developed commercially. This publication updates a previous version, which was published in 1996. The main sections are: (1) Introduction, (2) Solar energy, (3) Bio energy, (4) Wind power, (5) Energy from the sea, (6) Hydrogen, (7) Other new renewable energy technologies and (8) New renewable s in the energy system of the future

Monte Carlo simulation of chemistry following radiolysis with TOPAS-nBio

Science.gov (United States)

Ramos-Méndez, J.; Perl, J.; Schuemann, J.; McNamara, A.; Paganetti, H.; Faddegon, B.

2018-05-01

Simulation of water radiolysis and the subsequent chemistry provides important information on the effect of ionizing radiation on biological material. The Geant4 Monte Carlo toolkit has added chemical processes via the Geant4-DNA project. The TOPAS tool simplifies the modeling of complex radiotherapy applications with Geant4 without requiring advanced computational skills, extending the pool of users. Thus, a new extension to TOPAS, TOPAS-nBio, is under development to facilitate the configuration of track-structure simulations as well as water radiolysis simulations with Geant4-DNA for radiobiological studies. In this work, radiolysis simulations were implemented in TOPAS-nBio. Users may now easily add chemical species and their reactions, and set parameters including branching ratios, dissociation schemes, diffusion coefficients, and reaction rates. In addition, parameters for the chemical stage were re-evaluated and updated from those used by default in Geant4-DNA to improve the accuracy of chemical yields. Simulation results of time-dependent and LET-dependent primary yields Gx (chemical species per 100 eV deposited) produced at neutral pH and 25 °C by short track-segments of charged particles were compared to published measurements. The LET range was 0.05–230 keV µm‑1. The calculated Gx values for electrons satisfied the material balance equation within 0.3%, similar for protons albeit with long calculation time. A smaller geometry was used to speed up proton and alpha simulations, with an acceptable difference in the balance equation of 1.3%. Available experimental data of time-dependent G-values for agreed with simulated results within 7%  ±  8% over the entire time range; for over the full time range within 3%  ±  4% for H2O2 from 49%  ±  7% at earliest stages and 3%  ±  12% at saturation. For the LET-dependent Gx, the mean ratios to the experimental data were 1.11  ±  0.98, 1.21  ±  1.11, 1.05�

Forbidden energy band gap in diluted a-Ge{sub 1-x}Si{sub x}:N films

Energy Technology Data Exchange (ETDEWEB)

Guarneros, C.; Rebollo-Plata, B. [Posgrado en Fisica Aplicada, Facultad de Ciencias Fisico-Matematicas, Benemerita Universidad Autonoma de Puebla, Blvd. 14 Sur 6301, Col. San Manuel, 72570, Puebla (Mexico); Lozada-Morales, R., E-mail: rlozada@fcfm.buap.mx [Posgrado en Fisica Aplicada, Facultad de Ciencias Fisico-Matematicas, Benemerita Universidad Autonoma de Puebla, Blvd. 14 Sur 6301, Col. San Manuel, 72570, Puebla (Mexico); Espinosa-Rosales, J.E. [Posgrado en Fisica Aplicada, Facultad de Ciencias Fisico-Matematicas, Benemerita Universidad Autonoma de Puebla, Blvd. 14 Sur 6301, Col. San Manuel, 72570, Puebla (Mexico); Portillo-Moreno, J. [Facultad de Ciencias Quimicas, Benemerita Universidad Autonoma de Puebla, Blvd. 14 Sur 6301, Col. San Manuel, 72570, Puebla (Mexico); Zelaya-Angel, O. [Departamento de Fisica, Centro de Investigacion y de Estudios Avanzados del IPN, PO Box 14-740, Mexico 07360 D.F. (Mexico)

2012-06-01

By means of electron gun evaporation Ge{sub 1-x}Si{sub x}:N thin films, in the entire range 0 {<=} x {<=} 1, were prepared on Si (100) and glass substrates. The initial vacuum reached was 6.6 Multiplication-Sign 10{sup -4} Pa, then a pressure of 2.7 Multiplication-Sign 10{sup -2} Pa of high purity N{sub 2} was introduced into the chamber. The deposition time was 4 min. Crucible-substrate distance was 18 cm. X-ray diffraction patterns indicate that all the films were amorphous (a-Ge{sub 1-x}Si{sub x}:N). The nitrogen concentration was of the order of 1 at% for all the films. From optical absorption spectra data and by using the Tauc method the energy band gap (E{sub g}) was calculated. The Raman spectra only reveal the presence of Si-Si, Ge-Ge, and Si-Ge bonds. Nevertheless, infrared spectra demonstrate the existence of Si-N and Ge-N bonds. The forbidden energy band gap (E{sub g}) as a function of x in the entire range 0 {<=} x {<=} 1 shows two well defined regions: 0 {<=} x {<=} 0.67 and 0.67 {<=} x {<=} 1, due to two different behaviors of the band gap, where for x > 0.67 exists an abruptly change of E{sub g}(x). In this case E{sub g}(x) versus x is different to the variation of E{sub g} in a-Ge{sub 1-x}Si{sub x} and a-Ge{sub 1-x}Si{sub x}:H. This fact can be related to the formation of Ge{sub 3}N{sub 4} and GeSi{sub 2}N{sub 4} when x {<=} 0.67, and to the formation of Si{sub 3}N{sub 4} and GeSi{sub 2}N{sub 4} for 0.67 {<=} x. - Highlights: Black-Right-Pointing-Pointer Nitrogen doped amorphous Ge{sub 1-x}Si{sub x} thin films are grown by electron gun technique. Black-Right-Pointing-Pointer Nitrogen atoms on E{sub g} of the a-Ge{sub 1-x}Si{sub x} films in the 0 Pound-Sign x Pound-Sign 1 range are analyzed. Black-Right-Pointing-Pointer Variation in 0 Pound-Sign x Pound-Sign 1 range shows a warped change of E{sub g} in 1.0 - 3.6 eV range. Black-Right-Pointing-Pointer The change in E{sub g}(x) behavior when x {approx} 0.67 was associated with Ge{sub 2}SiN{sub 4

GROMACS 4.5: a high-throughput and highly parallel open source molecular simulation toolkit.

Science.gov (United States)

Pronk, Sander; Páll, Szilárd; Schulz, Roland; Larsson, Per; Bjelkmar, Pär; Apostolov, Rossen; Shirts, Michael R; Smith, Jeremy C; Kasson, Peter M; van der Spoel, David; Hess, Berk; Lindahl, Erik

2013-04-01

Molecular simulation has historically been a low-throughput technique, but faster computers and increasing amounts of genomic and structural data are changing this by enabling large-scale automated simulation of, for instance, many conformers or mutants of biomolecules with or without a range of ligands. At the same time, advances in performance and scaling now make it possible to model complex biomolecular interaction and function in a manner directly testable by experiment. These applications share a need for fast and efficient software that can be deployed on massive scale in clusters, web servers, distributed computing or cloud resources. Here, we present a range of new simulation algorithms and features developed during the past 4 years, leading up to the GROMACS 4.5 software package. The software now automatically handles wide classes of biomolecules, such as proteins, nucleic acids and lipids, and comes with all commonly used force fields for these molecules built-in. GROMACS supports several implicit solvent models, as well as new free-energy algorithms, and the software now uses multithreading for efficient parallelization even on low-end systems, including windows-based workstations. Together with hand-tuned assembly kernels and state-of-the-art parallelization, this provides extremely high performance and cost efficiency for high-throughput as well as massively parallel simulations. GROMACS is an open source and free software available from http://www.gromacs.org. Supplementary data are available at Bioinformatics online.

Laser ion source with solenoid field

International Nuclear Information System (INIS)

Kanesue, Takeshi; Okamura, Masahiro; Fuwa, Yasuhiro; Kondo, Kotaro

2014-01-01

Pulse length extension of highly charged ion beam generated from a laser ion source is experimentally demonstrated. The laser ion source (LIS) has been recognized as one of the most powerful heavy ion source. However, it was difficult to provide long pulse beams. By applying a solenoid field (90 mT, 1 m) at plasma drifting section, a pulse length of carbon ion beam reached 3.2 μs which was 4.4 times longer than the width from a conventional LIS. The particle number of carbon ions accelerated by a radio frequency quadrupole linear accelerator was 1.2 × 10 11 , which was provided by a single 1 J Nd-YAG laser shot. A laser ion source with solenoid field could be used in a next generation heavy ion accelerator

Laser ion source with solenoid field

Energy Technology Data Exchange (ETDEWEB)

Kanesue, Takeshi, E-mail: tkanesue@bnl.gov; Okamura, Masahiro [Collider-Accelerator Department, Brookhaven National Laboratory, Upton, New York 11973 (United States); Fuwa, Yasuhiro [Graduate School of Science, Kyoto University, Kitashirakawa, Sakyo, Kyoto 606-7501 (Japan); RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Kondo, Kotaro [Research Laboratory for Nuclear Reactors, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro, Tokyo 152-8550 (Japan)

2014-11-10

Pulse length extension of highly charged ion beam generated from a laser ion source is experimentally demonstrated. The laser ion source (LIS) has been recognized as one of the most powerful heavy ion source. However, it was difficult to provide long pulse beams. By applying a solenoid field (90 mT, 1 m) at plasma drifting section, a pulse length of carbon ion beam reached 3.2 μs which was 4.4 times longer than the width from a conventional LIS. The particle number of carbon ions accelerated by a radio frequency quadrupole linear accelerator was 1.2 × 10{sup 11}, which was provided by a single 1 J Nd-YAG laser shot. A laser ion source with solenoid field could be used in a next generation heavy ion accelerator.

Preliminary Result of Earthquake Source Parameters the Mw 3.4 at 23:22:47 IWST, August 21, 2004, Centre Java, Indonesia Based on MERAMEX Project

Science.gov (United States)

Laksono, Y. A.; Brotopuspito, K. S.; Suryanto, W.; Widodo; Wardah, R. A.; Rudianto, I.

2018-03-01

In order to study the structure subsurface at Merapi Lawu anomaly (MLA) using forward modelling or full waveform inversion, it needs a good earthquake source parameters. The best result source parameter comes from seismogram with high signal to noise ratio (SNR). Beside that the source must be near the MLA location and the stations that used as parameters must be outside from MLA in order to avoid anomaly. At first the seismograms are processed by software SEISAN v10 using a few stations from MERAMEX project. After we found the hypocentre that match the criterion we fine-tuned the source parameters using more stations. Based on seismogram from 21 stations, it is obtained the source parameters as follows: the event is at August, 21 2004, on 23:22:47 Indonesia western standard time (IWST), epicentre coordinate -7.80°S, 101.34°E, hypocentre 47.3 km, dominant frequency f0 = 3.0 Hz, the earthquake magnitude Mw = 3.4.

Sources of SO{sub 2}, SO{sub 4}{sup 2-}, NO{sub x} and NO{sub 3}{sup -} in the air of four Spanish remote stations

Energy Technology Data Exchange (ETDEWEB)

Rua, A.; Hernandez, E.; Parras, J. de las; Martin, I.; Gimeno, L. [Complutense University, Madrid (Spain). Dept. of Statistic and Operative Investigation II

1998-09-01

In this study we have analyzed the sources of SO{sub 2}, SO{sub 4}{sup 2-}, NO{sub x}, and NO{sub 3}{sup -} in the air of four remote Spanish stations belonging to the European Monitoring and Evaluation Programme (EMEP) network. Information about trajectories has been used together with the conditional probability functions (CPFs). The most remarkable result is that the Mediterranean area is the main source of these pollutants in the air of the Spanish EMEP stations. Northern Africa and Central Europe are also important sources while the Atlantic Ocean and British Islands are, in general terms, low sources of these pollutants. The role of the Iberian Peninsula as a source of these pollutants in one of the stations, Logrono, is analyzed with more details using smaller regions to define CPFs. 26 refs., 12 figs., 2 tabs.

Size-resolved source apportionment of particulate matter in urban Beijing during haze and non-haze episodes

Directory of Open Access Journals (Sweden)

S. L. Tian

2016-01-01

Full Text Available Additional size-resolved chemical information is needed before the physicochemical characteristics and sources of airborne particles can be understood; however, this information remains unavailable in most regions of China due to lacking measurement data. In this study, we report observations of various chemical species in size-segregated particle samples that were collected over 1 year in the urban area of Beijing, a megacity that experiences severe haze episodes. In addition to fine particles, high concentrations of coarse particles were measured during the periods of haze. The abundance and chemical compositions of the particles in this study were temporally and spatially variable, with major contributions from organic matter and secondary inorganic aerosols. The contributions of organic matter to the particle mass decreased from 37.9 to 31.2 %, and the total contribution of sulfate, nitrate and ammonium increased from 19.1 to 33.9 % between non-haze and haze days, respectively. Due to heterogeneous reactions and hygroscopic growth, the peak concentrations of the organic carbon, cadmium and sulfate, nitrate, ammonium, chloride and potassium shifted from 0.43 to 0.65 µm on non-haze days to 0.65–1.1 µm on haze days. Although the size distributions of lead and thallium were similar during the observation period, their concentrations increased by a factor of more than 1.5 on haze days compared with non-haze days. We observed that sulfate and ammonium, which have a size range of 0.43–0.65 µm, sulfate and nitrate, which have a size range of 0.65–1.1 µm, calcium, which has a size range of 5.8–9 µm, and the meteorological factors of relative humidity and wind speed were responsible for haze pollution when the visibility was less than 10 km. Source apportionment using Positive Matrix Factorization showed six PM2.1 sources and seven PM2.1–9 common sources: secondary inorganic aerosol (25.1 % for fine particles vs. 9.8�

Research on background neutron of 226Ra γ source

International Nuclear Information System (INIS)

Ji Changsong

1996-01-01

This work studies the background neutron emission of 226 Ra γ source: the mechanism of resulting in background neutron is studied; a thesis that the (α, n) type reaction on Radium carriers Cl or Br is the main source of creating background neutron emission of 226 Ra γ source has been proposed and certificated; a proposal of substitution of Cl carrier by Br in radium source produced in China in order to reduce background neutron emission is put forward. A result to reduce the background neutron from 96.4 neutrons/4πsmgRa to 6.1 neutrons/4πsmgRa is obtained

Thermal behaviour of pure and binary Fe(NO3)3.9H2O and (NH4)6Mo7O24.4H2O systems

International Nuclear Information System (INIS)

Shaheen, W.M.

2007-01-01

Thermal behaviour of pure ferric nitrate, ammonium molybdate and their mixtures in different ratios were investigated by means of thermal analysis (TG, DTG and DTA) techniques. Relative thermal analysis (RTA) graphical treatment of derivatographic curves of the components in the pure and binary system has been carried out as well. A series of Fe 2 O 3 -MoO 3 systems were prepared from pure and binary salts by heating at 350, 550, 750 and 1000 deg. C. The X-ray diffraction (XRD) analysis was used to characterize the phases produced from thermal treatment of investigated solids. The results revealed that pure ferric nitrate decomposed to Fe 2 O 3 at 250, while pure ammonium molybdate decomposed into MoO 3 and 340 deg. C and then melted at 790 deg. C. For the binary components, crystalline ferric or molybdenum oxides were detected beside ferric molybdate Fe 2 (MoO 4 ) 3 phase starting from 350 deg. C. Fe 2 (MoO 4 ) 3 phase was formed as a result of solid-solid interactions between the produced oxides. The thermal stability of the formed compound was significantly affected by the composition of the mixture and treatment temperature. The presence of two-component solids in the binary systems affected the thermal decomposition of their individual salt and affected their physical and chemical behaviour. The catalytic activity of the obtained pure and mixed oxides was measured using the decomposition of hydrogen peroxide reaction as a model reaction at 20-50 deg. C. It was found that the mixed oxide solids had catalytic activity higher than single oxides thermally treated at 350 and 550 deg. C. This is attributed to the increase in the concentration of active sites via creation of new ion pairs in case of binary systems. The rise in calcination temperature up to 750 and 1000 deg. C brought about drastic decrease in the activity of all solids because of changing catalyst composition and/or sintering process. The activation energies of H 2 O 2 decomposition were determined

Vγ4 γδ T Cells Provide an Early Source of IL-17A and Accelerate Skin Graft Rejection.

Science.gov (United States)

Li, Yashu; Huang, Zhenggen; Yan, Rongshuai; Liu, Meixi; Bai, Yang; Liang, Guangping; Zhang, Xiaorong; Hu, Xiaohong; Chen, Jian; Huang, Chibing; Liu, Baoyi; Luo, Gaoxing; Wu, Jun; He, Weifeng

2017-12-01

Activated γδ T cells have been shown to accelerate allograft rejection. However, the precise role of skin-resident γδ T cells and their subsets-Vγ5 (epidermis), Vγ1, and Vγ4 (dermis)-in skin graft rejection have not been identified. Here, using a male to female skin transplantation model, we demonstrated that Vγ4 T cells, rather than Vγ1 or Vγ5 T cells, accelerated skin graft rejection and that IL-17A was essential for Vγ4 T-cell-mediated skin graft rejection. Moreover, we found that Vγ4 T cells were required for early IL-17A production in the transplanted area, both in skin grafts and in the host epidermis around grafts. Additionally, the chemokine (C-C motif) ligand 20-chemokine receptor 6 pathway was essential for recruitment of Vγ4 T cells to the transplantation area, whereas both IL-1β and IL-23 induced IL-17A production from infiltrating cells. Lastly, Vγ4 T-cell-derived IL-17A promoted the accumulation of mature dendritic cells in draining lymph nodes to subsequently regulate αβ T-cell function after skin graft transplantation. Taken together, our data reveal that Vγ4 T cells accelerate skin graft rejection by providing an early source of IL-17A. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

Urban-Rural Disparities in Energy Intake and Contribution of Fat and Animal Source Foods in Chinese Children Aged 4-17 Years.

Science.gov (United States)

Zhang, Ji; Wang, Dantong; Eldridge, Alison L; Huang, Feifei; Ouyang, Yifei; Wang, Huijun; Zhang, Bing

2017-05-21

Excessive energy intake and poor food choices are major health concerns associated with overweight and obesity risk. This study aims to explore disparities in energy intake and the contributions from fat and animal source foods among Chinese school-aged children and adolescents in different communities based on urbanization levels. Three consecutive 24 h recalls were used to assess dietary intake. Subjects' height and weight were measured using standard equipment. Standardized questionnaires were used to collect household demographic and socioeconomic characteristics by trained interviewers. The 2011 China Health and Nutrition Survey is part of an ongoing longitudinal household survey across 228 communities in nine provinces and three mega-cities in China. Subjects consisted of children aged 4-17 years ( n = 1866; 968 boys and 898 girls). The estimated average energy intake was 1604 kcal/day (1706 kcal/day for boys and 1493 kcal/day for girls). Proportions of energy from fat and animal source foods were 36.8% and 19.8% respectively and did not differ by gender. Total energy intake showed no significant disparity, but the proportion of energy from fat and animal source foods increased with increasing urbanization levels and increasing household income level. The largest difference in consumption percentages between children in rural areas and those in highly urban areas was for milk and dairy products (14.8% versus 74.4%) and the smallest difference was seen in percent consuming meat and meat products (83.1% versus 97.1%). Results of this study highlight the need for developing and implementing community-specific strategies to improve Chinese children's diet quality.

Genotype by environment interaction for stayability of Red Angus in the United States.

Science.gov (United States)

Fennewald, Dennis J; Weaber, Robert L; Lamberson, William R

2018-03-06

Bulls are used across a wide variety of environments through the use of artificial insemination. However, not all bulls rank the same for genetic merit in all environments. Sire selection could be more accurate via improved methods of characterization. The objective of this study was to evaluate the presence of genotype by environment (GxE) interaction for stayability in Red Angus in the United States. Environments were defined as nine regions within the continental United States with similar temperature-humidity indices. Stayability was defined as having a calf at age 4 given that the cow had a calf at age 2. A probit sire model was used to determine the heritability on the underlying scale. The percentage of females that calved at age 2 that also calved at age 4 ranged from 32.9 to 58.5% across regions and was 55.0% for the national data set. The heritability of stayability ranged from 0.10 to 0.57 across regions and was 0.12 for the national data set. Genetic correlations were estimated for stayability between all pairs of regions. An estimate of less than 0.80 indicates GxE at a level for concern. Genetic correlations between regions ranged from 0.32 to 0.87 and were <0.80 for 29 of 36 region pairs.

Testing differential susceptibility: Plasticity genes, the social environment, and their interplay in adolescent response inhibition.

Science.gov (United States)

Richards, Jennifer S; Arias Vásquez, Alejandro; van Rooij, Daan; van der Meer, Dennis; Franke, Barbara; Hoekstra, Pieter J; Heslenfeld, Dirk J; Oosterlaan, Jaap; Faraone, Stephen V; Hartman, Catharina A; Buitelaar, Jan K

2017-06-01

Impaired inhibitory control is a key feature of attention-deficit/hyperactivity disorder (ADHD). We investigated gene-environment interaction (GxE) as a possible contributing factor to response inhibition variation in context of the differential susceptibility theory. This states individuals carrying plasticity gene variants will be more disadvantaged in negative, but more advantaged in positive environments. Behavioural and neural measures of response inhibition were assessed during a Stop-signal task in participants with (N = 197) and without (N = 295) ADHD, from N = 278 families (age M = 17.18, SD =3.65). We examined GxE between candidate plasticity genes (DAT1, 5-HTT, DRD4) and social environments (maternal expressed emotion, peer affiliation). A DRD4 × Positive peer affiliation interaction was found on the right fusiform gyrus (rFG) activation during successful inhibition. Further, 5-HTT short allele carriers showed increased rFG activation during failed inhibitions. Maternal warmth and positive peer affiliation were positively associated with right inferior frontal cortex activation during successful inhibition. Deviant peer affiliation was positively related to the error rate. While a pattern of differential genetic susceptibility was found, more clarity on the role of the FG during response inhibition is warranted before firm conclusions can be made. Positive and negative social environments were related to inhibitory control. This extends previous research emphasizing adverse environments.

The peak efficiency calibration of volume source using 152Eu point source in computer

International Nuclear Information System (INIS)

Shen Tingyun; Qian Jianfu; Nan Qinliang; Zhou Yanguo

1997-01-01

The author describes the method of the peak efficiency calibration of volume source by means of 152 Eu point source for HPGe γ spectrometer. The peak efficiency can be computed by Monte Carlo simulation, after inputting parameter of detector. The computation results are in agreement with the experimental results with an error of +-3.8%, with an exception one is about +-7.4%

Calculations of fuel burn-up and radionuclide inventory in the syrian miniature neutron source reactor using the WIMSD4 code

International Nuclear Information System (INIS)

Khattab, K.

2005-01-01

Calculations of the fuel burn up and radionuclide inventory in the Miniature Neutron Source Reactor after 10 years (the reactor core expected life) of the reactor operating time are presented in this paper. The WIMSD4 code is used to generate the fuel group constants and the infinite multiplication factor versus the reactor operating time for 10, 20, and 30 kW operating power levels. The amounts of uranium burnt up and plutonium produced in the reactor core, the concentrations and radioactivities of the most important fission product and actinide radionuclides accumulated in the reactor core, and the total radioactivity of the reactor core are calculated using the WIMSD4 code as well

Experiment list: SRX524970 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available SRX524970 hg19 Input control Input control Uterus Endometrial stromal cells NA 3525...5109,88.2,37.7,339 GSM1372862: Input case1 control; Homo sapiens; ChIP-Seq source_name=Human endometrial stromal cells || tissue=Endo...metrial stromal cells || condition=control (without any induction) || chip antibody

Improved Bevatron local injector ion source performance

International Nuclear Information System (INIS)

Stover, G.; Zajec, E.

1985-05-01

Performance tests of the improved Bevatron Local Injector PIG Ion Source using particles of Si 4 + , Ne 3 + , and He 2 + are described. Initial measurements of the 8.4 keV/nucleon Si 4 + beam show an intensity of 100 particle microamperes with a normalized emittance of .06 π cm-mrad. A low energy beam transport line provides mass analysis, diagnostics, and matching into a 200 MHz RFQ linac. The RFQ accelerates the beam from 8.4 to 200 keV/nucleon. The injector is unusual in the sense that all ion source power supplies, the ac distribution network, vacuum control equipment, and computer control system are contained in a four bay rack mounted on insulators which is located on a floor immediately above the ion source. The rack, transmission line, and the ion source housing are raised by a dc power supply to 80 kilovolts above earth ground. All power supplies, which are referenced to rack ground, are modular in construction and easily removable for maintenance. AC power is delivered to the rack via a 21 kVA, 3-phase transformer. 2 refs., 5 figs., 1 tab

Vacuum Technology for Ion Sources

International Nuclear Information System (INIS)

Chiggiato, P

2013-01-01

The basic notions of vacuum technology for ion sources are presented, with emphasis on pressure profile calculation and choice of pumping technique. A Monte Carlo code (Molflow+) for the evaluation of conductances and the vacuum-electrical analogy for the calculation of time-dependent pressure variations are introduced. The specific case of the Linac4 H - source is reviewed. (author)

Neuregulin 1: a prime candidate for research into gene-environment interactions in schizophrenia? Insights from genetic rodent models

Directory of Open Access Journals (Sweden)

Tim eKarl

2013-08-01

Full Text Available Schizophrenia is a multi-factorial disease characterized by a high heritability and environmental risk factors. In recent years, an increasing number of researchers worldwide have started investigating the ‘two-hit hypothesis’ of schizophrenia predicting that genetic and environmental risk factors (GxE interactively cause the development of the disorder. This work is starting to produce valuable new animal models and reveal novel insights into the pathophysiology of schizophrenia. This mini review will focus on recent advancements in the field made by challenging mutant and transgenic rodent models for the schizophrenia candidate gene neuregulin 1 (NRG1 with particular environmental factors. It will outline results obtained from mouse and rat models for various Nrg1 isoforms/isoform types (e.g. transmembrane domain Nrg1, Type II Nrg1, which have been exposed to different forms of stress (acute versus chronic, restraint versus social and housing conditions (standard laboratory versus minimally enriched housing. These studies suggest Nrg1 as a prime candidate for GxE interactions in schizophrenia rodent models and that the use of rodent models will enable a better understanding of GxE interactions and the underlying mechanisms.

Simple rules for ultrasonographic subcategorization of BI-RADS{sup ®}-US 4 breast masses

Energy Technology Data Exchange (ETDEWEB)

Jales, Rodrigo Menezes, E-mail: rodrigoj@hotmail.com [Department of Obstetrics and Gynecology, Faculty of Medical Sciences, State University of Campinas – Unicamp, Campinas, São Paulo (Brazil); Sarian, Luís Otavio, E-mail: luis.sarian@gmail.com [Department of Obstetrics and Gynecology, Faculty of Medical Sciences, State University of Campinas – Unicamp, Campinas, São Paulo (Brazil); Torresan, Renato, E-mail: torresan@terra.com.br [Department of Obstetrics and Gynecology, Faculty of Medical Sciences, State University of Campinas – Unicamp, Campinas, São Paulo (Brazil); Marussi, Emílio Francisco, E-mail: efmarussi@uol.com.br [Department of Obstetrics and Gynecology, Faculty of Medical Sciences, State University of Campinas – Unicamp, Campinas, São Paulo (Brazil); Álvares, Beatriz Regina, E-mail: alvaresb@terra.com.br [Department of Radiology, Faculty of Medical Sciences, State University of Campinas – Unicamp, Campinas, São Paulo (Brazil); Derchain, Sophie, E-mail: derchain@fcm.unicamp.br [Department of Obstetrics and Gynecology, Faculty of Medical Sciences, State University of Campinas – Unicamp, Campinas, São Paulo (Brazil)

2013-08-15

Objectives: To evaluate an objective method for ultrasonographic (US) subcategorization of BI-RADS{sup ®}-US 4 breast masses based on clear and simple rules in order for woman to benefit from a more complete and homogeneous breast mass analysis. Methods: In this cross-sectional study, we selected 330 women, with 339 US breast masses, classified as BI-RADS{sup ®}-US 4. Three physicians experienced in breast imaging independently reviewed all US images, assessing mass shape, margins, orientation, echo texture and vascularity. These experts further subdivided the masses into subcategories 4a, 4b and 4c, according to simple US rules. Inter-observer agreement was calculated for US features categories and for final subcategory assessment. We also estimated the positive predictive value (PPV) for BI-RADS{sup ®}-US subcategories 4a, 4b and 4c assigned by each of the three observers. Results: Pathological examination of all masses confirmed 144 (42%) malignant and 195 (58%) benign tumors. Moderate agreement was obtained for mass shape, margins, vascularity and for final BI-RADS{sup ®}-US 4 subcategory. Substantial agreement was obtained for the description of mass orientation and echo texture. The PPV for subcategories 4a, 4b and 4c were, 17%, 45% and 85%, respectively, for the first observer and 20%, 38% and 79% and 17%, 40% and 85% for the other two observers. Conclusion: Standardization of a US subcategorization of BI-RADS{sup ®}-US 4 breast masses seems to be feasible, with substantial inter-observer agreement and progressive increase in the PPV in the subcategories 4a, 4b and 4c, provided that clear and simple classification rules are defined.

A comparison between short pulse spallation source and long pulse spallation source

Energy Technology Data Exchange (ETDEWEB)

Aizawa, Kazuya; Watanabe, Noboru; Suzuki, Jun-ichi; Niimura, Nobuo; Morii, Yukio; Katano, Susumu; Osakabe, Toyotaka; Teshigawara, Makoto [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Mezei, F.

1997-11-01

The performance for a 5 MW short pulse spallation source (SPSS) and a 4.5 MW long pulse spallation source (LPSS) in a JAERI program which is based on the availability of a 1.5 GeV superconducting linac with a 30 mA peak current for both proton and H{sup -} beams is discussed. We have examined the superiority of SPSS to LPSS. While a LPSS facility is a second option, we propose an SPSS facility as a first option. (author)

A comparison between short pulse spallation source and long pulse spallation source

International Nuclear Information System (INIS)

Aizawa, Kazuya; Watanabe, Noboru; Suzuki, Jun-ichi; Niimura, Nobuo; Morii, Yukio; Katano, Susumu; Osakabe, Toyotaka; Teshigawara, Makoto; Mezei, F.

1997-01-01

The performance for a 5 MW short pulse spallation source (SPSS) and a 4.5 MW long pulse spallation source (LPSS) in a JAERI program which is based on the availability of a 1.5 GeV superconducting linac with a 30 mA peak current for both proton and H - beams is discussed. We have examined the superiority of SPSS to LPSS. While a LPSS facility is a second option, we propose an SPSS facility as a first option. (author)

Measuring the fractal dimension of the seismic source through the high-frequency fall-off of source spectra

International Nuclear Information System (INIS)

Wu, Z.L.; Chen, Y.T.; Kim, S.G.

1995-09-01

Using the Wigner-distribution estimation, the high-frequency fall-off of source spectra was estimated. The technique was applied to the analysis of the source spectra of the July 22, 1994, Vladivostok M6.4 deep-focus earthquake and that of the July 22, 1994, Northern Japan Sea M5.7 deep-focus earthquake. It is shown that the high-frequency fall-off of the source spectra of these two earthquakes may be characterized by two parts. Between the first corner frequency f 1 and the second corner frequency f 2 , the high-frequency fall-off of the source spectra can be represented by f 5.0 : above f 2 , the high-frequency fall-off can be represented by f 1.4 . In the perspective of the fractal geometry of earthquake source, it seems that the deep-focus earthquakes under consideration may be characterized as being composed of some 'sub events'. On the other hand, each sub event has its complex structure. (author). 12 refs, 3 figs, 1 tab

Pengaruh Perbandingan Media Tanam Gambut dan Pupuk P Terhadap Pertumbuhan Vegetatif Bibit Kelapa Sawit (Eiaeis guineensis Jacq.) di Main Nursery

OpenAIRE

Tirtana, Andang

2012-01-01

The objective of this research knowing peat land exploiting as media grow and phosphate palm oil seed in Main Nursery. This research executed at green house Faculty of Agriculture North Sumatra of University, Medan started in February 2004 up to May 2004 The research uses the Factorials Group Random Sampling, with two treatment factors. Factor I, treatment media composition peat land, which 4 level, that is Go = top soil ( 100 %), Gx = peat land: top soil ( 25%:75%), G2 = peat land: top s...

Spatially Resolved Isotopic Source Signatures of Wetland Methane Emissions

Science.gov (United States)

Ganesan, A. L.; Stell, A. C.; Gedney, N.; Comyn-Platt, E.; Hayman, G.; Rigby, M.; Poulter, B.; Hornibrook, E. R. C.

2018-04-01

We present the first spatially resolved wetland δ13C(CH4) source signature map based on data characterizing wetland ecosystems and demonstrate good agreement with wetland signatures derived from atmospheric observations. The source signature map resolves a latitudinal difference of 10‰ between northern high-latitude (mean -67.8‰) and tropical (mean -56.7‰) wetlands and shows significant regional variations on top of the latitudinal gradient. We assess the errors in inverse modeling studies aiming to separate CH4 sources and sinks by comparing atmospheric δ13C(CH4) derived using our spatially resolved map against the common assumption of globally uniform wetland δ13C(CH4) signature. We find a larger interhemispheric gradient, a larger high-latitude seasonal cycle, and smaller trend over the period 2000-2012. The implication is that erroneous CH4 fluxes would be derived to compensate for the biases imposed by not utilizing spatially resolved signatures for the largest source of CH4 emissions. These biases are significant when compared to the size of observed signals.

Stability of rotors and focal sources for human atrial fibrillation: focal impulse and rotor mapping (FIRM) of AF sources and fibrillatory conduction.

Science.gov (United States)

Swarup, Vijay; Baykaner, Tina; Rostamian, Armand; Daubert, James P; Hummel, John; Krummen, David E; Trikha, Rishi; Miller, John M; Tomassoni, Gery F; Narayan, Sanjiv M

2014-12-01

Several groups report electrical rotors or focal sources that sustain atrial fibrillation (AF) after it has been triggered. However, it is difficult to separate stable from unstable activity in prior studies that examined only seconds of AF. We applied phase-based focal impulse and rotor mapping (FIRM) to study the dynamics of rotors/sources in human AF over prolonged periods of time. We prospectively mapped AF in 260 patients (169 persistent, 61 ± 12 years) at 6 centers in the FIRM registry, using baskets with 64 contact electrodes per atrium. AF was phase mapped (RhythmView, Topera, Menlo Park, CA, USA). AF propagation movies were interpreted by each operator to assess the source stability/dynamics over tens of minutes before ablation. Sources were identified in 258 of 260 of patients (99%), for 2.8 ± 1.4 sources/patient (1.8 ± 1.1 in left, 1.1 ± 0.8 in right atria). While AF sources precessed in stable regions, emanating activity including spiral waves varied from collision/fusion (fibrillatory conduction). Each source lay in stable atrial regions for 4,196 ± 6,360 cycles, with no differences between paroxysmal versus persistent AF (4,290 ± 5,847 vs. 4,150 ± 6,604; P = 0.78), or right versus left atrial sources (P = 0.26). Rotors and focal sources for human AF mapped by FIRM over prolonged time periods precess ("wobble") but remain within stable regions for thousands of cycles. Conversely, emanating activity such as spiral waves disorganize and collide with the fibrillatory milieu, explaining difficulties in using activation mapping or signal processing analyses at fixed electrodes to detect AF rotors. These results provide a rationale for targeted ablation at AF sources rather than fibrillatory spiral waves. © 2014 Wiley Periodicals, Inc.

Simple, high current, antimony ion source

International Nuclear Information System (INIS)

Sugiura, H.

1979-01-01

A simple metal ion source capable of producing a continuous, uncontaminated, high current beam of Sb ions is presented. It produced a total ion current of 200 μA at 1 kV extraction voltage. A discharge occurred in the source at a pressure of 6 x 10 -4 Torr. The ion current extracted from the source increased with the 3/2 power of the extraction voltage. The perveance of the source and ion density in the plasma were 8 x 10 -9 and 1.8 x 10 11 cm -3 , respectively

Determination of discharge parameters via OES at the Linac4 H{sup −} ion source

Energy Technology Data Exchange (ETDEWEB)

Briefi, S., E-mail: stefan.briefi@physik.uni-augsburg.de [AG Experimentelle Plasmaphysik, Institut für Physik, Universität Augsburg, 86135 Augsburg (Germany); Fink, D.; Mattei, S.; Lettry, J. [Linac4 Ion Source Team, CERN-ABP, 1211 Geneva 23 (Switzerland); Fantz, U. [AG Experimentelle Plasmaphysik, Institut für Physik, Universität Augsburg, 86135 Augsburg (Germany); Max-Planck-Institut für Plasmaphysik, Boltzmannstraße 2, 85748 Garching (Germany)

2016-02-15

Optical emission spectroscopy (OES) measurements of the atomic Balmer series and the molecular Fulcher transition have been carried out at the Linac4 ion source in order to determine plasma parameters. As the spectroscopic system was only relatively calibrated, the data evaluation only yielded rough estimates of the plasma parameters (T{sub e} ≈ 1.2 eV, n{sub e} ≈ 1 × 10{sup 19} m{sup −3}, and n{sub H}/n{sub H{sub 2}} ≈ 0.5 at standard operational parameters). The analysis of the Fulcher transition revealed a non-thermal “hockey-stick” rotational population of the hydrogen molecules. At varying RF power, the measurements at the on-axis line of sight (LOS) showed a peak in the rotational temperatures between 25 and 40 kW of RF power, whereas a steady decrease with power was observed at a tilted LOS, indicating the presence of strong plasma parameter gradients.

Internal dosimetry for [4-14C]-cholesterol in humans