WorldWideScience

Sample records for sosnovy bor aluminum

  1. Survey of population health in towns with nuclear and fossil fuel power plants

    International Nuclear Information System (INIS)

    Ivanov, E.; Shubik, V. M.

    2004-01-01

    Comparative assessment of population health in Sosnovy Bor with nuclear power plant and Kirovsk with fossil fuel power station was made for public and administration information. Both towns are located in Leningrad administrative region at 150 km distance from each other. In nuclear power town radiological situation was assessed as normal and in Kirovsk up to 1995 yr. with coal fuel, maximum permissible levels of suspended particle of sulfur oxide in atmosphere were exceeded in 6-9% of samples. After 1995 yr. the natural gas was used as fuel. Demographic data for 1991-2000 yrs indicate that mortality including infants mortality and stillborns was lower in Sosnovy Bor (NOS) then in Kirovsk (fossil fuel) and on average Leningrad administrative region. Birth rate and population growth was higher in Sosnovy Bor at the same time surprisingly the recorded morbidity was higher in Sosnovy Bor which might be explained by extensive medical supervision and improved diagnostics. However, cancer and tuberculosis morbidity was lower in Sosnovy Bor. In Kirovsk in 1997-2000 yrs. oncological morbidity was higher on average comparing to Leningrad administrative region. Oncological mortality in Sosnovy Bor in 1997-2000 yrs. was lower than in Kirovsk and Leningrad region Standardized annual mortality in Sosnovy Bor, Kirovsk and Leningrad administrative region was 128.3, 209.6 and 211.7 on 100 000 respectively. Health state of pregnant women, deliveries, new-born condition were all in normal range in Sosnovy Bor, contrary to higher increased abortion rate and pregnancy complications in Kirovsk. These findings need further studies. (Author)

  2. Survey of population health in towns with nuclear and fossil fuel power plants

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, E.; Shubik, V. M.

    2004-07-01

    Comparative assessment of population health in Sosnovy Bor with nuclear power plant and Kirovsk with fossil fuel power station was made for public and administration information. Both towns are located in Leningrad administrative region at 150 km distance from each other. In nuclear power town radiological situation was assessed as normal and in Kirovsk up to 1995 yr. with coal fuel, maximum permissible levels of suspended particle of sulfur oxide in atmosphere were exceeded in 6-9% of samples. After 1995 yr. the natural gas was used as fuel. Demographic data for 1991-2000 yrs indicate that mortality including infants mortality and stillborns was lower in Sosnovy Bor (NOS) then in Kirovsk (fossil fuel) and on average Leningrad administrative region. Birth rate and population growth was higher in Sosnovy Bor at the same time surprisingly the recorded morbidity was higher in Sosnovy Bor which might be explained by extensive medical supervision and improved diagnostics. However, cancer and tuberculosis morbidity was lower in Sosnovy Bor. In Kirovsk in 1997-2000 yrs. oncological morbidity was higher on average comparing to Leningrad administrative region. Oncological mortality in Sosnovy Bor in 1997-2000 yrs. was lower than in Kirovsk and Leningrad region Standardized annual mortality in Sosnovy Bor, Kirovsk and Leningrad administrative region was 128.3, 209.6 and 211.7 on 100 000 respectively. Health state of pregnant women, deliveries, new-born condition were all in normal range in Sosnovy Bor, contrary to higher increased abortion rate and pregnancy complications in Kirovsk. These findings need further studies. (Author)

  3. Some Genetic Characteristics of the Population Residing Nearby Nuclear Power Plant. The First Step

    International Nuclear Information System (INIS)

    Mkheidze, M.

    2007-01-01

    There is Sosnovy Bor with 60 thousands of inhabitants located 80 km to the west from the centre of St. Petersburg. Here is the greatest and the oldest nuclear power plant, LNPP, with four reactors of the RMBK-1000 (Chernobyl) type. In fact every Sosnovy Bor inhabitant is connected with nuclear technologies. The strategy of the city development is formed and controlled by the policy of federal bodies. It is very difficult to have access to any demographic data and documents reflecting status of population health. Low doses of ionizing radiation are known to cause mutations in germ cells. A great part of the population of Sosnovy Bor works in the NPP and is exposed to low dose ionizing radiation. This paper presents some genetic characteristics of Sosnovy Bor inhabitants including monogenic diseases (phenylketonuria, Duchenne muscular dystrophy, lysosomal diseases, hypothyroidism etc), chromosomal pathology (Down syndrome, Turner and Klinefelter diseases), multiple malformation syndromes and results of aFP screening of pregnant women with high rate of abnormal values of aFP and hHG. These results are obligatory basis and the first step to conduct a study on possible genetic effects of LNPP on genetic structure of Sosnovy Bor population.(author)

  4. İçme ve sulama sularında bor kirliliği ve bor giderme yöntemleri

    Directory of Open Access Journals (Sweden)

    Meltem Bilici Başkan

    2014-03-01

    Full Text Available Periyodik cetvelin 3A grubunda yer alan bor yüksek iyonlaşma potansiyeline sahip olması nedeniyle yarı metal olarak kabul edilir. Yerkabuğundaki ortalama bor konsantrasyonu 10 mg/kg'dır. Bor doğada Ca, Na ve Mg'un tuzları şeklinde bulunur. Yüksek konsantrasyonlarda ve ekonomik boyutlardaki bor yatakları; borun oksijen ile bağlanmış bileşikleri şeklinde daha çok Türkiye ve ABD'nin kurak, volkanik ve hidrotermal aktivitesi olan bölgelerinde bulunmaktadır. Bor, bitkiler için gerekli bir mikro besin elementi olmanın yanı sıra, gerekli tüm besin elementleri içerisinde, eksiklik belirtilerine neden olan miktarı ile toksik etki yapan miktarı, birbirine çok yakın olan tek elementtir. Bor su ortamında genellikle borik asit ve kısmen de borat tuzları formlarında bulunmaktadır. Pek çok endüstride kullanım alanı bulan bor bileşiklerinin endüstriyel gelişmelere bağlı olarak yüzeysel sularda bulunan konsantrasyonu artış göstermektedir. Yüzeysel sularda bulunan bor aynı zamanda evsel atıksulardan da kaynaklanmaktadır. Türkiye'de içme ve sulama sularını en çok kirleten toksik elementlerin başında bor gelmektedir. Bu nedenle bor giderimi hem insan sağlığı açısından hem de sağlıklı tarım ürünü yetiştirilebilmesi açısından oldukça önemlidir. Sulardan bor giderimi için uygulanan temel yöntemler arasında iyon değişimi, ultrafiltrasyon, ters osmoz ve adsorbsiyon gelmektedir.

  5. Functional characterization of Citrus macrophylla BOR1 as a boron transporter.

    Science.gov (United States)

    Cañon, Paola; Aquea, Felipe; Rodríguez-Hoces de la Guardia, Amparo; Arce-Johnson, Patricio

    2013-11-01

    Plants have evolved to develop an efficient system of boron uptake and transport using a range of efflux carriers named BOR proteins. In this work we isolated and characterized a boron transporter of citrus (Citrus macrophylla), which was named CmBOR1 for its high homology to AtBOR1. CmBOR1 has 4403 bp and 12 exons. Its coding region has 2145 bp and encodes for a protein of 714 amino acids. CmBOR1 possesses the molecular features of BORs such as an anion exchanger domain and the presence of 10 transmembrane domains. Functional analysis in yeast indicated that CmBOR1 has an efflux boron transporter activity, and transformants have increased tolerance to excess boron. CmBOR1 is expressed in leaves, stem and flowers and shows the greatest accumulation in roots. The transcript accumulation was significantly increased under boron deficiency conditions in shoots. In contrast, the accumulation of the transcript did not change in boron toxicity conditions. Finally, we observed that constitutive expression of CmBOR1 was able to increase tolerance to boron deficiency conditions in Arabidopsis thaliana, suggesting that CmBOR1 is a xylem loading boron transporter. Based on these results, it was determined that CmBOR1 encodes a boric acid/borate transporter involved in tolerance to boron deficiency in plants. © 2013 Scandinavian Plant Physiology Society.

  6. Evaluation of BOR-60 operation safety

    International Nuclear Information System (INIS)

    Minakov, A.A.; Antipin, G.K.; Efimov, V.N.; Kuzin, G.G.; Eschenko, L.V.; Eschenko, S.N.

    1987-12-01

    In this communication, BOR-60 reactor operation anomalies capable to produce a dangerous overheating of the core (SDC) is examined. On bases of calculations and reactor operation experience an event tree for SDC is built. Evaluations of probable anomalies entering in the event tree and reactor parameters modifications in case of anomalies are presented. In conclusion BOR-60 agree with the sovietic nuclear safety [fr

  7. Calculated investigation of actinide transmutation in the BOR-60 reactor

    International Nuclear Information System (INIS)

    Zhemkov, I.Yu.; Ishunina, O.V.; Yakovleva, I.V.

    2000-01-01

    One of the prospective actinide burner reactor type is the fast reactor with a 'hard' spectrum and small breeding factor, which is the BOR-60. The calculated investigations demonstrate that Loading up to 40% of minor-actinides to the BOR-60 reactor did not lead to the considerable change of neutron-physical characteristics. The performed calculations show that the BOR- 60 reactor possesses a high efficiency of the minor-actinide and plutonium bum-up (up to 37 kg/(TW · h)) hat is comparable with properties of the actinide burner-reactors under design. The BOR-60 reactor can provide a homogeneous minor-actinide Loading (minor-actinide addition to the standard fuel) to the core and heterogeneous Loading (as separate assemblies-targets with a high minor-actinide fraction) to the first rows of a radial blanket that allows the optimum usage of the reactor and its characteristics. (authors)

  8. One-Step Leapfrog LOD-BOR-FDTD Algorithm with CPML Implementation

    Directory of Open Access Journals (Sweden)

    Yi-Gang Wang

    2016-01-01

    Full Text Available An unconditionally stable one-step leapfrog locally one-dimensional finite-difference time-domain (LOD-FDTD algorithm towards body of revolution (BOR is presented. The equations of the proposed algorithm are obtained by the algebraic manipulation of those used in the conventional LOD-BOR-FDTD algorithm. The equations for z-direction electric and magnetic fields in the proposed algorithm should be treated specially. The new algorithm obtains a higher computational efficiency while preserving the properties of the conventional LOD-BOR-FDTD algorithm. Moreover, the convolutional perfectly matched layer (CPML is introduced into the one-step leapfrog LOD-BOR-FDTD algorithm. The equation of the one-step leapfrog CPML is concise. Numerical results show that its reflection error is small. It can be concluded that the similar CPML scheme can also be easily applied to the one-step leapfrog LOD-FDTD algorithm in the Cartesian coordinate system.

  9. Eogenetic caves in conglomerate: an example from Udin Boršt, Slovenia

    Directory of Open Access Journals (Sweden)

    Lipar Matej

    2011-01-01

    Full Text Available Udin Boršt is a karstified terrace of carbonate rock, which is of fluvioglacial origin, and is situated in the north-western part of Slovenia. There are 15 registered caves, which have been interpreted as caves in conglomerate, while karst of Udin Boršt itself was interpreted as conglomerate karst, shallow karst or isolated karst. In this article, caves in Udin Boršt have been interpreted as eogenetic caves. Based on porosity and bedding material, different types of caves and cave passages have developed. Four general types of eogenetic caves found in Udin Boršt are; linear stream caves, shelter caves, breakdown caves and vadose shafts.

  10. MARKETING MIX BY BED OCCUPANCY RATIO (BOR

    Directory of Open Access Journals (Sweden)

    Abdul Muhith

    2017-04-01

    Full Text Available Introduction: Bed Occupancy Ratio (BOR in RSI Arafah Mojosari during the last three years are at under ideal rate and the lowest of the three existing hospitals in the area of Mojosari. The purpose of this study was to determine the relationship marketing mix with Bed Occupancy Ratio in RSI Arafah Mojosari. Methods: This research uses analytic methods with crossectional approach. Variables in the study is marketing mix and Bed Occupancy Ratio (BOR. The population in this study were all patients hospitalized in the RSI Arafah Mojosari. Samples amounted 44 respondents taken by the Stratified random sampling technique. Data were collected using the questionnaire and analyzed using Fisher's Exact test. Result: The results obtained more than 50% of respondents (59.1% rate well against the marketing mix is developed by the hospital management and the majority of respondents (79.5% are in the treatment room that has a number BOR is not ideal. Fisher Exact test test results obtained probabililty value=0.02<0.05 so that H0 is rejected, which means there is a relationship marketing mix with the Bed Occupancy Ratio in RSI Arafah Mojosari. Discussion: Hospitals which able to develop the marketing mix very well, can attract consumers to use inpatient services at the hospital, with that BOR value will increase as the increased use of inpatient services. Hospital management must be able to formulate a good marketing mix strategy that hospital marketing objectives can be achieved. Conformity between service quality and service rates must be addressed, otherwise it extent of media promotions can attract patients to inpatient services.

  11. Impact assessment of mine drainage water and municipal wastewater on the surface water in the vicinity of Bor

    OpenAIRE

    Gardić Vojka R.; Petrović Jelena V.; Đurđevac-Ignjatović Lidija V.; Kolaković Srđan R.; Vujović Svetlana R.

    2015-01-01

    Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB) activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj ...

  12. Possibilities of sustainable development the RTB Bor

    Directory of Open Access Journals (Sweden)

    Zeković Slavka

    2006-01-01

    Full Text Available The paper analysis the medium and long-term perspectives, framework and considered possibilities of sustainable development of RTB "Bor" in the period of transition. It is today the giant in the best quality copper production in the Balkans. In the paper are elaborated the problems of privatization, debt, investment, growth of copper production from own mines (and imported raw, opening of new mines, economical efficiency of production, environmental problems and impacts in the last time. The RTB "Bor" is a serious hot spot in Serbia. Unsustainability trends and process are identified, as follows: open-pit waste dumps, flotation tailings, mining and processing waste waters, air pollution; inefficiency useful of energy water and other inputs in copper complex; trans boundary character of emissions of dust; environmental degradation and quality of wide area and ecologically highly risk, etc.

  13. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji

    2015-01-24

    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range of conditions. In this study, we examined the evolutionary divergence of BORs among terrestrial plants and showed that the lycophyte Selaginella moellendorffii and angiosperms have evolved two types of BOR (clades I and II). Clade I includes AtBOR1 and homologs previously shown to be involved in efficient transport of B under conditions of limited B availability. AtBOR1 shows polar localization in the plasma membrane and high-B-induced vacuolar sorting, important features for efficient B transport under low-B conditions, and rapid down-regulation to avoid B toxicity. Clade II includes AtBOR4 and barley Bot1 involved in B exclusion for high-B tolerance. We showed, using yeast complementation and B transport assays, that three genes in S. moellendorffii, SmBOR1 in clade I and SmBOR3 and SmBOR4 in clade II, encode functional BORs. Furthermore, amino acid sequence alignments identified an acidic di-leucine motif unique in clade I BORs. Mutational analysis of AtBOR1 revealed that the acidic di-leucine motif is required for the polarity and high-B-induced vacuolar sorting of AtBOR1. Our data clearly indicated that the common ancestor of vascular plants had already acquired two types of BOR for low- and high-B tolerance, and that the BOR family evolved to establish B tolerance in each lineage by adapting to their environments. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.

  14. Impact assessment of mine drainage water and municipal wastewater on the surface water in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Gardić Vojka R.

    2015-01-01

    Full Text Available Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj River, which still flow into the Timok River and Danube River. These pollutions are often presented by low pH value, increased content of heavy metal ions, suspended particles and fine particles of flotation tailings, which is deposited in the valleys of these rivers on the area of over 2000 hectares. During the decades of exploitation of ore from the open pit Bor at different locations ("Visoki Planir" - also called “Oštreljski planir”, "Severni planir" dump of ore body "H" (RTH gangue and tailings were delayed. The largest amount of tailings, about 150 million tons, was postponed on location Visoki planir. The effect of the mining waste and the impact of the whole process of processing copper ore to the final products on the environment, was conducted during the 4th study period of the project "Management of mining waste-tailing dump in the Bor region," supported by the Japan Society for the Promotion Science (Eng. Japan Society for the Promotion of Science and the Japan international cooperation Agency and the Ministry of environment, Mining and Spatial planning of the Republic of Serbia. Influence of season on the level of pollutants in soil and water, the impact on water quality in the river Timok and the River Danube, was conducted during first three periods of project. This paper presents the results of the third study period. The third period of research, which was conducted over a period of 17. 10. 2012 to 17. 01.2013 year, included a review of pollution sources and define their

  15. Polarized localization and borate-dependent degradation of the Arabidopsis borate transporter BOR1 in tobacco BY-2 cells.

    Science.gov (United States)

    Yamauchi, Noboru; Gosho, Tadashi; Asatuma, Satoru; Toyooka, Kiminori; Fujiwara, Toru; Matsuoka, Ken

    2013-01-01

    In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP) in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM). This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.

  16. Soil-structural interaction analysis of RBMK type NPP for seismic event. Progress report. From 1 July 1998 - 30 June 1999

    International Nuclear Information System (INIS)

    1999-01-01

    The objective of the project is to assess the structural behavior and safety capacity of a RBMK-1000 MW Main Building Complex under critical combination of loads including seismic events. This project is part of the Coordinated Research Program carried out by International Atomic Energy Agency on safety of RBMK Type Nuclear Power Plants (NPP) in Relation to External Events. The nuclear power plant considered for this study is the Sosnovy Bor NPP, located near St.Petersburg, Russia. The Soviet standard design RBMK-1000 MW type units installed in Sosnovy Bor NPP were originally designed for a Safe Shutdown Earthquake (SSE) with a peak ground acceleration (PGA) of 0.1 g. The relevant response spectra are not available for reference and assessment. The new international requirements for nuclear power plants in operation require site specific seismic hazard studies as a basis for the definition of a Review Level Earthquake (RLE) for reassessment of the structures and safety related equipment Ell - As the RLE site specific seismic data is still not available, the RLE earthquake spectra for Kozloduy NPP scaled to PGA=0.1 g were used in this study. This value is intentionally chosen for comparison purposes. The Russian design requirements (if design floor response spectra are available) will be compared with the international regulations. The scope of the study is to perform a Soil-Structure Interaction (SSI) seismic response analysis of the referenced RBMK-11000 MW. Main Building Complex to evaluate the effect on the structural response of a greater than design earthquake. The analysis is focused on a realistic assessment of the structural response to a potentially higher earthquake level instead of a conservative design type analysis. Special attention is paid on the seismic response of the sub-structures in the safe shutdown path, as well as on the locations of the heavy equipment

  17. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  18. Cracking behavior and microstructure of austenitic stainless steels and alloy 690 irradiated in BOR-60 reactor, phase I.

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Y.; Chopra, O. K.; Soppet, W. K.; Shack, W. J.; Yang, Y.; Allen, T. R.; Univ. of Wisconsin at Madison

    2010-02-16

    Cracking behavior of stainless steels specimens irradiated in the BOR-60 at about 320 C is studied. The primary objective of this research is to improve the mechanistic understanding of irradiation-assisted stress corrosion cracking (IASCC) of core internal components under conditions relevant to pressurized water reactors. The current report covers several baseline tests in air, a comparison study in high-dissolved-oxygen environment, and TEM characterization of irradiation defect structure. Slow strain rate tensile (SSRT) tests were conducted in air and in high-dissolved-oxygen (DO) water with selected 5- and 10-dpa specimens. The results in high-DO water were compared with those from earlier tests with identical materials irradiated in the Halden reactor to a similar dose. The SSRT tests produced similar results among different materials irradiated in the Halden and BOR-60 reactors. However, the post-irradiation strength for the BOR-60 specimens was consistently lower than that of the corresponding Halden specimens. The elongation of the BOR-60 specimens was also greater than that of their Halden specimens. Intergranular cracking in high-DO water was consistent for most of the tested materials in the Halden and BOR-60 irradiations. Nonetheless, the BOR-60 irradiation was somewhat less effective in stimulating IG fracture among the tested materials. Microstructural characterization was also carried out using transmission electron microscopy on selected BOR-60 specimens irradiated to {approx}25 dpa. No voids were observed in irradiated austenitic stainless steels and cast stainless steels, while a few voids were found in base and grain-boundary-engineered Alloy 690. All the irradiated microstructures were dominated by a high density of Frank loops, which varied in mean size and density for different alloys.

  19. DRP1-Dependent Endocytosis is Essential for Polar Localization and Boron-Induced Degradation of the Borate Transporter BOR1 in Arabidopsis thaliana.

    Science.gov (United States)

    Yoshinari, Akira; Fujimoto, Masaru; Ueda, Takashi; Inada, Noriko; Naito, Satoshi; Takano, Junpei

    2016-09-01

    Boron (B) is essential for plants but toxic in excess. The borate efflux transporter BOR1 is expressed in various root cells and localized to the inner/stele-side domain of the plasma membrane (PM) under low-B conditions. BOR1 is rapidly degraded through endocytosis upon sufficient B supply. The polar localization and degradation of BOR1 are considered important for efficient B translocation and avoidance of B toxicity, respectively. In this study, we first analyzed the subcellular localization of BOR1 in roots, cotyledons and hypocotyls, and revealed a polar localization in various cell types. We also found that the inner polarity of BOR1 is established after completion of cytokinesis in the root meristem. Moreover, variable-angle epifluorescence microscopy visualized BOR1-green fluorescent protein (GFP) as particles in the PM with significant lateral movements but in restricted areas. Importantly, a portion of BOR1-GFP particles co-localized with DYNAMIN-RELATED PROTEIN 1A (DRP1A), which is involved in scission of the clathrin-coated vesicles, and they disappeared together from the PM. To examine the contribution of DRP1A-mediated endocytosis to BOR1 localization and degradation, we developed an inducible expression system of the DRP1A K47A variant. The DRP1A variant prolonged the residence time of clathrin on the PM and inhibited endocytosis of membrane lipids. The dominant-negative DRP1A blocked endocytosis of BOR1 and disturbed its polar localization and B-induced degradation. Our results provided insight into the endocytic mechanisms that modulate the subcellular localization and abundance of a mineral transporter for nutrient homeostasis in plant cells. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  20. Aspects of energy reduction by autogenous copper production in the copper smelting plant Bor

    International Nuclear Information System (INIS)

    Najdenov, Ivan; Raić, Karlo T.; Kokeza, Gordana

    2012-01-01

    This work presents a comparative analysis of the energy consumption during copper production by the “standard” procedure (roasting in a fluo–solid reactor and smelting in a reverberatory furnace) in the Smelting Plant in Bor with modern autogenous procedures. All forms of expended energy were reduced to primary energy or to the same energy form, i.e., to the energy equivalent of the process (EEP), the raw material and the process materials. In addition, the energy equivalent of the process and waste products (water vapour, thermal energy and similar) were balanced. To complete the consumption of all energy generating products in copper production, they were reduced to conditional fuel (coal equivalent = 29.3 MJ/kg). Additionally, this study suggests replacement of the existing technology by an appropriate autogenous procedure and considers the prospects for further development of mining and metallurgy in Bor. Estimates of development perspectives for copper production should be comprehensive, based on complete and relevant data, as well as on real considerations of future development in world production. -- Highlights: ► “Standard” autogenous copper production in the Smelting Plant, Bor, Serbia. ► Comparation of energy consumption in “standard” with other autogenous procedures. ► All forms of energy are reduced to energy equivalent and conditional fuel. ► Replacement of existing technology with the appropriate autogenous procedure. ► Perspectives of further development of mining and metallurgy in Bor.

  1. Transgenic tobacco plants expressing BoRS1 gene from Brassica ...

    Indian Academy of Sciences (India)

    Water stress is by far the leading environmental stress limiting crop yields worldwide. Genetic engineering techniques hold great promise for developing crop cultivars with high tolerance to water stress. In this study, the Brassica oleracea var. acephala BoRS1 gene was transferred into tobacco through ...

  2. A new approach to the spectral analysis of liquid membrane oscillators by Gábor transformation

    DEFF Research Database (Denmark)

    Płocharska-Jankowska, E.; Szpakowska, M.; Mátéfi-Tempfli, Stefan

    2006-01-01

    Liquid membrane oscillators very frequently have an irregular oscillatory behavior. Fourier transformation cannot be used for these nonstationary oscillations to establish their power spectra. This important point seems to be overlooked in the field of chemical oscillators. A new approach...... is presented here based on Gábor transformation allowing one to obtain power spectra of any kind of oscillations that can be met experimentally. The proposed Gábor analysis is applied to a liquid membrane oscillator containing a cationic surfactant. It was found that the power spectra are strongly influenced...

  3. Structure of Bor1 supports an elevator transport mechanism for SLC4 anion exchangers.

    Science.gov (United States)

    Thurtle-Schmidt, Bryan H; Stroud, Robert M

    2016-09-20

    Boron is essential for plant growth because of its incorporation into plant cell walls; however, in excess it is toxic to plants. Boron transport and homeostasis in plants is regulated in part by the borate efflux transporter Bor1, a member of the solute carrier (SLC) 4 transporter family with homology to the human bicarbonate transporter Band 3. Here, we present the 4.1-Å resolution crystal structure of Arabidopsis thaliana Bor1. The structure displays a dimeric architecture in which dimerization is mediated by centralized Gate domains. Comparisons with a structure of Band 3 in an outward-open state reveal that the Core domains of Bor1 have rotated inwards to achieve an occluded state. Further structural comparisons with UapA, a xanthine transporter from the nucleobase-ascorbate transporter family, show that the downward pivoting of the Core domains relative to the Gate domains may access an inward-open state. These results suggest that the SLC4, SLC26, and nucleobase-ascorbate transporter families all share an elevator transport mechanism in which alternating access is provided by Core domains that carry substrates across a membrane.

  4. Basic principles of accounting and control of nuclear materials in the BOR-60 experimental fast reactor

    International Nuclear Information System (INIS)

    Gryazev, V.M.; Gadzhiev, G.I.; Alekseev, I.N.

    1979-01-01

    Under a contract with the International Atomic Energy Agency, the V.I. Lenin Atomic Reactor Research Institute is currently carrying out a study of ways of organizing a nuclear materials accounting and control system for the BOR-60 fast reactor. Some results of this study are presented in the paper. The special physical and technological features of fast reactors create additional difficulties in safeguards systems and give rise to a number of new possibilities for the illicit removal of nuclear materials. These questions are discussed with reference to the BOR-60 reactor but the conclusions are probably applicable to all fast reactors. The proposed accounting and control system is based on non-destructive measurements of the amount of fissile materials in the operating fuel assemblies and screened bundles of the reactor, on the independent control of the principal facility parameters (a list of which is given) and on an automated information collection and evaluation system. Visual means of inspection can be very effective in fast reactor safeguards systems, especially for controlling storage, but they are not used with the BOR-60 reactor. (author)

  5. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji; Mineta, Katsuhiko; Amano, Taro; Toyoda, Atsushi; Fujiwara, Toru; Naito, Satoshi; Takano, Junpei

    2015-01-01

    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range

  6. Environmental impact of mining activity in Bor area as indicated by the distribution of heavy metals and bacterial population dynamics in sediment

    Directory of Open Access Journals (Sweden)

    Filimon M. N.

    2016-01-01

    Full Text Available The environmental impact of inorganic pollution is pronounced in water adjacent to Bor Copper Smelter Complex (RTB Bor, Serbia, with Cu, Zn, Pb, and As being the main determinants of aquatic pollution pattern. Communities of microorganisms present in the sediments are mainly affected by heavy metal pollution. Some groups of bacteria can be considered pollution bio-indicators, due to their sensibility and ability to bioaccumulate heavy metals, thus contributing to reducing pollution. This study investigates the relationships between trace element accumulation and heterogeneity in sediment bacteria community structure found in water streams adjacent to the Bor Copper Smelter Complex (RTB Bor, Serbia. Our results showed no contamination with copper, zinc, nickel, iron, and chromium, but did show a low to moderate contamination with lead and a moderate to high contamination with arsenic in aquatic sediments within the area of interest. Spatial heterogeneity in sediment-associated bacterial communities did not relate significantly to location of sampling sites, except for iron reducing bacteria. Iron reducing bacteria and nitrifying bacteria were the best distinguishing groups of bacteria. However, only iron reducing bacteria were significantly influenced by sampling locations. The iron reducing bacteria has correlated negatively with the degree of sediment contamination with lead, and therefore, we suggest that this group of bacteria could serve as potential bio-indicators of inorganic water contamination in Bor RTB area.

  7. Finanční analýza podniku BRISK Tábor, a.s.

    OpenAIRE

    Hašek, Jan

    2008-01-01

    Diploma is focused on Financial analysis, importance of it, users, implementation analysis on factual company -- BRISK Tábor, a.s., evaluation based on analysis financial statements, ratio indicators, working capital, balance order, scheme of indicators, analysis of financial arm and comparison intercompany.

  8. Leningrad NPP full scope simulator - new generation tool for training and analysis

    International Nuclear Information System (INIS)

    Malkin, S.D.; Shalia, V.V.; Rakitin, I.D.; Khoudiakov, M.M.

    1999-01-01

    Recent developments of Russian Research Center 'Kurchatov Institute' are aimed at the soonest and minimum expenditure's creation of modern high-performance means for personnel's training and regular restraining and also at the development of means of modeling, safety analysis and operators' support with severe accidents to be included. In this view, the most elaborated one is the Training Support Center (TSC) created at the Leningrad NPP, Sosnovy Bor, Russia. To be applied in this center, GSE Systems of USA and RRC 'Kurchatov Institute' have jointly developed the Total Training System that incorporates full-scope simulator; analytical full-scope simulator, expert system, interactive system, psycho-physiological system; and training support programs. Mathematical models creating and special software development were the responsibility of RRC 'Kurchatov Institute', the hardware and general purpose software were the responsibility of GSE Systems. (author)

  9. Optimization of heavy metals total emission, case study: Bor (Serbia)

    Science.gov (United States)

    Ilić, Ivana; Bogdanović, Dejan; Živković, Dragana; Milošević, Novica; Todorović, Boban

    2011-07-01

    The town of Bor (Serbia) is one of the most polluted towns in southeastern Europe. The copper smelter which is situated in the centre of the town is the main pollutant, mostly because of its old technology, which leads to environmental pollution caused by higher concentrations of SO 2 and PM 10. These facts show that the word is about a very polluted region in Europe which, apart from harming human health in the region itself, poses a particular danger for wider area of southeastern Europe. Optimization of heavy metal's total emission was undertaken because years of long contamination of the soil with heavy metals of anthropogenic origin created a danger that those heavy metals may enter the food chains of animals and people, which can lead to disastrous consequences. This work represents the usage of Geographic Information System (GIS) for establishing a multifactor assessment model to quantitatively divide polluted zones and for selecting control sites in a linear programming model, combined with PROMETHEE/GAIA method, Screen View modeling system, and linear programming model. The results show that emissions at some control sites need to be cut for about 40%. In order to control the background of heavy metal pollution in Bor, the ecological environment must be improved.

  10. Shear Punch Testing of BOR-60 Irradiated TEM Specimens

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-06-13

    As a part of the project “High Fidelity Ion Beam Simulation of High Dose Neutron Irradiation” an Integrated Research Program (IRP) project from the U.S. Department of Energy, Nuclear Energy University Programs (NEUP), TEM geometry samples of ferritic cladding alloys, Ni based super alloys and model alloys were irradiated in the BOR-60 reactor to ~16 dpa at ~370°C and ~400°C. Samples were sent to Los Alamos National Laboratory and subjected to shear punch testing. This report presents the results from this testing.

  11. Polarized localization and borate-dependent degradation of the Arabidopsis borate transporter BOR1 in tobacco BY-2 cells [v1; ref status: indexed, http://f1000r.es/kv

    Directory of Open Access Journals (Sweden)

    Noboru Yamauchi

    2013-09-01

    Full Text Available In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM. This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.

  12. Finanční analýza podniku IDEAL AUTOMOTIVE Bor, s.r.o.

    OpenAIRE

    Velebová, Štěpánka

    2009-01-01

    The aim of this bachelor thesis is to identify the financial situation of IDEAL AUTOMOTIVE Bor, Ltd., determine the strenghts and weaknesses of the company, and suggest some ideas of what to do in the future, so that the company could prosper

  13. Leningrad NPP full scope and analytical simulators as tools for MMI improvement and operator support systems development and testing

    International Nuclear Information System (INIS)

    Rakitin, I.D.; Malkin, S.D.; Shalia, V.V.; Fedorov, E.M.; Lebedev, N.N.; Khoudiakov, M.M.

    1999-01-01

    Training Support Center (TSC) created at the Leningrad NPP (LNPP), Sosnovy Bor, Russia, incorporates full-scope and analytical simulators working in parallel with the prototypes of the expert and interactive systems to provide a new scope of R and D MMI improvement work as for the developer as well as for the user. Possibilities of development, adjusting and testing of any new or up-graded Operators' Support System before its installation at the reference unit's Control Room are described in the paper. These Simulators ensure the modeling of a wide range of accidents and transients and provide with special software and ETHERNET data process communications with the Operators' Support systems' prototypes. The development and adjustment of two state-of-the-art Operators' Support Systems of interest with using of Simulators are described in the paper as an example. These systems have been developed jointly by RRC KI and LNPP team. (author)

  14. Peculiarities of 137Cs accumulation by macromycetes in dry bors of Ukrainian Polessye

    International Nuclear Information System (INIS)

    Orlov, O.O.; Kurbet, T.B.; Kalyish, O.B.; Prishchepa, O.L.

    2001-01-01

    The main ecological peculiarities of dry bor in Ukrainian Polessye were given. Research were carried out in Central Polessie of Ukraine during 1997 - 1999. Results were obtained due to spectrometric measurement of specific activity of 137 Cs in fruit bodies of mushrooms and in the soil. Species composition of macromycetes was divided on homogeneous groups on intensity of 13 7Cs accumulation. Amanita porphyria, A. muscaria and Tricholoma portentosum belong to the group of weak 137 Cs accumulation from the soil (TF = 15 - 20); Amanita pantherina, A. phalloides, Cantharellus cibarius, Boletus edulis, Tricholoma flavovirens and Laccaria laccata - to the group of moderate radionuclide accumulation (TF = 30 - 55). The group of strong 137 Cs accumulation (TF = 100 - 180) consists of Suillus variegates, S. bovines and Hydnum imbricatum; and group of very strong accumulation (TF 200 - 280) - of Xerocomus badius, Lactarius rufus, Russula xerampelina, Cortinarius varius and Paxillus involutus. Cortinarius sanguineus (with TF 400) is an accumulator of 137 Cs. Comparative evaluation of dry bor was given from the point of view of purchase of edible macromycetes in it

  15. Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp.

    Directory of Open Access Journals (Sweden)

    Julia Bock

    2016-10-01

    Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.

  16. Large-scale experimental facility for emergency condition investigation of a new generation NPP WWER-640 reactor with passive safety systems

    Energy Technology Data Exchange (ETDEWEB)

    Aniskevich, Y.N.; Vasilenko, V.A.; Zasukha, V.K.; Migrov, Y.A.; Khabensky, V.B. [Research Inst. of Technology NITI (Russian Federation)

    1997-12-31

    The creation of the large-scale integral experimental facility (KMS) is specified by the programme of the experimental investigations to justify the engineering decisions on the safety of the design of the new generation NPP with the reactor WWER-640. The construction of KMS in a full volume will allow to conduct experimental investigations of all physical phenomena and processes, practically, occurring during the accidents on the NPPs with the reactor of WWER type and including the heat - mass exchange processes with low rates of the coolant, which is typical during the utilization of the passive safety systems, process during the accidents with a large leak, and also the complex intercommunicated processes in the reactor unit, passive safety systems and in the containment with the condition of long-term heat removal to the final absorber. KMS is being constructed at the Research Institute of Technology (NITI), Sosnovy Bor, Leningrad region, Russia. (orig.). 5 refs.

  17. Radiological research more important than ever

    International Nuclear Information System (INIS)

    Mustonen, R.

    1996-01-01

    Ten years ago, the Finnish radiation monitoring and radiation protection systems were shown to be among the most efficient in Europe. The first overall picture of the radiation situation in Finland was published a little more than a week after the event in Chernobyl. Radioactivity in the environment and in people has been monitored in Finland since the early 1960s. Radioactive materials are, in fact, the best known substances that pose a hazard to the environment. Studies of the environment have perhaps played the most important role in the development of models describing the transportation of radioactive materials. These models are needed to form a basis for preparedness plans. Even though Finland is situated far from Chernobyl, the effects of the event here, too, were so strong that explicit instructions were needed for the population. If the accident had taken place, say, in Sosnovy Bor, some actual protective measures would have been needed in southern and south-eastern Finland. (orig.) (4 figs.)

  18. Large-scale experimental facility for emergency condition investigation of a new generation NPP WWER-640 reactor with passive safety systems

    International Nuclear Information System (INIS)

    Aniskevich, Y.N.; Vasilenko, V.A.; Zasukha, V.K.; Migrov, Y.A.; Khabensky, V.B.

    1997-01-01

    The creation of the large-scale integral experimental facility (KMS) is specified by the programme of the experimental investigations to justify the engineering decisions on the safety of the design of the new generation NPP with the reactor WWER-640. The construction of KMS in a full volume will allow to conduct experimental investigations of all physical phenomena and processes, practically, occurring during the accidents on the NPPs with the reactor of WWER type and including the heat - mass exchange processes with low rates of the coolant, which is typical during the utilization of the passive safety systems, process during the accidents with a large leak, and also the complex intercommunicated processes in the reactor unit, passive safety systems and in the containment with the condition of long-term heat removal to the final absorber. KMS is being constructed at the Research Institute of Technology (NITI), Sosnovy Bor, Leningrad region, Russia. (orig.)

  19. Large-scale experimental facility for emergency condition investigation of a new generation NPP WWER-640 reactor with passive safety systems

    Energy Technology Data Exchange (ETDEWEB)

    Aniskevich, Y N; Vasilenko, V A; Zasukha, V K; Migrov, Y A; Khabensky, V B [Research Inst. of Technology NITI (Russian Federation)

    1998-12-31

    The creation of the large-scale integral experimental facility (KMS) is specified by the programme of the experimental investigations to justify the engineering decisions on the safety of the design of the new generation NPP with the reactor WWER-640. The construction of KMS in a full volume will allow to conduct experimental investigations of all physical phenomena and processes, practically, occurring during the accidents on the NPPs with the reactor of WWER type and including the heat - mass exchange processes with low rates of the coolant, which is typical during the utilization of the passive safety systems, process during the accidents with a large leak, and also the complex intercommunicated processes in the reactor unit, passive safety systems and in the containment with the condition of long-term heat removal to the final absorber. KMS is being constructed at the Research Institute of Technology (NITI), Sosnovy Bor, Leningrad region, Russia. (orig.). 5 refs.

  20. Acoustic monitoring of the BOR-60 reactor circulating pump state

    International Nuclear Information System (INIS)

    Efimov, V.N.; Myntsov, A.A.

    1988-01-01

    Diagnostics methods for circulation pumps of the experimental BOR-60 fast reactor are described. The results of signal processing during a microcompain, as well as detected anomalies in pump operation in the earth stage are presented. Analysis carried out for an acoustic signal envelope has shown high efficiency of the method. When oscillations of a mechanical shaft are present, the envelope level increases 1.5 times. More detailed investigation is carried out by the analysis of the spectrum of the pump acoustic signal envelope. During abnormal operation there are peaks, corresponding to the circulation frequency, and harmonics multiple of it, in the spectrum. 6 figs

  1. Characterization of BOR-60 Irradiated 14YWT-NFA1 Tubes

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Maloy, Stuart Andrew [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Aydogan, Eda [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-15

    Tubes of FCRD 14YWT-NFA1 Alloy were placed in the BOR-60 reactor and irradiated under a fast flux neutron environment to two conditions: 7 dpa at 360-370 °C and 6 dpa at 385-430 °C. Small sections of the tube were cut and sent to UC Berkeley for nanohardness testing and focused ion beam (FIB) milling of TEM specimens. FIB specimens were sent back to LANL for final FIB milling and TEM imaging. Hardness data and TEM images are presented in this report. This is the first fast reactor neutron irradiated information on the 14YWT-NFA1 alloy.

  2. Multi-criteria Analysis of Air Pollution with SO(2) and PM(10) in Urban Area Around the Copper Smelter in Bor, Serbia.

    Science.gov (United States)

    Nikolić, Djordje; Milošević, Novica; Mihajlović, Ivan; Zivković, Zivan; Tasić, Viša; Kovačević, Renata; Petrović, Nevenka

    2010-02-01

    This work presents the results of 4 years long monitoring of concentrations of SO(2) gas and PM(10) in the urban area around the copper smelter in Bor. The contents of heavy metals Pb, Cd, Cu, Ni, and As in PM(10) were determined and obtained values were compared to the limit values provided in EU Directives. Manifold excess concentrations of all the components in the atmosphere of the urban area of the townsite Bor were registered. Through application of a multi-criteria analysis by using PROMETHEE/GAIA method, the zones were ranked according to the level of pollution.

  3. Monitoring the Effect of Internet Use on Students Behavior Case Study: Technical Faculty Bor, University of Belgrade

    Science.gov (United States)

    Niculovic, Milica; Zivkovic, Dragana; Manasijevic, Dragan; Strbac, Nada

    2012-01-01

    A large number of criteria for evaluating Internet addiction have been developed recently. The research of Internet addiction among students of the Technical faculty in Bor, University of Belgrade has been conducted and its results are presented in this paper. The study included 270 students using criteria of Young's Internet Addiction Test. In…

  4. SHB1/HY1 Alleviates Excess Boron Stress by Increasing BOR4 Expression Level and Maintaining Boron Homeostasis in Arabidopsis Roots

    Directory of Open Access Journals (Sweden)

    Qiang Lv

    2017-05-01

    Full Text Available Boron is an essential mineral nutrient for higher plant growth and development. However, excessive amounts of boron can be toxic. Here, we report on the characterization of an Arabidopsis mutant, shb1 (sensitive to high-level of boron 1, which exhibits hypersensitivity to excessive boron in roots. Positional cloning demonstrated that the shb1 mutant bears a point mutation in a gene encoding a heme oxygenase 1 (HO1 corresponding to the HY1 gene involved in photomorphogenesis. The transcription level of the SHB1/HY1 gene in roots is up-regulated under excessive boron stimulation. Either overexpressing SHB1/HY1 or applying the HO1 inducer hematin reduces boron accumulation in roots and confers high boron tolerance. Furthermore, carbon monoxide and bilirubin, catalytic products of HO1, partially rescue the boron toxicity-induced inhibition of primary root growth in shb1. Additionally, the mRNA level of BOR4, a boron efflux transporter, is reduced in shb1 roots with high levels of boron supplementation, and hematin cannot relieve the boron toxicity-induced root inhibition in bor4 mutants. Taken together, our study reveals that HO1 acts via its catalytic by-products to promote tolerance of excessive boron by up-regulating the transcription of the BOR4 gene and therefore promoting the exclusion of excessive boron in root cells.

  5. Evaluation of signal processing for boiling noise detection. Further analysis of BOR-60 reactor noise data

    International Nuclear Information System (INIS)

    Ledwidge, T.J.; Black, J.L.

    1989-01-01

    The present paper deals with investigations of acoustic signals from a boiling experiment performed on the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is described. (author). 3 refs, 16 figs

  6. Mobility and natural attenuation of metals and arsenic in acidic waters of the drainage system of Timok River from Bor copper mines (Serbia) to Danube River.

    Science.gov (United States)

    Đorđievski, Stefan; Ishiyama, Daizo; Ogawa, Yasumasa; Stevanović, Zoran

    2018-06-22

    Bor, Krivelj, and Bela Rivers belong to the watershed of Timok River, which is a tributary of transboundary Danube River. These rivers receive metal-rich acidic wastewater from metallurgical facilities and acid mine drainage (AMD) from mine wastes around Bor copper mines. The aim of this study was to determine the mobility and natural attenuation of metals and arsenic in rivers from Bor copper mines to Danube River during the year 2015. The results showed that metallurgical facilities had the largest impact on Bor River by discharging about 400 t of Cu per year through highly acidic wastewater (pH = 2.6). The highest measured concentrations of Cu in river water and sediments were 40 mg L -1 and 1.6%, respectively. Dissolution of calcite from limestone bedrock and a high concentration of bicarbonate ions in natural river water (about 250 mg L -1 ) enhanced the neutralization of acidic river water and subsequent chemical precipitation of metals and arsenic. Decreases in the concentrations of Al, Fe, Cu, As, and Pb in river water were mainly due to precipitation on the river bed. On the other hand, dilution played an important role in the decreases in concentrations of Mn, Ni, Zn, and Cd. Chemically precipitated materials and flotation tailings containing Fe-rich minerals (fayalite, magnetite, and pyrite) were transported toward Danube River during the periods of high discharge. This study showed that processes of natural attenuation in catchments with limestone bedrock play an important role in reducing concentrations of metals and arsenic in AMD-bearing river water.

  7. Cytogenetic damage at low doses and the problem of bioindication of chronic low level radiation exposure

    International Nuclear Information System (INIS)

    Geras'kin, S.A.; Dikarev, V.G.; Nesterov, E.B.; Vasiliev, D.V.; Dikareva, N.S.

    2000-01-01

    radioactive wastes located at Sosnovy Bor in the Leningrad region was carried out in 1995-1999. Results of this research give evidence on pronounced genotoxic influence presence in investigated sites and as against the 30-km ChNPP zone in the Sosnovy Bor region chemical toxicants make the significant contribution to pollution of the environment. The seeds collected in control and experimental population were compared by acute γ-irradiation resistance. This comparison has revealed the selection toward the increase of repair system efficiency. The received results give evidence that although the cytogenetic damage frequency within low dose range cannot be used in biological dosimetry, but the indexes based on it are informative and important for the man-made effect bioindication and for identification of groups at risk of long term health consequences of radiation. (author)

  8. Pengaruh Perbedaan Kelas Umur terhadap Produktivitas Getah Pinus merkusii Jungh et de Vriese Ras Lahan Jawa melalui Penyadapan Getah Metode Bor

    Directory of Open Access Journals (Sweden)

    Agus Sukarno

    2013-09-01

    Full Text Available Pinus merkusii Jungh et de Vriese merupakan tanaman asli Indonesia, yang sebaran alaminya di Aceh, Tapanuli dan Kerinci. Penyadapan getah dengan metode bor pada kelas umur yang berbeda belum pernah dilakukan. Tujuan penelitian untuk mengetahui perbedaan produksi getah pinus di antara  kelas umur. Penelitian dilakukan di RPH Oro-oro Ombo, BKPH Pujon, KPH Malang pada tanaman pinus kelas umur III, IV,  V  dan VI  dengan ketinggian tempat antara 1.100 m –1.250 m dari permukaan air laut.  Waktu penelitian bulan September sampai dengan Nopember 2010.  Jumlah pohon yang disadap di setiap kelas umur sebanyak 150 - 160 pohon dengan dua lubang per pohon.  Penyadapan getah menggunakan bor mesin, kantong plastik tahan minyak diikatkan pada ujung pipa untuk menampung getah.  Pemungutan getah dilakukan sehari setelah penyadapan. Analisis  data  menggunakan  one way anova, apabila terdapat perbedaan yang nyata,  dilakukan uji lanjut dengan orthogonal polynomial. Produksi getah di antara kelas umur, menunjukkan perbedaan yang nyata. Produksi getah kelas umur III (36,5 g/ 2 lubang/1 hari meningkat pada kelas umur IV (62,9 g/2 lubang/1 hari dan menurun pada kelas umur V  (24,61 g/2 lubang/1 hari.  Produksi getah pada kelas umur VI (38,3 g/ 2 lubang/1 hari hampir sama dengan kelas umur III. Hasil uji lanjut orthogonal polynomial  menunjukkan respons  bersifat kuadratik (p=0,09 antara produksi getah dengan kelas umur. Kata Kunci: Pinus, kelas umur, getah, metode bor

  9. Necropolis on Bor lake: New reports on Bronze age burial

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar

    2011-01-01

    Full Text Available This article deals with the social and anthropological aspects of burial rituals during the Middle Bronze Age in Timočka Krajina. Decades of systematic research of necropolises and reconnaissance in the basin of the Crni Timok proved an increase in number of sites around ore - rich areas of the east Kučaj mountains as well as around Romuliana site and the fertile valleys of Džanovo polje (Map. 1. The quantitative increase in settlements was reflected by the emergence of large necropolises, only three of which have been systematically explored; those in Trnjani, Magura and Bor Lake (Fig. 1; Plan 1. Analysis of geographical features of many settlements and their position in relation to natural resources helped define two communities, one of which carried out mining and metallurgical activities, while the other group engaged in the production of food. Both groups lived in the immediate vicinity and mutual dependence, functioning within a developed market for copper production. During the exploration of the necropolis near Bor Lake in 1997, the remains of burnt skeletons were collected from burial structures 2/97 and 13/97 (Fig. 2; Plans 2 and 3. Anthropological analysis of the cremated remains of the deceased showed that high temperatures were used during the cremation process, which we assume could have only been achieved in metallurgical furnaces. This is confirmed by the fact that the skeletal fragments contain traces of melted metal, as well as finds of bronze slag inside urns and grave structures in the necropolis in Trnjani (Figs. 3 and 4; Tables 1-4. Burial ritual of this kind was not proved by systematic archaeological research of necropolises in the basin of Crni Timok, although anthropological data collected from necropolises linked to metallurgical settlements may indicate some guidelines in the ritual cremation of prominent members of these communities. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Arheologija Srbije

  10. New evidence for prehistoric copper metallurgy in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar

    2016-01-01

    Full Text Available The last three years of archaeological investigations at the site Ru`ana in Banjsko Polje, in the immediate vicinity of Bor, have provided new evidence regarding the role of non-ferrous metallurgy in the economy of the prehistoric communities of north-eastern Serbia. The remains of metallurgical furnaces and a large amount of metallic slags at two neighbouring sites in the mentioned settlement reveal that locations with many installations for the thermal processing of copper ore existed in the Bronze Age. We believe, judging by the finds of material culture, that metallurgical activities in this area also continued into the Iron Age and, possibly, into the 4th century AD. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Archaeology of Serbia: Cultural identity, integration factors, technological processes and the role of the central Balkans in the development of European prehistory

  11. Study of the accumulation and distribution of the radioactivity in the cooling circuit of the BOR-60 reactor

    International Nuclear Information System (INIS)

    Kizin, V.D.; Konyashov, V.V.; Lisitsyn, E.S.; Polyakov, V.I.; Chechetkin, Yu.V.

    1976-04-01

    The results of measurements of the radioactivity of the coolant and the deposits in the primary circuit of the BOR-60 reactor during its five years of operation are discussed. The values calculated for the exposure dose rate from the piping system and the contribution of the γ-radiation from the corrosion and fission product nuclides are given. The efficiency of coolant draining from the pipes in reducing the dose rate is estimated. (orig.) [de

  12. IAEA/IWGFR benchmark tests on sodium boiling noise detection. Part 2: Decision making and BOR-60 data

    International Nuclear Information System (INIS)

    Brown, C.J.; Hughes, G.; Overton, R.S.; Wey, B.O.

    1989-01-01

    The present paper deals with the second stage of investigations of acoustic signals from a boiling experiment performed on the KNS I loop at KfK Karlsruhe and first results of analysis of data from a series of boiling experiments carried out in the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is briefly described. (author). 5 refs, 23 figs

  13. Analysis of copper losses throughout weak acid effluent flows generated during off-gas treatment in the New Copper Smelter RTB Bor

    Directory of Open Access Journals (Sweden)

    Dragana Ivšić-Bajčeta

    2013-09-01

    Full Text Available The previous inadequate treatment of off-gas in RTB Bor in Serbia has resulted in serious pollution of the environment and the possibly high losses of copper through the effluent flows. The project of New Copper Smelter RTB Bor, besides the new flash smelting furnace (FSF and the reconstruction of Pierce-Smith converter (PSC, includes more effective effluent treatment. Paper presents an analysis of the new FSF and PSC off-gas treatment, determination of copper losses throughout generated wastewaters and discussion of its possible valorization. Assumptions about the solubility of metals phases present in the FSF and PSC off-gas, obtained by the treatment process simulation, were compared with the leaching results of flue dusts. Determined wastewaters characteristics indicate that the PSC flow is significantly richer in copper, mostly present in insoluble metallic/sulfide form, while the FSF flow has low concentration of copper in the form of completely soluble oxide/sulfate. The possible scenario for the copper valorization, considering arsenic and lead as limiting factors, is the separation of the FSF and PSC flows, return of the metallic/sulfide solid phase to the smelting process and recovery from the sulfate/oxide liquid phase.

  14. Neutron irradiation of V-Cr-Ti alloys in the BOR-60 fast reactor: Description of the fusion-1 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Rowcliffe, A.F. [Oak Ridge National Laboratory, TN (United States); Tsai, H.C.; Smith, D.L. [Argonne National Lab., IL (United States)] [and others

    1997-08-01

    The FUSION-1 irradiation capsule was inserted in Row 5 of the BOR-60 fast reactor in June 1995. The capsule contains a collaborative RF/U.S. experiment to investigate the irradiation performance of V-Cr-Ti alloys in the temperature range 310 to 350{degrees}C. This report describes the capsule layout, specimen fabrication history, and the detailed test matrix for the U.S. specimens. A description of the operating history and neutronics will be presented in the next semiannual report.

  15. 1x2M steel performance in the BOR-60 steam generator

    International Nuclear Information System (INIS)

    Golovanov, V.N.; Shamardin, V.K.; Kondratiev, V.I.; Kryukov, F.N.; Chernobrovkin, Yu.V.; Bulanova, T.M.; Bai, V.F.

    The results from studies of 1x2M steel characteristics are presented. This steel was used as the material for the BOR-60 steam generator that had been in operation under the steam generating mode for 18,000 hs (35,000 hs in sodium). It was revealed that the pit corrosion depth on the water/steam side evaporative tube surfaces was about 0.25 μm and less and the total corrosion rate was less than 0.06 mm/y. The mechanical properties of the material were essentially similar both in the evaporator and superheater and met all the requirements imposed on. Based on the analysis of data on the decarbonizaton depth in sodium and on the corrosion damage in water and steam it was concluded that 1x2M steel can be successfully used as the steam generator material at the operating temperatures up to 470 deg. C and had sufficiently longer service-life as compared to 18,000 hs. (author)

  16. The Novo Okno copper deposit of olistostrome origin (Bor, Eastern Serbia

    Directory of Open Access Journals (Sweden)

    Antonijević Ivan

    2011-01-01

    Full Text Available The copper deposit Novo Okno, uncovered at present, with non-ore and ore clasts of massive sulphides (from 0.5 to 50 m3 in size, has many distinctive features that indicate its olistostrome origin. The deposit is chaotic in structure, unstratified, with the lower surface unconformable over the underlying parent rock of the basin. It is a lens-like body, with the longer axis directed east and west, variable in thickness from 15 to 28 metres, about 335 metres long and less than 140 metres wide. These and other characteristics of the body indicate a unified, reworked, olistostrome copper deposit formed from primary ore bodies of the Bor mineral deposit and vulcanite, destroyed by volcanic explosion into blocks and rocks of Turonian age and extrusion and concurrent deposition on the land surface. Gravitational massive sliding of the consolidated rocks down the slopes of the volcanic relief and chaotic accumulation of ore and non-ore clasts (olistoliths in a marine basin evolved in the Upper Turonian and the Lower Senonian.

  17. New approach to the reclamation of the old flotation tailings in Bor

    Directory of Open Access Journals (Sweden)

    Dožić Stevan

    2010-01-01

    Full Text Available The old flotation tailings of the Bor copper mine have not been reclaimed for several decades, although it is a serious threat to the environment, especially to some parts of the town. To date, there have been no efficacious attempts of solving the problem by indirect rehabilitation, only several cases of direct reclamation. This paper presents some results of the experiment established on a part of the tailings in the vicinity of the town, where various variants of meliorated and sterile substrates were applied in the biological reclamation with several tree and grass species. The analysis shows that, in the rehabilitation of sterile substrate of the copper mine, it is possible to grow several woody species. The best results were achieved by the species that were planted in the fertile soil layer on the sterile copper mine substrate, and on the mixture of soil and waste. Among the woody species, Robinia pseudoaccacia, Fraxinus excelsior and Acer pseudoplatanus showed the best survival percent, growth, and physiological vitality and the poorest were spruce and common oak.

  18. Aluminum anode for aluminum-air battery - Part I: Influence of aluminum purity

    Science.gov (United States)

    Cho, Young-Joo; Park, In-Jun; Lee, Hyeok-Jae; Kim, Jung-Gu

    2015-03-01

    2N5 commercial grade aluminum (99.5% purity) leads to the lower aluminum-air battery performances than 4N high pure grade aluminum (99.99% purity) due to impurities itself and formed impurity complex layer which contained Fe, Si, Cu and others. The impurity complex layer of 2N5 grade Al declines the battery voltage on standby status. It also depletes discharge current and battery efficiency at 1.0 V which is general operating voltage of aluminum-air battery. However, the impurity complex layer of 2N5 grade Al is dissolved with decreasing discharge voltage to 0.8 V. This phenomenon leads to improvement of discharge current density and battery efficiency by reducing self-corrosion reaction. This study demonstrates the possibility of use of 2N5 grade Al which is cheaper than 4N grade Al as the anode for aluminum-air battery.

  19. A hypothetical severe reactor accident in Sosnovyj Bor, Russia

    International Nuclear Information System (INIS)

    Lahtinen, J.; Toivonen, H.; Poellaenen, R.; Nordlund, G.

    1993-12-01

    Individual doses and short-term radiological consequences from a hypothetical severe accident at the Russian nuclear power plant in Sosnovyj Bor were estimated for two sites in Finland. The sites are Kotka, located 140 km from the plant, and Helsinki, 220 km from the plant. The release was assumed to start immediately after the shutdown of the reactor (a 1000 MW RBMK unit) which had been operating at nominal power level for a long time. An effective release height of 500 m was assumed. The prevailing meteorological conditions during the release were taken to present the situation typical of the area (effective wind speed 9 m/s, neutral dispersion conditions). The release fractions applied in the study were of the same order as in the Chernobyl accident, i.e. 100% for noble gases, 60% for iodines, 40% for cesium and 1-10% for other radiologically important nuclides. The release was assumed to last 24 hours. However, half of the nuclides were released during the first hour. No attention was paid to the actual sequence of events that could lead to such release characteristics and time behaviour. The concentration and dose calculations were performed with a modified version of the computer code OIVA developed in Finnish Centre for Radiation and Nuclear Safety. Inhalation dose and external doses from the release plume and from the deposited activity were calculated for adults only, and no sheltering was considered. (11 refs., 4 figs., 6 tabs.)

  20. İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 / Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports

    Directory of Open Access Journals (Sweden)

    Tahir Bilirli

    2016-06-01

    Full Text Available İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 Öz Bu makale, Osmanlı Devleti'nde 1845 yılında ilan edilen Tensikât-ı mülkiye kararı çerçevesinde geçici olarak olarak kurulan İmar Meclisleri'nin görevlerini incelemektedir. Makalede, bu meclislerin özellikle halkın borç para alma durumları ile selem usulü denilen mahsulün hasattan önce satılması konusundaki faaliyetleri incelenmektedir. Hasat zamanından önce alınan vergi, ahaliyi borçlanmaya yöneltmekte, bu da halkın fahiş faiz oranlarıyla tefecilerden borç almalarına ve ürünün hasat edilmeden önce daha düşük fiyatlara satılmasına sebep olmaktaydı. Bu durum gelir kaybı nedeniyle hem tebaya hem de devlete zarar vermekteydi. İmar Meclisi memurları yaşanan bu sıkıntının giderilmesi noktasında yerinde durum tespiti yapmışlardır. Makalenin birinci bölümünde İmar Meclisleri'nin kuruluşu ve görevleri hakkında bilgi verilmektedir. İkinci bölümde makalenin ana konusu olan borçlanma ve selem usulünün uygulanmasının meclis raporlarına nasıl yansıdığı arşiv belgelerine göre ele alınmıştır. Makalenin sonuç bölümünde arşiv belgelerinde elde edilen veriler doğrultusunda değerlendirme yapılmıştır. Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports Abstract This article examines the mission of Macalis Imariyya (Develepment Counsils which were founded by the decree of Tankisat al-Mulkiyye declared in 1845. In the article, the activity of these Counsils about the indebtedness status of the people and the selling of products before the harvest -called “selem”- particularly examined. The tax collection before harvest period was impelling the people borrowing from usurers with excessive interest rates and to sell the product at nearly half price. This case was damaging both the state and the citizens because of income loss. Development Council

  1. STUDI KONEKTIVITAS AKUIFER ANTARA SUMUR BOR DENGAN SUMBER DAYA AIR DI BAWAHNYA (Study on Aquifer Connectivity, between Boreholes with water resources underneath

    Directory of Open Access Journals (Sweden)

    Agus Budhie Wijatna

    2013-11-01

    Full Text Available ABSTRAK Untuk memenuhi kebutuhan air bersih bagi penduduk di daerah bekas bencana letusan Gunung Merapi, Kabupaten Sleman, DIY, telah dibuat 5 sumur bor di Dusun Srunen (BH1, Pagerjurang (BH2, Ngepring (BH3, Kuweron (BH4, dan di Dusun Bubur (BH5. Pembuatan sumur bor pada elevasi antara 544 sampai 846 m.dpl, dengan kedalaman antara 98-146 m dan debit pengambilan airtanah rerata 9-10 liter per detik tersebut dikawatirkan akan mempengaruhi kondisi muka airtanah sumur gali di Dusun Pendowoharjo (W7, Ngaglik (W8, Gebang (W9, Condong Catur (W10, sumur UGM (W11 dan mempengaruhi debit umbul (mataair Ngepas (S8, Umbul Jogopaten (S9, Umbul Pajangan (S10, Umbul Londo (S11, Umbul Permai (S12, dan Umbul Seturan (S13, yang berada pada elevasi 148-329 m.dpl. Secara teoritis, pengambilan airtanah di sumur bor akan berpengaruh jika terdapat interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair. Pada penelitian ini, interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair dilakukan menggunakan isotop lingkungan (D, 3H dan 18O. Penelitian diawali dengan menentukan lokasi pengambilan sampel airtanah berdasarkan peta topografi dan kondisi hidrologi; sampel airtanah diambil dari sumur bor, sumur gali dan mataair sebanyak 30 ml dan 1.000 ml; rasio isotop δD dan δ18O pada sampel airtanah diukur dengan liquid-water stable isotope analyzer LGR DLT-100, sedangkan kadar tritium diukur dengan Liquid Scientillation Counter (LSC Tri Carb 1900 TR. Genesis sampel airtanah ditentukan berdasarkan komposisi isotop (δ18O, δD dengan mengacu pada persamaan Merapi Meteoric Water Line (MMWL; sedangkan untuk memastikan adanya interkoneksi hidraulik, maka hasil pengukuran kadar tritium dianalisis dengan tritium dating method. Hasil penelitian menunjukkan bahwa genesis airtanah di BH1, BH2, BH3, dan BH4 berbeda dengan genesis airtanah sumur gali dan mataair di bawahnya. Sehingga dapat disimpulkan airtanah sumur bor di BH1, BH2, BH3, dan BH4 tidak memiliki

  2. Packaging material and aluminum. Hoso zairyo to aluminum

    Energy Technology Data Exchange (ETDEWEB)

    Itaya, T [Mitsubishi Aluminum Co. Ltd., Tokyo (Japan)

    1992-02-01

    The present paper introduces aluminum foil packaging materials among the relation between packing materials and aluminum. The characteristics of aluminum foil in the packaging area are in its barrier performance, non-toxicity, tastelessness and odorlessness. Its excellent functions and processibility suit best as functional materials for food, medicine and industrial material packaging. While an aluminum foil may be used as a single packing material as in foils used in homes, many of it as a packaging material are used in combination with adhesives, papers or plastic films, or coated or printed. It is used as composite materials laminated or coated with other materials according to their use for the purpose of complementing the aluminum foil as the base material. Representative method to laminate aluminum foils include the wet lamination, dry lamination, thermally dissolved lamination and extruded lamination. The most important quality requirement in lamination is the adhesion strength, which requires a close attention in selecting the kinds of adhesive, laminating conditions, and aging conditions. 8 figs., 6 tabs.

  3. Preliminary analysis of levels of arsenic and other metalic elements in PM10 sampled near Copper Smelter Bor (Serbia

    Directory of Open Access Journals (Sweden)

    Renata Kovačević

    2010-09-01

    Full Text Available In this paper, the levels of twenty one elements (Ag, Al, As, B, Ba, Ca, Cd, Cr, Cu, Fe, K, Mg, Mn, Mo, Na, Ni, Pb, S, Se, Sr and Zn in PM10 are presented, as well as SO2 concentration, measured at the sampling site in an urban area of the town of Bor (40,000 inhabitants in eastern Serbia. The sampling site was located in a densely populated city center about 0.65 km away from one of the largest copper mines and copper smelters in Europe. For the first time PM10 was collected using the European standard sampler, during a preliminary campaign in duration of 7 days in early spring 2009. PM10 were sampled on PTFE membrane filters and element concentrations were quantified by GF AAS and ICP AES. Concentration levels and correlations within trace elements, PM10 and SO2 indicated that industrial activities underpinned with meteorological conditions of low wind speed (calm are the main factors that influence air pollution in a densely populated area. It was evident that both PM10 mass concentration and SO2 concentration once exceeded the daily limit values during a measuring period of seven days. Strong relationship was found between PM10 and Mn, Mg, Ca and B daily average concentrations. On the other hand, SO2 correlated strongly with As, Pb, Cd, Cu and S daily average concentrations. These results confirm the relationship between emissions of SO2 from the Copper Smelter Bor and calm meteorological conditions (wind speed less than 0.5 m/sec with the concentration levels of carcinogenic substances of arsenic, lead and cadmium in ambient air.

  4. Interpenetrated Uranyl-Organic Frameworks with bor and pts Topology: Structure, Spectroscopy, and Computation.

    Science.gov (United States)

    Liu, Chao; Chen, Fang-Yuan; Tian, Hong-Rui; Ai, Jing; Yang, Weiting; Pan, Qing-Jiang; Sun, Zhong-Ming

    2017-11-20

    Two novel three-dimensional interpenetrated uranyl-organic frameworks, (NH 4 ) 4 [(UO 2 ) 4 (L 1 ) 3 ]·6H 2 O (1) and [(UO 2 ) 2 (H 2 O) 2 L 2 ]·2H 2 O (2), where L 1 = tetrakis(3-carboxyphenyl)silicon and L 2 = tetrakis(4-carboxyphenyl)silicon, were synthesized by a combination of two isomeric tetrahedral silicon-centered ligands with 3-connected triangular [(UO 2 )(COO) 3 ] - and 4-connected dinuclear [(UO 2 ) 2 (COO) 4 ] units, respectively. Structural analyses indicate that 1 possesses a 2-fold interpenetrating anion bor network, while 2 exhibits a 3-fold interpenetrated 4,4-connected neutral network with pts topology. Both compounds were characterized by thermogravimetric analysis and IR, UV-vis, and photoluminescence spectroscopy. A relativistic density functional theory (DFT) investigation on 10 model compounds of 1 and 2 shows good agreement of the structural parameters, stretching vibrational frequencies, and absorption with experimental results; the time-dependent DFT calculations unravel that low-energy absorption bands originate from ligand-to-uranium charge transfer.

  5. Radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor

    International Nuclear Information System (INIS)

    Ilvonen, M.; Rossi, J.; Salonoja, M.

    1994-06-01

    The present study is an application of the long range transport and dose model TRADOS developed jointly by the Finnish Meteorological Institute and Technical Research Centre of Finland. The aim of the study is to assess the radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor near St. Petersburg in Russia. Probabilities of reaching different parts of the country, transport time and time spent over Finland by the trajectories are presented. Also breadth of the radioactive cloud and incidence of rain are estimated. The calculated radiation doses are based on one single hypothetical release, in which all noble gases are released, together with 10 % of easily vaporizing elements and 1 % of others. All results are based on the assumption that the probability of the release is 100 %. The dose pathways calculated are cloud gamma, fallout gamma, inhalation, and ingestion of milk, meat, green vegetables, grain and roots. External dose rates have been calculated. The necessity of countermeasures and the ratio of the avertable dose to the costs are also assessed. (13 refs., 156 figs., 12 tabs.)

  6. Helium trapping in aluminum and sintered aluminum powders

    International Nuclear Information System (INIS)

    Das, S.K.; Kaminsky, M.; Rossing, T.

    1975-01-01

    The surface erosion of annealed aluminum and of sintered aluminum powder (SAP) due to blistering from implantation of 100-keV 4 He + ions at room temperature has been investigated. A substantial reduction in the blistering erosion rate in SAP was observed from that in pure annealed aluminum. In order to determine whether the observed reduction in blistering is due to enhanced helium trapping or due to helium released, the implanted helium profiles in annealed aluminum and in SAP have been studied by Rutherford backscattering. The results show that more helium is trapped in SAP than in aluminum for identical irradiation conditions. The observed reduction in erosion from helium blistering in SAP is more likely due to the dispersion of trapped helium at the large Al-Al 2 O 3 interfaces and at the large grain boundaries in SAP than to helium release

  7. Graphene-aluminum nanocomposites

    International Nuclear Information System (INIS)

    Bartolucci, Stephen F.; Paras, Joseph; Rafiee, Mohammad A.; Rafiee, Javad; Lee, Sabrina; Kapoor, Deepak; Koratkar, Nikhil

    2011-01-01

    Highlights: → We investigated the mechanical properties of aluminum and aluminum nanocomposites. → Graphene composite had lower strength and hardness compared to nanotube reinforcement. → Processing causes aluminum carbide formation at graphene defects. → The carbides in between grains is a source of weakness and lowers tensile strength. - Abstract: Composites of graphene platelets and powdered aluminum were made using ball milling, hot isostatic pressing and extrusion. The mechanical properties and microstructure were studied using hardness and tensile tests, as well as electron microscopy, X-ray diffraction and differential scanning calorimetry. Compared to the pure aluminum and multi-walled carbon nanotube composites, the graphene-aluminum composite showed decreased strength and hardness. This is explained in the context of enhanced aluminum carbide formation with the graphene filler.

  8. IWGFR benchmark test on signal processing for boiling noise detection, stage 2: Analysis of data from BOR-60

    International Nuclear Information System (INIS)

    Rowley, R.; Waites, C.; Macleod, I.D.

    1989-01-01

    Data from boiling experiments in the BOR 60 reactor in USSR has been supplied by IAEA to enable analysis techniques to be compared. The signals have been analysed at RNL using two basic techniques, High Frequency RMS analysis and Pulse Counting analysis and two more sophisticated methods, Pattern Recognition and Pulse Timing Analysis. All methods indicated boiling successfully, pulse counting proved more sensitive than RMS for the detection of the onset of boiling. Pattern Recognition shows promise of a very reliable detector provided the background can be defined. Data from an Ionisation chamber was also supplied and there was good correlation between the neutronic and acoustic signals. (author). 25 figs, 4 tabs

  9. Selective Adsorption of Sodium Aluminum Fluoride Salts from Molten Aluminum

    Energy Technology Data Exchange (ETDEWEB)

    Leonard S. Aubrey; Christine A. Boyle; Eddie M. Williams; David H. DeYoung; Dawid D. Smith; Feng Chi

    2007-08-16

    Aluminum is produced in electrolytic reduction cells where alumina feedstock is dissolved in molten cryolite (sodium aluminum fluoride) along with aluminum and calcium fluorides. The dissolved alumina is then reduced by electrolysis and the molten aluminum separates to the bottom of the cell. The reduction cell is periodically tapped to remove the molten aluminum. During the tapping process, some of the molten electrolyte (commonly referred as “bath” in the aluminum industry) is carried over with the molten aluminum and into the transfer crucible. The carryover of molten bath into the holding furnace can create significant operational problems in aluminum cast houses. Bath carryover can result in several problems. The most troublesome problem is sodium and calcium pickup in magnesium-bearing alloys. Magnesium alloying additions can result in Mg-Na and Mg-Ca exchange reactions with the molten bath, which results in the undesirable pickup of elemental sodium and calcium. This final report presents the findings of a project to evaluate removal of molten bath using a new and novel micro-porous filter media. The theory of selective adsorption or removal is based on interfacial surface energy differences of molten aluminum and bath on the micro-porous filter structure. This report describes the theory of the selective adsorption-filtration process, the development of suitable micro-porous filter media, and the operational results obtained with a micro-porous bed filtration system. The micro-porous filter media was found to very effectively remove molten sodium aluminum fluoride bath by the selective adsorption-filtration mechanism.

  10. Aluminum recovery as a product with high added value using aluminum hazardous waste

    International Nuclear Information System (INIS)

    David, E.; Kopac, J.

    2013-01-01

    Highlights: • Granular and compact aluminum dross were physically and chemically characterized. • A relationship between density, porosity and metal content from dross was established. • Chemical reactions involving aluminum in landfill and negative consequences are shown. • A processing method for aluminum recovering from aluminum dross was developed. • Aluminum was recovered as an value product with high grade purity such as alumina. -- Abstract: The samples of hazardous aluminum solid waste such as dross were physically and chemically characterized. A relationship between density, porosity and metal content of dross was established. The paper also examines the chemical reactions involving aluminum dross in landfill and the negative consequences. To avoid environmental problems and to recovery the aluminum, a processing method was developed and aluminum was recovered as an added value product such as alumina. This method refers to a process at low temperature, in more stages: acid leaching, purification, precipitation and calcination. At the end of this process aluminum was extracted, first as Al 3+ soluble ions and final as alumina product. The composition of the aluminum dross and alumina powder obtained were measured by applying the leaching tests, using atomic absorption spectrometry (AAS) and chemical analysis. The mineralogical composition of aluminum dross samples and alumina product were determined by X-ray diffraction (XRD) and the morphological characterization was performed by scanning electron microscopy (SEM). The method presented in this work allows the use of hazardous aluminum solid waste as raw material to recover an important fraction from soluble aluminum content as an added value product, alumina, with high grade purity (99.28%)

  11. Bioleaching of copper from old flotation tailings samples (Copper Mine Bor, Serbia

    Directory of Open Access Journals (Sweden)

    Stanković Srđan

    2015-01-01

    Full Text Available Bioleaching of samples taken from depths of 10, 15, and 20 meters from old flotation tailings of the Copper Mine Bor was conducted in shaken flasks using extremely acidic water of Lake Robuleas lixiviant. Yield of copper after five weeks of the bioleaching experiment was 68.34±1.21% for 15 m sample, 72.57±0.57% for 20 m sample and 97.78±5.50% for 10 m sample. The obtained results were compared to the results of acid leaching of the same samples and it was concluded that bioleaching was generally more efficient for the treatment of samples taken from depths of 10 m and 20 m. The content of pyrite in the 20 m sample, which contained the highest amount of this mineral, was reduced after bioleaching. Benefits of this approach are: recovery of substantial amounts of copper, reducing the environmental impact of flotation tailings and the application of abundant and free water from the Robule acidic lake as lixiviant. Results of the experiment showed that bioleaching can be more efficient than acid leaching for copper extraction from flotation tailings with higher sulfide contents. [Projekat Ministarstva nauke Republike Srbije, br. 176016 i br. 173048

  12. A Study of the Optimal Model of the Flotation Kinetics of Copper Slag from Copper Mine BOR

    Science.gov (United States)

    Stanojlović, Rodoljub D.; Sokolović, Jovica M.

    2014-10-01

    In this study the effect of mixtures of copper slag and flotation tailings from copper mine Bor, Serbia on the flotation results of copper recovery and flotation kinetics parameters in a batch flotation cell has been investigated. By simultaneous adding old flotation tailings in the ball mill at the rate of 9%, it is possible to increase copper recovery for about 20%. These results are compared with obtained copper recovery of pure copper slag. The results of batch flotation test were fitted by MatLab software for modeling the first-order flotation kinetics in order to determine kinetics parameters and define an optimal model of the flotation kinetics. Six kinetic models are tested on the batch flotation copper recovery against flotation time. All models showed good correlation, however the modified Kelsall model provided the best fit.

  13. Aluminum powder metallurgy processing

    Energy Technology Data Exchange (ETDEWEB)

    Flumerfelt, J.F.

    1999-02-12

    The objective of this dissertation is to explore the hypothesis that there is a strong linkage between gas atomization processing conditions, as-atomized aluminum powder characteristics, and the consolidation methodology required to make components from aluminum powder. The hypothesis was tested with pure aluminum powders produced by commercial air atomization, commercial inert gas atomization, and gas atomization reaction synthesis (GARS). A comparison of the GARS aluminum powders with the commercial aluminum powders showed the former to exhibit superior powder characteristics. The powders were compared in terms of size and shape, bulk chemistry, surface oxide chemistry and structure, and oxide film thickness. Minimum explosive concentration measurements assessed the dependence of explosibility hazard on surface area, oxide film thickness, and gas atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization oxidation of aluminum powder. An Al-Ti-Y GARS alloy exposed in ambient air at different temperatures revealed the effect of reactive alloy elements on post-atomization powder oxidation. The pure aluminum powders were consolidated by two different routes, a conventional consolidation process for fabricating aerospace components with aluminum powder and a proposed alternative. The consolidation procedures were compared by evaluating the consolidated microstructures and the corresponding mechanical properties. A low temperature solid state sintering experiment demonstrated that tap densified GARS aluminum powders can form sintering necks between contacting powder particles, unlike the total resistance to sintering of commercial air atomization aluminum powder.

  14. The Oxidation Products of Aluminum Hydride and Boron Aluminum Hydride Clusters

    Science.gov (United States)

    2016-01-04

    AFRL-AFOSR-VA-TR-2016-0075 The Oxidation Products of Aluminum Hydride and Boron Aluminum Hydride Clusters KIT BOWEN JOHNS HOPKINS UNIV BALTIMORE MD...2. REPORT TYPE Final Performance 3. DATES COVERED (From - To) 30-09-2014 to 29-09-2015 4. TITLE AND SUBTITLE The Oxidation Products of Aluminum ...Hydride and Boron Aluminum Hydride Clusters 5a.  CONTRACT NUMBER 5b.  GRANT NUMBER FA9550-14-1-0324 5c.  PROGRAM ELEMENT NUMBER 61102F 6. AUTHOR(S) KIT

  15. Aluminum Hydroxide

    Science.gov (United States)

    Aluminum hydroxide is used for the relief of heartburn, sour stomach, and peptic ulcer pain and to ... Aluminum hydroxide comes as a capsule, a tablet, and an oral liquid and suspension. The dose and ...

  16. On the re-emergence of motion and innovations in the Gábor Bódy's intermedia experiments

    Directory of Open Access Journals (Sweden)

    Kamil Lipiński

    2015-06-01

    Full Text Available The article explores the main cases of Hungarian neo-avant-garde cinema in terms of re-emergence of visual material and the introduction of electronic innovations resulting in the transformation of reality. Among the research conducted in Béla Balázs Studio based on reframing the perception limits in the 1960s and the 1970s, the most innovative were Gábor Bódy's intermedia experiments. Along with launching K/3 subgroup within BBS, Bódy directed its objectives to reduce the material derived from reality and to visually intervene into media image electronically transforming the landscape of his films. Innovatively adapting the Sándor Weöres's verse, the film Narcissus and Psyche (1983 aimed at using hyper-real aesthetics to reframe the film reality. Starting from 1980, Bódy founded an international magazine Infermental to disseminate the advent of the video and electronics by creating a community drew on sharing news about emerging media image.

  17. Mechanical properties and TEM examination of RAFM steels irradiated up to 70 dpa in BOR-60

    Energy Technology Data Exchange (ETDEWEB)

    Gaganidze, E., E-mail: Ermile.Gaganidze@kit.edu [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Petersen, C.; Materna-Morris, E.; Dethloff, C.; Weiss, O.J.; Aktaa, J. [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Povstyanko, A.; Fedoseev, A.; Makarov, O.; Prokhorov, V. [Joint Stock Company ' State Scientific Centre Research Institute of Atomic Reactors' , 433510 Dimitrovgrad-10, Ulyanovsk Region (Russian Federation)

    2011-10-01

    Mechanical properties of Reduced Activation Ferritic/Martensitic (RAFM) steels were studied after irradiation in BOR-60 reactor to a neutron displacement damage of 70 dpa at 330-340 deg. C. Yield stress and Ductile-to-Brittle-Transition-Temperature of EUROFER97 indicate saturation of hardening and embrittlement. The phenomenological models for description of microstructure evolution and resulting irradiation hardening and embrittlement are discussed. The evolution of yield stress with dose is qualitatively understood within a Whapham and Makin model. Dislocation loops examined in TEM are considered a main source for low-temperature irradiation hardening. The analysis of the fatigue data in terms of the inelastic strain reveals comparable fatigue behaviour both for unirradiated and irradiated conditions, which can be described by a common Manson-Coffin relation. The study of helium effects in B-doped model steels indicated progressive material embrittlement with helium content. Post-irradiation annealing of RAFM steels yielded substantial recovery of mechanical properties.

  18. Is the Aluminum Hypothesis Dead?

    Science.gov (United States)

    2014-01-01

    The Aluminum Hypothesis, the idea that aluminum exposure is involved in the etiology of Alzheimer disease, dates back to a 1965 demonstration that aluminum causes neurofibrillary tangles in the brains of rabbits. Initially the focus of intensive research, the Aluminum Hypothesis has gradually been abandoned by most researchers. Yet, despite this current indifference, the Aluminum Hypothesis continues to attract the attention of a small group of scientists and aluminum continues to be viewed with concern by some of the public. This review article discusses reasons that mainstream science has largely abandoned the Aluminum Hypothesis and explores a possible reason for some in the general public continuing to view aluminum with mistrust. PMID:24806729

  19. 75 FR 70689 - Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum-Greenwood Forge Division; Currently...

    Science.gov (United States)

    2010-11-18

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-70,376] Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum- Greenwood Forge Division; Currently Known As Contech Forgings, LLC..., applicable to workers of Kaiser Aluminum Fabricated Products, LLC, Kaiser Aluminum-Greenwood Forge Division...

  20. The effect of zinc on the aluminum anode of the aluminum-air battery

    Science.gov (United States)

    Tang, Yougen; Lu, Lingbin; Roesky, Herbert W.; Wang, Laiwen; Huang, Baiyun

    Aluminum is an ideal material for batteries, due to its excellent electrochemical performance. Herein, the effect of zinc on the aluminum anode of the aluminum-air battery, as an additive for aluminum alloy and electrolytes, has been studied. The results show that zinc can decrease the anodic polarization, restrain the hydrogen evolution and increase the anodic utilization rate.

  1. Aluminum phosphate shows more adjuvanticity than Aluminum hydroxide in recombinant hepatitis –B vaccine formulation

    Directory of Open Access Journals (Sweden)

    2008-08-01

    Full Text Available Background: Although a number of investigation have been carried out to find alternative adjuvants to aluminum salts in vaccine formulations, they are still extensively used due to their good track record of safety, low cost and proper adjuvanticity with a variety of antigens. Adsorption of antigens onto aluminum compounds depends heavily on electrostatic forces between adjuvant and antigen. Commercial recombinant protein hepatitis B vaccines containing aluminum hydroxide as adjuvant is facing low induction of immunity in some sections of the vaccinated population. To follow the current global efforts in finding more potent hepatitis B vaccine formulation, adjuvanticity of aluminum phosphate has been compared to aluminum hydroxide. Materials and methods: The adjuvant properties of aluminum hydroxide and aluminum phosphate in a vaccine formulation containing a locally manufactured hepatitis B (HBs surface antigen was evaluated in Balb/C mice. The formulations were administered intra peritoneally (i.p. and the titers of antibody which was induced after 28 days were determined using ELISA technique. The geometric mean of antibody titer (GMT, seroconversion and seroprotection rates, ED50 and relative potency of different formulations were determined. Results: All the adjuvanicity markers obtained in aluminum phosphate formulation were significantly higher than aluminum hydroxide. The geometric mean of antibody titer of aluminum phosphate was approximately three folds more than aluminum hydroxide. Conclusion: Aluminum phosphate showed more adjuvanticity than aluminum hydroxide in hepatitis B vaccine. Therefore the use of aluminum phosphate as adjuvant in this vaccine may lead to higher immunity with longer duration of effects in vaccinated groups.

  2. Aluminum fin-stock alloys

    International Nuclear Information System (INIS)

    Gul, R.M.; Mutasher, F.

    2007-01-01

    Aluminum alloys have long been used in the production of heat exchanger fins. The comparative properties of the different alloys used for this purpose has not been an issue in the past, because of the significant thickness of the finstock material. However, in order to make fins lighter in weight, there is a growing demand for thinner finstock materials, which has emphasized the need for improved mechanical properties, thermal conductivity and corrosion resistance. The objective of this project is to determine the effect of iron, silicon and manganese percentage increment on the required mechanical properties for this application by analyzing four different aluminum alloys. The four selected aluminum alloys are 1100, 8011, 8079 and 8150, which are wrought non-heat treatable alloys with different amount of the above elements. Aluminum alloy 1100 serve as a control specimen, as it is commercially pure aluminum. The study also reports the effect of different annealing cycles on the mechanical properties of the selected alloys. Metallographic examination was also preformed to study the effect of annealing on the precipitate phases and the distribution of these phases for each alloy. The microstructure analysis of the aluminum alloys studied indicates that the precipitated phase in the case of aluminum alloys 1100 and 8079 is beta-FeAI3, while in 8011 it is a-alfa AIFeSi, and the aluminum alloy 8150 contains AI6(Mn,Fe) phase. The comparison of aluminum alloys 8011 and 8079 with aluminum alloy 1100 show that the addition of iron and silicon improves the percent elongation and reduces strength. The manganese addition increases the stability of mechanical properties along the annealing range as shown by the comparison of aluminum alloy 8150 with aluminum alloy 1100. Alloy 8150 show superior properties over the other alloys due to the reaction of iron and manganese, resulting in a preferable response to thermal treatment and improved mechanical properties. (author)

  3. Irradiation Microstructure of Austenitic Steels and Cast Steels Irradiated in the BOR-60 Reactor at 320°C

    Science.gov (United States)

    Yang, Yong; Chen, Yiren; Huang, Yina; Allen, Todd; Rao, Appajosula

    Reactor internal components are subjected to neutron irradiation in light water reactors, and with the aging of nuclear power plants around the world, irradiation-induced material degradations are of concern for reactor internals. Irradiation-induced defects resulting from displacement damage are critical for understanding degradation in structural materials. In the present work, microstructural changes due to irradiation in austenitic stainless steels and cast steels were characterized using transmission electron microscopy. The specimens were irradiated in the BOR-60 reactor, a fast breeder reactor, up to 40 dpa at 320°C. The dose rate was approximately 9.4x10-7 dpa/s. Void swelling and irradiation defects were analyzed for these specimens. A high density of faulted loops dominated the irradiated-altered microstructures. Along with previous TEM results, a dose dependence of the defect structure was established at 320°C.

  4. Investigation of Methods for Selectively Reinforcing Aluminum and Aluminum-Lithium Materials

    Science.gov (United States)

    Bird, R. Keith; Alexa, Joel A.; Messick, Peter L.; Domack, Marcia S.; Wagner, John A.

    2013-01-01

    Several studies have indicated that selective reinforcement offers the potential to significantly improve the performance of metallic structures for aerospace applications. Applying high-strength, high-stiffness fibers to the high-stress regions of aluminum-based structures can increase the structural load-carrying capability and inhibit fatigue crack initiation and growth. This paper discusses an investigation into potential methods for applying reinforcing fibers onto the surface of aluminum and aluminum-lithium plate. Commercially-available alumina-fiber reinforced aluminum alloy tapes were used as the reinforcing material. Vacuum hot pressing was used to bond the reinforcing tape to aluminum alloy 2219 and aluminum-lithium alloy 2195 base plates. Static and cyclic three-point bend testing and metallurgical analysis were used to evaluate the enhancement of mechanical performance and the integrity of the bond between the tape and the base plate. The tests demonstrated an increase in specific bending stiffness. In addition, no issues with debonding of the reinforcing tape from the base plate during bend testing were observed. The increase in specific stiffness indicates that selectively-reinforced structures could be designed with the same performance capabilities as a conventional unreinforced structure but with lower mass.

  5. 40 CFR 180.1091 - Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Aluminum isopropoxide and aluminum... PESTICIDE CHEMICAL RESIDUES IN FOOD Exemptions From Tolerances § 180.1091 Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a tolerance. Aluminum isopropoxide (CAS Reg. No. 555...

  6. A simple aluminum gasket for use with both stainless steel and aluminum flanges

    Energy Technology Data Exchange (ETDEWEB)

    Langley, R.A.

    1991-01-01

    A technique has been developed for making aluminum wire seal gaskets of various sizes and shapes for use with both stainless steel and aluminum alloy flanges. The gasket material used is 0.9999 pure aluminum, drawn to a diameter of 3 mm. This material can be easily welded and formed into various shapes. A single gasket has been successfully used up to five times without baking. The largest gasket tested to date is 3.5 m long and was used in the shape of a parallelogram. Previous use of aluminum wire gaskets, including results for bakeout at temperatures from 20 to 660{degree}C, is reviewed. A search of the literature indicates that this is the first reported use of aluminum wire gaskets for aluminum alloy flanges. The technique is described in detail, and the results are summarized. 11 refs., 4 figs.

  7. The aluminum smelting process.

    Science.gov (United States)

    Kvande, Halvor

    2014-05-01

    This introduction to the industrial primary aluminum production process presents a short description of the electrolytic reduction technology, the history of aluminum, and the importance of this metal and its production process to modern society. Aluminum's special qualities have enabled advances in technologies coupled with energy and cost savings. Aircraft capabilities have been greatly enhanced, and increases in size and capacity are made possible by advances in aluminum technology. The metal's flexibility for shaping and extruding has led to architectural advances in energy-saving building construction. The high strength-to-weight ratio has meant a substantial reduction in energy consumption for trucks and other vehicles. The aluminum industry is therefore a pivotal one for ecological sustainability and strategic for technological development.

  8. Deposition behavior of residual aluminum in drinking water distribution system: Effect of aluminum speciation.

    Science.gov (United States)

    Zhang, Yue; Shi, Baoyou; Zhao, Yuanyuan; Yan, Mingquan; Lytle, Darren A; Wang, Dongsheng

    2016-04-01

    Finished drinking water usually contains some residual aluminum. The deposition of residual aluminum in distribution systems and potential release back to the drinking water could significantly influence the water quality at consumer taps. A preliminary analysis of aluminum content in cast iron pipe corrosion scales and loose deposits demonstrated that aluminum deposition on distribution pipe surfaces could be excessive for water treated by aluminum coagulants including polyaluminum chloride (PACl). In this work, the deposition features of different aluminum species in PACl were investigated by simulated coil-pipe test, batch reactor test and quartz crystal microbalance with dissipation monitoring. The deposition amount of non-polymeric aluminum species was the least, and its deposition layer was soft and hydrated, which indicated the possible formation of amorphous Al(OH)3. Al13 had the highest deposition tendency, and the deposition layer was rigid and much less hydrated, which indicated that the deposited aluminum might possess regular structure and self-aggregation of Al13 could be the main deposition mechanism. While for Al30, its deposition was relatively slower and deposited aluminum amount was relatively less compared with Al13. However, the total deposited mass of Al30 was much higher than that of Al13, which was attributed to the deposition of particulate aluminum matters with much higher hydration state. Compared with stationary condition, stirring could significantly enhance the deposition process, while the effect of pH on deposition was relatively weak in the near neutral range of 6.7 to 8.7. Copyright © 2015. Published by Elsevier B.V.

  9. Production of aluminum metal by electrolysis of aluminum sulfide

    Science.gov (United States)

    Minh, Nguyen Q.; Loutfy, Raouf O.; Yao, Neng-Ping

    1984-01-01

    Production of metallic aluminum by the electrolysis of Al.sub.2 S.sub.3 at 700.degree.-800.degree. C. in a chloride melt composed of one or more alkali metal chlorides, and one or more alkaline earth metal chlorides and/or aluminum chloride to provide improved operating characteristics of the process.

  10. BONDING ALUMINUM METALS

    Science.gov (United States)

    Noland, R.A.; Walker, D.E.

    1961-06-13

    A process is given for bonding aluminum to aluminum. Silicon powder is applied to at least one of the two surfaces of the two elements to be bonded, the two elements are assembled and rubbed against each other at room temperature whereby any oxide film is ruptured by the silicon crystals in the interface; thereafter heat and pressure are applied whereby an aluminum-silicon alloy is formed, squeezed out from the interface together with any oxide film, and the elements are bonded.

  11. Calidad de abonos orgánicos empleados en la depresión de Quíbor-Venezuela bajo ambientes protegidos

    Directory of Open Access Journals (Sweden)

    Duilio Torres Rodríguez

    2017-01-01

    Full Text Available La depresión de Quíbor es una de las zonas agrícolas más importante de Venezuela, donde en los últimos años se han introducido sistemas de producción bajo ambientes protegidos, los cuales están acompañados por el uso de abonos orgánicos, no certi cados. El objetivo de esta investigación fue evaluar la calidad de los abonos orgánicos empleados en sistemas de producción bajo ambientes protegidos en la depresión de Quíbor, Venezuela. Se realizó un diseño experimental completamente al azar y se evaluaron once (11 abonos orgánicos (cuatro sólidos y siete líquidos por triplicados. Los abonos sólidos fueron colectados en la parte superior, inferior y media de las pilas, mientras que los líquidos fueron tomados directamente de los tanques de almacenamiento. Para la caracterización de los abonos se empleó el protocolo TMECC, la materia orgánica se determinó por calcinación a 450°C, el nitrógeno por Kjeldahl y los macronutrientes (potasio y calcio y micronutrientes (cobre, manganeso, hierro y zinc en extracto acuoso 1/20 (v/v del material y cuantificación por absorción atómica. Los resultados obtenidos muestran que el vermicompost y compost de gallinaza presentaron los valores más altos de macronutrientes, mientras, para los abonos líquidos Macro®, fue quien presentó la mayor concentración de nitrógeno, humus1 los valores más altos de Ca y Mg y Micro® y humus2 los mayores contenidos de manganeso, hierro, cobre y zinc fueron encontrados, todos los abonos sólidos presentaron valores bajos de micronutrientes.

  12. Borated aluminum alloy manufacturing technology

    International Nuclear Information System (INIS)

    Shimojo, Jun; Taniuchi, Hiroaki; Kajihara, Katsura; Aruga, Yasuhiro

    2003-01-01

    Borated aluminum alloy is used as the basket material of cask because of its light weight, thermal conductivity and superior neutron absorbing abilities. Kobe Steel has developed a unique manufacturing process for borated aluminum alloy using a vacuum induction melting method. In this process, aluminum alloy is melted and agitated at higher temperatures than common aluminum alloy fabrication methods. It is then cast into a mold in a vacuum atmosphere. The result is a high quality aluminum alloy which has a uniform boron distribution and no impurities. (author)

  13. 21 CFR 73.1645 - Aluminum powder.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Aluminum powder. 73.1645 Section 73.1645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1645 Aluminum powder. (a) Identity. (1) The color additive aluminum powder shall be composed of finely divided particles of aluminum prepared from virgin aluminum. It...

  14. ALUMINUM BOX BUNDLING PRESS

    Directory of Open Access Journals (Sweden)

    Iosif DUMITRESCU

    2015-05-01

    Full Text Available In municipal solid waste, aluminum is the main nonferrous metal, approximately 80- 85% of the total nonferrous metals. The income per ton gained from aluminum recuperation is 20 times higher than from glass, steel boxes or paper recuperation. The object of this paper is the design of a 300 kN press for aluminum box bundling.

  15. Progress in Aluminum Electrolysis Control and Future Direction for Smart Aluminum Electrolysis Plant

    Science.gov (United States)

    Zhang, Hongliang; Li, Tianshuang; Li, Jie; Yang, Shuai; Zou, Zhong

    2017-02-01

    The industrial aluminum reduction cell is an electrochemistry reactor that operates under high temperatures and highly corrosive conditions. However, these conditions have restricted the measurement of key control parameters, making the control of aluminum reduction cells a difficult problem in the industry. Because aluminum electrolysis control systems have a significant economic influence, substantial research has been conducted on control algorithms, control systems and information systems for aluminum reduction cells. This article first summarizes the development of control systems and then focuses on the progress made since 2000, including alumina concentration control, temperature control and electrolyte molecular ratio control, fault diagnosis, cell condition prediction and control system expansion. Based on these studies, the concept of a smart aluminum electrolysis plant is proposed. The frame construction, key problems and current progress are introduced. Finally, several future directions are discussed.

  16. Research of plating aluminum and aluminum foil on internal surface of carbon fiber composite material centrifuge rotor drum

    International Nuclear Information System (INIS)

    Lu Xiuqi; Dong Jinping; Dai Xingjian

    2014-01-01

    In order to improve the corrosion resistance, thermal conductivity and sealability of the internal surface of carbon fiber/epoxy composite material centrifuge rotor drum, magnetron sputtering aluminum and pasting an aluminum foil on the inner wall of the drum are adopted to realize the aim. By means of XRD, SEM/EDS and OM, the surface topography of aluminum coated (thickness of 5 μm and 12 μm) and aluminum foil (12 μm) are observed and analyzed; the cohesion of between aluminum coated (or aluminum foil) and substrate material (CFRP) is measured by scratching experiment, direct drawing experiment, and shear test. Besides, the ultra-high-speed rotation experiment of CFRP ring is carried out to analyze stress and strain of coated aluminum (or aluminum foil) which is adhered on the ring. The results showed aluminum foil pasted on inner surface do better performance than magnetron sputtering aluminum on CFRP centrifuge rotor drum. (authors)

  17. Coordination Structure of Aluminum in Magnesium Aluminum Hydroxide Studied by 27Al NMR

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The coordination structure of aluminum in magnesium aluminum hydroxide was studiedby 27Al NMR. The result showed that tetrahedral aluminum (AlⅣ) existed in magnesiumaluminum hydroxide, and the contents of AlⅣ increased with the increase of the ratio of Al/Mg andwith the peptizing temperature. AlⅣ originated from the so-called Al13 polymer with the structureof one Al tetrahedron surrounded by twelve Al octahedrons.

  18. Air-Impregnated Nanoporous Anodic Aluminum Oxide Layers for Enhancing the Corrosion Resistance of Aluminum.

    Science.gov (United States)

    Jeong, Chanyoung; Lee, Junghoon; Sheppard, Keith; Choi, Chang-Hwan

    2015-10-13

    Nanoporous anodic aluminum oxide layers were fabricated on aluminum substrates with systematically varied pore diameters (20-80 nm) and oxide thicknesses (150-500 nm) by controlling the anodizing voltage and time and subsequent pore-widening process conditions. The porous nanostructures were then coated with a thin (only a couple of nanometers thick) Teflon film to make the surface hydrophobic and trap air in the pores. The corrosion resistance of the aluminum substrate was evaluated by a potentiodynamic polarization measurement in 3.5 wt % NaCl solution (saltwater). Results showed that the hydrophobic nanoporous anodic aluminum oxide layer significantly enhanced the corrosion resistance of the aluminum substrate compared to a hydrophilic oxide layer of the same nanostructures, to bare (nonanodized) aluminum with only a natural oxide layer on top, and to the latter coated with a thin Teflon film. The hydrophobic nanoporous anodic aluminum oxide layer with the largest pore diameter and the thickest oxide layer (i.e., the maximized air fraction) resulted in the best corrosion resistance with a corrosion inhibition efficiency of up to 99% for up to 7 days. The results demonstrate that the air impregnating the hydrophobic nanopores can effectively inhibit the penetration of corrosive media into the pores, leading to a significant improvement in corrosion resistance.

  19. Decarbonization process for carbothermically produced aluminum

    Science.gov (United States)

    Bruno, Marshall J.; Carkin, Gerald E.; DeYoung, David H.; Dunlap, Sr., Ronald M.

    2015-06-30

    A method of recovering aluminum is provided. An alloy melt having Al.sub.4C.sub.3 and aluminum is provided. This mixture is cooled and then a sufficient amount of a finely dispersed gas is added to the alloy melt at a temperature of about 700.degree. C. to about 900.degree. C. The aluminum recovered is a decarbonized carbothermically produced aluminum where the step of adding a sufficient amount of the finely dispersed gas effects separation of the aluminum from the Al.sub.4C.sub.3 precipitates by flotation, resulting in two phases with the Al.sub.4C.sub.3 precipitates being the upper layer and the decarbonized aluminum being the lower layer. The aluminum is then recovered from the Al.sub.4C.sub.3 precipitates through decanting.

  20. Weld Repair of Thin Aluminum Sheet

    Science.gov (United States)

    Beuyukian, C. S.; Mitchell, M. J.

    1986-01-01

    Weld repairing of thin aluminum sheets now possible, using niobium shield and copper heat sinks. Refractory niobium shield protects aluminum adjacent to hole, while copper heat sinks help conduct heat away from repair site. Technique limits tungsten/inert-gas (TIG) welding bombardment zone to melt area, leaving surrounding areas around weld unaffected. Used successfully to repair aluminum cold plates on Space Shuttle, Commercial applications, especially in sealing fractures, dents, and holes in thin aluminum face sheets or clad brazing sheet in cold plates, heat exchangers, coolers, and Solar panels. While particularly suited to thin aluminum sheet, this process also used in thicker aluminum material to prevent surface damage near weld area.

  1. Gas evolution behavior of aluminum in mortar

    Energy Technology Data Exchange (ETDEWEB)

    Hashizume, Shuji; Matsumoto, Junko; Banba, Tsunetaka [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1996-10-01

    As a part of study of leaching behavior for solidified dry low level radioactive waste, gas evolution behavior of aluminum in mortar was investigated, and a plan of our research was proposed. The effect of pH on corrosion rate of aluminum, corrosion product, time dependency of corrosion rate of aluminum in mortar, change of corrosion mechanism, the effects of Na, Ca and Cl ions on corrosion rate of aluminum in mortar and corrosion behavior of aluminum when aluminum was used as sacrificed anode in reinforced concrete were previously clarified. Study of the effects of environmental factors such as pH, kind of ions and temperature on gas evolution behavior of aluminum and the effect of aluminum/carbon steel surface ratio no gas evolution behavior of aluminum were planed. (author). 75 refs.

  2. Gas evolution behavior of aluminum in mortar

    International Nuclear Information System (INIS)

    Hashizume, Shuji; Matsumoto, Junko; Banba, Tsunetaka

    1996-10-01

    As a part of study of leaching behavior for solidified dry low level radioactive waste, gas evolution behavior of aluminum in mortar was investigated, and a plan of our research was proposed. The effect of pH on corrosion rate of aluminum, corrosion product, time dependency of corrosion rate of aluminum in mortar, change of corrosion mechanism, the effects of Na, Ca and Cl ions on corrosion rate of aluminum in mortar and corrosion behavior of aluminum when aluminum was used as sacrificed anode in reinforced concrete were previously clarified. Study of the effects of environmental factors such as pH, kind of ions and temperature on gas evolution behavior of aluminum and the effect of aluminum/carbon steel surface ratio no gas evolution behavior of aluminum were planed. (author). 75 refs

  3. Aluminum-based metal-air batteries

    Science.gov (United States)

    Friesen, Cody A.; Martinez, Jose Antonio Bautista

    2016-01-12

    Provided in one embodiment is an electrochemical cell, comprising: (i) a plurality of electrodes, comprising a fuel electrode that comprises aluminum and an air electrode that absorbs gaseous oxygen, the electrodes being operable in a discharge mode wherein the aluminum is oxidized at the fuel electrode and oxygen is reduced at the air electrode, and (ii) an ionically conductive medium, comprising an organic solvent; wherein during non-use of the cell, the organic solvent promotes formation of a protective interface between the aluminum of the fuel electrode and the ionically conductive medium, and wherein at an onset of the discharge mode, at least some of the protective interface is removed from the aluminum to thereafter permit oxidation of the aluminum during the discharge mode.

  4. Acoustic noises of the BOR-60 reactor steam generators when simulating leaks with argon and steam

    International Nuclear Information System (INIS)

    Sokolov, V.M.; Golushko, V.V.; Afanas'ev, V.A.; Grebenkin, Yu.P.; Muralev, A.B.

    1985-01-01

    Background acoustic noises of stea generators in different operational regimes and noises of argon and steam small leads (about 0.1 g/s) are studied to determine the possibility of designing the acoustic system for leak detection in sodium-water steamgenerators. Investigations are carried out at the 30 MW micromodule steam generator being in operation at the BOR-60 reactor as well as at the 20 MW tank type steam generator. Immersed ransduceres made of lithium niobate 6 mm in-diameter and waveguide transducers made of a stainless steel in the form of rods 10 mm in-diameter and 500 mm long are used as acoustic monitors. It is shown that the leak noise is more wide-band than the background noise of the steam generator and both high and low frequencies appear in the spectrum. The use of monitors of different types results in similar conslusions inrelation to the character of background noises and leak signals (spectral density, signal to-noise ratio) in the ase of similar bandroidths of the transduceres. A conclusion is made that the change of operational regimes leads to changes of background noise level, which can be close to the reaction of

  5. A Virtual Aluminum Reduction Cell

    Science.gov (United States)

    Zhang, Hongliang; Zhou, Chenn Q.; Wu, Bing; Li, Jie

    2013-11-01

    The most important component in the aluminum industry is the aluminum reduction cell; it has received considerable interests and resources to conduct research to improve its productivity and energy efficiency. The current study focused on the integration of numerical simulation data and virtual reality technology to create a scientifically and practically realistic virtual aluminum reduction cell by presenting complex cell structures and physical-chemical phenomena. The multiphysical field simulation models were first built and solved in ANSYS software (ANSYS Inc., Canonsburg, PA, USA). Then, the methodology of combining the simulation results with virtual reality was introduced, and a virtual aluminum reduction cell was created. The demonstration showed that a computer-based world could be created in which people who are not analysis experts can see the detailed cell structure in a context that they can understand easily. With the application of the virtual aluminum reduction cell, even people who are familiar with aluminum reduction cell operations can gain insights that make it possible to understand the root causes of observed problems and plan design changes in much less time.

  6. Electrically conductive anodized aluminum coatings

    Science.gov (United States)

    Alwitt, Robert S. (Inventor); Liu, Yanming (Inventor)

    2001-01-01

    A process for producing anodized aluminum with enhanced electrical conductivity, comprising anodic oxidation of aluminum alloy substrate, electrolytic deposition of a small amount of metal into the pores of the anodized aluminum, and electrolytic anodic deposition of an electrically conductive oxide, including manganese dioxide, into the pores containing the metal deposit; and the product produced by the process.

  7. Mesoporous aluminum phosphite

    International Nuclear Information System (INIS)

    El Haskouri, Jamal; Perez-Cabero, Monica; Guillem, Carmen; Latorre, Julio; Beltran, Aurelio; Beltran, Daniel; Amoros, Pedro

    2009-01-01

    High surface area pure mesoporous aluminum-phosphorus oxide-based derivatives have been synthesized through an S + I - surfactant-assisted cooperative mechanism by means of a one-pot preparative procedure from aqueous solution and starting from aluminum atrane complexes and phosphoric and/or phosphorous acids. A soft chemical extraction procedure allows opening the pore system of the parent as-prepared materials by exchanging the surfactant without mesostructure collapse. The nature of the pore wall can be modulated from mesoporous aluminum phosphate (ALPO) up to total incorporation of phosphite entities (mesoporous aluminum phosphite), which results in a gradual evolution of the acidic properties of the final materials. While phosphate groups in ALPO act as network building blocks (bridging Al atoms), the phosphite entities become basically attached to the pore surface, what gives practically empty channels. The mesoporous nature of the final materials is confirmed by X-ray diffraction (XRD), transmission electron microscopy (TEM) and N 2 adsorption-desorption isotherms. The materials present regular unimodal pore systems whose order decreases as the phosphite content increases. NMR spectroscopic results confirm the incorporation of oxo-phosphorus entities to the framework of these materials and also provide us useful information concerning the mechanism through which they are formed. - Abstract: TEM image of the mesoporous aluminum phosphite showing the hexagonal disordered pore array that is generated by using surfactant micelles as template. Also a scheme emphasizing the presence of an alumina-rich core and an ALPO-like pore surface is presented.

  8. Gut: An underestimated target organ for Aluminum.

    Science.gov (United States)

    Vignal, C; Desreumaux, P; Body-Malapel, M

    2016-06-01

    Since World War II, several factors such as an impressive industrial growth, an enhanced environmental bioavailability and intensified food consumption have contributed to a significant amplification of human exposure to aluminum. Aluminum is particularly present in food, beverages, some drugs and airbone dust. In our food, aluminum is superimposed via additives and cooking utensils. Therefore, the tolerable intake of aluminum is exceeded for a significant part of the world population, especially in children who are more vulnerable to toxic effects of pollutants than adults. Faced with this oral aluminum influx, intestinal tract is an essential barrier, especially as 38% of ingested aluminum accumulates at the intestinal mucosa. Although still poorly documented to date, the impact of oral exposure to aluminum in conditions relevant to real human exposure appears to be deleterious for gut homeostasis. Aluminum ingestion affects the regulation of the permeability, the microflora and the immune function of intestine. Nowadays, several arguments are consistent with an involvement of aluminum as an environmental risk factor for inflammatory bowel diseases. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  9. Infrared radiation properties of anodized aluminum

    Energy Technology Data Exchange (ETDEWEB)

    Kohara, S. [Science Univ. of Tokyo, Noda, Chiba (Japan). Dept. of Materials Science and Technology; Niimi, Y. [Science Univ. of Tokyo, Noda, Chiba (Japan). Dept. of Materials Science and Technology

    1996-12-31

    The infrared radiation heating is an efficient and energy saving heating method. Ceramics have been used as an infrared radiant material, because the emissivity of metals is lower than that of ceramics. However, anodized aluminum could be used as the infrared radiant material since an aluminum oxide film is formed on the surface. In the present study, the infrared radiation properties of anodized aluminum have been investigated by determining the spectral emissivity curve. The spectral emissivity curve of anodized aluminum changed with the anodizing time. The spectral emissivity curve shifted to the higher level after anodizing for 10 min, but little changed afterwards. The infrared radiant material with high level spectral emissivity curve can be achieved by making an oxide film thicker than about 15 {mu}m on the surface of aluminum. Thus, anodized aluminum is applicable for the infrared radiation heating. (orig.)

  10. Vapor corrosion of aluminum cladding alloys and aluminum-uranium fuel materials in storage environments

    International Nuclear Information System (INIS)

    Lam, P.; Sindelar, R.L.; Peacock, H.B. Jr.

    1997-04-01

    An experimental investigation of the effects of vapor environments on the corrosion of aluminum spent nuclear fuel (A1 SNF) has been performed. Aluminum cladding alloys and aluminum-uranium fuel alloys have been exposed to environments of air/water vapor/ionizing radiation and characterized for applications to degradation mode analysis for interim dry and repository storage systems. Models have been developed to allow predictions of the corrosion response under conditions of unlimited corrodant species. Threshold levels of water vapor under which corrosion does not occur have been identified through tests under conditions of limited corrodant species. Coupons of aluminum 1100, 5052, and 6061, the US equivalent of cladding alloys used to manufacture foreign research reactor fuels, and several aluminum-uranium alloys (aluminum-10, 18, and 33 wt% uranium) were exposed to various controlled vapor environments in air within the following ranges of conditions: Temperature -- 80 to 200 C; Relative Humidity -- 0 to 100% using atmospheric condensate water and using added nitric acid to simulate radiolysis effects; and Gamma Radiation -- none and 1.8 x 10 6 R/hr. The results of this work are part of the body of information needed for understanding the degradation of the A1 SNF waste form in a direct disposal system in the federal repository. It will provide the basis for data input to the ongoing performance assessment and criticality safety analyses. Additional testing of uranium-aluminum fuel materials at uranium contents typical of high enriched and low enriched fuels is being initiated to provide the data needed for the development of empirical models

  11. PREPARATION OF ACTINIDE-ALUMINUM ALLOYS

    Science.gov (United States)

    Moore, R.H.

    1962-09-01

    BS>A process is given for preparing alloys of aluminum with plutonium, uranium, and/or thorium by chlorinating actinide oxide dissolved in molten alkali metal chloride with hydrochloric acid, chlorine, and/or phosgene, adding aluminum metal, and passing air and/or water vapor through the mass. Actinide metal is formed and alloyed with the aluminum. After cooling to solidification, the alloy is separated from the salt. (AEC)

  12. 40 CFR 63.5753 - How do I calculate the combined organic HAP content of aluminum wipedown solvents and aluminum...

    Science.gov (United States)

    2010-07-01

    ... HAP content of aluminum wipedown solvents and aluminum recreational boat surface coatings? 63.5753... Standards for Hazardous Air Pollutants for Boat Manufacturing Standards for Aluminum Recreational Boat Surface Coating Operations § 63.5753 How do I calculate the combined organic HAP content of aluminum...

  13. Casting Characteristics of High Cerium Content Aluminum Alloys

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, D; Rios, O R; Sims, Z C; McCall, S K; Ott, R T

    2017-09-05

    This paper compares the castability of the near eutectic aluminum-cerium alloy system to the aluminum-silicon and aluminum-copper systems. The alloys are compared based on die filling capability, feeding characteristics and tendency to hot tear in both sand cast and permanent mold applications. The castability ranking of the binary Al–Ce systems is as good as the aluminum-silicon system with some deterioration as additional alloying elements are added. In alloy systems that use cerium in combination with common aluminum alloying elements such as silicon, magnesium and/or copper, the casting characteristics are generally better than the aluminum-copper system. In general, production systems for melting, de-gassing and other processing of aluminum-silicon or aluminum-copper alloys can be used without modification for conventional casting of aluminum-cerium alloys.

  14. Aluminum industry options paper

    International Nuclear Information System (INIS)

    1999-10-01

    In 1990, Canada's producers of aluminum (third largest in the world) emitted 10 million tonnes of carbon dioxide and equivalent, corresponding to 6.4 tonnes of greenhouse gas intensity per tonne of aluminum. In 2000, the projection is that on a business-as-usual (BAU) basis Canadian producers now producing 60 per cent more aluminum than in 1990, will emit 10.7 million tonnes of carbon dioxide and equivalent, corresponding to a GHG intensity of 4.2 tonnes per tonne of aluminum. This improvement is due to production being based largely on hydro-electricity, and partly because in general, Canadian plants are modern, with technology that is relatively GHG-friendly. The Aluminum Association of Canada estimates that based on anticipated production, and under a BAU scenario, GHG emissions from aluminum production will rise by 18 per cent by 2010 and by 30 per cent by 2020. GHG emissions could be reduced below the BAU forecast first, by new control and monitoring systems at some operations at a cost of $4.5 to 7.5 million per smelter. These systems could reduce carbon dioxide equivalent emissions by 0.8 million tonnes per year. A second alternative would require installation of breaker feeders which would further reduce perfluorocarbon (PFC) emissions by 0.9 million tonnes of carbon dioxide equivalent. Cost of the breakers feeders would be in the order of $200 million per smelter. The third option calls for the the shutting down of some of the smelters with older technology by 2015. In this scenario GHG emissions would be reduced by 2010 by 0.8 million tonnes per year of carbon dioxide equivalent. However, the cost in this case would be about $1.36 billion. The industry would support measures that would encourage the first two sets of actions, which would produce GHG emissions from aluminum production in Canada of about 10.2 million tonnes per year of carbon dioxide equivalent, or about two per cent above 1990 levels with double the aluminum production of 1990. Credit for

  15. Anodizing Aluminum with Frills.

    Science.gov (United States)

    Doeltz, Anne E.; And Others

    1983-01-01

    "Anodizing Aluminum" (previously reported in this journal) describes a vivid/relevant laboratory experience for general chemistry students explaining the anodizing of aluminum in sulfuric acid and constrasting it to electroplating. Additions to this procedure and the experiment in which they are used are discussed. Reactions involved are…

  16. Scientific Background for Processing of Aluminum Waste

    Science.gov (United States)

    Kononchuk, Olga; Alekseev, Alexey; Zubkova, Olga; Udovitsky, Vladimir

    2017-11-01

    Changing the source of raw materials for producing aluminum and the emergence of a huge number of secondary alumina waste (foundry slag, sludge, spent catalysts, mineral parts of coal and others that are formed in various industrial enterprises) require the creation of scientific and theoretical foundations for their processing. In this paper, the aluminum alloys (GOST 4784-97) are used as an aluminum raw material component, containing the aluminum component produced as chips in the machine-building enterprises. The aluminum waste is a whole range of metallic aluminum alloys including elements: magnesium, copper, silica, zinc and iron. Analysis of the aluminum waste A1- Zn-Cu-Si-Fe shows that depending on the content of the metal the dissolution process of an aluminum alloy should be treated as the result of the chemical interaction of the metal with an alkaline solution. It is necessary to consider the behavior of the main components of alloys in an alkaline solution as applied to the system Na2O - Al2O3 - SiO2 - CO2 - H2O.

  17. Synthesis of Aluminum-Aluminum Nitride Nanocomposites by a Gas-Liquid Reaction II. Microstructure and Mechanical Properties

    Science.gov (United States)

    Borgonovo, Cecilia; Makhlouf, Makhlouf M.

    2016-04-01

    In situ fabrication of the reinforcing particles in the metal matrix is an answer to many of the challenges encountered in manufacturing aluminum matrix nanocomposites. In this method, the nanoparticles are formed directly within the melt by means of a chemical reaction between a specially designed aluminum alloy and a gas. In this publication, we describe a process for synthesizing aluminum-aluminum nitride nanocomposites by reacting a nitrogen-containing gas with a molten aluminum-lithium alloy. We quantify the effect of the process parameters on the average particle size and particle distribution, as well as on the tendency of the particles to cluster in the alloy matrix, is quantified. Also in this publication, we present the measured room temperature and elevated temperature tensile properties of the nanocomposite material as well as its measured room temperature impact toughness.

  18. 21 CFR 73.2645 - Aluminum powder.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Aluminum powder. 73.2645 Section 73.2645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Cosmetics § 73.2645 Aluminum powder. (a) Identity and specifications. The color additive aluminum powder shall conform in identity and specifications to the requirements of...

  19. 21 CFR 582.1125 - Aluminum sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aluminum sulfate. 582.1125 Section 582.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This substance...

  20. 21 CFR 182.1125 - Aluminum sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum sulfate. 182.1125 Section 182.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This substance...

  1. Fast LIBS Identification of Aluminum Alloys

    Directory of Open Access Journals (Sweden)

    Tawfik W.

    2007-04-01

    Full Text Available Laser-induced breakdown spectroscopy (LIBS has been applied to analysis aluminum alloy targets. The plasma is generated by focusing a 300 mJ pulsed Nd: YAG laser on the target in air at atmospheric pressure. Such plasma emission spectrum was collected using a one-meter length wide band fused-silica optical fiber connected to a portable Echelle spectrometer with intensified CCD camera. Spectroscopic analysis of plasma evolution of laser produced plasmas has been characterized in terms of their spectra, electron density and electron temperature assuming the LTE and optically thin plasma conditions. The LIBS spectrum was optimized for high S/N ratio especially for trace elements. The electron temperature and density were determined using the emission intensity and stark broadening, respectively, of selected aluminum spectral lines. The values of these parameters were found to change with the aluminum alloy matrix, i.e. they could be used as a fingerprint character to distinguish between different aluminum alloy matrices using only one major element (aluminum without needing to analysis the rest of elements in the matrix. Moreover, It was found that the values of T(e and N(e decrease with increasing the trace elements concentrations in the aluminum alloy samples. The obtained results indicate that it is possible to improve the exploitation of LIBS in the remote on-line industrial monitoring application, by following up only the values of T(e and N(e for the aluminum in aluminum alloys using an optical fiber probe.

  2. An all aluminum alloy UHV components

    International Nuclear Information System (INIS)

    Sugisaki, Kenzaburo

    1985-01-01

    An all aluminum components was developed for use with UHV system. Aluminum alloy whose advantage are little discharge gas, easy to bake out, light weight, little damage against radieactivity radiation is used. Therefore, as it is all aluminum alloy, baking is possible. Baking temperature is 150 deg C in case of not only ion pump, gate valve, angle valve but also aluminum components. Ion pump have to an ultrahigh vacuum of order 10 -9 torr can be obtained without baking, 10 -10 torr order can be obtained after 24 hour of baking. (author)

  3. Low-temperature resistance of cyclically strained aluminum

    International Nuclear Information System (INIS)

    Segal, H.R.; Richard, T.G.

    1977-01-01

    An experimental study of the resistance changes in high-purity, reinforced aluminum due to cyclic straining is presently underway. The purpose of this work is to determine the optimum purity of aluminum to be used as a stabilizing material for superconducting magnets used for energy storage. Since pure aluminum has a low yield strength, it is not capable of supporting the stress levels in an energized magnet. Therefore, it has been bonded to a high-strength material--in this case, 6061 aluminum alloy. This bonding permits pure aluminum to be strained cyclically beyond its elastic limit with recovery of large plastic strains upon release of the load. The resistance change in this composite material is less than that of pure, unreinforced aluminum

  4. Investigating aluminum alloy reinforced by graphene nanoflakes

    Energy Technology Data Exchange (ETDEWEB)

    Yan, S.J., E-mail: shaojiuyan@126.com [Beijing Institute of Aeronautical Materials, Beijing 100095 (China); Dai, S.L.; Zhang, X.Y.; Yang, C.; Hong, Q.H.; Chen, J.Z. [Beijing Institute of Aeronautical Materials, Beijing 100095 (China); Lin, Z.M. [Aviation Industry Corporation of China, Beijing 100022 (China)

    2014-08-26

    As one of the most important engineering materials, aluminum alloys have been widely applied in many fields. However, the requirement of enhancing their mechanical properties without sacrificing the ductility is always a challenge in the development of aluminum alloys. Thanks to the excellent physical and mechanical properties, graphene nanoflakes (GNFs) have been applied as promising reinforcing elements in various engineering materials, including polymers and ceramics. However, the investigation of GNFs as reinforcement phase in metals or alloys, especially in aluminum alloys, is still very limited. In this study, the aluminum alloy reinforced by GNFs was successfully prepared via powder metallurgy approach. The GNFs were mixed with aluminum alloy powders through ball milling and followed by hot isostatic pressing. The green body was then hot extruded to obtain the final GNFs reinforced aluminum alloy nanocomposite. The scanning electron microscopy and transmission electron microscope analysis show that GNFs were well dispersed in the aluminum alloy matrix and no chemical reactions were observed at the interfaces between the GNFs and aluminum alloy matrix. The mechanical properties' testing results show that with increasing filling content of GNFs, both tensile and yield strengths were remarkably increased without losing the ductility performance. These results not only provided a pathway to achieve the goal of preparing high strength aluminum alloys with excellent ductilitybut they also shed light on the development of other metal alloys reinforced by GNFs.

  5. Studies of aluminum in rat brain

    Energy Technology Data Exchange (ETDEWEB)

    Lipman, J.J.; Brill, A.B.; Som, P.; Jones, K.W.; Colowick, S.; Cholewa, M.

    1985-01-01

    The effects of high aluminum concentrations in rat brains were studied using /sup 14/C autoradiography to measure the uptake of /sup 14/C 2-deoxy-D-glucose (/sup 14/C-2DG) and microbeam proton-induced x-ray emission (microPIXE) with a 20-..mu..m resolution to measure concentrations of magnesium, aluminum, potassium, and calcium. The aluminum was introduced intracisternally in the form of aluminum tartrate (Al-T) while control animals were given sodium tartrate (Na-T). The /sup 14/C was administered intravenously. The animals receiving Al-T developed seizure disorders and had pathological changes that included cerebral cortical atrophy. The results showed that there was a decreased uptake of /sup 14/C-2DG in cortical regions in which increased aluminum levels were measured, i.e., there is a correlation between the aluminum in the rat brain and decreased brain glucose metabolism. A minimum detection limit of about 16 ppM (mass fraction) or 3 x 10/sup 9/ Al atoms was obtained for Al under the conditions employed. 14 refs., 4 figs., 1 tab.

  6. Aluminum neurotoxicity in the rat brain

    International Nuclear Information System (INIS)

    Yumoto, S.; Ohashi, H.; Nagai, H.; Kakimi, S.; Ogawa, Y.; Iwata, Y.; Ishii, K.

    1992-01-01

    To investigate the etiology of Alzheimer's disease, we administered aluminum to healthy rats and examined the aluminum uptake in the brain and isolated brain cell nuclei by particle-induced X-ray emission (PIXE) analysis. Ten days after the last injection, Al was detected in the rat brain and in isolated brain cell nuclei by PIXE analysis. Al was also demonstrated in the brain after 15 months of oral aluminum administration. Moreover, Al was detected in the brain and isolated brain cell nuclei from the patients with Alzheimer's disease. Silver impregnation studies revealed that spines attached to the dendritic processes of cortical nerve cells decreased remarkably after aluminum administration. Electron microscopy revealed characteristic inclusion bodies in the hippocampal nerve cells 75 days after the injection. These morphological changes in the rat brain after the aluminum administration were similar to those reportedly observed in the brain of Alzheimer's disease patients. Our results indicate that Alzheimer's disease is caused by irreversible accumulation of aluminum in the brain, as well as in the nuclei of brain cells. (author)

  7. Aluminum neurotoxicity in the rat brain

    Energy Technology Data Exchange (ETDEWEB)

    Yumoto, S [Tokyo Univ. (Japan). Faculty of Medicine; Ohashi, H; Nagai, H; Kakimi, S; Ogawa, Y; Iwata, Y; Ishii, K

    1993-12-31

    To investigate the etiology of Alzheimer`s disease, we administered aluminum to healthy rats and examined the aluminum uptake in the brain and isolated brain cell nuclei by particle-induced X-ray emission (PIXE) analysis. Ten days after the last injection, Al was detected in the rat brain and in isolated brain cell nuclei by PIXE analysis. Al was also demonstrated in the brain after 15 months of oral aluminum administration. Moreover, Al was detected in the brain and isolated brain cell nuclei from the patients with Alzheimer`s disease. Silver impregnation studies revealed that spines attached to the dendritic processes of cortical nerve cells decreased remarkably after aluminum administration. Electron microscopy revealed characteristic inclusion bodies in the hippocampal nerve cells 75 days after the injection. These morphological changes in the rat brain after the aluminum administration were similar to those reportedly observed in the brain of Alzheimer`s disease patients. Our results indicate that Alzheimer`s disease is caused by irreversible accumulation of aluminum in the brain, as well as in the nuclei of brain cells. (author).

  8. Studies of aluminum in rat brain

    International Nuclear Information System (INIS)

    Lipman, J.J.; Brill, A.B.; Som, P.; Jones, K.W.; Colowick, S.; Cholewa, M.

    1985-01-01

    The effects of high aluminum concentrations in rat brains were studied using 14 C autoradiography to measure the uptake of 14 C 2-deoxy-D-glucose ( 14 C-2DG) and microbeam proton-induced x-ray emission (microPIXE) with a 20-μm resolution to measure concentrations of magnesium, aluminum, potassium, and calcium. The aluminum was introduced intracisternally in the form of aluminum tartrate (Al-T) while control animals were given sodium tartrate (Na-T). The 14 C was administered intravenously. The animals receiving Al-T developed seizure disorders and had pathological changes that included cerebral cortical atrophy. The results showed that there was a decreased uptake of 14 C-2DG in cortical regions in which increased aluminum levels were measured, i.e., there is a correlation between the aluminum in the rat brain and decreased brain glucose metabolism. A minimum detection limit of about 16 ppM (mass fraction) or 3 x 10 9 Al atoms was obtained for Al under the conditions employed. 14 refs., 4 figs., 1 tab

  9. Aluminum Hydroxide and Magnesium Hydroxide

    Science.gov (United States)

    Aluminum Hydroxide, Magnesium Hydroxide are antacids used together to relieve heartburn, acid indigestion, and upset stomach. They ... They combine with stomach acid and neutralize it. Aluminum Hydroxide, Magnesium Hydroxide are available without a prescription. ...

  10. [Analysis of tartrazine aluminum lake and sunset yellow aluminum lake in foods by capillary zone electrophoresis].

    Science.gov (United States)

    Zhang, Yiding; Chang, Cuilan; Guo, Qilei; Cao, Hong; Bai, Yu; Liu, Huwei

    2014-04-01

    A novel analytical method for tartrazine aluminum lake and sunset yellow aluminum lake using capillary zone electrophoresis (CZE) was studied. The pigments contained in the color lakes were successfully separated from the aluminum matrix in the pre-treatment process, which included the following steps: dissolve the color lakes in 0.1 mol/L H2SO4, adjust the pH of the solution to 5.0, then mix it with the solution of EDTA x 2Na and heat it in a water bath, then use polyamide powder as the stationary phase of solid phase extraction to separate the pigments from the solution, and finally elute the pigments with 0.1 mol/L NaOH. The CZE conditions systematically optimized for tartrazine aluminum lake were: 48.50 cm of a fused silica capillary with 40.00 cm effective length and 50 microm i. d., the temperature controlled at 20.0 degrees C, 29.0 kV applied, HPO4(2-)-PO4(3-) (0.015 mol/L, pH 11.45) solution as running buffer, detection at 263 nm. The conditions for sunset yellow aluminum lake were: the same capillary and temperature, 25.0 kV applied, HPO4(2-)-PO4(3-) (0.025 mol/L, pH 11.45) solution as running buffer, detection at 240 nm. The limits of detection were 0.26 mg/L and 0.27 mg/L, and the linear ranges were 0.53-1.3 x 10(2) mg/L and 0.54-1.4 x 10(2) mg/L for tartrazine aluminum lake and sunset yellow aluminum lake, respectively. The RSDs were 4.3% and 5.7% (run to run, n = 6), 5.6% and 6.0% (day to day, n = 6) for tartrazine aluminum lake and sunset yellow aluminum lake, respectively. Further developments for this method could make it a routinely used method analyzing color lakes in foods.

  11. Fast LIBS Identification of Aluminum Alloys

    Directory of Open Access Journals (Sweden)

    Tawfik W.

    2007-04-01

    Full Text Available Laser-induced breakdown spectroscopy (LIBS has been applied to analysis aluminum alloy targets. The plasma is generated by focusing a 300 mJ pulsed Nd: YAG laser on the target in air at atmospheric pressure. Such plasma emission spectrum was collected using a one-meter length wide band fused-silica optical fiber connected to a portable Echelle spectrometer with intensified CCD camera. Spectroscopic analysis of plasma evolution of laser produced plasmas has been characterized in terms of their spectra, electron density and electron temperature assuming the LTE and optically thin plasma conditions. The LIBS spectrum was optimized for high S/N ratio especially for trace elements. The electron temperature and density were determined using the emission intensity and stark broadening, respectively, of selected aluminum spectral lines. The values of these parameters were found to change with the aluminum alloy matrix, i.e. they could be used as a fingerprint character to distinguish between different aluminum alloy matrices using only one major element (aluminum without needing to analysis the rest of elements in the matrix. Moreover, It was found that the values of T e and N e decrease with increasing the trace elements concentrations in the aluminum alloy samples. The obtained results indicate that it is possible to improve the exploitation of LIBS in the remote on-line industrial monitoring application, by following up only the values of T e and N e for aluminum in aluminum alloys as a marker for the correct alloying using an optical fiber probe.

  12. FLOWSHEET FOR ALUMINUM REMOVAL FROM SLUDGE BATCH 6

    International Nuclear Information System (INIS)

    Pike, J.; Gillam, J.

    2008-01-01

    Samples of Tank 12 sludge slurry show a substantially larger fraction of aluminum than originally identified in sludge batch planning. The Liquid Waste Organization (LWO) plans to formulate Sludge Batch 6 (SB6) with about one half of the sludge slurry in Tank 12 and one half of the sludge slurry in Tank 4. LWO identified aluminum dissolution as a method to mitigate the effect of having about 50% more solids in High Level Waste (HLW) sludge than previously planned. Previous aluminum dissolution performed in a HLW tank in 1982 was performed at approximately 85 C for 5 days and dissolved nearly 80% of the aluminum in the sludge slurry. In 2008, LWO successfully dissolved 64% of the aluminum at approximately 60 C in 46 days with minimal tank modifications and using only slurry pumps as a heat source. This report establishes the technical basis and flowsheet for performing an aluminum removal process in Tank 51 for SB6 that incorporates the lessons learned from previous aluminum dissolution evolutions. For SB6, aluminum dissolution process temperature will be held at a minimum of 65 C for at least 24 days, but as long as practical or until as much as 80% of the aluminum is dissolved. As planned, an aluminum removal process can reduce the aluminum in SB6 from about 84,500 kg to as little as 17,900 kg with a corresponding reduction of total insoluble solids in the batch from 246,000 kg to 131,000 kg. The extent of the reduction may be limited by the time available to maintain Tank 51 at dissolution temperature. The range of dissolution in four weeks based on the known variability in dissolution kinetics can range from 44 to more than 80%. At 44% of the aluminum dissolved, the mass reduction is approximately 1/2 of the mass noted above, i.e., 33,300 kg of aluminum instead of 66,600 kg. Planning to reach 80% of the aluminum dissolved should allow a maximum of 81 days for dissolution and reduce the allowance if test data shows faster kinetics. 47,800 kg of the dissolved

  13. Effect of the aluminum flow pattern on the bonding of aluminum to oxidized Zircaloy-2

    International Nuclear Information System (INIS)

    Watson, R.D.; Lambert, J.P.

    1965-04-01

    The bonds produced when hot aluminum is allowed to flow smoothly from an extrusion die to the oxidized surface of a heated tube of Zircaloy-2 are consistently inferior to those produced with back-extruded flow. The difference is believed to be due to the reduction in, or elimination of, the oxide layer on the aluminum that comes in contact with the surface of the Zircaloy-2. This method of bonding aluminum to Zircaloy-2 is covered by Canadian patent 702,438 January 1965. (author)

  14. [Microbiological corrosion of aluminum alloys].

    Science.gov (United States)

    Smirnov, V F; Belov, D V; Sokolova, T N; Kuzina, O V; Kartashov, V R

    2008-01-01

    Biological corrosion of ADO quality aluminum and aluminum-based construction materials (alloys V65, D16, and D16T) was studied. Thirteen microscopic fungus species and six bacterial species proved to be able to attack aluminum and its alloys. It was found that biocorrosion of metals by microscopic fungi and bacteria was mediated by certain exometabolites. Experiments on biocorrosion of the materials by the microscopic fungus Alternaria alternata, the most active biodegrader, demonstrated that the micromycete attack started with the appearance of exudate with pH 8-9 on end faces of the samples.

  15. Anodized aluminum on LDEF: A current status of measurements on chromic acid anodized aluminum

    International Nuclear Information System (INIS)

    Golden, J.L.

    1992-01-01

    Chromic acid anodize was used as the exterior coating for aluminum surfaces on LDEF to provide passive thermal control. Chromic acid anodized aluminum was also used as test specimens in thermal control coatings experiments. The following is a compilation and analysis of the data obtained thus far

  16. Anodized aluminum on LDEF: A current status of measurements on chromic acid anodized aluminum

    Science.gov (United States)

    Golden, Johnny L.

    1992-01-01

    Chromic acid anodize was used as the exterior coating for aluminum surfaces on LDEF to provide passive thermal control. Chromic acid anodized aluminum was also used as test specimens in thermal control coatings experiments. The following is a compilation and analysis of the data obtained thus far.

  17. Spatial and functional city structure with examples of Valjevo, Bor and Knjaževac

    Directory of Open Access Journals (Sweden)

    Spasić Nenad

    2005-01-01

    Full Text Available Cities represent such social environments which develop under the influence of their resource hinterland, yet at the same time they vigorously affect changes in their immediate or broader surroundings, depending on dynamics of city limits change. From city origins to the present day, interdependences between its spatial and functional structures can be noticed. Historical context plays a significant role in city development, both in terms of its spatial structure formation as well as in terms of development of city functions and territorial distribution of urban services. Spatial structure of a city is also defined by a set of geographical, economic, social functional and other features in their interdependency. Functional structure of a city depends on its size and position it takes in the functional distribution on a regional level as well as it is related to the functional capacity of a city. This paper analyses concrete examples of spatial and functional structures featuring three Serbian towns: Valjevo, Bor and Knjaževac. From the analysis of their common attributes in this respect, the following can be noticed: formation of the case study towns happened around inherited historical city cores, which even now perform a number of public functions; basic road networks significantly influenced formation of spatial patterns of these towns; spatial development of the towns in the last decade or so was slowed down because of economic and social stagnation, which didn't show major influence on change of spatial and functional structures of the towns involved.

  18. The Evaluation of Alkali Grass (Puccinellia ciliata Bor Populations in Aydin Province of Turkey

    Directory of Open Access Journals (Sweden)

    İlkay Yavaş

    2017-08-01

    Full Text Available Alkali grass grows in waterlogged, saline and alaline soils. The main problem in these soils is minerals at toxic level. The toxic ions are chloride, sodium and boron. A number of techniques have been investigated for removing toxic metals from the soil. Today, the cost-effective and environmentally technique is phytoremediation, using hyperaccumulator plants. Alkali grass (Puccinellia ciliata Bor is suggested as a hyperaccumulator plant by the combination of more favourable characteristics with salt and waterlogging tolerance, high biomass value and convincing nutritive value for adverse environmental conditions. For this reason, we collected alkali grass and soil samples from five different locations in Aydın-Muğla highway, Turanlar and Sınırteke villages in Germencik-Aydın. In the soil analysis, we observed that K accumulation varies between root, shoot and panicle at least whereas Na and B shows more variation on whole plant portions among locations. Intense aerenchyma development on the root tips of Puccinellia plant was observed and it is determined as radial lysogenic aerenchyma formation. Average plant height and dry matter values were between 47.2-74.4 cm and 15.61-80.85 g/plant according to locations. The highest plant height value was obtained from the first location whereas the highest dry matter yield was detected in the fifth location. In conclusion, plants from fifth location can be regarded as fodder plants in these areas. Our results indicated that alkali grass can be effective for phytoextraction of sodium and boron from contaminated sites.

  19. 75 FR 80527 - Aluminum Extrusions From China

    Science.gov (United States)

    2010-12-22

    ...)] Aluminum Extrusions From China AGENCY: United States International Trade Commission. ACTION: Scheduling of... of subsidized and less-than-fair-value imports from China of aluminum extrusions, primarily provided... contained in Aluminum Extrusions From the People's Republic of China: Notice of Preliminary Determination of...

  20. Proposal of 99.99%-aluminum/7N01-Aluminum clad beam tube for high energy booster of Superconducting Super Collider

    International Nuclear Information System (INIS)

    Ishimaru, Hajime

    1994-01-01

    Proposal of 99.99% pure aluminum/7N01 aluminum alloy clad beam tube for high energy booster in Superconducting Super Collider is described. This aluminum clad beam tube has many good performances, but a eddy current effect is large in superconducting magnet quench collapse. The quench test result for aluminum clad beam tube is basically no problem against magnet quench collapse. (author)

  1. Reshock and release response of aluminum single crystal

    International Nuclear Information System (INIS)

    Huang, H.; Asay, J. R.

    2007-01-01

    Reshock and release experiments were performed on single crystal aluminum along three orientations and on polycrystalline 1050 aluminum with 50 μm grain size at shock stresses of 13 and 21 GPa to investigate the mechanisms for previously observed quasielastic recompression behavior. Particle velocity profiles obtained during reshocking both single crystals and polycrystalline aluminum from initial shock stresses of 13-21 GPa show similar quasielastic recompression behavior. Quasielastic release response is also observed in all single crystals, but the magnitude of the effect is crystal orientation dependent, with [111] and [110] exhibiting more ideal elastic-plastic release for unloading from the shocked state than for the [100] orientation and polycrystalline aluminum. The quasielastic response of 1050 aluminum is intermediate to that of the [100] and [111] orientations. Comparison of the wave profiles obtained for both unloading and reloading of single crystals and polycrystalline 1050 aluminum from shocked states suggests that the observed quasielastic response of polycrystalline aluminum results from the averaging response of single crystals for shock propagation along different orientations, and that the response of 1050 aluminum with large grain boundaries is not significantly different from the results obtained on single crystal aluminum. The yield strength of the single crystals and 1050 aluminum is found to increase with shock stress, which is consistent with previous results [H. Huang and I. R. Asay, J. Appl. Phys. 98, 033524 (2005)

  2. 49 CFR 178.505 - Standards for aluminum drums.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for aluminum drums. 178.505 Section 178... PACKAGINGS Non-bulk Performance-Oriented Packaging Standards § 178.505 Standards for aluminum drums. (a) The following are the identification codes for aluminum drums: (1) 1B1 for a non-removable head aluminum drum...

  3. Aluminum low temperature smelting cell metal collection

    Science.gov (United States)

    Beck, Theodore R.; Brown, Craig W.

    2002-07-16

    A method of producing aluminum in an electrolytic cell containing alumina dissolved in an electrolyte. The method comprises the steps of providing a molten salt electrolyte in an electrolytic cell having an anodic liner for containing the electrolyte, the liner having an anodic bottom and walls including at least one end wall extending upwardly from the anodic bottom, the anodic liner being substantially inert with respect to the molten electrolyte. A plurality of non-consumable anodes is provided and disposed vertically in the electrolyte. A plurality of cathodes is disposed vertically in the electrolyte in alternating relationship with the anodes. The anodes are electrically connected to the anodic liner. An electric current is passed through the anodic liner to the anodes, through the electrolyte to the cathodes, and aluminum is deposited on said cathodes. Oxygen bubbles are generated at the anodes and the anodic liner, the bubbles stirring the electrolyte. Molten aluminum is collected from the cathodes into a tubular member positioned underneath the cathodes. The tubular member is in liquid communication with each cathode to collect the molten aluminum therefrom while excluding electrolyte. Molten aluminum is delivered through the tubular member to a molten aluminum reservoir located substantially opposite the anodes and cathodes. The molten aluminum is collected from the cathodes and delivered to the reservoir while avoiding contact of the molten aluminum with the anodic bottom.

  4. Studying the processes of sodium-water interaction in the BOR-60 reactor micromodule steam generator

    International Nuclear Information System (INIS)

    Tsykanov, V.A.; Antipin, G.K.; Borisov, V.V.

    1981-01-01

    Main results of experimental studies of emergency regimes of micromodule steam generator (MSG) at small and big leaks of water into sodium, realized using the 30 MW MSG, operating in the BOR-o0 reactor, are considered. The aims of the study are as follows: the modelling of macroleak in ''Nadja'' steam generator for the BN-350 reactor; testing the conceptions of alarm signalling and MSG protection; testing under real conditions of new perspective systems of leak detection; gaining the experimence and development of the ways to eliminate the consequences of accident caused by big water leak into sodium; accumulation of knowledge on restoration of MSG operating ability after accident; experimental test of calculational techniques for big leak accidents to use them in future for calculational studies of similar situations at other reactors equipped with sodium-water steam generators; refinement of characteristics of hydrodynamic and thermal effects interaction zone for big leak in real circuit during the plant operation. A series of experiments with the imitation of water leak into sodium by means of argon and steam supply through injection devices, located before the steam superheater module of one of the sections and between evaporator module of the same section, is conducted. The range of steam flow rate is 0.02-0.45 g/s. Duration of steam supply is 100-400 s. A conclusion is made that the results obtained can be used for steam generator of the BN-350 reactor [ru

  5. Electrometallurgical treatment of aluminum-based fuels

    International Nuclear Information System (INIS)

    Willit, J. L.

    1998-01-01

    We have successfully demonstrated aluminum electrorefining from a U-Al-Si alloy that simulates spent aluminum-based reactor fuel. The aluminum product contains less than 200 ppm uranium. All the results obtained have been in agreement with predictions based on equilibrium thermodynamics. We have also demonstrated the need for adequate stirring to achieve a low-uranium product. Most of the other process steps have been demonstrated in other programs. These include uranium electrorefining, transuranic fission product scrubbing, fission product oxidation, and product consolidation by melting. Future work will focus on the extraction of active metal and rare earth fission products by a molten flux salt and scale-up of the aluminum electrorefining

  6. Use of low-cost aluminum in electric energy production

    Science.gov (United States)

    Zhuk, Andrey Z.; Sheindlin, Alexander E.; Kleymenov, Boris V.; Shkolnikov, Eugene I.; Lopatin, Marat Yu.

    Suppression of the parasitic corrosion while maintaining the electrochemical activity of the anode metal is one of the serious problems that affects the energy efficiency of aluminum-air batteries. The need to use high-purity aluminum or special aluminum-based alloys results in a significant increase in the cost of the anode, and thus an increase in the total cost of energy generated by the aluminum-air battery, which narrows the range of possible applications for this type of power source. This study considers the process of parasitic corrosion as a method for hydrogen production. Hydrogen produced in an aluminum-air battery by this way may be further employed in a hydrogen-air fuel cell (Hy-air FC) or in a heat engine, or it may be burnt to generate heat. Therefore, anode materials may be provided by commercially pure aluminum, commercially produced aluminum alloys, and secondary aluminum. These materials are much cheaper and more readily available than special anode alloys of aluminum and high-purity aluminum. The aim of present study is to obtain experimental data for comparison of energy and cost parameters of some commercially produced aluminum alloys, of high-purity aluminum, and of a special Al-ln anode alloy in the context of using these materials as anodes for an Al-air battery and for combined production of electrical power and hydrogen.

  7. Corrosion Protection of Aluminum

    Science.gov (United States)

    Dalrymple, R. S.; Nelson, W. B.

    1963-07-01

    Treatment of aluminum-base metal surfaces in an autoclave with an aqueous chromic acid solution of 0.5 to 3% by weight and of pH below 2 for 20 to 50 hrs at 160 to 180 deg C produces an extremely corrosion-resistant aluminum oxidechromium film on the surface. A chromic acid concentration of 1 to 2% and a pH of about 1 are preferred.

  8. Technological, Economic, and Environmental Optimization of Aluminum Recycling

    Science.gov (United States)

    Ioana, Adrian; Semenescu, Augustin

    2013-08-01

    The four strategic directions (referring to the entire life cycle of aluminum) are as follows: production, primary use, recycling, and reuse. Thus, in this work, the following are analyzed and optimized: reducing greenhouse gas emissions from aluminum production, increasing energy efficiency in aluminum production, maximizing used-product collection, recycling, and reusing. According to the energetic balance at the gaseous environment level, the conductive transfer model is also analyzed through the finished elements method. Several principles of modeling and optimization are presented and analyzed: the principle of analogy, the principle of concepts, and the principle of hierarchization. Based on these principles, an original diagram model is designed together with the corresponding logic diagram. This article also presents and analyzes the main benefits of aluminum recycling and reuse. Recycling and reuse of aluminum have the main advantage that it requires only about 5% of energy consumed to produce it from bauxite. The aluminum recycling and production process causes the emission of pollutants such as dioxides and furans, hydrogen chloride, and particulate matter. To control these emissions, aluminum recyclers are required to comply with the National Emission Standards for Hazardous Air Pollutants for Secondary Aluminum Production. The results of technological, economic, and ecological optimization of aluminum recycling are based on the criteria function's evaluation in the modeling system.

  9. Aluminum hydroxide issue closure package

    International Nuclear Information System (INIS)

    Bergman, T.B.

    1998-01-01

    Aluminum hydroxide coatings on fuel elements stored in aluminum canisters in K West Basin were measured in July and August 1998. Good quality data was produced that enabled statistical analysis to determine a bounding value for aluminum hydroxide at a 99% confidence level. The updated bounding value is 10.6 kg per Multi-Canister Overpack (MCO), compared to the previously estimated bounding value of 8 kg/MCO. Thermal analysis using the updated bounding value, shows that the MCO generates oxygen concentrate that are below the lower flammability limits during the 40-year interim storage period and are, therefore, acceptable

  10. 21 CFR 582.2122 - Aluminum calcium silicate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent. (c...

  11. 21 CFR 182.2122 - Aluminum calcium silicate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum calcium silicate. 182.2122 Section 182.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent. (c...

  12. 21 CFR 582.1781 - Sodium aluminum phosphate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Sodium aluminum phosphate. 582.1781 Section 582.1781 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Additives § 582.1781 Sodium aluminum phosphate. (a) Product. Sodium aluminum phosphate. (b) Conditions of...

  13. 21 CFR 182.1781 - Sodium aluminum phosphate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium aluminum phosphate. 182.1781 Section 182.1781 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Food Substances § 182.1781 Sodium aluminum phosphate. (a) Product. Sodium aluminum phosphate. (b...

  14. Trends in the global aluminum fabrication industry

    Science.gov (United States)

    Das, Subodh; Yin, Weimin

    2007-02-01

    The aluminum fabrication industry has become more vital to the global economy as international aluminum consumption has grown steadily in the past decades. Using innovation, value, and sustainability, the aluminum industry is strengthening its position not only in traditional packaging and construction applications but also in the automotive and aerospace markets to become more competitive and to face challenges from other industries and higher industrial standards. The aluminum fabrication industry has experienced a significant geographical shift caused by rapid growth in emerging markets in countries such as Brazil, Russia, India, and China. Market growth and distribution will vary with different patterns of geography and social development; the aluminum industry must be part of the transformation and keep pace with market developments to benefit.

  15. Electrical transport through single-wall carbon nanotube-anodic aluminum oxide-aluminum heterostructures

    International Nuclear Information System (INIS)

    Kukkola, Jarmo; Rautio, Aatto; Sala, Giovanni; Pino, Flavio; Toth, Geza; Leino, Anne-Riikka; Maeklin, Jani; Jantunen, Heli; Uusimaeki, Antti; Kordas, Krisztian; Gracia, Eduardo; Terrones, Mauricio; Shchukarev, Andrey; Mikkola, Jyri-Pekka

    2010-01-01

    Aluminum foils were anodized in sulfuric acid solution to form thick porous anodic aluminum oxide (AAO) films of thickness ∼6 μm. Electrodes of carboxyl-functionalized single-wall carbon nanotube (SWCNT) thin films were inkjet printed on the anodic oxide layer and the electrical characteristics of the as-obtained SWCNT-AAO-Al structures were studied. Nonlinear current-voltage transport and strong temperature dependence of conduction through the structure was measured. The microstructure and chemical composition of the anodic oxide layer was analyzed using transmission and scanning electron microscopy as well as x-ray photoelectron spectroscopy. Schottky emission at the SWCNT-AAO and AAO-Al interfaces allowed by impurity states in the anodic aluminum oxide film together with ionic surface conduction on the pore walls of AAO gives a reasonable explanation for the measured electrical conduction. Calcined AAO is proposed as a dielectric material for SWCNT-field effect transistors.

  16. A melt refining method for uranium-contaminated aluminum

    International Nuclear Information System (INIS)

    Uda, T.; Iba, H.; Hanawa, K.

    1986-01-01

    Melt refining of uranium-contaminated aluminum which has been difficult to decontaminate because of the high reactivity of aluminum, was experimentally studied. Samples of contaminated aluminum and its alloys were melted after adding various halide fluxes at various melting temperatures and various melting times. Uranium concentration in the resulting ingots was determined. Effective flux compositions were mixtures of chlorides and fluorides, such as LiF, KCl, and BaCl 2 , at a fluoride/chloride mole ratio of 1 to 1.5. The removal of uranium from aluminum (the ''decontamination effect'') increased with decreasing melting temperature, but the time allowed for reaction had little influence. Pure aluminum was difficult to decontaminate from uranium; however, uranium could be removed from alloys containing magnesium. This was because the activity of the aluminum was decreased by formation of the intermetallic compound Al-Mg. With a flux of LiF-KCl-BaCl 2 and a temperature of 800 0 C, uranium added to give an initial concentration of 500 ppm was removed from a commercial alloy of aluminum, A5056, which contains 5% magnesium, to a final concentration of 0.6 ppm, which is near that in the initial aluminum alloy

  17. Decontamination and reuse of ORGDP aluminum scrap

    International Nuclear Information System (INIS)

    Compere, A.L.; Griffith, W.L.; Hayden, H.W.; Wilson, D.F.

    1996-12-01

    The Gaseous Diffusion Plants, or GDPs, have significant amounts of a number of metals, including nickel, aluminum, copper, and steel. Aluminum was used extensively throughout the GDPs because of its excellent strength to weight ratios and good resistance to corrosion by UF 6 . This report is concerned with the recycle of aluminum stator and rotor blades from axial compressors. Most of the stator and rotor blades were made from 214-X aluminum casting alloy. Used compressor blades were contaminated with uranium both as a result of surface contamination and as an accumulation held in surface-connected voids inside of the blades. A variety of GDP studies were performed to evaluate the amounts of uranium retained in the blades; the volume, area, and location of voids in the blades; and connections between surface defects and voids. Based on experimental data on deposition, uranium content of the blades is 0.3%, or roughly 200 times the value expected from blade surface area. However, this value does correlate with estimated internal surface area and with lengthy deposition times. Based on a literature search, it appears that gaseous decontamination or melt refining using fluxes specific for uranium removal have the potential for removing internal contamination from aluminum blades. A melt refining process was used to recycle blades during the 1950s and 1960s. The process removed roughly one-third of the uranium from the blades. Blade cast from recycled aluminum appeared to perform as well as blades from virgin material. New melt refining and gaseous decontamination processes have been shown to provide substantially better decontamination of pure aluminum. If these techniques can be successfully adapted to treat aluminum 214-X alloy, internal and, possibly, external reuse of aluminum alloys may be possible

  18. Lithium-aluminum-magnesium electrode composition

    Science.gov (United States)

    Melendres, Carlos A.; Siegel, Stanley

    1978-01-01

    A negative electrode composition is presented for use in a secondary, high-temperature electrochemical cell. The cell also includes a molten salt electrolyte of alkali metal halides or alkaline earth metal halides and a positive electrode including a chalcogen or a metal chalcogenide as the active electrode material. The negative electrode composition includes up to 50 atom percent lithium as the active electrode constituent and a magnesium-aluminum alloy as a structural matrix. Various binary and ternary intermetallic phases of lithium, magnesium, and aluminum are formed but the electrode composition in both its charged and discharged state remains substantially free of the alpha lithium-aluminum phase and exhibits good structural integrity.

  19. Evaluation of aluminum migration into foodstuffs from aluminium cookware

    Directory of Open Access Journals (Sweden)

    M Radi

    2014-05-01

    Full Text Available Nowadays, the existence of aluminum in human diet as a food contaminant has attracted the concerns of many researchers. It seems that the cooking pans are common sources of aluminum exposure through foodstuffs in Iran. The aim of this study was to evaluate the migration of aluminum from cooking containers into foodstuffs. For this purpose, solutions with different concentrations of citric acid, sodium chloride, fat, protein and sugar were prepared and migration of aluminum into these solutions was measured using atomic absorption spectrometry. Results showed that salt and citric acid concentrations could enhance aluminum migration; whereas, acid concentration was more effective than salt due to its corrosive effect. The intensity of heat processing and the duration of heat treatment had direct relation with aluminum migration. The aluminum content of cooked foods in aluminum cooking pans was also significantly more than control samples.

  20. Chemical effects in the Corrosion of Aluminum and Aluminum Alloys. A Bibliography

    Science.gov (United States)

    1976-10-01

    tances.II. Effect Of Pomegranate Juice And The Aqueous Extract Of Pomegranate Fruits And Tea leaves On The Corrosion Of Aluminum" The effect of the juices...T7651 tempers to exfoliation and stress- corrosion cracking . 1968-8 D.P. Doyle and H.P. Godard ,a) Tr. Mezhdunar. Kongr. Korroz. Metal, 4, 439-48, (1968...Tapper Brit. Corros. J., 3, 285-87, (1968) "Corrosion Of Aluminum" Summary of the literature of Al corrosion which includes stress- corrosion cracking

  1. Membrane Purification Cell for Aluminum Recycling

    Energy Technology Data Exchange (ETDEWEB)

    David DeYoung; James Wiswall; Cong Wang

    2011-11-29

    Recycling mixed aluminum scrap usually requires adding primary aluminum to the scrap stream as a diluent to reduce the concentration of non-aluminum constituents used in aluminum alloys. Since primary aluminum production requires approximately 10 times more energy than melting scrap, the bulk of the energy and carbon dioxide emissions for recycling are associated with using primary aluminum as a diluent. Eliminating the need for using primary aluminum as a diluent would dramatically reduce energy requirements, decrease carbon dioxide emissions, and increase scrap utilization in recycling. Electrorefining can be used to extract pure aluminum from mixed scrap. Some example applications include producing primary grade aluminum from specific scrap streams such as consumer packaging and mixed alloy saw chips, and recycling multi-alloy products such as brazing sheet. Electrorefining can also be used to extract valuable alloying elements such as Li from Al-Li mixed scrap. This project was aimed at developing an electrorefining process for purifying aluminum to reduce energy consumption and emissions by 75% compared to conventional technology. An electrolytic molten aluminum purification process, utilizing a horizontal membrane cell anode, was designed, constructed, operated and validated. The electrorefining technology could also be used to produce ultra-high purity aluminum for advanced materials applications. The technical objectives for this project were to: - Validate the membrane cell concept with a lab-scale electrorefining cell; - Determine if previously identified voltage increase issue for chloride electrolytes holds for a fluoride-based electrolyte system; - Assess the probability that voltage change issues can be solved; and - Conduct a market and economic analysis to assess commercial feasibility. The process was tested using three different binary alloy compositions (Al-2.0 wt.% Cu, Al-4.7 wt.% Si, Al-0.6 wt.% Fe) and a brazing sheet scrap composition (Al-2

  2. Achieving Carbon Neutrality in the Global Aluminum Industry

    Science.gov (United States)

    Das, Subodh

    2012-02-01

    In the 21st century, sustainability is widely regarded as the new corporate culture, and leading manufacturing companies (Toyota, GE, and Alcoa) and service companies (Google and Federal Express) are striving towards carbon neutrality. The current carbon footprint of the global aluminum industry is estimated at 500 million metric tonnes carbon dioxide equivalent (CO2eq), representing about 1.7% of global emissions from all sources. For the global aluminum industry, carbon neutrality is defined as a state where the total "in-use" CO2eq saved from all products in current use, including incremental process efficiency improvements, recycling, and urban mining activities, equals the CO2eq expended to produce the global output of aluminum. This paper outlines an integrated and quantifiable plan for achieving "carbon neutrality" in the global aluminum industry by advocating five actionable steps: (1) increase use of "green" electrical energy grid by 8%, (2) reduce process energy needs by 16%, (3) deploy 35% of products in "in-use" energy saving applications, (4) divert 6.1 million metric tonnes/year from landfills, and (5) mine 4.5 million metric tonnes/year from aluminum-rich "urban mines." Since it takes 20 times more energy to make aluminum from bauxite ore than to recycle it from scrap, the global aluminum industry could set a reasonable, self-imposed energy/carbon neutrality goal to incrementally increase the supply of recycled aluminum by at least 1.05 metric tonnes for every tonne of incremental production via primary aluminum smelter capacity. Furthermore, the aluminum industry can and should take a global leadership position by actively developing internationally accepted and approved carbon footprint credit protocols.

  3. Role of Spirulina in mitigating hemato-toxicity in Swiss albino mice exposed to aluminum and aluminum fluoride.

    Science.gov (United States)

    Sharma, Shweta; Sharma, K P; Sharma, Subhasini

    2016-12-01

    Aluminum is ingested through foods, water, air, and even drugs. Its intake is potentiated further through foods and tea prepared in aluminum utensils and Al salt added in the drinking water for removal of suspended impurities and also fluoride in the affected areas. The ameliorating role of a blue green alga Spirulina is well documented to various pollutants in the animal models. We, therefore, examined its protective role (230 mg/kg body weight) on the hematology of male Swiss albino mice treated with aluminum (sub-acute = 78.4 mg/kg body weight for 7 days, sub-chronic = 7.8 mg/kg body weight for 90 days) and aluminum fluoride (sub-acute = 103 mg/kg body weight, sub-chronic = 21 mg/kg body weight), along with their recovery after 90 days of sub-chronic exposure. This study revealed significant reduction in the values of RBC (5-18 %), Hb (15-17 %), PCV (8-14 %), and platelets (26-36 %), and increase in WBC (54-124 %) in the treated mice, particularly after sub-acute exposure. Aluminum fluoride was comparatively more toxic than aluminum. Further, Spirulina supplement not only alleviated toxicity of test chemicals in Swiss albino mice but also led to their better recovery after withdrawal.

  4. Nanshan Aluminum Reached Strategic Cooperation with CSR Corporation Limited

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    As a key supplier of aluminum profiles and aluminum plate,sheet and trip products for CSR Corporation Limited,Nanshan Aluminum will join hands with CSR Corporation Limited to reach strategic cooperation.On January 5,Nanshan Aluminum signed strategic cooperation agreement with CSR Sifang Locomotive&Rolling; Stock Co.,Ltd,both

  5. Reactive ion assisted deposition of aluminum oxynitride thin films

    International Nuclear Information System (INIS)

    Hwangbo, C.K.; Lingg, L.J.; Lehan, J.P.; Macleod, H.A.; Suits, F.

    1989-01-01

    Optical properties, stoichiometry, chemical bonding states, and crystal structure of aluminum oxynitride (AlO/sub x/N/sub y/) thin films prepared by reactive ion assisted deposition were investigated. The results show that by controlling the amount of reactive gases the refractive index of aluminum oxynitride films at 550 nm is able to be varied from 1.65 to 1.83 with a very small extinction coefficient. Variations of optical constants and chemical bonding states of aluminum oxynitride films are related to the stoichiometry. From an x-ray photoelectron spectroscopy analysis it is observed that our aluminum oxynitride film is not simply a mixture of aluminum oxide and aluminum nitride but a continuously variable compound. The aluminum oxynitride films are amorphous from an x-ray diffraction analysis. A rugate filter using a step index profile of aluminum oxynitride films was fabricated by nitrogen ion beam bombardment of a growing Al film with backfill oxygen pressure as the sole variation. This filter shows a high resistivity to atmospheric moisture adsorption, suggesting that the packing density of aluminum oxynitride films is close to unity and the energetic ion bombardment densifies the film as well as forming the compound

  6. Characterization of ultrafine aluminum nanoparticles

    International Nuclear Information System (INIS)

    Sandstrom, Mary M.; Jorgensen, Betty S.; Mang, Joseph T.; Smith, Bettina L.; Son, Steven F.

    2004-01-01

    Aluminum nanopowders with particle sizes ranging from ∼25 nm to 80 nm were characterized by a variety of methods. We present and compare the results from common powder characterization techniques including transmission electron microscopy (TEM), high resolution transmission electron microscopy (HRTEM), BET gas adsorption surface area analysis, thermogravimetric analysis (TGA), photon correlation spectroscopy (PCS), and low angle laser light scattering (LALLS). Aluminum nanoparticles consist of an aluminum core with an aluminum oxide coating. HRTEM measurements of both the particle diameter and oxide layer thickness tend to be larger than those obtained from BET and TGA. LALLS measurements show a large degree of particle agglomeration in solution; therefore, primary particle sizes could not be determined. Furthermore, results from small-angle scattering techniques (SAS), including small-angle neutron (SANS) and x-ray (SAXS) scattering are presented and show excellent agreement with the BET, TGA, and HRTEM. The suite of analytical techniques presented in this paper can be used as a powerful tool in the characterization of many types of nanosized powders.

  7. Enhanced active aluminum content and thermal behaviour of nano-aluminum particles passivated during synthesis using thermal plasma route

    International Nuclear Information System (INIS)

    Mathe, Vikas L.; Varma, Vijay; Raut, Suyog; Nandi, Amiya Kumar; Pant, Arti; Prasanth, Hima; Pandey, R.K.; Bhoraskar, Sudha V.; Das, Asoka K.

    2016-01-01

    Graphical abstract: - Highlights: • Synthesis of nano crystalline Al (nAl) using DC thermal plasma reactor. • In situ passivation of nAl by palmitic acid and air. • Enhanced active aluminum content obtained for palmitic acid passivated nAl. • Palmitic acid passivated nAl are quite stable in humid atmospheres. - Abstract: Here, we report synthesis and in situ passivation of aluminum nanoparticles using thermal plasma reactor. Both air and palmitc acid passivation was carried out during the synthesis in the thermal plasma reactor. The passivated nanoparticles have been characterized for their structural and morphological properties using X-ray diffraction (XRD) and transmission electron microscopy (TEM) techniques. In order to understand nature of passivation vibrational spectroscopic analysis have been carried out. The enhancement in active aluminum content and shelf life for a palmitic acid passivated nano-aluminum particles in comparison to the air passivated samples and commercially available nano Al powder (ALEX) has been observed. Thermo-gravimetric analysis was used to estimate active aluminum content of all the samples under investigation. In addition cerimetric back titration method was also used to estimate AAC and the shelf life of passivated aluminum particles. Structural, microstructural and thermogravomateric analysis of four year aged passivated sample also depicts effectiveness of palmitic acid passivation.

  8. Enhanced active aluminum content and thermal behaviour of nano-aluminum particles passivated during synthesis using thermal plasma route

    Energy Technology Data Exchange (ETDEWEB)

    Mathe, Vikas L., E-mail: vlmathe@physics.unipune.ac.in [Department of Physics, Savitribai Phule Pune University, Pune 411007, Maharashtra (India); Varma, Vijay; Raut, Suyog [Department of Physics, Savitribai Phule Pune University, Pune 411007, Maharashtra (India); Nandi, Amiya Kumar; Pant, Arti; Prasanth, Hima; Pandey, R.K. [High Energy Materials Research Lab, Sutarwadi, Pune 411021, Maharashtra (India); Bhoraskar, Sudha V. [Department of Physics, Savitribai Phule Pune University, Pune 411007, Maharashtra (India); Das, Asoka K. [Utkal University, VaniVihar, Bhubaneswar, Odisha 751004 (India)

    2016-04-15

    Graphical abstract: - Highlights: • Synthesis of nano crystalline Al (nAl) using DC thermal plasma reactor. • In situ passivation of nAl by palmitic acid and air. • Enhanced active aluminum content obtained for palmitic acid passivated nAl. • Palmitic acid passivated nAl are quite stable in humid atmospheres. - Abstract: Here, we report synthesis and in situ passivation of aluminum nanoparticles using thermal plasma reactor. Both air and palmitc acid passivation was carried out during the synthesis in the thermal plasma reactor. The passivated nanoparticles have been characterized for their structural and morphological properties using X-ray diffraction (XRD) and transmission electron microscopy (TEM) techniques. In order to understand nature of passivation vibrational spectroscopic analysis have been carried out. The enhancement in active aluminum content and shelf life for a palmitic acid passivated nano-aluminum particles in comparison to the air passivated samples and commercially available nano Al powder (ALEX) has been observed. Thermo-gravimetric analysis was used to estimate active aluminum content of all the samples under investigation. In addition cerimetric back titration method was also used to estimate AAC and the shelf life of passivated aluminum particles. Structural, microstructural and thermogravomateric analysis of four year aged passivated sample also depicts effectiveness of palmitic acid passivation.

  9. Defect reduction in seeded aluminum nitride crystal growth

    Science.gov (United States)

    Bondokov, Robert T.; Schowalter, Leo J.; Morgan, Kenneth; Slack, Glen A; Rao, Shailaja P.; Gibb, Shawn Robert

    2017-09-26

    Bulk single crystal of aluminum nitride (AlN) having an areal planar defect density.ltoreq.100 cm.sup.-2. Methods for growing single crystal aluminum nitride include melting an aluminum foil to uniformly wet a foundation with a layer of aluminum, the foundation forming a portion of an AlN seed holder, for an AlN seed to be used for the AlN growth. The holder may consist essentially of a substantially impervious backing plate.

  10. 46 CFR 154.195 - Aluminum cargo tank: Steel enclosure.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Aluminum cargo tank: Steel enclosure. 154.195 Section... Equipment Hull Structure § 154.195 Aluminum cargo tank: Steel enclosure. (a) An aluminum cargo tank and its... the aluminum cargo tank must meet the steel structural standards of the American Bureau of Shipping...

  11. Precision forging technology for aluminum alloy

    Science.gov (United States)

    Deng, Lei; Wang, Xinyun; Jin, Junsong; Xia, Juchen

    2018-03-01

    Aluminum alloy is a preferred metal material for lightweight part manufacturing in aerospace, automobile, and weapon industries due to its good physical properties, such as low density, high specific strength, and good corrosion resistance. However, during forging processes, underfilling, folding, broken streamline, crack, coarse grain, and other macro- or microdefects are easily generated because of the deformation characteristics of aluminum alloys, including narrow forgeable temperature region, fast heat dissipation to dies, strong adhesion, high strain rate sensitivity, and large flow resistance. Thus, it is seriously restricted for the forged part to obtain precision shape and enhanced property. In this paper, progresses in precision forging technologies of aluminum alloy parts were reviewed. Several advanced precision forging technologies have been developed, including closed die forging, isothermal die forging, local loading forging, metal flow forging with relief cavity, auxiliary force or vibration loading, casting-forging hybrid forming, and stamping-forging hybrid forming. High-precision aluminum alloy parts can be realized by controlling the forging processes and parameters or combining precision forging technologies with other forming technologies. The development of these technologies is beneficial to promote the application of aluminum alloys in manufacturing of lightweight parts.

  12. Energy analysis of hydrogen and electricity production from aluminum-based processes

    International Nuclear Information System (INIS)

    Wang, Huizhi; Leung, Dennis Y.C.; Leung, Michael K.H.

    2012-01-01

    The aluminum energy conversion processes have been characterized to be carbon-free and sustainable. However, their applications are restrained by aluminum production capacity as aluminum is never found as a free metal on the earth. This study gives an assessment of typical aluminum-based energy processes in terms of overall energy efficiency and cost. Moreover, characteristics associated with different processes are identified. Results in this study indicate the route from which aluminum is produced can be a key factor in determining the efficiency and costs. Besides, the aluminum–air battery provides a more energy-efficient manner for the conversion of energy stored in primary aluminum and recovered aluminum from products compared to aluminum-based hydrogen production, whereas the aluminum-based hydrogen production gives a more energy-efficient way of utilizing energy stored in secondary aluminum or even scrap aluminum.

  13. Comparison of Electromagnetic and Marangoni Forces on Thin Coatings during Rapid Heating Process

    Science.gov (United States)

    Steinberg, T.; Opitz, T.; Rybakov, A.; Baake, E.

    2018-05-01

    The present paper is dedicated to the investigation of Marangoni and Lorentz forces in a rapid heating process. During the melting of aluminum-silicon (AlSi) layer on the bor-manganese steel 22MnB5, the liquid AlSi is shifting from the middle to the side and leaves dry spots on the steel due to a combination of both forces. In order to solve this process design issue, the impact of each force in the process will be evaluated. Evaluation is carried out using experimental data and numerical simulation.

  14. Lead exposure from aluminum cookware in Cameroon

    International Nuclear Information System (INIS)

    Weidenhamer, Jeffrey D.; Kobunski, Peter A.; Kuepouo, Gilbert; Corbin, Rebecca W.; Gottesfeld, Perry

    2014-01-01

    Blood lead levels have decreased following the removal of lead from gasoline in most of the world. However, numerous recent studies provide evidence that elevated blood lead levels persist in many low and middle-income countries around the world at much higher prevalence than in the more developed countries. One potential source of lead exposure that has not been widely investigated is the leaching of lead from artisanal aluminum cookware, which is commonly used in the developing world. Twenty-nine samples of aluminum cookware and utensils manufactured by local artisans in Cameroon were collected and analyzed for their potential to release lead during cooking. Source materials for this cookware included scrap metal such as engine parts, radiators, cans, and construction materials. The lead content of this cookware is relatively low (< 1000 ppm by X-ray fluorescence), however significant amounts of lead, as well as aluminum and cadmium were released from many of the samples using dilute acetic acid extractions at boiling and ambient temperatures. Potential exposures to lead per serving were estimated to be as high as 260 μg, indicating that such cookware can pose a serious health hazard. We conclude that lead, aluminum and cadmium can migrate from this aluminum cookware during cooking and enter food at levels exceeding recommended public health guidelines. Our results support the need to regulate lead content of materials used to manufacture these pots. Artisanal aluminum cookware may be a major contributor to lead poisoning throughout the developing world. Testing of aluminum cookware in other developing countries is warranted. - Highlights: • Cookware is manufactured in Cameroon from scrap aluminum including car parts. • Twenty-nine cookware samples were evaluated for their potential to leach lead. • Boiling extractions to simulate the effects of cooking released significant lead. • Potential lead exposures per serving are estimated as high as 260 μg.

  15. Lead exposure from aluminum cookware in Cameroon

    Energy Technology Data Exchange (ETDEWEB)

    Weidenhamer, Jeffrey D.; Kobunski, Peter A. [Department of Chemistry, Geology and Physics, 401 College Ave., Ashland University, Ashland, OH 44805 (United States); Kuepouo, Gilbert [Research and Education Centre for Development (CREPD), Yaounde (Cameroon); Corbin, Rebecca W. [Department of Chemistry, Geology and Physics, 401 College Ave., Ashland University, Ashland, OH 44805 (United States); Gottesfeld, Perry, E-mail: pgottesfeld@okinternational.org [Occupational Knowledge International, San Francisco, CA (United States)

    2014-10-15

    Blood lead levels have decreased following the removal of lead from gasoline in most of the world. However, numerous recent studies provide evidence that elevated blood lead levels persist in many low and middle-income countries around the world at much higher prevalence than in the more developed countries. One potential source of lead exposure that has not been widely investigated is the leaching of lead from artisanal aluminum cookware, which is commonly used in the developing world. Twenty-nine samples of aluminum cookware and utensils manufactured by local artisans in Cameroon were collected and analyzed for their potential to release lead during cooking. Source materials for this cookware included scrap metal such as engine parts, radiators, cans, and construction materials. The lead content of this cookware is relatively low (< 1000 ppm by X-ray fluorescence), however significant amounts of lead, as well as aluminum and cadmium were released from many of the samples using dilute acetic acid extractions at boiling and ambient temperatures. Potential exposures to lead per serving were estimated to be as high as 260 μg, indicating that such cookware can pose a serious health hazard. We conclude that lead, aluminum and cadmium can migrate from this aluminum cookware during cooking and enter food at levels exceeding recommended public health guidelines. Our results support the need to regulate lead content of materials used to manufacture these pots. Artisanal aluminum cookware may be a major contributor to lead poisoning throughout the developing world. Testing of aluminum cookware in other developing countries is warranted. - Highlights: • Cookware is manufactured in Cameroon from scrap aluminum including car parts. • Twenty-nine cookware samples were evaluated for their potential to leach lead. • Boiling extractions to simulate the effects of cooking released significant lead. • Potential lead exposures per serving are estimated as high as 260 μg.

  16. 49 CFR 178.512 - Standards for steel or aluminum boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for steel or aluminum boxes. 178.512... aluminum boxes. (a) The following are identification codes for steel or aluminum boxes: (1) 4A for a steel box; and (2) 4B for an aluminum box. (b) Construction requirements for steel or aluminum boxes are as...

  17. Painting rusted steel: The role of aluminum phosphosilicate

    International Nuclear Information System (INIS)

    Roselli, S.N.; Amo, B. del; Carbonari, R.O.; Di Sarli, A.R.; Romagnoli, R.

    2013-01-01

    Highlights: •Aluminum phosphosilicate is an acid pigment which could act as mild phosphating agent. •Aluminum phosphosilicate can phosphatize iron oxides on rusted surfaces. •Aluminum phosphosilicate is compatible with acid binders. •Aluminum phosphosilicate could replace chromate in complete painting schemes. •Aluminum phosphosilicate primers improve paints adhesion on rusted surfaces. -- Abstract: Surface preparation is a key factor for the adequate performance of a paint system. The aim of this investigation is to employ a wash-primer to accomplish the chemical conversion of rusted surface when current cleaning operations are difficult to carry out. The active component of the wash-primer was aluminum phosphosilicate whose electrochemical behavior and the composition of the generated protective layer, both, were studied by electrochemical techniques and scanning electron microscopy (SEM), respectively. Primed rusted steel panels were coated with an alkyd system to perform accelerated tests in the salt spray chamber and electrochemical impedance measurements (EIS). These tests were conducted in parallel with a chromate wash primer and the same alkyd system. Results showed that the wash-primer containing aluminum phosphosilicate could be used satisfactorily to paint rusted steel exhibiting a similar performance to the chromate primer

  18. Aluminum-air battery crystallizer

    Science.gov (United States)

    Maimoni, A.

    1987-01-01

    A prototype crystallizer system for the aluminum-air battery operated reliably through simulated startup and shutdown cycles and met its design objectives. The crystallizer system allows for crystallization and removal of the aluminium hydroxide reaction product; it is required to allow steady-state and long-term operation of the aluminum-air battery. The system has to minimize volume and maintain low turbulence and shear to minimize secondary nucleation and energy consumption while enhancing agglomeration. A lamella crystallizer satisfies system constraints.

  19. Manufacturing of aluminum composite material using stir casting process

    International Nuclear Information System (INIS)

    Jokhio, M.H.; Panhwar, M.I.; Unar, M.A.

    2011-01-01

    Manufacturing of aluminum alloy based casting composite materials via stir casting is one of the prominent and economical route for development and processing of metal matrix composites materials. Properties of these materials depend upon many processing parameters and selection of matrix and reinforcements. Literature reveals that most of the researchers are using 2, 6 and 7 xxx aluminum matrix reinforced with SiC particles for high strength properties whereas, insufficient information is available on reinforcement of 'AI/sub 2/O/sub 3/' particles in 7 xxx aluminum matrix. The 7 xxx series aluminum matrix usually contains Cu-Zn-Mg; Therefore, the present research was conducted to investigate the effect of elemental metal such as Cu-Zn-Mg in aluminum matrix on mechanical properties of stir casting of aluminum composite materials reinforced with alpha 'AI/sub 2/O/sub 3/' particles using simple foundry melting alloying and casting route. The age hardening treatments were also applied to study the aging response of the aluminum matrix on strength, ductility and hardness. The experimental results indicate that aluminum matrix cast composite can be manufactured via conventional foundry method giving very good responses to the strength and ductility up to 10% 'AI/sub 2/O/sub 3/' particles reinforced in aluminum matrix. (author)

  20. Manufacturing of Aluminum Composite Material Using Stir Casting Process

    Directory of Open Access Journals (Sweden)

    Muhammad Hayat Jokhio

    2011-01-01

    Full Text Available Manufacturing of aluminum alloy based casting composite materials via stir casting is one of the prominent and economical route for development and processing of metal matrix composites materials. Properties of these materials depend upon many processing parameters and selection of matrix and reinforcements. Literature reveals that most of the researchers are using 2, 6 and 7xxx aluminum matrix reinforced with SiC particles for high strength properties whereas, insufficient information is available on reinforcement of \\"Al2O3\\" particles in 7xxx aluminum matrix. The 7xxx series aluminum matrix usually contains Cu-Zn-Mg. Therefore, the present research was conducted to investigate the effect of elemental metal such as Cu-Zn-Mg in aluminum matrix on mechanical properties of stir casting of aluminum composite materials reinforced with alpha \\"Al2O3\\" particles using simple foundry melting alloying and casting route. The age hardening treatments were also applied to study the aging response of the aluminum matrix on strength, ductility and hardness. The experimental results indicate that aluminum matrix cast composite can be manufactured via conventional foundry method giving very good responses to the strength and ductility up to 10% \\"Al2O3\\" particles reinforced in aluminum matrix.

  1. Hydrolysis of aluminum dross material to achieve zero hazardous waste

    International Nuclear Information System (INIS)

    David, E.; Kopac, J.

    2012-01-01

    Highlights: ► The hydrolysis of aluminum dross in tap water generates pure hydrogen. ► Aluminum particles from dross are activated by mechanically milling technique. ► The process is completely greenhouse gases free and is cleanly to environment. ► Hydrolysis process leads to recycling of waste aluminum by hydrogen production. - Abstract: A simple method with high efficiency for generating high pure hydrogen by hydrolysis in tap water of highly activated aluminum dross is established. Aluminum dross is activated by mechanically milling to particles of about 45 μm. This leads to removal of surface layer of the aluminum particles and creation of a fresh chemically active metal surface. In contact with water the hydrolysis reaction takes place and hydrogen is released. In this process a Zero Waste concept is achieved because the other product of reaction is aluminum oxide hydroxide (AlOOH), which is nature-friendly and can be used to make high quality refractory or calcium aluminate cement. For comparison we also used pure aluminum powder and alkaline tap water solution (NaOH, KOH) at a ratio similar to that of aluminum dross content. The rates of hydrogen generated in hydrolysis reaction of pure aluminum and aluminum dross have been found to be similar. As a result of the experimental setup, a hydrogen generator was designed and assembled. Hydrogen volume generated by hydrolysis reaction was measured. The experimental results obtained reveal that aluminum dross could be economically recycled by hydrolysis process with achieving zero hazardous aluminum dross waste and hydrogen generation.

  2. New electrolytes for aluminum production: Ionic liquids

    Science.gov (United States)

    Zhang, Mingming; Kamavarum, Venkat; Reddy, Ramana G.

    2003-11-01

    In this article, the reduction, refining/recycling, and electroplating of aluminum from room-temperature molten salts are reviewed. In addition, the characteristics of several non-conventional organic solvents, electrolytes, and molten salts are evaluated, and the applicability of these melts for production of aluminum is discussed with special attention to ionic liquids. Also reviewed are electrochemical processes and conditions for electrodeposition of aluminum using ionic liquids at near room temperatures.

  3. 21 CFR 73.1010 - Alumina (dried aluminum hydroxide).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Alumina (dried aluminum hydroxide). 73.1010... GENERAL LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1010 Alumina (dried aluminum hydroxide). (a) Identity. (1) The color additive alumina (dried aluminum hydroxide) is a white, odorless...

  4. Beryllium-aluminum alloys for investment castings

    International Nuclear Information System (INIS)

    Nachtrab, W.T.; Levoy, N.

    1997-01-01

    Beryllium-aluminum alloys containing greater than 60 wt % beryllium are very favorable materials for applications requiring light weight and high stiffness. However, when produced by traditional powder metallurgical methods, these alloys are expensive and have limited applications. To reduce the cost of making beryllium-aluminum components, Nuclear Metals Inc. (NMI) and Lockheed Martin Electronics and Missiles have recently developed a family of patented beryllium-aluminum alloys that can be investment cast. Designated Beralcast, the alloys can achieve substantial weight savings because of their high specific strength and stiffness. In some cases, weight has been reduced by up to 50% over aluminum investment casting. Beralcast is now being used to make thin wall precision investment castings for several advanced aerospace applications, such as the RAH-66 Comanche helicopter and F-22 jet fighter. This article discusses alloy compositions, properties, casting method, and the effects of cobalt additions on strength

  5. Recycling of aluminum to produce green energy

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Susana Silva; Lopez Benites, Wendy; Alvarez Gallegos, Alberto A. [Centro de Investigacion en Ingenieria y Ciencias Aplicadas, Av. Universidad 1001, Col. Chamilpa, Cuernavaca, Morelos C.P. 62210 (Mexico); Sebastian, P.J. [Centro de Investigacion en Energia-UNAM, 62580 Temixco, Morelos (Mexico)

    2005-07-15

    High-purity hydrogen gas was generated from the chemical reaction of aluminum with sodium hydroxide. Several molar relations of sodium hydroxide/aluminum were investigated in this study. The experimental results showed that hydrogen yields are acceptable and its purity was good enough to be used in a proton exchange membrane (PEM) fuel cell to produce electricity. An estimation of the amount of energy produced from the reaction of 100 aluminum cans with caustic soda showed that the hydrogen production is feasible to be scaled up to reach up to 5kWh in a few hours. This study is environmentally friendly and also shows that green energy can be produced from aluminum waste at a low cost.

  6. Low Velocity Impact Properties of Aluminum Foam Sandwich Structural Composite

    Directory of Open Access Journals (Sweden)

    ZHAO Jin-hua

    2018-01-01

    Full Text Available Sandwich structural composites were prepared by aluminum foam as core materials with basalt fiber(BF and ultra-high molecular weight polyethylene(UHMWPE fiber composite as faceplate. The effect of factors of different fiber type faceplates, fabric layer design and the thickness of the corematerials on the impact properties and damage mode of aluminum foam sandwich structure was studied. The impact properties were also analyzed to compare with aluminum honeycomb sandwich structure. The results show that BF/aluminum foam sandwich structural composites has bigger impact damage load than UHMWPE/aluminum foam sandwich structure, but less impact displacement and energy absorption. The inter-layer hybrid fabric design of BF and UHMWPE has higher impact load and energy absorption than the overlay hybrid fabric design faceplate sandwich structure. With the increase of the thickness of aluminum foam,the impact load of the sandwich structure decreases, but the energy absorption increases. Aluminum foam sandwich structure has higher impact load than the aluminum honeycomb sandwich structure, but smaller damage energy absorption; the damage mode of aluminum foam core material is mainly the fracture at the impact area, while aluminum honeycomb core has obvious overall compression failure.

  7. Utilization of Aluminum Waste with Hydrogen and Heat Generation

    Science.gov (United States)

    Buryakovskaya, O. A.; Meshkov, E. A.; Vlaskin, M. S.; Shkolnokov, E. I.; Zhuk, A. Z.

    2017-10-01

    A concept of energy generation via hydrogen and heat production from aluminum containing wastes is proposed. The hydrogen obtained by oxidation reaction between aluminum waste and aqueous solutions can be supplied to fuel cells and/or infrared heaters for electricity or heat generation in the region of waste recycling. The heat released during the reaction also can be effectively used. The proposed method of aluminum waste recycling may represent a promising and cost-effective solution in cases when waste transportation to recycling plants involves significant financial losses (e.g. remote areas). Experiments with mechanically dispersed aluminum cans demonstrated that the reaction rate in alkaline solution is high enough for practical use of the oxidation process. In theexperiments aluminum oxidation proceeds without any additional aluminum activation.

  8. First-principles surface interaction studies of aluminum-copper and aluminum-copper-magnesium secondary phases in aluminum alloys

    Science.gov (United States)

    da Silva, Thiago H.; Nelson, Eric B.; Williamson, Izaak; Efaw, Corey M.; Sapper, Erik; Hurley, Michael F.; Li, Lan

    2018-05-01

    First-principles density functional theory-based calculations were performed to study θ-phase Al2Cu, S-phase Al2CuMg surface stability, as well as their interactions with water molecules and chloride (Cl-) ions. These secondary phases are commonly found in aluminum-based alloys and are initiation points for localized corrosion. Density functional theory (DFT)-based simulations provide insight into the origins of localized (pitting) corrosion processes of aluminum-based alloys. For both phases studied, Cl- ions cause atomic distortions on the surface layers. The nature of the distortions could be a factor to weaken the interlayer bonds in the Al2Cu and Al2CuMg secondary phases, facilitating the corrosion process. Electronic structure calculations revealed not only electron charge transfer from Cl- ions to alloy surface but also electron sharing, suggesting ionic and covalent bonding features, respectively. The S-phase Al2CuMg structure has a more active surface than the θ-phase Al2Cu. We also found a higher tendency of formation of new species, such as Al3+, Al(OH)2+, HCl, AlCl2+, Al(OH)Cl+, and Cl2 on the S-phase Al2CuMg surface. Surface chemical reactions and resultant species present contribute to establishment of local surface chemistry that influences the corrosion behavior of aluminum alloys.

  9. 21 CFR 172.310 - Aluminum nicotinate.

    Science.gov (United States)

    2010-04-01

    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION Special Dietary and Nutritional Additives § 172.310 Aluminum nicotinate. Aluminum nicotinate may be safely...

  10. 21 CFR 73.1015 - Chromium-cobalt-aluminum oxide.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Chromium-cobalt-aluminum oxide. 73.1015 Section 73... LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1015 Chromium-cobalt-aluminum oxide. (a) Identity. The color additive chromium-cobalt-aluminum oxide is a blue-green pigment obtained by calcining a...

  11. Electrometallurgical treatment of aluminum-matrix fuels

    International Nuclear Information System (INIS)

    Willit, J.L.; Gay, E.C.; Miller, W.E.; McPheeters, C.C.; Laidler, J.J.

    1996-01-01

    The electrometallurgical treatment process described in this paper builds on our experience in treating spent fuel from the Experimental Breeder Reactor (EBR-II). The work is also to some degree, a spin-off from applying electrometallurgical treatment to spent fuel from the Hanford single pass reactors (SPRs) and fuel and flush salt from the Molten Salt Reactor Experiment (MSRE) in treating EBR-II fuel, we recover the actinides from a uranium-zirconium fuel by electrorefining the uranium out of the chopped fuel. With SPR fuel, uranium is electrorefined out of the aluminum cladding. Both of these processes are conducted in a LiCl-KCl molten-salt electrolyte. In the case of the MSRE, which used a fluoride salt-based fuel, uranium in this salt is recovered through a series of electrochemical reductions. Recovering high-purity uranium from an aluminum-matrix fuel is more challenging than treating SPR or EBR-II fuel because the aluminum- matrix fuel is typically -90% (volume basis) aluminum

  12. Aluminum Solubility in Complex Electrolytes - 13011

    Energy Technology Data Exchange (ETDEWEB)

    Agnew, S.F. [Columbia Energy and Environmental Services, Inc., 1806 Terminal Dr., Richland, WA 99354 (United States); Johnston, C.T. [Dept. of Crop, Soil, and Environmental Sciences, Purdue University, West Lafayette, IN 47907 (United States)

    2013-07-01

    Predicting aluminum solubility for Hanford and Savannah River waste liquids is very important for their disposition. It is a key mission goal at each Site to leach as much aluminum as practical from sludges in order to minimize the amount of vitrified high level waste. And it is correspondingly important to assure that any soluble aluminum does not precipitate during subsequent decontamination of the liquid leachates with ion exchange. This report shows a very simple and yet thermodynamic model for aluminum solubility that is consistent with a wide range of Al liquors, from simple mixtures of hydroxide and aluminate to over 300 Hanford concentrates and to a set of 19 Bayer liquors for temperatures from 20-100 deg. C. This dimer-dS{sub mix} (DDS) model incorporates an ideal entropy of mixing along with previous reports for the Al dimer, water activities, gibbsite, and bayerite thermodynamics. We expect this model will have broad application for nuclear wastes as well as the Bayer gibbsite process industry. (authors)

  13. Electrochemically replicated smooth aluminum foils for anodic alumina nanochannel arrays

    International Nuclear Information System (INIS)

    Biring, Sajal; Tsai, K-T; Sur, Ujjal Kumar; Wang, Y-L

    2008-01-01

    A fast electrochemical replication technique has been developed to fabricate large-scale ultra-smooth aluminum foils by exploiting readily available large-scale smooth silicon wafers as the masters. Since the adhesion of aluminum on silicon depends on the time of surface pretreatment in water, it is possible to either detach the replicated aluminum from the silicon master without damaging the replicated aluminum and master or integrate the aluminum film to the silicon substrate. Replicated ultra-smooth aluminum foils are used for the growth of both self-organized and lithographically guided long-range ordered arrays of anodic alumina nanochannels without any polishing pretreatment

  14. Lithium-aluminum-iron electrode composition

    Science.gov (United States)

    Kaun, Thomas D.

    1979-01-01

    A negative electrode composition is presented for use in a secondary electrochemical cell. The cell also includes an electrolyte with lithium ions such as a molten salt of alkali metal halides or alkaline earth metal halides that can be used in high-temperature cells. The cell's positive electrode contains a a chalcogen or a metal chalcogenide as the active electrode material. The negative electrode composition includes up to 50 atom percent lithium as the active electrode constituent in an alloy of aluminum-iron. Various binary and ternary intermetallic phases of lithium, aluminum and iron are formed. The lithium within the intermetallic phase of Al.sub.5 Fe.sub.2 exhibits increased activity over that of lithium within a lithium-aluminum alloy to provide an increased cell potential of up to about 0.25 volt.

  15. Recrystallization in Commercially Pure Aluminum

    DEFF Research Database (Denmark)

    Bay, Bent; Hansen, Niels

    1984-01-01

    Recrystallization behavior in commercial aluminum with a purity of 99.4 pct was studied by techniques such as high voltage electron microscopy, 100 kV transmission electron microscopy, and light microscopy. Sample parameters were the initial grain size (290 and 24 microns) and the degree of defor......Recrystallization behavior in commercial aluminum with a purity of 99.4 pct was studied by techniques such as high voltage electron microscopy, 100 kV transmission electron microscopy, and light microscopy. Sample parameters were the initial grain size (290 and 24 microns) and the degree...... are discussed and compared with results from an earlier study1 covering the recrystallization behavior of commercial aluminum of the same purity deformed at higher degrees of deformation (50 to 90 pct reduction in thickness by cold-rolling)....

  16. Aluminum-carbon composite electrode

    Science.gov (United States)

    Farahmandi, C. Joseph; Dispennette, John M.

    1998-07-07

    A high performance double layer capacitor having an electric double layer formed in the interface between activated carbon and an electrolyte is disclosed. The high performance double layer capacitor includes a pair of aluminum impregnated carbon composite electrodes having an evenly distributed and continuous path of aluminum impregnated within an activated carbon fiber preform saturated with a high performance electrolytic solution. The high performance double layer capacitor is capable of delivering at least 5 Wh/kg of useful energy at power ratings of at least 600 W/kg.

  17. Preparation of aluminum nitride-silicon carbide nanocomposite powder by the nitridation of aluminum silicon carbide

    NARCIS (Netherlands)

    Itatani, K.; Tsukamoto, R.; Delsing, A.C.A.; Hintzen, H.T.J.M.; Okada, I.

    2002-01-01

    Aluminum nitride (AlN)-silicon carbide (SiC) nanocomposite powders were prepared by the nitridation of aluminum-silicon carbide (Al4SiC4) with the specific surface area of 15.5 m2·g-1. The powders nitrided at and above 1400°C for 3 h contained the 2H-phases which consisted of AlN-rich and SiC-rich

  18. Aluminum extrusion with a deformable die

    NARCIS (Netherlands)

    Assaad, W.

    2010-01-01

    Aluminum extrusion process is one of metal forming processes. In aluminum extrusion, a work-piece (billet) is pressed through a die with an opening that closely resembles a desired shape of a profile. By this process, long profiles with an enormous variety of cross-sections can be produced to

  19. Aluminum uptake from natural waters by a radiation-grafted membrane

    Energy Technology Data Exchange (ETDEWEB)

    Bazante-Yamaguishi, Renata; Moura, Eduardo; Manzoli, Jose E.; Geraldo, Aurea B.C., E-mail: ageraldo@ipen.br, E-mail: ryamaguishi@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Styrene grafted, chemically modified polymeric membranes were used to carry off aluminum of drinking water from wells located at Billings dam region. The membranes comprised polymeric substrates of PVC (polyvinylchloride) and PP (polypropylene), which were mutually grafted with gamma radiation. The chemical modification included three basic reaction paths: Friedel-Crafts acylation, 2-methylanisole coupling and a final oxidation; this modification enables aluminum selectivity on the membrane. This chemical process inserts a salicylated derivative bonded onto the aromatic ring of styrene; such molecular arrangement is responsible for complexation of aluminum ions. The aluminum sorption capacity of these membranes was evaluated firstly from an aluminum control solution, where parameters like the ideal pH value for aluminum sorption and the interfering species were studied and correlated to know the best conditions for aluminum uptake. Later, the membranes were used for aluminum remediation of natural waters (real-life samples). The applicability results and limits are then discussed. (author)

  20. Aluminum uptake from natural waters by a radiation-grafted membrane

    International Nuclear Information System (INIS)

    Bazante-Yamaguishi, Renata; Moura, Eduardo; Manzoli, Jose E.; Geraldo, Aurea B.C.

    2013-01-01

    Styrene grafted, chemically modified polymeric membranes were used to carry off aluminum of drinking water from wells located at Billings dam region. The membranes comprised polymeric substrates of PVC (polyvinylchloride) and PP (polypropylene), which were mutually grafted with gamma radiation. The chemical modification included three basic reaction paths: Friedel-Crafts acylation, 2-methylanisole coupling and a final oxidation; this modification enables aluminum selectivity on the membrane. This chemical process inserts a salicylated derivative bonded onto the aromatic ring of styrene; such molecular arrangement is responsible for complexation of aluminum ions. The aluminum sorption capacity of these membranes was evaluated firstly from an aluminum control solution, where parameters like the ideal pH value for aluminum sorption and the interfering species were studied and correlated to know the best conditions for aluminum uptake. Later, the membranes were used for aluminum remediation of natural waters (real-life samples). The applicability results and limits are then discussed. (author)

  1. Determination of aluminum by four analytical methods

    International Nuclear Information System (INIS)

    Hanson, T.J.; Smetana, K.M.

    1975-11-01

    Four procedures have been developed for determining the aluminum concentration in basic matrices. Atomic Absorption Spectroscopy (AAS) was the routine method of analysis. Citrate was required to complex the aluminum and eliminate matrix effects. AAS was the least accurate of the four methods studied and was adversely affected by high aluminum concentrations. The Fluoride Electrode Method was the most accurate and precise of the four methods. A Gran's Plot determination was used to determine the end point and average standard recovery was 100% +- 2%. The Thermometric Titration Method was the fastest method for determining aluminum and could also determine hydroxide concentration at the same time. Standard recoveries were 100% +- 5%. The pH Electrode Method also measures aluminum and hydroxide content simultaneously, but is less accurate and more time consuming that the thermal titration. Samples were analyzed using all four methods and results were compared to determine the strengths and weaknesses of each. On the basis of these comparisons, conclusions were drawn concerning the application of each method to our laboratory needs

  2. Aluminum as anode for energy storage and conversion: a review

    Science.gov (United States)

    Li, Qingfeng; Bjerrum, Niels J.

    Aluminum has long attracted attention as a potential battery anode because of its high theoretical voltage and specific energy. The protective oxide layer on the aluminum surface is however detrimental to the battery performance, contributing to failure to achieve the reversible potential and causing the delayed activation of the anode. By developing aluminum alloys as anodes and solution additives to electrolytes, a variety of aluminum batteries have been extensively investigated for various applications. From molten salt and other non-aqueous electrolytes, aluminum can be electrodeposited and therefore be suitable for developing rechargable batteries. Considerable efforts have been made to develop secondary aluminum batteries of high power density. In the present paper, these research activities are reviewed, including aqueous electrolyte primary batteries, aluminum-air batteries and molten salt secondary batteries.

  3. A liquid aluminum corrosion resistance surface on steel substrate

    International Nuclear Information System (INIS)

    Wang Deqing; Shi Ziyuan; Zou Longjiang

    2003-01-01

    The process of hot dipping pure aluminum on a steel substrate followed by oxidation was studied to form a surface layer of aluminum oxide resistant to the corrosion of aluminum melt. The thickness of the pure aluminum layer on the steel substrate is reduced with the increase in temperature and time in initial aluminizing, and the thickness of the aluminum layer does not increase with time at given temperature when identical temperature and complete wetting occur between liquid aluminum and the substrate surface. The thickness of the Fe-Al intermetallic layer on the steel base is increased with increasing bath temperature and time. Based on the experimental data and the mathematics model developed by the study, a maximum exists in the thickness of the Fe-Al intermetallic at certain dipping temperature. X-ray diffraction (XRD) and energy dispersive X-ray (EDX) analysis reveals that the top portion of the steel substrate is composed of a thin layer of α-Al 2 O 3 , followed by a thinner layer of FeAl 3 , and then a much thicker one of Fe 2 Al 5 on the steel base side. In addition, there is a carbon enrichment zone in diffusion front. The aluminum oxide surface formed on the steel substrate is in perfect condition after corrosion test in liquid aluminum at 750 deg. C for 240 h, showing extremely good resistance to aluminum melt corrosion

  4. Fatigue analysis of aluminum drill pipes

    Directory of Open Access Journals (Sweden)

    João Carlos Ribeiro Plácido

    2005-12-01

    Full Text Available An experimental program was performed to investigate the fundamental fatigue mechanisms of aluminum drill pipes. Initially, the fatigue properties were determined through small-scale tests performed in an optic-mechanical fatigue apparatus. Additionally, full-scale fatigue tests were carried out with three aluminum drill pipe specimens under combined loading of cyclic bending and constant axial tension. Finally, a finite element model was developed to simulate the stress field along the aluminum drill pipe during the fatigue tests and to estimate the stress concentration factors inside the tool joints. By this way, it was possible to estimate the stress values in regions not monitored during the fatigue tests.

  5. Method of melting and decontaminating radioactive contaminated aluminum material

    International Nuclear Information System (INIS)

    Uda, Tatsuhiko; Miura, Noboru; Kawasaki, Katsuo; Iba, Hajime.

    1986-01-01

    Purpose: To improve the decontaminating efficiency upon melting decontamination of radioactive-contaminated aluminum materials. Method: This invention concerns an improvement for the method of melting decontamination by adding slug agent composed of organic compound to contaminated aluminum material and extracting the radioactive materials into the slug thereby decontaminating the aluminum material. Specifically metals effective for reducing the active amount of aluminum are added such that the content is greater than a predetermined value in the heat melting process. The metal comprises Mg, Cu or a mixture thereof and the content is more than 4 % including those previously contained in the aluminum material. (Ikeda, J.)

  6. Reuse of Aluminum Dross as an Engineered Product

    Science.gov (United States)

    Dai, Chen; Apelian, Diran

    To prevent the leaching of landfilled aluminum dross waste and save the energy consumed by recovering metallic aluminum from dross, aluminum dross is reused as an engineering product directly rather than "refurbished" ineffectively. The concept is to reduce waste and to reuse. Two kinds of aluminum dross from industrial streams were selected and characterized. We have shown that dross can be applied directly, or accompanied with a simple conditioning process, to manufacture refractory components. Dross particles below 50 mesh are most effective. Mechanical property evaluations revealed the possibility for dross waste to be utilized as filler in concrete, resulting in up to 40% higher flexural strength and 10% higher compressive strength compared to pure cement, as well as cement with sand additions. The potential usage of aluminum dross as a raw material for such engineering applications is presented and discussed.

  7. Transition of hydrated oxide layer for aluminum electrolytic capacitors

    International Nuclear Information System (INIS)

    Chi, Choong-Soo; Jeong, Yongsoo; Ahn, Hong-Joo; Lee, Jong-Ho; Kim, Jung-Gu; Lee, Jun-Hee; Jang, Kyung-Wook; Oh, Han-Jun

    2007-01-01

    A hydrous oxide film for the application as dielectric film is synthesized by immersion of pure aluminum in hot water. From a Rutherford backscattering analysis, the ratio of aluminum to oxygen atoms was found to be 3:2 in the anodized aluminum oxide film, and 2:1 in the hydrous oxide layer. Anodization of the hydrous oxide layer was more effective for the transition of amorphous anodic oxides to the crystalline aluminum oxides

  8. Charge-density-shear-moduli relationships in aluminum-lithium alloys.

    Science.gov (United States)

    Eberhart, M

    2001-11-12

    Using the first principles full-potential linear-augmented-Slater-type orbital technique, the energies and charge densities of aluminum and aluminum-lithium supercells have been computed. The experimentally observed increase in aluminum's shear moduli upon alloying with lithium is argued to be the result of predictable changes to aluminum's total charge density, suggesting that simple rules may allow the alloy designer to predict the effects of dilute substitutional elements on alloy elastic response.

  9. Design and research on discharge performance for aluminum-air battery

    Science.gov (United States)

    Liu, Zu; Zhao, Junhong; Cai, Yanping; Xu, Bin

    2017-01-01

    As a kind of clean energy, the research of aluminum air battery is carried out because aluminum-air battery has advantages of high specific energy, silence and low infrared. Based on the research on operating principle of aluminum-air battery, a novel aluminum-air battery system was designed composed of aluminum-air cell and the circulation system of electrolyte. A system model is established to analyze the polarization curve, the constant current discharge performance and effect of electrolyte concentration on the performance of monomer. The experimental results show that the new energy aluminum-air battery has good discharge performance, which lays a foundation for its application.

  10. ALUMINUM AND CHROMIUM LEACHING WORKSHOP WHITEPAPER

    International Nuclear Information System (INIS)

    McCabe, D; Jeff Pike, J; Bill Wilmarth, B

    2007-01-01

    A workshop was held on January 23-24, 2007 to discuss the status of processes to leach constituents from High Level Waste (HLW) sludges at the Hanford and Savannah River Sites. The objective of the workshop was to examine the needs and requirements for the HLW flowsheet for each site, discuss the status of knowledge of the leaching processes, communicate the research plans, and identify opportunities for synergy to address knowledge gaps. The purpose of leaching of non-radioactive constituents from the sludge waste is to reduce the burden of material that must be vitrified in the HLW melter systems, resulting in reduced HLW glass waste volume, reduced disposal costs, shorter process schedules, and higher facility throughput rates. The leaching process is estimated to reduce the operating life cycle of SRS by seven years and decrease the number of HLW canisters to be disposed in the Repository by 1000 [Gillam et al., 2006]. Comparably at Hanford, the aluminum and chromium leaching processes are estimated to reduce the operating life cycle of the Waste Treatment Plant by 20 years and decrease the number of canisters to the Repository by 15,000-30,000 [Gilbert, 2007]. These leaching processes will save the Department of Energy (DOE) billions of dollars in clean up and disposal costs. The primary constituents targeted for removal by leaching are aluminum and chromium. It is desirable to have some aluminum in glass to improve its durability; however, too much aluminum can increase the sludge viscosity, glass viscosity, and reduce overall process throughput. Chromium leaching is necessary to prevent formation of crystalline compounds in the glass, but is only needed at Hanford because of differences in the sludge waste chemistry at the two sites. Improving glass formulations to increase tolerance of aluminum and chromium is another approach to decrease HLW glass volume. It is likely that an optimum condition can be found by both performing leaching and improving

  11. Evidence of sub-10 nm aluminum-oxygen precipitates in silicon

    International Nuclear Information System (INIS)

    Moutanabbir, Oussama; Isheim, Dieter; Mao, Zugang; Seidman, David N

    2016-01-01

    In this research, ultraviolet laser-assisted atom-probe tomography (APT) was utilized to investigate precisely the behavior at the atomistic level of aluminum impurities in ultrathin epitaxial silicon layers. Aluminum atoms were incorporated in situ during the growth process. The measured average aluminum concentration in the grown layers exceeds by several orders of magnitude the equilibrium bulk solubility. Three-dimensional atom-by-atom mapping demonstrates that aluminum atoms precipitate in the silicon matrix and form nanoscopic precipitates with lateral dimensions in the 1.3 to 6.2 nm range. These precipitates were found to form only in the presence of oxygen impurity atoms, thus providing clear evidence of the long-hypothesized role of oxygen and aluminum-oxygen complexes in facilitating the precipitation of aluminum in a silicon lattice. The measured average aluminum and oxygen concentrations in the precipitates are ∼10 ± 0.5 at.% and ∼4.4 ± 0.5 at.%, respectively. This synergistic interaction is supported by first-principles calculations of the binding energies of aluminum-oxygen dimers in silicon. The calculations demonstrate that there is a strong binding between aluminum and oxygen atoms, with Al-O-Al and O-Al-Al as the energetically favorable sequences corresponding to precipitates in which the concentration of aluminum is twice as large as the oxygen concentration in agreement with APT data. (paper)

  12. Corrosion of aluminum components and remedial measures

    International Nuclear Information System (INIS)

    Sheikh, S.T.; Khalique, A.; Malik, F.A.

    2006-01-01

    Aluminum has versatile physical properties, mechanical strength, corrosion resistance, and is used in special applications like aerospace, automobiles and other strategic industries. The outdoor exposed structural components of aluminum have very good corrosion resistance due to the thick oxide layer (0.2 -0.4 micro). This study involves the corrosion of aluminum based components, though aluminum is protected by an oxide layer but due to extreme weather and environmental conditions the oxide layer was damaged. The corroded product was removed, pits or cavities formed due to the material removal were filled with epoxy resins and acrylic-based compounds containing fibreglass as reinforcement. Optimum results were obtained with epoxy resins incorporated with 5% glass fibers. The inner surface of the components was provided further protection with a cellulose nitrate compound. (author)

  13. Metallic aluminum in combustion; Metalliskt aluminium i foerbraenningen

    Energy Technology Data Exchange (ETDEWEB)

    Backman, Rainer; Berg, Magnus; Bostroem, Dan; Hirota, Catherine; Oehman, Marcus; Oehrstroem, Anna

    2007-06-15

    Although aluminum is easily oxidized and melts at temperatures lower than those common in combustion, it can pass through the combustion chamber almost unscathed. If one performs calculations of thermodynamic equilibriums, conditions under which this could happen are extreme in comparison to those generally found in a furnace. Metallic aluminum may yet be found in rather large concentrations in fly ashes. There are also indications that metallic aluminum is present in deposits inside the furnaces. The objectives for the present investigation are better understanding of the behavior of the metallic aluminum in the fuel when it passes through an incinerator and to suggest counter/measures that deal with the problems associated with it. The target group is primary incineration plants using fuel that contains aluminum foil, for example municipal waste, industrial refuse or plastic reject from cardboard recycling. Combustion experiments were performed in a bench scale reactor using plastic reject obtained from the Fiskeby Board mill. First the gas velocity at which a fraction of the reject hovers was determined for the different fuel fractions, yielding a measure for their propensity to be carried over by the combustion gases. Second fractions rich in aluminum foils were combusted with time, temperature and gas composition as parameters. The partially combusted samples were analyzed using SEM/EDS. The degree of oxidation was determined using TGA/DTA. Reference material from full scale incinerators was obtained by collecting fly ash samples from five plants and analyzing them using XRD and SEM/EDS. The results show that thin aluminum foils may easily be carried over from the furnace. Furthermore, it was very difficult to fully oxidize the metallic flakes. The oxide layer on the surface prevents further diffusion of oxygen to the molten core of the flake. The contribution of these flakes to the build of deposits in a furnace is confirmed by earlier investigations in pilot

  14. Aluminum nitride insulating films for MOSFET devices

    Science.gov (United States)

    Lewicki, G. W.; Maserjian, J.

    1972-01-01

    Application of aluminum nitrides as electrical insulator for electric capacitors is discussed. Electrical properties of aluminum nitrides are analyzed and specific use with field effect transistors is defined. Operational limits of field effect transistors are developed.

  15. "Ripples" in an Aluminum Pool?

    Science.gov (United States)

    Rohr, James; Wang, Si-Yin; Nesterenko, Vitali F.

    2018-05-01

    Our motivation for this article is for students to realize that opportunities for discovery are all around them. Discoveries that can still puzzle present day researchers. Here we explore an observation by a middle school student concerning the production of what appears to be water-like "ripples" produced in aluminum foil when placed between two colliding spheres. We both applaud and explore the student's reasoning that the ripples were formed in a melted aluminum pool.

  16. Functional aluminum alloys for ultra high vacuum use

    International Nuclear Information System (INIS)

    Kato, Yutaka; Tsukamoto, Kenji; Isoyama, Eizo

    1985-01-01

    Ultra high vacuum systems made of aluminum alloys are actively developed. The reasons for using aluminum alloys are low residual radioactivity, light weight, good machinability, good thermal conductivity, non-magnetism. The important function required for ultra high vacuum materials is low outgassing rate, but surface gas on ordinary aluminum is much. Then the research on aluminum surface structure with low outgassing rate has been made and the special extrusion method, that is, extrusion method with the conditions of preventing air from entering inside of pipe and of taking in mixture gas of Ar + O 2 , was developed. 6063 alloy obtained by special extrusion method showed low outgassing rate (2 x 10 -13 Torr. 1/s. cm 2 ) by only 150 deg C, 24 h baking. For the future it will be important to develop aluminum alloys with low dynamic outgassing rate as well as low static outgassing rate. (author)

  17. The aluminum chemistry and corrosion in alkaline solutions

    International Nuclear Information System (INIS)

    Zhang Jinsuo; Klasky, Marc; Letellier, Bruce C.

    2009-01-01

    Aluminum-alkaline solution systems are very common in engineering applications including nuclear engineering. Consequently, a thorough knowledge of the chemistry of aluminum and susceptibility to corrosion in alkaline solutions is reviewed. The aluminum corrosion mechanism and corrosion rate are examined based on current experimental data. A review of the phase transitions with aging time and change of environment is also performed. Particular attention is given to effect of organic and inorganic ions. As an example, the effect of boron is examined in detail because of the application in nuclear reactor power systems. Methods on how to reduce the corrosion rate of aluminum in alkaline solutions are also highlighted

  18. Dissolution mechanism of aluminum hydroxides in acid media

    Science.gov (United States)

    Lainer, Yu. A.; Gorichev, I. G.; Tuzhilin, A. S.; Gololobova, E. G.

    2008-08-01

    The effects of the concentration, temperature, and potential at the hydroxide/electrolyte interface on the aluminum hydroxide dissolution in sulfuric, hydrochloric, and perchloric acids are studied. The limiting stage of the aluminum hydroxide dissolution in the acids is found to be the transition of the complexes that form on the aluminum hydroxide surface from the solid phase into the solution. The results of the calculation of the acid-base equilibrium constants at the oxide (hydroxide)/solution interface using the experimental data on the potentiometric titration of Al2O3 and AlOOH suspensions are analyzed. A mechanism is proposed for the dissolution of aluminum hydroxides in acid media.

  19. Oxidation of nano-sized aluminum powders

    International Nuclear Information System (INIS)

    Vorozhtsov, A.B.; Lerner, M.; Rodkevich, N.; Nie, H.; Abraham, A.; Schoenitz, M.; Dreizin, E.L.

    2016-01-01

    Highlights: • Weight gain measured in TG oxidation experiments was split between particles of different sizes. • Reaction kinetics obtained by isoconversion explicitly accounting for the effect of size distribution. • Activation energy is obtained as a function of oxide thickness for growth of amorphous alumina. • Oxidation mechanism for nanopowders remains the same as for coarser aluminum powders. - Abstract: Oxidation of aluminum nanopowders obtained by electro-exploded wires is studied. Particle size distributions are obtained from transmission electron microscopy (TEM) images. Thermo-gravimetric (TG) experiments are complemented by TEM and XRD studies of partially oxidized particles. Qualitatively, oxidation follows the mechanism developed for coarser aluminum powder and resulting in formation of hollow oxide shells. Sintering of particles is also observed. The TG results are processed to account explicitly for the particle size distribution and spherical shapes, so that oxidation of particles of different sizes is characterized. The apparent activation energy is obtained as a function of the reaction progress using model-free isoconversion processing of experimental data. A complete phenomenological oxidation model is then proposed assuming a spherically symmetric geometry. The oxidation kinetics of aluminum powder is shown to be unaffected by particle sizes reduced down to tens of nm. The apparent activation energy describing growth of amorphous alumina is increasing at the very early stages of oxidation. The higher activation energy is likely associated with an increasing homogeneity in the growing amorphous oxide layer, initially containing multiple defects and imperfections. The trends describing changes in both activation energy and pre-exponent of the growing amorphous oxide are useful for predicting ignition delays of aluminum particles. The kinetic trends describing activation energies and pre-exponents in a broader range of the oxide

  20. Regeneration of aluminum hydride

    Science.gov (United States)

    Graetz, Jason Allan; Reilly, James J.

    2009-04-21

    The present invention provides methods and materials for the formation of hydrogen storage alanes, AlH.sub.x, where x is greater than 0 and less than or equal to 6 at reduced H.sub.2 pressures and temperatures. The methods rely upon reduction of the change in free energy of the reaction between aluminum and molecular H.sub.2. The change in free energy is reduced by lowering the entropy change during the reaction by providing aluminum in a state of high entropy, by increasing the magnitude of the change in enthalpy of the reaction or combinations thereof.

  1. Regeneration of aluminum hydride

    Science.gov (United States)

    Graetz, Jason Allan; Reilly, James J; Wegrzyn, James E

    2012-09-18

    The present invention provides methods and materials for the formation of hydrogen storage alanes, AlH.sub.x, where x is greater than 0 and less than or equal to 6 at reduced H.sub.2 pressures and temperatures. The methods rely upon reduction of the change in free energy of the reaction between aluminum and molecular H.sub.2. The change in free energy is reduced by lowering the entropy change during the reaction by providing aluminum in a state of high entropy, and by increasing the magnitude of the change in enthalpy of the reaction or combinations thereof.

  2. Formulation and method for preparing gels comprising hydrous aluminum oxide

    Science.gov (United States)

    Collins, Jack L.

    2014-06-17

    Formulations useful for preparing hydrous aluminum oxide gels contain a metal salt including aluminum, an organic base, and a complexing agent. Methods for preparing gels containing hydrous aluminum oxide include heating a formulation to a temperature sufficient to induce gel formation, where the formulation contains a metal salt including aluminum, an organic base, and a complexing agent.

  3. Aluminum Target Dissolution in Support of the Pu-238 Program

    Energy Technology Data Exchange (ETDEWEB)

    McFarlane, Joanna [ORNL; Benker, Dennis [ORNL; DePaoli, David W [ORNL; Felker, Leslie Kevin [ORNL; Mattus, Catherine H [ORNL

    2014-09-01

    Selection of an aluminum alloy for target cladding affects post-irradiation target dissolution and separations. Recent tests with aluminum alloy 6061 yielded greater than expected precipitation in the caustic dissolution step, forming up to 10 wt.% solids of aluminum hydroxides and aluminosilicates. We present a study to maximize dissolution of aluminum metal alloy, along with silicon, magnesium, and copper impurities, through control of temperature, the rate of reagent addition, and incubation time. Aluminum phase transformations have been identified as a function of time and temperature, using X-ray diffraction. Solutions have been analyzed using wet chemical methods and X-ray fluorescence. These data have been compared with published calculations of aluminum phase diagrams. Temperature logging during the transients has been investigated as a means to generate kinetic and mass transport data on the dissolution process. Approaches are given to enhance the dissolution of aluminum and aluminosilicate phases in caustic solution.

  4. Fracture toughness of steel--aluminum deformation welds

    International Nuclear Information System (INIS)

    Albright, C.E.

    1978-11-01

    A study of the fracture toughness (in this case, G/sub Ic/) of steel--aluminum deformation welds using a specially developed double cantilever beam fracture toughness specimen is presented. Welds made at 350 0 C were heat treated at 360, 380, 400, 420, and 440 0 C. An intermetallic reaction product layer of Fe 2 Al 5 is formed at the steel--aluminum interface with increasing heat treating temperature and time by a process of nucleation and growth of discrete particles. A transition in toughness from a higher average G/sub Ic/ value (6097 N/m) to a very low average G/sub Ic/ value (525 N/m) is observed. The decrease in toughness is accompanied by an increase in Fe 2 Al 5 particle diameter from 4 to 8 μm. Failure at the higher toughness values is characterized by ductile rupture through the aluminum. At the lower toughness values, failure occurs between the aluminum and the Fe 2 Al 5 reaction product layer. A void layer forming by a vacancy condensation mechanism in the aluminum adjacent to the Fe 2 Al 5 is shown to cause the embrittlement

  5. Bilayer lift-off process for aluminum metallization

    Science.gov (United States)

    Wilson, Thomas E.; Korolev, Konstantin A.; Crow, Nathaniel A.

    2015-01-01

    Recently published reports in the literature for bilayer lift-off processes have described recipes for the patterning of metals that have recommended metal-ion-free developers, which do etch aluminum. We report the first measurement of the dissolution rate of a commercial lift-off resist (LOR) in a sodium-based buffered commercial developer that does not etch aluminum. We describe a reliable lift-off recipe that is safe for multiple process steps in patterning thin (recipe consists of an acid cleaning of the substrate, the bilayer (positive photoresist/LOR) deposition and development, the sputtering of the aluminum film along with a palladium capping layer and finally, the lift-off of the metal film by immersion in the LOR solvent. The insertion into the recipe of postexposure and sequential develop-bake-develop process steps are necessary for an acceptable undercut. Our recipe also eliminates any need for accompanying sonication during lift-off that could lead to delamination of the metal pattern from the substrate. Fine patterns were achieved for both 100-nm-thick granular aluminum/palladium bilayer bolometers and 500-nm-thick aluminum gratings with 6-μm lines and 4-μm spaces.

  6. NASA-427: A New Aluminum Alloy

    Science.gov (United States)

    Nabors, Sammy A.

    2015-01-01

    NASA's Marshall Space Flight Center researchers have developed a new, stronger aluminum alloy, ideal for cast aluminum products that have powder or paint-baked thermal coatings. With advanced mechanical properties, the NASA-427 alloy shows greater tensile strength and increased ductility, providing substantial improvement in impact toughness. In addition, this alloy improves the thermal coating process by decreasing the time required for heat treatment. With improvements in both strength and processing time, use of the alloy provides reduced materials and production costs, lower product weight, and better product performance. The superior properties of NASA-427 can benefit many industries, including automotive, where it is particularly well-suited for use in aluminum wheels.

  7. Study of aluminum-doped silicon clusters

    International Nuclear Information System (INIS)

    Zhan Shichang; Li Baoxing; Yang Jiansong

    2007-01-01

    Using full-muffin-tin-orbital molecular-dynamics (FP-LMTO-MD) method, we have investigated the effect of aluminum heteroatoms on the geometric structures and bond characteristics of Si n (n=5-10) clusters in detail. It is found that the geometric framework of the ground state structures for Si n (n=5-10) clusters change to some extent upon the substitution of Al atoms in some Si atoms. The effect of aluminum doping on the silicon clusters depends on the geometric structures of Si n (n=5-10) clusters. In particular, the calculations suggest that the aluminum doping would improve the bond strength of some Si-Si bonds in the mixed Si n - m Al m clusters

  8. The aluminum-air battery for electric vehicles - An update

    Science.gov (United States)

    1980-11-01

    The development of aluminum-air batteries as mechanically rechargeable power sources to be used in electric vehicles is discussed. The chemistry of the aluminum-air battery, which has a potential for providing the range, acceleration and rapid refueling capability of contemporary automobiles and is based on the reaction of aluminum metal with atmospheric oxygen in the presence of an aqueous sodium hydroxide/sodium aluminate electrolyte, is examined, and it is pointed out that the electric vehicle would be practically emissionless. The battery development program at the Lawrence Livermore National Laboratory, which includes evaluations of electrochemical and chemical phenomena, studies of the economics and energy balance of a transportation system based on aluminum, and power cell design and performance analysis, is presented. It is concluded that although difficult problems must be overcome before the technical and economic feasibility of aluminum-air batteries for electric vehicles can be established, projections indicate that the aluminum-air vehicle is potentially competitive with internal combustion vehicles powered by synthetic liquid fuels.

  9. Chrome - Free Aluminum Coating System

    Science.gov (United States)

    Bailey, John H.; Gugel, Jeffrey D.

    2010-01-01

    This slide presentation concerns the program to qualify a chrome free coating for aluminum. The program was required due to findings by OSHA and EPA, that hexavalent chromium, used to mitigate corrosion in aerospace aluminum alloys, poses hazards for personnel. This qualification consisted of over 4,000 tests. The tests revealed that a move away from Cr+6, required a system rather than individual components and that the maximum corrosion protection required pretreatment, primer and topcoat.

  10. Sensitization of Naturally Aged Aluminum 5083 Armor Plate

    Science.gov (United States)

    2015-07-29

    5 - 1 - SENSITIZATION OF NATURALLY AGED ALUMINUM 5083 ARMOR PLATE INTRODUCTION Aluminum -magnesium alloys are important for both ship...boundaries [3,4]. The magnesium-rich phase (normally β-Al3Mg2) is highly anodic with respect to the surrounding aluminum phase, thus is susceptible... alloys , and with varying amounts of debris scattered about the surface consistent with corrosion product, Figure 2b, that often forms over time within

  11. Reactions of aluminum with uranium fluorides and oxyfluorides

    Energy Technology Data Exchange (ETDEWEB)

    Leitnaker, J.M.; Nichols, R.W.; Lankford, B.S. [Martin Marietta Energy Systems, Inc., Oak Ridge, TN (United States)

    1991-12-31

    Every 30 to 40 million operating hours a destructive reaction is observed in one of the {approximately}4000 large compressors that move UF{sub 6} through the gaseous diffusion plants. Despite its infrequency, such a reaction can be costly in terms of equipment and time. Laboratory experiments reveal that the presence of moderate pressures of UF{sub 6} actually cools heated aluminum, although thermodynamic calculations indicate the potential for a 3000-4000{degrees}C temperature rise. Within a narrow and rather low (<100 torr; 1 torr = 133.322 Pa) pressure range, however, the aluminum is seen to react with sufficient heat release to soften an alumina boat. Three things must occur in order for aluminum to react vigorously with either UF{sub 6} or UO{sub 2}F{sub 2}. 1. An initiating source of heat must be provided. In the compressors, this source can be friction, permitted by disruption of the balance of the large rotating part or by creep of the aluminum during a high-temperature treatment. In the absence of this heat source, compressors have operated for 40 years in UF{sub 6} without significant reaction. 2. The film protecting the aluminum must be breached. Melting (of UF{sub 5} at 620 K or aluminum at 930 K) can cause such a breach in laboratory experiments. In contrast, holding Al samples in UF{sub 6} at 870 K for several hours produces only moderate reaction. Rubbing in the cascade can undoubtedly breach the protective film. 3. Reaction products must not build up and smother the reaction. While uranium products tend to dissolve or dissipate in molten aluminum, AIF{sub 3} shows a remarkable tendency to surround and hence protect even molten aluminum. Hence the initial temperature rise must be rapid and sufficient to move reactants into a temperature region in which products are removed from the reaction site.

  12. Carbon contaminant in the ion processing of aluminum oxide film

    International Nuclear Information System (INIS)

    Chaug, Y.; Roy, N.

    1989-01-01

    Ion processing can induce contamination on the bombarded surface. However, this process is essential for the microelectronics device fabrication. Auger electron spectroscopy has been used to study the simultaneous deposition of carbon impurity during ion bombardment of magnetron rf-sputtering deposited aluminum oxide film. Ion bombardment on aluminum oxide results in a preferential removal of surface oxygen and a formation of a metastable state of aluminum suboxide. Cosputtered implanted carbon contaminant appears to have formed a new state of stoichiometry on the surface of the ion bombarded aluminum oxide and existed as an aluminum carbide. This phase has formed due to the interaction of the implanted carbon and the aluminum suboxide. The Ar + ion sputter etching rate is reduced for the carbon contaminated oxide. The electrical resistance of the aluminum oxide between two gold strips has been measured. It is found that the electrical resistance is also reduced due to the formation of the new stoichiometry on the surface

  13. Method of forming aluminum oxynitride material and bodies formed by such methods

    Science.gov (United States)

    Bakas, Michael P [Ammon, ID; Lillo, Thomas M [Idaho Falls, ID; Chu, Henry S [Idaho Falls, ID

    2010-11-16

    Methods of forming aluminum oxynitride (AlON) materials include sintering green bodies comprising aluminum orthophosphate or another sacrificial material therein. Such green bodies may comprise aluminum, oxygen, and nitrogen in addition to the aluminum orthophosphate. For example, the green bodies may include a mixture of aluminum oxide, aluminum nitride, and aluminum orthophosphate or another sacrificial material. Additional methods of forming aluminum oxynitride (AlON) materials include sintering a green body including a sacrificial material therein, using the sacrificial material to form pores in the green body during sintering, and infiltrating the pores formed in the green body with a liquid infiltrant during sintering. Bodies are formed using such methods.

  14. Ultrasonic Real-Time Quality Monitoring Of Aluminum Spot Weld Process

    Science.gov (United States)

    Perez Regalado, Waldo Josue

    The real-time ultrasonic spot weld monitoring system, introduced by our research group, has been designed for the unsupervised quality characterization of the spot welding process. It comprises the ultrasonic transducer (probe) built into one of the welding electrodes and an electronics hardware unit which gathers information from the transducer, performs real-time weld quality characterization and communicates with the robot programmable logic controller (PLC). The system has been fully developed for the inspection of spot welds manufactured in steel alloys, and has been mainly applied in the automotive industry. In recent years, a variety of materials have been introduced to the automotive industry. These include high strength steels, magnesium alloys, and aluminum alloys. Aluminum alloys have been of particular interest due to their high strength-to-weight ratio. Resistance spot welding requirements for aluminum vary greatly from those of steel. Additionally, the oxide film formed on the aluminum surface increases the heat generation between the copper electrodes and the aluminum plates leading to accelerated electrode deterioration. Preliminary studies showed that the real-time quality inspection system was not able to monitor spot welds manufactured with aluminum. The extensive experimental research, finite element modelling of the aluminum welding process and finite difference modeling of the acoustic wave propagation through the aluminum spot welds presented in this dissertation, revealed that the thermodynamics and hence the acoustic wave propagation through an aluminum and a steel spot weld differ significantly. For this reason, the hardware requirements and the algorithms developed to determine the welds quality from the ultrasonic data used on steel, no longer apply on aluminum spot welds. After updating the system and designing the required algorithms, parameters such as liquid nugget penetration and nugget diameter were available in the ultrasonic data

  15. Inhibition of aluminum corrosion using Opuntia extract

    International Nuclear Information System (INIS)

    El-Etre, A.Y.

    2003-01-01

    The inhibitive action of the mucilage extracted from the modified stems of prickly pears, toward acid corrosion of aluminum, is tested using weight loss, thermometry, hydrogen evolution and polarization techniques. It was found that the extract acts as a good corrosion inhibitor for aluminum corrosion in 2.0 M HCl solution. The inhibition action of the extract was discussed in view of Langmuir adsorption isotherm. It was found that the adsorption of the extract on aluminum surface is a spontaneous process. The inhibition efficiency (IE) increases as the extract concentration is increased. The effect of temperature on the IE was studied. It was found that the presence of extract increases the activation energy of the corrosion reaction. Moreover, the thermodynamic parameters of the adsorption process were calculated. It was found also that the Opuntia extract provides a good protection to aluminum against pitting corrosion in chloride ion containing solutions

  16. Investigation of magnetism in aluminum-doped silicon carbide nanotubes

    Science.gov (United States)

    Behzad, Somayeh; Chegel, Raad

    2013-11-01

    The effect of aluminum doping on the structural, electronic and magnetic properties of (8,0) silicon carbide nanotube (SiCNT) is investigated using spin-polarized density functional theory. It is found from the calculation of the formation energies that aluminum substitution for silicon atom is preferred. Our results show that the magnetization depends on the substitutional site, aluminum substitution at silicon site does not introduce any spin-polarization, whereas the aluminum substitution for carbon atom yields a spin polarized, almost dispersionless π band within the original band gap.

  17. Aluminum-catalyzed silicon nanowires: Growth methods, properties, and applications

    Energy Technology Data Exchange (ETDEWEB)

    Hainey, Mel F.; Redwing, Joan M. [Department of Materials Science and Engineering, Materials Research Institute, The Pennsylvania State University, University Park, Pennsylvania 16802 (United States)

    2016-12-15

    Metal-mediated vapor-liquid-solid (VLS) growth is a promising approach for the fabrication of silicon nanowires, although residual metal incorporation into the nanowires during growth can adversely impact electronic properties particularly when metals such as gold and copper are utilized. Aluminum, which acts as a shallow acceptor in silicon, is therefore of significant interest for the growth of p-type silicon nanowires but has presented challenges due to its propensity for oxidation. This paper summarizes the key aspects of aluminum-catalyzed nanowire growth along with wire properties and device results. In the first section, aluminum-catalyzed nanowire growth is discussed with a specific emphasis on methods to mitigate aluminum oxide formation. Next, the influence of growth parameters such as growth temperature, precursor partial pressure, and hydrogen partial pressure on nanowire morphology is discussed, followed by a brief review of the growth of templated and patterned arrays of nanowires. Aluminum incorporation into the nanowires is then discussed in detail, including measurements of the aluminum concentration within wires using atom probe tomography and assessment of electrical properties by four point resistance measurements. Finally, the use of aluminum-catalyzed VLS growth for device fabrication is reviewed including results on single-wire radial p-n junction solar cells and planar solar cells fabricated with nanowire/nanopyramid texturing.

  18. 21 CFR 73.3110a - Chromium-cobalt-aluminum oxide.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Chromium-cobalt-aluminum oxide. 73.3110a Section... LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Medical Devices § 73.3110a Chromium-cobalt-aluminum oxide. (a) Identity. The color additive chromium-cobalt-aluminum oxide (Pigment Blue 36) (CAS Reg. No...

  19. Aluminum phosphate ceramics for waste storage

    Science.gov (United States)

    Wagh, Arun; Maloney, Martin D

    2014-06-03

    The present disclosure describes solid waste forms and methods of processing waste. In one particular implementation, the invention provides a method of processing waste that may be particularly suitable for processing hazardous waste. In this method, a waste component is combined with an aluminum oxide and an acidic phosphate component in a slurry. A molar ratio of aluminum to phosphorus in the slurry is greater than one. Water in the slurry may be evaporated while mixing the slurry at a temperature of about 140-200.degree. C. The mixed slurry may be allowed to cure into a solid waste form. This solid waste form includes an anhydrous aluminum phosphate with at least a residual portion of the waste component bound therein.

  20. Physical and Electrical Characterization of Polymer Aluminum Capacitors

    Science.gov (United States)

    Liu, David; Sampson, Michael J.

    2010-01-01

    Polymer aluminum capacitors from several manufacturers with various combinations of capacitance, rated voltage, and ESR values were physically examined and electrically characterized. The physical construction analysis of the capacitors revealed three different capacitor structures, i.e., traditional wound, stacked, and laminated. Electrical characterization results of polymer aluminum capacitors are reported for frequency-domain dielectric response at various temperatures, surge breakdown voltage, and other dielectric properties. The structure-property relations in polymer aluminum capacitors are discussed.

  1. Physical and Electrical Characterization of Aluminum Polymer Capacitors

    Science.gov (United States)

    Liu, David; Sampson, Michael J.

    2010-01-01

    Polymer aluminum capacitors from several manufacturers with various combinations of capacitance, rated voltage, and ESR values were physically examined and electrically characterized. The physical construction analysis of the capacitors revealed three different capacitor structures, i.e., traditional wound, stacked, and laminated. Electrical characterization results of polymer aluminum capacitors are reported for frequency-domain dielectric response at various temperatures, surge breakdown voltage, and other dielectric properties. The structure-property relations in polymer aluminum capacitors are discussed.

  2. Türkiye’de 2001 Krizi Öncesi ve Sonrası Dönemler İçin Dış Borç Ekonomik Büyüme İlişkisi (1991–2010 External Debt Economıcal Growing Relationship For The Terms Before And After The 2001 Crysis İn Turkey (1991–2010

    Directory of Open Access Journals (Sweden)

    Süleyman ÇELİK

    2013-03-01

    Full Text Available In order to overcome financial restrictions and so achieve ahigher rate of growth, these countries often utilize external loans.External debts, which are initially taken as additional resources, canaccelerate the investments, economic growth and development whenthey are used efficiently. But if the external debts aren’t used efficientlyand the principal and interest payments of the external debts becomehigher than national income increase, it is required to get debts again topay debts and thereby it causes to increase external debt burden anddecrease the country welfare.Most empirical studies indicate a negative correlation betweenforeign debt and economic growth. In this study, the relationshipbetween economic growth and foreign debt is discussed in terms ofTurkish economy. Using time series data over the 1991–2010 period.The stationarity of time series data used in this study was tested by theADF test. Cointegration test which is developed by Johansen was usedin order to investigate long-term relationship between the variableswhich are stabilize at the same level or not. A least squares regressionanalysis and at last in order to obtain effect direction between thevariables Granger analysis are performed. Analysis show that foreigndebts in Turkey habe a negative effect on economical growth. Accordingto these results, domestic resources should finance the requiredinvestments and external resources should be reduced in order toincrease economic growth-in Turkey. Az gelişmiş ve gelişmekte olan ülkeler finansman kısıtlarınıaşarak yüksek büyüme hızlarına ulaşmak için dış borçlanmaya sık sıkbaşvurmaktadırlar. Başlangıçta ek bir kaynak olarak alınan dış borçlaretkin bir şekilde kullanıldıklarında yatırımları, ekonomik büyümeyi vekalkınmayı hızlandırabilmektedir. Fakat alınan dış borcun etkinkullanılmaması ve dış borcun anapara ve faiz ödemelerinin ulusal gelirartışından daha fazla artış g

  3. Assessment of secondary aluminum reserves of nations

    DEFF Research Database (Denmark)

    Maung, Kyaw Nyunt; Yoshida, Tomoharu; Liu, Gang

    2017-01-01

    aluminum resources are accumulated in landfill sites. Understanding the sizes of primary and secondary aluminum reserves enables us to extend knowledge of efficient raw material sourcing from a narrow perspective of primary reserves alone to a broader perspective of both primary and secondary reserves...

  4. Laboratory Powder Metallurgy Makes Tough Aluminum Sheet

    Science.gov (United States)

    Royster, D. M.; Thomas, J. R.; Singleton, O. R.

    1993-01-01

    Aluminum alloy sheet exhibits high tensile and Kahn tear strengths. Rapid solidification of aluminum alloys in powder form and subsequent consolidation and fabrication processes used to tailor parts made of these alloys to satisfy such specific aerospace design requirements as high strength and toughness.

  5. High strength corrosion-resistant zirconium aluminum alloys

    International Nuclear Information System (INIS)

    Schulson, E.M.; Cameron, D.J.

    1976-01-01

    A zirconium-aluminum alloy is described possessing superior corrosion resistance and mechanical properties. This alloy, preferably 7.5-9.5 wt% aluminum, is cast, worked in the Zr(Al)-Zr 2 Al region, and annealed to a substantially continuous matrix of Zr 3 Al. (E.C.B.)

  6. ON THE REACTIONS IN ILMENITE, ALUMINUM AND GRAPHITE SYSTEM

    Directory of Open Access Journals (Sweden)

    R. Khoshhal

    2016-03-01

    Full Text Available Al2O3/TiC composites are used as cutting tools for machining gray cast iron and steels. The addition of iron improves the toughness of Al2O3/TiC composites. Ilmenite, aluminum and graphite can be used to produce in-situ Al2O3/TiC–Fe composites. However, the formation mechanism and reaction sequences of this system are not clear enough. Therefore, the present research is designed to determine the reactions mechanism of the first step of reactions that may be occurred between raw materials. In this research, pure ilmenite was synthesized to eliminate the effects of impurities available in the natural ilmenite in the system. The milled and pressed samples, prepared from the synthesized ilmenite, aluminum and graphite mixture with a molar ratio of 1:2:1, were heat treated at 720°C for 48h. In addition, two samples one containing ilmenite and aluminum with a molar ratio of 1:2 and ilmenite and graphite with a molar ratio of 1:1 were heat treated at 720°C for 48h. The final products were analyzed with XRD. It was found that at 720°C, aluminum reacts with FeTiO3, forming Fe, TiO2 and Al2O3. Since the aluminum content used in the mixture was more than the stoichiometry for reaction of ilmenite and aluminum, some unreacted aluminum remains. Therefore, the residual aluminum reacts with the reduced Fe to form Fe2Al5.

  7. Differential response of plants to aluminum. A review

    OpenAIRE

    Valencia R, Rubén A; Ligarreto M, Gustavo A

    2012-01-01

    Aluminum toxicity is a major limiting factor to the growth and development of plants in acidic soils worldwide, occurring in 40% of arable soils. The root seems to be the object of aluminum toxicity, particularly the apex, producing a rapid inhibition of cell division and elongation of the root. Fortunately, plants differ in their ability to tolerate aluminum and grow in acidic soils. Tolerance mechanisms have commonly been defined in genetic and physiological terms, however, tolerance mechan...

  8. Carbide coated fibers in graphite-aluminum composites

    Science.gov (United States)

    Imprescia, R. J.; Levinson, L. S.; Reiswig, R. D.; Wallace, T. C.; Williams, J. M.

    1975-01-01

    The NASA-supported program at the Los Alamos Scientific Laboratory (LASL) to develop carbon fiber-aluminum matrix composites is described. Chemical vapor deposition (CVD) was used to uniformly deposit thin, smooth, continuous coats of TiC on the fibers of graphite tows. Wet chemical coating of fibers, followed by high-temperature treatment, was also used, but showed little promise as an alternative coating method. Strength measurements on CVD coated fiber tows showed that thin carbide coats can add to fiber strength. The ability of aluminum alloys to wet TiC was successfully demonstrated using TiC-coated graphite surfaces. Pressure-infiltration of TiC- and ZrC-coated fiber tows with aluminum alloys was only partially successful. Experiments were performed to evaluate the effectiveness of carbide coats on carbon as barriers to prevent reaction between alluminum alloys and carbon. Initial results indicate that composites of aluminum and carbide-coated graphite are stable for long periods of time at temperatures near the alloy solidus.

  9. Molybdate Coatings for Protecting Aluminum Against Corrosion

    Science.gov (United States)

    Calle, Luz Marina; MacDowell, Louis G.

    2005-01-01

    Conversion coatings that comprise mixtures of molybdates and several additives have been subjected to a variety of tests to evaluate their effectiveness in protecting aluminum and alloys of aluminum against corrosion. Molybdate conversion coatings are under consideration as replacements for chromate conversion coatings, which have been used for more than 70 years. The chromate coatings are highly effective in protecting aluminum and its alloys against corrosion but are also toxic and carcinogenic. Hexavalent molybdenum and, hence, molybdates containing hexavalent molybdenum, have received attention recently as replacements for chromates because molybdates mimic chromates in a variety of applications but exhibit significantly lower toxicity. The tests were performed on six proprietary formulations of molybdate conversion coatings, denoted formulations A through F, on panels of aluminum alloy 2024-T3. A bare alloy panel was also included in the tests. The tests included electrochemical impedance spectroscopy (EIS), measurements of corrosion potentials, scanning electron microscopy (SEM) with energy-dispersive spectroscopy (EDS), and x-ray photoelectron spectroscopy (XPS).

  10. Seacoast stress corrosion cracking of aluminum alloys

    Science.gov (United States)

    Humphries, T. S.; Nelson, E. E.

    1981-01-01

    The stress corrosion cracking resistance of high strength, wrought aluminum alloys in a seacoast atmosphere was investigated and the results were compared with those obtained in laboratory tests. Round tensile specimens taken from the short transverse grain direction of aluminum plate and stressed up to 100 percent of their yield strengths were exposed to the seacoast and to alternate immersion in salt water and synthetic seawater. Maximum exposure periods of one year at the seacoast, 0.3 or 0.7 of a month for alternate immersion in salt water, and three months for synthetic seawater were indicated for aluminum alloys to avoid false indications of stress corrosion cracking failure resulting from pitting. Correlation of the results was very good among the three test media using the selected exposure periods. It is concluded that either of the laboratory test media is suitable for evaluating the stress corrosion cracking performance of aluminum alloys in seacoast atmosphere.

  11. Aluminum alloy excellent in neutron absorbing performance

    International Nuclear Information System (INIS)

    Iida, Tetsuya; Tamamura, Tadao; Morimoto, Hiroyuki; Ouchi, Ken-ichiro.

    1987-01-01

    Purpose: To obtain structural materials made of aluminum alloys having favorable neutron absorbing performance and excellent in the performance as structural materials such as processability and strength. Constitution: Powder of Gd 2 O 3 as a gadolinium compound or metal gadolinium is uniformly mixed with the powder of aluminum or aluminum alloy. The amount of the gadolinium compound added is set to 0.1 - 30 % by weight. No sufficient neutron absorbing performance can be obtained if it is less than 0.1 % by weight, whereas the processability and mechanical property of the alloy are degraded if it exceeds 30 % by weight. Further, the grain size is set to less about 50 μm. Further, since the neutron absorbing performance varies greatly if the aluminum powder size exceeds 100 μm, the diameter is set to less than about 100 μm. These mixtures are molded in a hot press. This enables to obtain aimed structural materials. (Takahashi, M.)

  12. Analysis of Material Flow in Screw Extrusion of Aluminum

    International Nuclear Information System (INIS)

    Haugen, Bjoern; Oernskar, Magnus; Welo, Torgeir; Wideroee, Fredrik

    2010-01-01

    Screw extrusion of aluminum is a new process for production of aluminum profiles. The commercial potential could be large. Little experimental and numerical work has been done with respect to this process.The material flow of hot aluminum in a screw extruder has been analyzed using finite element formulations for the non-Newtonian Navier-Stokes equations. Aluminum material properties are modeled using the Zener-Holloman material model. Effects of stick-slip conditions are investigated with respect to pressure build up and mixing quality of the extrusion process.The numerical results are compared with physical experiments using an experimental screw extruder.

  13. The crystallization processes in the aluminum particles production technology

    Directory of Open Access Journals (Sweden)

    Arkhipov Vladimir

    2015-01-01

    Full Text Available The physical and mathematical model of the crystallization process of liquid aluminum particles in the spray-jet of the ejection-type atomizer was proposed. The results of mathematical modeling of two-phase flow in the spray-jet and the crystallization process of fluid particles are given. The influence of the particle size, of the flow rate and the stagnation temperature gas in the ranges of industrial technology implemented for the production of powders aluminum of brands ASD, on the crystallization characteristics were investigated. The approximations of the characteristics of the crystallization process depending on the size of the aluminum particles on the basis of two approaches to the mathematical description of the process of crystallization of aluminum particles were obtained. The results allow to optimize the process parameters of ejection-type atomizer to produce aluminum particles with given morphology.

  14. CHARACTERIZATION AND ALUMINUM DISSOLUTION DEMONSTRATION WITH A 3 LITER TANK 51H SAMPLE

    International Nuclear Information System (INIS)

    Hay, M; John Pareizs, J; Cj Bannochie, C; Michael Stone, M; Damon Click, D; Daniel McCabe, D

    2008-01-01

    A 3-liter sludge slurry sample was sent to SRNL for demonstration of a low temperature aluminum dissolution process. The sludge was characterized before and after the aluminum dissolution. Post aluminum dissolution sludge settling and the stability of the decanted supernate were also observed. The characterization of the as-received 3-liter sample of Tank 51H sludge slurry shows a typical high aluminum HM sludge. The XRD analysis of the dried solids indicates Boehmite is the predominant crystalline form of aluminum in the sludge solids. However, amorphous phases of aluminum present in the sludge would not be identified using this analytical technique. The low temperature (55 C) aluminum dissolution process was effective at dissolving aluminum from the sludge. Over the three week test, ∼42% of the aluminum was dissolved out of the sludge solids. The process appears to be selective for aluminum with no other metals dissolving to any appreciable extent. At the termination of the three week test, the aluminum concentration in the supernate had not leveled off indicating more aluminum could be dissolved from the sludge with longer contact times or higher temperatures. The slow aluminum dissolution rate in the test may indicate the dissolution of the Boehmite form of aluminum however; insufficient kinetic data exists to confirm this hypothesis. The aluminum dissolution process appears to have minimal impact on the settling rate of the post aluminum dissolution sludge. However, limited settling data were generated during the test to quantify the effects. The sludge settling was complete after approximately twelve days. The supernate decanted from the settled sludge after aluminum dissolution appears stable and did not precipitate aluminum over the course of several months. A mixture of the decanted supernate with Tank 11 simulated supernate was also stable with respect to precipitation

  15. Drying studies of simulated DOE aluminum plate fuels

    International Nuclear Information System (INIS)

    Lords, R.E.; Windes, W.E.; Crepeau, J.C.; Sidwell, R.W.

    1996-01-01

    Experiments have been conducted to validate the Idaho National Engineering Laboratory (INEL) drying procedures for preparation of corroded aluminum plate fuel for dry storage in an existing vented (and filtered) fuel storage facility. A mixture of hydrated aluminum oxide bound with a clay was used to model the aluminum corrosion product and sediment expected in these Department of Energy (DOE) owned fuel types. Previous studies demonstrated that the current drying procedures are adequate for removal of free water inside the storage canister and for transfer of this fuel to a vented dry storage facility. However, using these same drying procedures, the simulated corrosion product was found to be difficult to dry completely from between the aluminum clad plates of the fuel. Another related set of experiments was designed to ensure that the fuel would not be damaged during the drying process. Aluminum plate fuels are susceptible to pitting damage on the cladding that can result in a portion of UAl x fuel meat being disgorged. This would leave a water-filled void beneath the pit in the cladding. The question was whether bursting would occur when water in the void flashes to steam, causing separation of the cladding from the fuel, and/or possible rupture. Aluminum coupons were fabricated to model damaged fuel plates. These coupons do not rupture or sustain any visible damage during credible drying scenarios

  16. Genome-wide association study of borderline personality disorder reveals genetic overlap with bipolar disorder, major depression and schizophrenia

    DEFF Research Database (Denmark)

    Witt, S H; Streit, F; Jungkunz, M

    2017-01-01

    Borderline personality disorder (BOR) is determined by environmental and genetic factors, and characterized by affective instability and impulsivity, diagnostic symptoms also observed in manic phases of bipolar disorder (BIP). Up to 20% of BIP patients show comorbidity with BOR. This report...... describes the first case-control genome-wide association study (GWAS) of BOR, performed in one of the largest BOR patient samples worldwide. The focus of our analysis was (i) to detect genes and gene sets involved in BOR and (ii) to investigate the genetic overlap with BIP. As there is considerable genetic...... overlap between BIP, major depression (MDD) and schizophrenia (SCZ) and a high comorbidity of BOR and MDD, we also analyzed the genetic overlap of BOR with SCZ and MDD. GWAS, gene-based tests and gene-set analyses were performed in 998 BOR patients and 1545 controls. Linkage disequilibrium score...

  17. Aluminum and aluminum/silicon coatings on ferritic steels by CVD-FBR technology

    International Nuclear Information System (INIS)

    Perez, F.J.; Hierro, M.P.; Trilleros, J.A.; Carpintero, M.C.; Sanchez, L.; Bolivar, F.J.

    2006-01-01

    The use of chemical vapor deposition by fluidized bed reactors (CVD-FBR) offers some advantages in comparison to other coating techniques such as pack cementation, because it allows coating deposition at lower temperatures than pack cementation and at atmospheric pressure without affecting the mechanical properties of material due to heat treatments of the bulk during coating process. Aluminum and aluminum/silicon coatings have been obtained on two different ferritics steels (P-91 and P-92). The coatings were analyzed using several techniques like SEM/EDX and XRD. The results indicated that both coatings were form by Fe 2 Al 5 intermetallic compound, and in the co-deposition the Si was incorporated to the Fe 2 Al 5 structure in small amounts

  18. Cytogenetic variability in pinus sylvestris L. populations experiencing anthropogenic influence

    International Nuclear Information System (INIS)

    Oudalova, A.; Geras'kin, S.; Vasiliev, D.; Dikarev, V.

    2004-01-01

    Techno-genic pollution has become one of the most significant ecological factors determining biosphere existence and development. An analysis of genetic consequences of the radiation accidents in the South Urals and Chernobyl has shown that mutation and recombination processes are considerably accelerated in plant and animal's populations experiencing techno-genic influence. This implies that there are complicated adaptation processes leading to changes in genetic structure of populations and increasing genetic load. Pinus sylvestris L. populations growing at the territory of the 'radon' Leningrad regional radioactive waste reprocessing enterprise and Sosnovy Bor town were monitored 6 years (1997-2002) by a set of cyto-genetical and morphological tests. Cytogenetic damage levels within intercalary meristem of needle as well as in root meristem of seedlings were found to significantly exceed corresponding controls. A higher radioresistance of the Scots pine seeds analyzed was demonstrated with an acute γ-radiation that also revealed a selection process directed at an enhancement of repair efficiency and resulting in a shift of mean values of radioresistance in populations towards higher values. An enlargement of variance of studied cytogenetic parameters was found in the populations experiencing techno-genic influence. This indicates, with an account of phenomenon of the enhanced radioresistance, that there are processes of cyto-genetical adaptation in the investigated regions. An analysis of the structure of ecological-genetical variability was carried out with the purpose of separating two components in the inter-population variability - the first is engaged to the genetically determined variability of biological characteristics intrinsic for this species, and the second is responsible for the variability originating from anthropogenic contamination of the natural habitat. Changes of these two types of variability were studied in dependence on time and techno

  19. Cytogenetic variability in pinus sylvestris L. populations experiencing anthropogenic influence

    Energy Technology Data Exchange (ETDEWEB)

    Oudalova, A.; Geras' kin, S.; Vasiliev, D.; Dikarev, V. [Russian Institute of Agricultural Radiology and Agroecology, Obninsk (Russian Federation)

    2004-07-01

    Techno-genic pollution has become one of the most significant ecological factors determining biosphere existence and development. An analysis of genetic consequences of the radiation accidents in the South Urals and Chernobyl has shown that mutation and recombination processes are considerably accelerated in plant and animal's populations experiencing techno-genic influence. This implies that there are complicated adaptation processes leading to changes in genetic structure of populations and increasing genetic load. Pinus sylvestris L. populations growing at the territory of the 'radon' Leningrad regional radioactive waste reprocessing enterprise and Sosnovy Bor town were monitored 6 years (1997-2002) by a set of cyto-genetical and morphological tests. Cytogenetic damage levels within intercalary meristem of needle as well as in root meristem of seedlings were found to significantly exceed corresponding controls. A higher radioresistance of the Scots pine seeds analyzed was demonstrated with an acute {gamma}-radiation that also revealed a selection process directed at an enhancement of repair efficiency and resulting in a shift of mean values of radioresistance in populations towards higher values. An enlargement of variance of studied cytogenetic parameters was found in the populations experiencing techno-genic influence. This indicates, with an account of phenomenon of the enhanced radioresistance, that there are processes of cyto-genetical adaptation in the investigated regions. An analysis of the structure of ecological-genetical variability was carried out with the purpose of separating two components in the inter-population variability - the first is engaged to the genetically determined variability of biological characteristics intrinsic for this species, and the second is responsible for the variability originating from anthropogenic contamination of the natural habitat. Changes of these two types of variability were studied in dependence on

  20. A comparison of corrosion inhibition of magnesium aluminum and zinc aluminum vanadate intercalated layered double hydroxides on magnesium alloys

    Science.gov (United States)

    Guo, Lian; Zhang, Fen; Lu, Jun-Cai; Zeng, Rong-Chang; Li, Shuo-Qi; Song, Liang; Zeng, Jian-Min

    2018-04-01

    The magnesium aluminum and zinc aluminum layered double hydroxides intercalated with NO3 -(MgAl-NO3-LDH and ZnAl-NO3-LDH) were prepared by the coprecipitation method, and the magnesium aluminum and the zinc aluminum layered double hydroxides intercalated with VO x -(MgAl-VO x -LDH and ZnAl-VO x -LDH) were prepared by the anion-exchange method. Morphologies, microstructures and chemical compositions of LDHs were investigated by SEM, EDS, XRD, FTIR, Raman and TG analyses. The immersion tests were carried to determine the corrosion inhibition properties of MgAl-VO x -LDH and ZnAl-VO x -LDH on AZ31 Mg alloys. The results showed that ZnAl-VO x -LDH possesses the best anion-exchange and inhibition abilities. The influence of treatment parameters on microstructures of LDHs were discussed. Additionally, an inhibition mechanism for ZnAl-VO x -LDH on the AZ31 magnesium alloy was proposed and discussed.

  1. Improving of Corrosion Resistance of Aluminum Alloys by Removing Intermetallic Compound

    International Nuclear Information System (INIS)

    Seri, Osami

    2008-01-01

    It is well known that iron is one of the most common impurity elements sound in aluminum and its alloys. Iron in the aluminum forms an intermetallic compounds such as FeAl 3 . The FeAl 3 particles on the aluminum surface are one of the most detrimental phases to the corrosion process and anodizing procedure for aluminum and its alloys. Trial and error surface treatment will be carried out to find the preferential and effective removal of FeAl 3 particles on the surfaces without dissolution of aluminum matrix around the particles. One of the preferable surface treatments for the aim of getting FeAl 3 free surface was an electrochemical treatment such as cathodic current density of -2 kAm -2 in a 20-30 mass% HNO 3 solution for the period of 300s. The corrosion characteristics of aluminum surface with FeAl 3 free particles are examined in a 0.1 kmol/m 3 NaCl solution. It is found that aluminum with free FeAl 3 particles shows higher corrosion resistance than aluminum with FeAl 3 particles

  2. Effect of direct contact with iron on gas evolution behavior of aluminum

    International Nuclear Information System (INIS)

    Hashizume, Shuji; Matsumoto, Junko; Banba, Tsunetaka

    1998-01-01

    Dry Low-Level Radioactive Waste (LLW), incombustible solid LLW, generated from nuclear power stations is planed to be solidified with cement backfill in drums. The solidified dry LLW will be buried to shallow underground at Rokkasyo LLW Disposal Center. It is well known that corrosion of aluminum and hydrogen gas evolution occur in high pH environments such as mortar. Gas evolution from aluminum is likely to effect the leachability of solidified dry LLW with mortar. Though aluminum removal from dry LLW is planed, a small amount of aluminum will be actually included in dry LLW. Large effects of pH and temperature on corrosion rate of aluminum and gas evolution were recognized in our previous study. It was also found that 1.5 mole hydrogen gas evolves while 1 mole aluminum corrodes under 60degC. Actually aluminum in drums is likely to contact with carbon steel of which main element is iron. The gas evolution behavior of aluminum is expected to be affected by its direct contact with iron. Therefore, effect of direct contact with iron on gas evolution behavior of aluminum was studied. The corrosion rate of aluminum increased by contacting it with iron in simulating mortar environments. The amount of gas evolution from aluminum was reduced by contacting with iron. The reduction in gas evolution was considered to result from the change of cathode reaction from hydrogen evolution to oxygen reduction. When aluminum contacts with iron, the corrosion and gas evolution behavior of aluminum is significantly affected oxygen in environment. (author)

  3. Bone aluminum measurements in patients with end-stage renal disease

    International Nuclear Information System (INIS)

    Ellis, K.J.; Kelleher, S.P.

    1986-01-01

    Long-term use of aluminum-based phosphate binders and trace aluminum contamination of dialysate solution have led to increased body burden of this metal in patients with end-stage renal disease. Aluminum accumulates in bone and has been associated with the development of a renal osteodystrophy, called aluminum-induced osteomalacia. At present, bone biopsy is the method of diagnosis of this condition. When examined by quantitative histomorphometry, the aluminum accumulation was reported to correlate with the severity of the osteomalacia. This project was therefore undertaken to investigate the possibility of developing a non-invasive technique using neutron activation analysis for the direct in vivo assessment of bone aluminum levels. A bilateral exposure of the patient's hand is performed at the patient port of the Brookhaven Medical Research Reactor. The induced activity is then counted for 5 min using four 4'' x 4'' x 16'' NaI(T1) detectors arranged in a quasi-4! geometry. In addition to Al, Ca is also detected and serves as each individual's internal standard for the volume of bone mass irradiated. The Al/Ca ratio provides an index of the amount of elevated aluminum per unit bone mass. When this ratio is multiplied by the total body calcium value, an estimate of total skeletal aluminum is obtained. These measurements will be presented for a pilot study of ten asymptomatic renal patients

  4. Effects of aluminum and manganese on the growth of ectomycorrhizal fungi.

    Science.gov (United States)

    Thompson, G W; Medve, R J

    1984-09-01

    Cenococcum graniforme, Suillus luteus, Thelephora terrestris, and three isolates of Pisolithus tinctorius were cultured on modified Melin-Norkrans medium at pH 3.4 and adjusted to 0 to 500 ppm (0 to 500 mug/ml) of aluminum or manganese sulfate. Except for T. terrestris, which was intolerant of aluminum at 150 and 250 to 500 ppm, and P. tinctorius isolate 250, which was intolerant of aluminum at 450 ppm, all fungi showed some growth at all concentrations of aluminum. S. luteus was the most tolerant to aluminum. Manganese was less fungitoxic than aluminum, with all fungi showing at least 65% growth at 500 ppm as compared with the control. C. graniforme was not inhibited at any concentration of manganese, and S. luteus was only affected at 500 ppm. P. tinctorius isolate 230 showed no significant variation in growth when subjected to various concentrations of three forms of manganese salts. Significant differences in growth were detected in response to three aluminum salts, but no detectable pattern was apparent. Genotypic responses to aluminum and manganese were evident for P. tinctorius. Isolates 210 and 230 were more tolerant to manganese than was isolate 250. Aluminum tolerance was in the order of isolate 230 > 210 > 250. Results of in vitro studies concerning tolerance responses of ectomycorrhizal fungi to aluminum and manganese were not consistent with field observations of the successional sequence of these fungi on acid coal spoils.

  5. Effects of aluminum and manganese on the growth of ectomycorrhizal fungi

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, G.W.; Medve, R.J.

    1984-09-01

    Cenococcum graniforme, Suillus luteus, Thelephora terrestris, and three isolates of Pisolithus tinctorius were cultured on modified Melin-Norkrans medium at pH 3.4 and adjusted to 0 to 500 ppm (0 to 500 ..mu..g/ml) of aluminum or manganese sulfate. Except for T. terrestris, which was intolerant of aluminum at 150 and 250 to 500 ppm, and P. tinctorius isolate 250, which was intolerant of aluminum at 450 ppm, all fungi showed some growth at all concentrations of aluminum. S. luteus was the most tolerant to aluminum. Manganese was less fungitoxic than aluminum, with all fungi showing at least 65% growth at 500 ppm as compared with the control. C graniforme was not inhibited at any concentration of manganese, and S. luteus was only affected at 500 ppm. P. tinctorius isolate 230 showed no significant variation in growth when subjected to various concentrations of three forms of manganese salts. Significant differences in growth were detected in response to three aluminum salts, but no detectable pattern was apparent. Genotypic responses to aluminum and manganese were evident for P. tinctorius. Isolates 210 and 230 were more tolerant to manganese than was isolate 250. Aluminum tolerance was in the order of isolate 230 > 210 > 250. Results of in vitro studies concerning tolerance responses of ectomycorrhizal fungi to aluminum and manganese were not consistent with field observations of the successional sequence of these fungi on acid coal spoils. 43 references, 3 tables.

  6. Strengthening of Aluminum Wires Treated with A206/Alumina Nanocomposites.

    Science.gov (United States)

    Florián-Algarín, David; Marrero, Raúl; Li, Xiaochun; Choi, Hongseok; Suárez, Oscar Marcelo

    2018-03-10

    This study sought to characterize aluminum nanocomposite wires that were fabricated through a cold-rolling process, having potential applications in TIG (tungsten inert gas) welding of aluminum. A206 (Al-4.5Cu-0.25Mg) master nanocomposites with 5 wt % γAl₂O₃ nanoparticles were first manufactured through a hybrid process combining semi-solid mixing and ultrasonic processing. A206/1 wt % γAl₂O₃ nanocomposites were fabricated by diluting the prepared master nanocomposites with a monolithic A206 alloy, which was then added to a pure aluminum melt. The fabricated Al-γAl₂O₃ nanocomposite billet was cold-rolled to produce an Al nanocomposite wire with a 1 mm diameter and a transverse area reduction of 96%. Containing different levels of nanocomposites, the fabricated samples were mechanically and electrically characterized. The results demonstrate a significantly higher strength of the aluminum wires with the nanocomposite addition. Further, the addition of alumina nanoparticles affected the wires' electrical conductivity compared with that of pure aluminum and aluminum-copper alloys. The overall properties of the new material demonstrate that these wires could be an appealing alternative for fillers intended for aluminum welding.

  7. Improving pitting corrosion resistance of aluminum by anodizing process

    International Nuclear Information System (INIS)

    John, P.; Khan, I.U.

    2013-01-01

    Summary: Anodizing of aluminum was studied in sulphuric/citric/boric acid electrolyte system to improve pitting corrosion resistance. Maximum oxide film thickness was obtained using 5% sulphuric acid, 3% citric acid and 0.5% boric acid electrolyte composition. The corrosion resistance of aluminum sample was determined to find the effectiveness of oxide coating by potentiodynamic polarization test. The surface morphology of aluminum samples was investigated using scanning electron microscope (SEM) before and after corrosion test. It was found that the coated aluminum sample obtained by anodizing in sulphuric/citric/boric acid electrolyte system exhibited better pitting corrosion resistance with no significant difference in surface morphology. (author)

  8. Aluminum nitrate recrystallization and recovery from liquid extraction raffinates

    International Nuclear Information System (INIS)

    Griffith, W.L.; Compere, A.L.; Googin, J.M.; Huxtable, W.P.

    1991-09-01

    The solid sludges resulting form biodenitrification of discarded aluminum nitrate are the largest Y-12 Plant process solid waste. Aluminum nitrate feedstocks also represent a major plant materials cost. The chemical constraints on aluminum nitrate recycle were investigated to determine the feasibility of increasing recycle while maintaining acceptable aluminum nitrate purity. Reported phase behavior of analogous systems, together with bench research, indicated that it would be possible to raise the recycle rate from 35% to between 70 and 90% by successive concentration and recrystallization of the mother liquor. A full scale pilot test successfully confirmed the ability to obtain 70% recycle in existing process equipment

  9. Polyphenol-aluminum complex formation: Implications for aluminum tolerance in plants

    Science.gov (United States)

    Natural polyphenols may play an important role in aluminum detoxification in some plants. We examined the interaction between Al3+ and the purified high molecular weight polyphenols pentagalloyl glucose (940 Da) and oenothein B (1568 Da), and the related compound methyl gallate (184 Da) at pH 4 and ...

  10. Crystallization of aluminum hydroxide in the aluminum-air battery: Literature review, crystallizer design and results of integrated system tests

    Science.gov (United States)

    Maimoni, A.

    1988-03-01

    The literature on aluminum trihydroxide crystallization is reviewed and the implications of crystallization on the design and performance of the aluminum-air battery are illustrated. Results of research on hydrargillite crystallization under battery operating conditions at Alcoa Laboratories, Alcan Kingston Laboratories, and Lawrence Livermore National Laboratory are summarized and are applied to the design of an electrolyte management system using lamella settlers for clarification of the electrolyte and product separation. The design principles were validated in a series of experiments that, for the first time in the aluminum-air program, demonstrated continuous operation of an integrated system consisting of cells, crystallizer, and a product-removal system.

  11. Activated aluminum hydride hydrogen storage compositions and uses thereof

    Science.gov (United States)

    Sandrock, Gary; Reilly, James; Graetz, Jason; Wegrzyn, James E.

    2010-11-23

    In one aspect, the invention relates to activated aluminum hydride hydrogen storage compositions containing aluminum hydride in the presence of, or absence of, hydrogen desorption stimulants. The invention particularly relates to such compositions having one or more hydrogen desorption stimulants selected from metal hydrides and metal aluminum hydrides. In another aspect, the invention relates to methods for generating hydrogen from such hydrogen storage compositions.

  12. Mechanism of Corrosion of Activated Aluminum Particles by Hot Water

    International Nuclear Information System (INIS)

    Razavi-Tousi, S.S.; Szpunar, J.A.

    2014-01-01

    Mechanism of corrosion in aluminum particles by hot water treatment for hydrogen generation is evaluated. The aluminum powder was activated by ball milling for different durations, which modified size and microstructure of the particles. Open circuit potential test was carried out to elucidate different stages of the reaction. Tafel test was used to explain the effect of ball milling and growth of hydroxide layer on corrosion of the particles. Surface, cross section and thickness of the grown hydroxide on the aluminum particles were studied in a scanning electron microscope. The corrosion potential of the aluminum powders depends on microstructure of the aluminum particles, growth of the hydroxide layer and a change in pH because of cathodic reactions. The hydrogen production test showed that a deformed microstructure and smaller particle size accelerates the corrosion rate of aluminum by hot water, the effect of the deformed microstructure being more significant at the beginning of the reaction. Effect of growth of the hydroxide layer on corrosion mechanism is discussed

  13. AlN powder synthesis via nitriding reaction of aluminum sub-chloride

    Energy Technology Data Exchange (ETDEWEB)

    Ohashi, T.; Nishida, T.; Sugiura, M. (Waseda Univ., Tokyo (Japan). Graduate School); Fuwa, A. (Waseda Univ., Tokyo (Japan))

    1993-06-01

    In order to obtain the pertinent properties of aluminium nitride in its sintered form, it is desirable to have powders of finer sizes with narrower size distribution and higher purity, thereby making the sintering processing easier and the final body denser. Instead of using sublimated aluminum tri-chloride vapor (AlCl3) as an aluminum source in the vapor phase nitriding reaction, the mixed aluminum chloride vapor consisted of aluminum tri-chloride, bi-chloride and mono-chloride are used in the reaction with ammonia at temperatures of 1000 and 1200K. The mixed chloride vapors are produced by reacting chlorine with molten aluminum at 1000 or 1200K under atmospheric pressure. The reaction of this mixed chloride vapor with ammonia is then experimentally investigated to study the aluminum nitride powder morphology. The aluminum nitride powders synthesized under various ammonia concentrations are characterized for size distribution, mean particle size and particle morphology. 24 refs., 8 figs., 2 tabs.

  14. Carrier gas effects on aluminum-catalyzed nanowire growth

    International Nuclear Information System (INIS)

    Ke, Yue; Hainey, Mel Jr; Won, Dongjin; Weng, Xiaojun; Eichfeld, Sarah M; Redwing, Joan M

    2016-01-01

    Aluminum-catalyzed silicon nanowire growth under low-pressure chemical vapor deposition conditions requires higher reactor pressures than gold-catalyzed growth, but the reasons for this difference are not well understood. In this study, the effects of reactor pressure and hydrogen partial pressure on silicon nanowire growth using an aluminum catalyst were studied by growing nanowires in hydrogen and hydrogen/nitrogen carrier gas mixtures at different total reactor pressures. Nanowires grown in the nitrogen/hydrogen mixture have faceted catalyst droplet tips, minimal evidence of aluminum diffusion from the tip down the nanowire sidewalls, and significant vapor–solid deposition of silicon on the sidewalls. In comparison, wires grown in pure hydrogen show less well-defined tips, evidence of aluminum diffusion down the nanowire sidewalls at increasing reactor pressures and reduced vapor–solid deposition of silicon on the sidewalls. The results are explained in terms of a model wherein the hydrogen partial pressure plays a critical role in aluminum-catalyzed nanowire growth by controlling hydrogen termination of the silicon nanowire sidewalls. For a given reactor pressure, increased hydrogen partial pressures increase the extent of hydrogen termination of the sidewalls which suppresses SiH_4 adsorption thereby reducing vapor–solid deposition of silicon but increases the surface diffusion length of aluminum. Conversely, lower hydrogen partial pressures reduce the hydrogen termination and also increase the extent of SiH_4 gas phase decomposition, shifting the nanowire growth window to lower growth temperatures and silane partial pressures. (paper)

  15. Predictors of Poor Prognosis in Aluminum Phosphide Intoxication

    Directory of Open Access Journals (Sweden)

    Fakhredin Taghaddosi Nejad

    2012-05-01

    Full Text Available Background: Aluminum phosphide as a fumigant is extensively used for wheat preservation from rodents and bugs especially in silos worldwide. There is increasing number of acute intoxication with this potentially lethal compound because of its easy availability. We have tried to locate predictors of poor prognosis in patients with aluminum phosphide intoxication in order to find patients who need more strict medical cares. Methods: All cases of aluminum phosphide intoxication that had been referred to our hospital during April 2008 to March 2010 were studied by their medical dossiers. Pertinent data including vital signs, demographic features, clinical and lab findings, and incidence of any complication were collected and analyzed by the relevant statistical methods. Results: Sixty seven cases of aluminum phosphide intoxication were included in the study. 44.8% of them were male. 97% of cases were suicidal. Mean amount of ingestion was 1.23+/- 0.71 tablets. Mortality rate was 41.8%. ECG abnormality and need for mechanical ventilation had negative relation with outcome. Conclusion: Correlation between some findings and complications with outcome in aluminum phosphide intoxication can be used as guidance for risk assessment and treatment planning in the patients.

  16. Improving of Corrosion Resistance of Aluminum Alloys by Removing Intermetallic Compound

    Energy Technology Data Exchange (ETDEWEB)

    Seri, Osami [Muroran it., Hokkaido (Japan)

    2008-06-15

    It is well known that iron is one of the most common impurity elements sound in aluminum and its alloys. Iron in the aluminum forms an intermetallic compounds such as FeAl{sub 3}. The FeAl{sub 3} particles on the aluminum surface are one of the most detrimental phases to the corrosion process and anodizing procedure for aluminum and its alloys. Trial and error surface treatment will be carried out to find the preferential and effective removal of FeAl{sub 3} particles on the surfaces without dissolution of aluminum matrix around the particles. One of the preferable surface treatments for the aim of getting FeAl{sub 3} free surface was an electrochemical treatment such as cathodic current density of -2 kAm{sup -2} in a 20-30 mass% HNO{sub 3} solution for the period of 300s. The corrosion characteristics of aluminum surface with FeAl{sub 3} free particles are examined in a 0.1 kmol/m{sup 3} NaCl solution. It is found that aluminum with free FeAl{sub 3} particles shows higher corrosion resistance than aluminum with FeAl{sub 3} particles.

  17. Practical Modeling of aluminum species in high-pH waste

    International Nuclear Information System (INIS)

    Reynolds, D.A.

    1995-10-01

    One of the main components of the nuclear waste stored at the Hanford Site is aluminum. As efforts are made to dispose of the waste, the need to predict the various phases of the aluminum becomes important for modeling of the disposal processes. Current databases of the aluminum species are not adequate as they stand. This study is not an attempt to present a rigorous discussion of aluminum chemistry, but to approach aluminum solubility as a practical application. The approach considers two different forms of aluminate; Al(OH) 4 - and AlO 2 - . By taking both of these forms of aluminate into consideration, a workable system of aluminium chemistry is formed that can be used to model the various waste disposal processes

  18. Aluminum alloy and associated anode and battery

    International Nuclear Information System (INIS)

    Tarcy, G.P.

    1990-01-01

    This patent describes an aluminum alloy. It comprises: eutectic amounts of at least two alloying elements selected from the group consisting of bismuth, cadmium, scandium, gallium, indium, lead, mercury, thallium, tin, and zinc with the balance being aluminum and the alloying elements being about 0.01 to 3.0 percent by weight of the alloy

  19. Aluminum-rich mesoporous MFI - type zeolite single crystals

    DEFF Research Database (Denmark)

    Kustova, Marina; Kustov, Arkadii; Christensen, Christina Hviid

    2005-01-01

    Zeolitcs are crystalline materials, which are widely used as solid acid catalysts and supports in many industrial processes. Recently, mesoporous MFI-type zeolite single crystals were synthesized by use of carbon particles as a mesopore template and sodium aluminate as the aluminum Source....... With this technique, only zeolites with relatively low Al contents were reported (Si/Al ratio about 100). In this work, the preparation of aluminum-rich mesoporous MFI-type zeolite single crystals (Si/Al similar to 16-50) using aluminum isopropoxide as the aluminum Source is reported for the first time. All samples...... are characterized by X-ray powder diffraction (XRD), scanning electron microscopy (SEM), ammonia temperature programmed desorption (NH3-TPD), and N-2 adsorption measurements. The obtained zeolites combine the high crystallinity and the characteristic micropores of zeolites with an intracrystalline mesopore system...

  20. The Advanced Aluminum Nitride Synthesis Methods and Its Applications: Patent Review.

    Science.gov (United States)

    Shishkin, Roman A; Elagin, Andrey A; Mayorova, Ekaterina S; Beketov, Askold R

    2016-01-01

    High purity nanosized aluminum nitride synthesis is a current issue for both industry and science. However, there is no up-to-date review considering the major issues and the technical solutions for different methods. This review aims to investigate the advanced methods of aluminum nitride synthesis and its development tendencies. Also the aluminum nitride application patents and prospects for development of the branch have been considered. The patent search on "aluminum nitride synthesis" has been carried out. The research activity has been analyzed. Special attention has been paid to the patenting geography and the leading researchers in aluminum nitride synthesis. Aluminum nitride synthesis methods have been divided into 6 main groups, the most studied approaches are carbothermal reduction (88 patents) and direct nitridation (107 patents). The current issues for each group have been analyzed; the main trends are purification of the final product and nanopowder synthesis. The leading researchers in aluminum nitride synthesis have represented 5 countries, namely: Japan, China, Russia, South Korea and USA. The main aluminum nitride application spheres are electronics (59,1 percent of applications) and new materials manufacturing (30,9 percent). The review deals with the state of the art data in nanosized aluminum nitride synthesis, the major issues and the technical solutions for different synthesis methods. It gives a full understanding of the development tendencies and of the current leaders in the sphere.

  1. Aluminum-air power cell research and development

    Science.gov (United States)

    Cooper, J. F.

    1984-12-01

    The wedge-shaped design, of the aluminum-air battery being developed, is mechanically simple and capable of full anode utilization and rapid full or partial recharge. To maintain constant interelectrode separation and to collect anodic current, the cell uses tin-coated copper tracks mounted on removable cassettes. Under gravity feed, slabs of aluminum enter the cell at a continuous and constant rate and gradually assume the wedge shape as they dissolve. Voltage losses at this tin-aluminum junction are 7 mV at 2 kA/m(2). A second-generation wedge cell incorporates air and electrolyte manifolding into individually replaceable air-cathode cassettes. Prototype wedge cells of one design were operated simultaneously with a fluidized-bed crystallizer, which stabilized aluminate concentration and produced a granular aluminum-trihydroxide reaction product. Electrolyte was circulated between the cell and crystallizer, and a hydrocyclone was used to retain particles larger than 0.015 mm within the crystallizer. Air electrodes were tested over simulated vehicle drive systems that include a standby phase in cold, supersaturated electrolyte.

  2. The use of aluminum dome tank roofs

    International Nuclear Information System (INIS)

    Morovich, G.L.

    1992-01-01

    Since the late 1970's the aluminum dome tank roof has gained wide usage for both new and retrofit applications. The increased application for the structure results from a need for maintenance reduction, environmental considerations, concern for product quality and economics. The American Petroleum Institute (API) has approved Standard API 650, Appendix G - Structurally Supported Aluminum Dome Roofs for publication. The aluminum dome was originally used as weather cover for retrofiting external floating roof tanks. The roof was considered for the reduction of maintenance related to draining water from the external floating roofs and problems resulting from freezing of drain lines and snow accumulation. This paper reports that environmental concerns have expanded the value of aluminum dome roofs. Rainwater bypassing the seals of an external floating roof became classified as a hazardous material requiring special and expensive disposal procedures. The marketing terminal facilities typically do not have the capacity for proper treatment of contaminated bottom water. With new fuel additives being water soluble, water contamination not only created a hazardous waste disposal problem, but resulted in reduced product quality

  3. Optical scattering from rough-rolled aluminum surfaces.

    Science.gov (United States)

    Rönnelid, M; Adsten, M; Lindström, T; Nostell, P; Wäckelgård, E

    2001-05-01

    Bidirectional, angular resolved scatterometry was used to evaluate the feasibility of using rolled aluminum as reflectors in solar thermal collectors and solar cells. Two types of rolled aluminum with different surface roughnesses were investigated. The results show that the smoother of the two samples [rms height, (0.20 ? 0.02) mum] can be used as a nonimaging, concentrating reflector with moderate reflection losses compared with those of optically smooth aluminum reflectors. The sample with the rougher surface [rms height, (0.6 ? 0.1) mum] is not suitable as a concentrating element but can be used as planar reflectors. The orientation of the rolling grooves is then of importance for minimizing reflection losses in the system.

  4. Preparation of nano-aluminum and studies on thermo-reaction properties

    International Nuclear Information System (INIS)

    Wei Sheng; Wang Chaoyang; Huang Yong; Wu Weidong; Tang Yongjian; Wei Jianjun

    2002-01-01

    The author presents the fabrication of nano-aluminum powders by evaporation-condensation method. The thermo gravimetric-differential scanning calorimetry technique is used to characterize the thermo-reaction properties between nano-aluminum powders and N 2 or Ar. The experiment results confirm the different thermo-reaction properties between block- and nano-aluminum

  5. Comparative effects of macro-sized aluminum oxide and aluminum oxide nanoparticles on erythrocyte hemolysis: influence of cell source, temperature, and size

    Energy Technology Data Exchange (ETDEWEB)

    Vinardell, M. P., E-mail: mpvinardellmh@ub.edu; Sordé, A. [Universitat de Barcelona, Departament de Fisiologia, Facultat de Farmàcia (Spain); Díaz, J. [Universitat de Barcelona CCiT, Scientific and Technological Centers (Spain); Baccarin, T.; Mitjans, M. [Universitat de Barcelona, Departament de Fisiologia, Facultat de Farmàcia (Spain)

    2015-02-15

    Al{sub 2}O{sub 3} is the most abundantly produced nanomaterial and has been used in diverse fields, including the medical, military, and industrial sectors. As there are concerns about the health effects of nanoparticles, it is important to understand how they interact with cells, and specifically with red blood cells. The hemolysis induced by three commercial nano-sized aluminum oxide particles (nanopowder 13 nm, nanopowder <50 nm, and nanowire 2–6 × 200–400 nm) was compared to aluminum oxide and has been studied on erythrocytes from humans, rats, and rabbits, in order to elucidate the mechanism of action and the influence of size and shape on hemolytic behavior. The concentrations inducing 50 % hemolysis (HC{sub 50}) were calculated for each compound studied. The most hemolytic aluminum oxide particles were of nanopowder 13, followed by nanowire and nanopowder 50. The addition of albumin to PBS induced a protective effect on hemolysis in all the nano-forms of Al{sub 2}O{sub 3}, but not on Al{sub 2}O{sub 3}. The drop in HC{sub 50} correlated to a decrease in nanomaterial size, which was induced by a reduction of aggregation. Aluminum oxide nanoparticles are less hemolytic than other oxide nanoparticles and behave differently depending on the size and shape of the nanoparticles. The hemolytic behavior of aluminum oxide nanoparticles differs from that of aluminum oxide.

  6. Anodization process produces opaque, reflective coatings on aluminum

    Science.gov (United States)

    1965-01-01

    Opaque, reflective coatings are produced on aluminum articles by an anodizing process wherein the anodizing bath contains an aqueous dispersion of finely divided insoluble inorganic compounds. These particles appear as uniformly distributed occlusions in the anodic deposit on the aluminum.

  7. The Properties of Arc-Sprayed Aluminum Coatings on Armor-Grade Steel

    Directory of Open Access Journals (Sweden)

    Marcin Adamiak

    2018-02-01

    Full Text Available This article presents the results of an examination of the properties of arc-sprayed aluminum on alloyed armor-grade steel. Thermal arc spraying was conducted with a EuTronic Arc Spray 4 wire arc sprayer. Aluminum wire 1.6 mm in diameter was used to produce dense, abrasion- and erosion-resistant coatings approx. 1.0 mm thick with and without nickel/5% aluminum-buffered subcoating. Aluminum coatings were characterized in accordance with ASTM G 65-00 abrasion resistance test, ASTM G 76-95 erosion resistance tests, ASTM C 633-01 adhesion strength, HV0.1 hardness tests and metallographic analyses. Results demonstrate properties of arc-sprayed aluminum and aluminum-nickel material coatings that are especially promising in industrial applications where erosion-, abrasion- and corrosion-resistant coating properties are required.

  8. [The unbearable lightness of aluminum: the social and environmental impacts of Brazil's insertion in the primary aluminum global market].

    Science.gov (United States)

    Henriques, Alen Batista; Porto, Marcelo Firpo Souza

    2013-11-01

    This article assesses aluminum production in Brazil and its social, environmental and public health impacts. The effects of the aluminum production chain challenge the idea of sustainable growth affirmed by business groups that operate in the sector. This article upholds the theory that the insertion of Brazil in the global aluminum market is part of a new configuration of the International Division of Labor (IDL), the polluting economic and highly energy dependent activities of which - as is the case of aluminum - have been moving to peripheral nations or emerging countries. The laws in such countries are less stringent, and similarly the environmental movements and the claims of the affected populations in the territories prejudiced in their rights to health, a healthy environment and culture are less influential. The competitiveness of this commodity is guaranteed in the international market, from the production of external factors such as environmental damage, deforestation, emissions of greenhouse gases and scenarios of environmental injustice. This includes undertakings in the construction of hydroelectric dams that expose traditional communities to situations involving the loss of their territories.

  9. Mercury-free dissolution of aluminum-clad fuel in nitric acid

    Science.gov (United States)

    Christian, Jerry D.; Anderson, Philip A.

    1994-01-01

    A mercury-free dissolution process for aluminum involves placing the aluminum in a dissolver vessel in contact with nitric acid-fluoboric acid mixture at an elevated temperature. By maintaining a continuous flow of the acid mixture through the dissolver vessel, an effluent containing aluminum nitrate, nitric acid, fluoboric acid and other dissolved components are removed.

  10. Final Technical Report Microwave Assisted Electrolyte Cell for Primary Aluminum Production

    Energy Technology Data Exchange (ETDEWEB)

    Xiaodi Huang; J.Y. Hwang

    2007-04-18

    This research addresses the high priority research need for developing inert anode and wetted cathode technology, as defined in the Aluminum Industry Technology Roadmap and Inert Anode Roadmap, with the performance targets: a) significantly reducing the energy intensity of aluminum production, b) ultimately eliminating anode-related CO2 emissions, and c) reducing aluminum production costs. This research intended to develop a new electrometallurgical extraction technology by introducing microwave irradiation into the current electrolytic cells for primary aluminum production. This technology aimed at accelerating the alumina electrolysis reduction rate and lowering the aluminum production temperature, coupled with the uses of nickel based superalloy inert anode, nickel based superalloy wetted cathode, and modified salt electrolyte. Michigan Technological University, collaborating with Cober Electronic and Century Aluminum, conducted bench-scale research for evaluation of this technology. This research included three sub-topics: a) fluoride microwave absorption; b) microwave assisted electrolytic cell design and fabrication; and c) aluminum electrowinning tests using the microwave assisted electrolytic cell. This research concludes that the typically used fluoride compound for aluminum electrowinning is not a good microwave absorbing material at room temperature. However, it becomes an excellent microwave absorbing material above 550°C. The electrowinning tests did not show benefit to introduce microwave irradiation into the electrolytic cell. The experiments revealed that the nickel-based superalloy is not suitable for use as a cathode material; although it wets with molten aluminum, it causes severe reaction with molten aluminum. In the anode experiments, the chosen superalloy did not meet corrosion resistance requirements. A nicked based alloy without iron content could be further investigated.

  11. Feasibility Study and Demonstration of an Aluminum and Ice Solid Propellant

    Directory of Open Access Journals (Sweden)

    Timothee L. Pourpoint

    2012-01-01

    Full Text Available Aluminum-water reactions have been proposed and studied for several decades for underwater propulsion systems and applications requiring hydrogen generation. Aluminum and water have also been proposed as a frozen propellant, and there have been proposals for other refrigerated propellants that could be mixed, frozen in situ, and used as solid propellants. However, little work has been done to determine the feasibility of these concepts. With the recent availability of nanoscale aluminum, a simple binary formulation with water is now feasible. Nanosized aluminum has a lower ignition temperature than micron-sized aluminum particles, partly due to its high surface area, and burning times are much faster than micron aluminum. Frozen nanoscale aluminum and water mixtures are stable, as well as insensitive to electrostatic discharge, impact, and shock. Here we report a study of the feasibility of an nAl-ice propellant in small-scale rocket experiments. The focus here is not to develop an optimized propellant; however improved formulations are possible. Several static motor experiments have been conducted, including using a flight-weight casing. The flight weight casing was used in the first sounding rocket test of an aluminum-ice propellant, establishing a proof of concept for simple propellant mixtures making use of nanoscale particles.

  12. Preparation of boron-rich aluminum boride nanoparticles by RF thermal plasma

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Sooseok [Inha University, Department of Chemical Engineering and Regional Innovation Center for Environmental Technology of Thermal Plasma (Korea, Republic of); Matsuo, Jiro; Cheng, Yingying [Tokyo Institute of Technology, Department of Environmental Chemistry and Engineering (Japan); Watanabe, Takayuki, E-mail: watanabe@chemenv.titech.ac.jp [Kyushu University, Department of Chemical Engineering (Japan)

    2013-08-15

    Boron-rich compounds of AlB{sub 12} and AlB{sub 10} nanoparticles were synthesized by a radiofrequency thermal plasma. Aluminum and boron raw powders were evaporated in virtue of high enthalpy of the thermal plasma in upstream region, followed by the formation of aluminum boride nanoparticles in the tail region of plasma flame with rapid quenching. A high production rate of aluminum boride was confirmed by the X-ray diffraction measurement in the case of high input power, high boron content in raw material and helium inner gas. Polyhedral nanoparticles of 20.8 nm in mean size were observed by a transmission electron microscope. In the raw powder mixture of aluminum, titanium, and boron, titanium-boride nanoparticles were synthesized preferentially, because the Gibbs free energy for the boridation of titanium is lower than that of aluminum. Since the nucleation temperature of boron is higher than that of aluminum, the condensation of metal monomers onto boron nuclei results in the formation of boron-rich aluminum boride nanoparticles.

  13. Investigation of Inner Vacuum Sucking method for degassing of molten aluminum

    International Nuclear Information System (INIS)

    Zeng, Jianmin; Gu, Ping; Wang, Youbing

    2012-01-01

    Hydrogen is a harmful gas element that is appreciably soluble in aluminum and its alloys. Removal of hydrogen from molten aluminum has been one of the most important tasks in aluminum melt processing. In this paper, a patented degassing process, which is based on principle of vacuum metallurgy, is proposed. A porous head that connects a vacuum system is immersed in the molten aluminum. The vacuum is created within the porous head and the dissolved hydrogen will diffuse unidirectionally towards the porous head according to Sievert's law. In this way, the hydrogen in the molten aluminum can be removed. The Fick's diffusion equation is used to explain hydrogen transfer in the molten aluminum. RPT experiments are carried out to evaluate the effectiveness of the new degassing process. The experiments indicate that the hydrogen content can be dramatically reduced by use of this process.

  14. Cadmium plated steel caps seal anodized aluminum fittings

    Science.gov (United States)

    Padden, J.

    1971-01-01

    Cadmium prevents fracturing of hard anodic coating under torquing to system specification requirements, prevents galvanic coupling, and eliminates need for crush washers, which, though commonly used in industry, do not correct leakage problem experienced when anodized aluminum fittings and anodized aluminum cap assemblies are joined.

  15. Selenium Adsorption To Aluminum-Based Water Treatment Residuals

    Science.gov (United States)

    Aluminum-based water treatment residuals (WTR) can adsorb water-and soil-borne P, As(V), As(III), and perchlorate, and may be able to adsorb excess environmental selenium. WTR, clay minerals, and amorphous aluminum hydroxide were shaken for 24 hours in selenate or selenite solut...

  16. Radiation corrosion in aluminum alloy bellows

    International Nuclear Information System (INIS)

    Konno, Osamu

    1987-01-01

    Testing was carried out in which materials for vacuum devices (Al, Ti, Cu, SUS) are exposed to electron beams (50 MeV, average current 80 μA) to determine the changes in the quantity, partial pressure and composition of the gases released from the materials. The test appratus used are made of Al alloys alone. During the test, vacuum leak is found in the Al alloy bellows used in the drive device. The leak is found to result from corrosion caused by water. The surface structure is analyzed by SEM, EPMA, ESCA and IMA. It is confirmed that the Al alloy used as material for the bellows if highly resistant to corrosion. It is concluded that it is necessary to use high purity cooling water to prevent the cooling water from causing corrosion. It has been reported that high purity aluminum is very high in resistance to corrosion. Based on these measurements and considerations, it is suggested that when aluminum is to be used as material for vacuum devices in an accelerator, it is required to provide protection film on its surface to prevent corrosion or to use cooling water pipes cladded with pure aluminum and an aluminum alloy. In addition, the temperature of the cooling water should be set after adequately considering the environmental conditions in the room. (Nogami, K.)

  17. Low Mass, Aluminum NOFBX Combustion Chamber Development, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Our team proposes to define a diffusion bonding process for aluminum as an enabling step to ultimately develop an innovative, lightweight, long life, aluminum...

  18. Passivation of aluminum with alkyl phosphonic acids for biochip applications

    Science.gov (United States)

    Attavar, Sachin; Diwekar, Mohit; Linford, Matthew R.; Davis, Mark A.; Blair, Steve

    2010-09-01

    Self-assembly of decylphosphonic acid (DPA) and octadecylphosphonic acid (ODPA) was studied on aluminum films using XPS, ToF-SIMS and surface wettability. Modified aluminum films were tested for passivation against silanization and subsequent oligonucleotide attachment. Passivation ratios of at least 450:1 compared to unprotected aluminum were obtained, as quantified by attachment of radio-labeled oligos.

  19. 40 CFR 464.10 - Applicability; description of the aluminum casting subcategory.

    Science.gov (United States)

    2010-07-01

    ... aluminum casting subcategory. 464.10 Section 464.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS METAL MOLDING AND CASTING POINT SOURCE CATEGORY Aluminum Casting Subcategory § 464.10 Applicability; description of the aluminum casting subcategory. The...

  20. Joining of parts via magnetic heating of metal aluminum powders

    Science.gov (United States)

    Baker, Ian

    2013-05-21

    A method of joining at least two parts includes steps of dispersing a joining material comprising a multi-phase magnetic metal-aluminum powder at an interface between the at least two parts to be joined and applying an alternating magnetic field (AMF). The AMF has a magnetic field strength and frequency suitable for inducing magnetic hysteresis losses in the metal-aluminum powder and is applied for a period that raises temperature of the metal-aluminum powder to an exothermic transformation temperature. At the exothermic transformation temperature, the metal-aluminum powder melts and resolidifies as a metal aluminide solid having a non-magnetic configuration.

  1. Aluminum enhances inflammation and decreases mucosal healing in experimental colitis in mice

    Science.gov (United States)

    Pineton de Chambrun, G; Body-Malapel, M; Frey-Wagner, I; Djouina, M; Deknuydt, F; Atrott, K; Esquerre, N; Altare, F; Neut, C; Arrieta, M C; Kanneganti, T-D; Rogler, G; Colombel, J-F; Cortot, A; Desreumaux, P; Vignal, C

    2014-01-01

    The increasing incidence of inflammatory bowel diseases (IBDs) in developing countries has highlighted the critical role of environmental pollutants as causative factors in their pathophysiology. Despite its ubiquity and immune toxicity, the impact of aluminum in the gut is not known. This study aimed to evaluate the effects of environmentally relevant intoxication with aluminum in murine models of colitis and to explore the underlying mechanisms. Oral administration of aluminum worsened intestinal inflammation in mice with 2,4,6-trinitrobenzene sulfonic acid- and dextran sodium sulfate-induced colitis and chronic colitis in interleukin 10-negative (IL10−/−) mice. Aluminum increased the intensity and duration of macroscopic and histologic inflammation, colonic myeloperoxidase activity, inflammatory cytokines expression, and decreased the epithelial cell renewal compared with control animals. Under basal conditions, aluminum impaired intestinal barrier function. In vitro, aluminum induced granuloma formation and synergized with lipopolysaccharide to stimulate inflammatory cytokines expression by epithelial cells. Deleterious effects of aluminum on intestinal inflammation and mucosal repair strongly suggest that aluminum might be an environmental IBD risk factor. PMID:24129165

  2. Application of aluminum slag incorporated in lightweigh aggregate

    International Nuclear Information System (INIS)

    Takahashi, Elisa Akiko Nakano

    2006-01-01

    The use of industrial waste materials as additives in the manufacture of ceramic product has been attracting a growing interest in the last few years and is becoming common practice. The main purpose of this work is to evaluate the possibility of incorporation of aluminum slag into clay materials. Expansive clays are obtained from a pyro plastic expansion, and are usually employed like lightweight aggregate in structural concrete as ornamental garden products. The characterization of the aluminum slag and clay materials was carried out by Xray fluorescence spectrometry, Xray diffraction, granulometry, differential thermal analysis, thermal gravimetry (DTA and TG) and scanning electron microscopy. The studied compositions contained 5, 10, 15 and 20 weight % of aluminum slag into clay mass. The linear expansion, mass variation, apparent specific mass and water absorption of all compositions were determined. Leaching and solubilization experiments were also performed. The main results show the viability of using up to 5 wt% aluminum slag for producing expansive clays with characteristics within the accepted standards. (author)

  3. The Identification of Aluminum in Human Brain Tissue Using Lumogallion and Fluorescence Microscopy

    Science.gov (United States)

    Mirza, Ambreen; King, Andrew; Troakes, Claire; Exley, Christopher

    2016-01-01

    Aluminum in human brain tissue is implicated in the etiologies of neurodegenerative diseases including Alzheimer’s disease. While methods for the accurate and precise measurement of aluminum in human brain tissue are widely acknowledged, the same cannot be said for the visualization of aluminum. Herein we have used transversely-heated graphite furnace atomic absorption spectrometry to measure aluminum in the brain of a donor with Alzheimer’s disease, and we have developed and validated fluorescence microscopy and the fluor lumogallion to show the presence of aluminum in the same tissue. Aluminum is observed as characteristic orange fluorescence that is neither reproduced by other metals nor explained by autofluorescence. This new and relatively simple method to visualize aluminum in human brain tissue should enable more rigorous testing of the aluminum hypothesis of Alzheimer’s disease (and other neurological conditions) in the future. PMID:27472886

  4. Structural and optical characterization of porous anodic aluminum oxide

    International Nuclear Information System (INIS)

    Galca, Aurelian C.; Kooij, E. Stefan; Wormeester, Herbert; Salm, Cora; Leca, Victor; Rector, Jan H.; Poelsema, Bene

    2003-01-01

    Spectroscopic ellipsometry and scanning electron microscopy (SEM) experiments are employed to characterize porous aluminum oxide obtained by anodization of thin aluminum films. Rutherford backscattering spectra and x-ray diffraction experiments provide information on the composition and the structure of the samples. Results on our thin film samples with a well-defined geometry show that anodization of aluminum is reproducible and results in a porous aluminum oxide network with randomly distributed, but perfectly aligned cylindrical pores perpendicular to the substrate. The ellipsometry spectra are analyzed using an anisotropic optical model, partly based on the original work by Bruggeman. The model adequately describes the optical response of the anodized film in terms of three physically relevant parameters: the film thickness, the cylinder fraction, and the nanoporosity of the aluminum oxide matrix. Values of the first two quantities, obtained from fitting the spectra, are in perfect agreement with SEM results, when the nanoporosity of the aluminum oxide matrix is taken into account. The validity of our optical model was verified over a large range of cylinder fractions, by widening of the pores through chemical etching in phosphoric acid. While the cylinder fraction increases significantly with etch time and etchant concentration, the nanoporosity remains almost unchanged. Additionally, based on a simple model considering a linear etch rate, the concentration dependence of the etch rate was determined

  5. Study on combined polishing process of aspherical aluminum mirrors

    Science.gov (United States)

    Deng, Jinqiu; Peng, Xiaoqiang; Hu, Hao; Ge, Kunpeng

    2017-10-01

    The aluminum mirrors are widely used as important optical components in some vital fields such as astronomical instruments or military installations due to the unique advantages of aluminum alloy. In order to simplify the structure of optical system and improve the performance at the same time, it's a tendency that the optics will be designed to aspherical or other freeform shapes. However, the traditional techniques are falling to have adequate abilities to deal with the increasing demands of aluminum optics. For example, the tool marks leaved on the surface from single point diamond turning (SPDT) has obvious adverse effects to optical system. The deterministic and sub-aperture polishing process has showed the potential to fabricate complex shapes over the few years. But it's still recognized as a problem to polish bare aluminum directly because of its soft surface and active chemical characteristics. Therefore, a combination of magnetorheological finishing (MRF) and small tool polishing (STP) is applied to obtain high performance aluminum optics in this paper. A paraboloid aluminum mirror was polished with this proposed method, and the results showed that the surface texture of the sample is restrained from rms 0.409λ (λ=632.8nm) to rms 0.025λ, and the surface roughness is improved from average Ra 6 7nm to Ra 3 4nm.

  6. Chromic acid anodizing of aluminum foil

    Science.gov (United States)

    Dursch, H.

    1988-01-01

    The success of the Space Station graphite/epoxy truss structure depends on its ability to endure long-term exposure to the LEO environment, primarily the effects of atomic oxygen and the temperture cycling resulting from the 94 minute orbit. This report describes the development and evaluation of chromic acid anodized (CAA) aluminum foil as protective coatings for these composite tubes. Included are: development of solar absorptance and thermal emittance properties required of Al foil and development of CAA parameters to achieve these optical properties; developing techniques to CAA 25 ft lengths of Al foil; developing bonding processes for wrapping the Al foil to graphite/epoxy tubes; and atomic oxygen testing of the CAA Al foil. Two specifications were developed and are included in the report: Chromic Acid Anodizing of Aluminum Foil Process Specification and Bonding of Anodized Aluminum Foil to Graphite/Epoxy Tubes. Results show that CAA Al foil provides and excellent protective and thermal control coating for the Space Station truss structure.

  7. Improved Density Functional Tight Binding Potentials for Metalloid Aluminum Clusters

    Science.gov (United States)

    2016-06-01

    unlimited IMPROVED DENSITY-FUNCTIONAL TIGHT BINDING POTENTIALS FOR METALLOID ALUMINUM CLUSTERS by Joon H. Kim June 2016 Thesis Advisor...DATES COVERED Master’s thesis 4. TITLE AND SUBTITLE IMPROVED DENSITY-FUNCTIONAL TIGHT BINDING POTENTIALS FOR METALLOID ALUMINUM CLUSTERS 5. FUNDING...repulsive potentials for use in density-functional tight binding (DFTB) simulations of low-valence aluminum metalloid clusters . These systems are under

  8. The role of aluminum sensing and signaling in plant aluminum resistance

    Science.gov (United States)

    As researchers have gained a better understanding in recent years into the physiological, molecular and genetic basis of how plants deal with aluminum (Al) toxicity in acid soils prevalent in the tropics and sub-tropics, it has become clear that an important component of these responses is the trigg...

  9. Corrosion of aluminum alloys in a reactor disassembly basin

    International Nuclear Information System (INIS)

    Howell, J.P.; Zapp, P.E.; Nelson, D.Z.

    1992-01-01

    This document discusses storage of aluminum clad fuel and target tubes of the Mark 22 assembly takes place in the concrete-lined, light-water-filled, disassembly basins located within each reactor area at the Savannah River Site (SRS). A corrosion test program has been conducted in the K-Reactor disassembly basin to assess the storage performance of the assemblies and other aluminum clad components in the current basin environment. Aluminum clad alloys cut from the ends of actual fuel and target tubes were originally placed in the disassembly water basin in December 1991. After time intervals varying from 45--182 days, the components were removed from the basin, photographed, and evaluated metallographically for corrosion performance. Results indicated that pitting of the 8001 aluminum fuel clad alloy exceeded the 30-mil (0.076 cm) cladding thickness within the 45-day exposure period. Pitting of the 1100 aluminum target clad alloy exceeded the 30-mil (0.076 cm) clad thickness in 107--182 days exposure. The existing basin water chemistry is within limits established during early site operations. Impurities such as Cl - , NO 3 - and SO 4 - are controlled to the parts per million level and basin water conductivity is currently 170--190 μmho/cm. The test program has demonstrated that the basin water is aggressive to the aluminum components at these levels. Other storage basins at SRS and around the US have successfully stored aluminum components for greater than ten years without pitting corrosion. These basins have impurity levels controlled to the parts per billion level (1000X lower) and conductivity less than 1.0 μmho/cm

  10. Radiation effects in crystalline SiO2: the role of aluminum

    International Nuclear Information System (INIS)

    Halliburton, L.E.; Koumvakalis, N.; Markes, M.E.; Martin, J.J.

    1981-01-01

    Electron spin resonance (ESR) and infrared absorption (IR) experiments have provided information about the role of aluminum in the radiation response of commercially available high-quality synthetic quartz. Samples obtained from two separate sources were investigated, and identical radiation responses were found for the two materials. Interstitial ions such as H + , Li + , and Na + as well as radiation-induced holes trapped at oxygen ions act as charge compensators for the ever-present substitutional aluminum ions. Usually the charge compensator is located adjacent to the aluminum, and this gives rise to Al-OH - , Al-Li + , Al-Na + , and [Al/sub e/ + ] 0 centers. Absolute concentrations of these compensated aluminum centers have been determined as a function of irradiation and annealing temperature for a variety of samples, both swept and unswept. The various treatments simply exchange one type of compensator for another at the aluminum sites, and within experimental error, the sum of the aluminum centers remains constant for a given sample. This direct accountability of all the aluminum ions in hydrogen-swept samples strongly suggests that the 3306- and 3367-cm -1 infrared bands are associated with the Al-OH - center. Also, the ESR and IR results show that the aluminum content of randomly selected bars of high-quality quartz can vary by an order of magnitude

  11. A Study on the Anodic Dissolution of Aluminum(II)

    International Nuclear Information System (INIS)

    Nam, C. W.; Park, C. S.; Park, C. S.

    1978-01-01

    In many cases oxide films formed on metals in atmosphere or aqueous solution are chemically inactive, especially it is the case with aluminum. In this study, anodic dissolution of aluminum was done using various electrolyte and cathode, mechanism of which was examined. As a consequence, oxide film on aluminum surface was dissolved together with the dissolution reaction of metal by the anodic current. It was shown that the dissolution reaction due to the contact between electrolyte and metal happened in the same time

  12. Wear behaviors of pure aluminum and extruded aluminum alloy (AA2024-T4) under variable vertical loads and linear speeds

    Science.gov (United States)

    Jung, Jeki; Oak, Jeong-Jung; Kim, Yong-Hwan; Cho, Yi Je; Park, Yong Ho

    2017-11-01

    The aim of this study was to investigate the transition of wear behavior for pure aluminum and extruded aluminum alloy 2024-T4 (AA2024-T4). The wear test was carried using a ball-on-disc wear testing machine at various vertical loads and linear speeds. The transition of wear behaviors was analyzed based on the microstructure, wear tracks, wear cross-section, and wear debris. The critical wear rates for each material are occurred at lower linear speed for each vertical load. The transition of wear behavior was observed in which abrasion wears with the generation of an oxide layer, fracture of oxide layer, adhesion wear, severe adhesion wear, and the generation of seizure occurred in sequence. In case of the pure aluminum, the change of wear debris occurred in the order of blocky, flake, and needle-like debris. Cutting chip, flake-like, and coarse flake-like debris was occurred in sequence for the extruded AA2024-T4. The transition in the wear behavior of extruded AA2024-T4 occurred slower than in pure aluminum.

  13. Strengthening of Aluminum Wires Treated with A206/Alumina Nanocomposites

    Directory of Open Access Journals (Sweden)

    David Florián-Algarín

    2018-03-01

    Full Text Available This study sought to characterize aluminum nanocomposite wires that were fabricated through a cold-rolling process, having potential applications in TIG (tungsten inert gas welding of aluminum. A206 (Al-4.5Cu-0.25Mg master nanocomposites with 5 wt % γAl2O3 nanoparticles were first manufactured through a hybrid process combining semi-solid mixing and ultrasonic processing. A206/1 wt % γAl2O3 nanocomposites were fabricated by diluting the prepared master nanocomposites with a monolithic A206 alloy, which was then added to a pure aluminum melt. The fabricated Al–γAl2O3 nanocomposite billet was cold-rolled to produce an Al nanocomposite wire with a 1 mm diameter and a transverse area reduction of 96%. Containing different levels of nanocomposites, the fabricated samples were mechanically and electrically characterized. The results demonstrate a significantly higher strength of the aluminum wires with the nanocomposite addition. Further, the addition of alumina nanoparticles affected the wires’ electrical conductivity compared with that of pure aluminum and aluminum–copper alloys. The overall properties of the new material demonstrate that these wires could be an appealing alternative for fillers intended for aluminum welding.

  14. 77 FR 16987 - National Emission Standards for Hazardous Air Pollutants: Secondary Aluminum Production

    Science.gov (United States)

    2012-03-23

    ... National Emission Standards for Hazardous Air Pollutants: Secondary Aluminum Production AGENCY... for secondary aluminum production (77 FR 8576). The EPA is extending the deadline for written comments... from the Aluminum Association. The Aluminum Association has requested the extension in order to allow...

  15. 40 CFR 180.415 - Aluminum tris (O-ethylphosphonate); tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Aluminum tris (O-ethylphosphonate... Tolerances § 180.415 Aluminum tris (O-ethylphosphonate); tolerances for residues. (a) General. Tolerances are established for residues of the fungicide aluminum tris(O-ethylphosphonate) in or on the following food...

  16. Study on Explosive Forming of Aluminum Alloy

    Directory of Open Access Journals (Sweden)

    H Iyama

    2016-09-01

    Full Text Available Now, the aluminum alloy is often used as auto parts, for example, body, engine. For example, there are the body, a cylinder block, a piston, a connecting rod, interior, exterior parts, etc. These are practical used the characteristic of a light and strong aluminum alloy efficiently. However, although an aluminum alloy is lighter than steel, the elongation is smaller than that. Therefore, in press forming, some problems often occur. We have proposed use of explosive forming, in order to solve this problem. In the explosive forming, since a blank is formed at high speed, a strain rate effect becomes large and it can be made the elongation is larger. Then, in order to clarify this feature, we carried out experimental research and numerical analysis. In this paper, these contents will be discussed.

  17. Cratering Equations for Zinc Orthotitanate Coated Aluminum

    Science.gov (United States)

    Hyde, James; Christiansen, Eric; Liou, Jer-Chyi; Ryan, Shannon

    2009-01-01

    The final STS-125 servicing mission (SM4) to the Hubble Space Telescope (HST) in May of 2009 saw the return of the 2nd Wide Field Planetary Camera (WFPC2) aboard the shuttle Discovery. This hardware had been in service on HST since it was installed during the SM1 mission in December of 1993 yielding one of the longest low Earth orbit exposure times (15.4 years) of any returned space hardware. The WFPC2 is equipped with a 0.8 x 2.2 m radiator for thermal control of the camera electronics (Figure 1). The space facing surface of the 4.1 mm thick aluminum radiator is coated with Z93 zinc orthotitanate thermal control paint with a nominal thickness of 0.1 0.2 mm. Post flight inspections of the radiator panel revealed hundreds of micrometeoroid/orbital debris (MMOD) impact craters ranging in size from less than 300 to nearly 1000 microns in diameter. The Z93 paint exhibited large spall areas around the larger impact sites (Figure 2) and the craters observed in the 6061-T651 aluminum had a different shape than those observed in uncoated aluminum. Typical hypervelocity impact craters in aluminum have raised lips around the impact site. The craters in the HST radiator panel had suppressed crater lips, and in some cases multiple craters were present instead of a single individual crater. Humes and Kinard observed similar behavior after the WFPC1 post flight inspection and assumed the Z93 coating was acting like a bumper in a Whipple shield. Similar paint behavior (spall) was also observed by Bland2 during post flight inspection of the International Space Station (ISS) S-Band Antenna Structural Assembly (SASA) in 2008. The SASA, with similar Z93 coated aluminum, was inspected after nearly 4 years of exposure on the ISS. The multi-crater phenomena could be a function of the density, composition, or impact obliquity angle of the impacting particle. For instance, a micrometeoroid particle consisting of loosely bound grains of material could be responsible for creating the

  18. Effect of Silicon on Desulfurization of Aluminum-killed Steels

    Science.gov (United States)

    Roy, Debdutta

    Recent reports have suggested that silicon has a beneficial effect on the rate of desulfurization of Al-killed steel. This effect is difficult to understand looking at the overall desulfurization reaction which does not include silicon. However an explanation is proposed by taking into account the (SiO2)/[Si] equilibrium in which some Al reaching the slag-metal interface is used in reducing the SiO2 in the slag. This reaction can be suppressed to some extent if the silicon content of the metal is increased and in doing so, more Al will be available at the slag-metal interface for the desulfurization reaction and this would increase the rate of the desulfurization reaction. A model was developed, assuming the rates are controlled by mass transfer, taking into account the coupled reactions of the reduction of silica, and other unstable oxides, namely iron oxide and manganese oxide, in the slag and desulfurization reaction in the steel by aluminum. The model predicts that increasing silicon increases the rate and extent of desulfurization. Plant data was analyzed to obtain rough estimates of ladle desulfurization rates and also used to validate the model predictions. Experiments have been conducted on a kilogram scale of material in an induction furnace to test the hypothesis. The major conclusions of the study are as follows: The rate and extent of desulfurization improve with increasing initial silicon content in the steel; the effect diminishes at silicon contents higher than approximately 0.2% and with increasing slag basicity. This was confirmed with kilogram-scale laboratory experiments. The effects of the silicon content in the steel (and of initial FeO and MnO in the slag) largely arise from the dominant effects of these reactions on the equilibrium aluminum content of the steel: as far as aluminum consumption or pick-up is concerned, the Si/SiO2 reaction dominates, and desulfurization has only a minor effect on aluminum consumption. The rate is primarily

  19. High-strength laser welding of aluminum-lithium scandium-doped alloys

    Science.gov (United States)

    Malikov, A. G.; Ivanova, M. Yu.

    2016-11-01

    The work presents the experimental investigation of laser welding of an aluminum alloy (system Al-Mg-Li) and aluminum alloy (system Al-Cu-Li) doped with Sc. The influence of nano-structuring of the surface layer welded joint by cold plastic deformation on the strength properties of the welded joint is determined. It is founded that, regarding the deformation degree over the thickness, the varying value of the welded joint strength is different for these aluminum alloys. The strength of the plastically deformed welded joint, aluminum alloys of the Al-Mg-Li and Al-Cu-Li systems reached 0.95 and 0.6 of the base alloy strength, respectively.

  20. Reaction of Aluminum with Water to Produce Hydrogen - 2010 Update

    Energy Technology Data Exchange (ETDEWEB)

    Petrovic, John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Thomas, George [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2011-06-01

    A Study of Issues Related to the Use of Aluminum for On-Board Vehicular Hydrogen Storage The purpose of this White Paper is to describe and evaluate the potential of aluminum-water reactions for the production of hydrogen for on-board hydrogen-powered vehicle applications. Although the concept of reacting aluminum metal with water to produce hydrogen is not new, there have been a number of recent claims that such aluminum-water reactions might be employed to power fuel cell devices for portable applications such as emergency generators and laptop computers, and might even be considered for possible use as the hydrogen source for fuel cell-powered vehicles.

  1. Retention and release of tritium in aluminum clad, Al-Li alloys

    International Nuclear Information System (INIS)

    Louthan, M.R. Jr.

    1991-01-01

    Tritium retention in and release from aluminum clad, aluminum-lithium alloys is modeled from experimental and operational data developed during the thirty plus years of tritium production at the Savannah River Site. The model assumes that tritium atoms, formed by the 6 Li(n,α) 3 He reaction, are produced in solid solution in the Al-Li alloy. Because of the low solubility of hydrogen isotopes in aluminum alloys, the irradiated Al-Li rapidly becomes supersaturated in tritium. Newly produced tritium atoms are trapped by lithium atoms to form a lithium tritide. The effective tritium pressure required for trap or tritide stability is the equilibrium decomposition pressure of tritium over a lithium tritide-aluminum mixture. The temperature dependence of tritium release is determined by the permeability of the cladding to tritium and the local equilibrium at the trap sites. This model is used to calculate tritium release from aluminum clad, aluminum-lithium alloys. 9 refs., 3 figs

  2. TANK 12 SLUDGE CHARACTERIZATION AND ALUMINUM DISSOLUTION DEMONSTRATION

    International Nuclear Information System (INIS)

    Reboul, S.; Hay, Michael; Zeigler, Kristine; Stone, Michael

    2009-01-01

    A 3-L sludge slurry sample from Tank 12 was characterized and then processed through an aluminum dissolution demonstration. The dominant constituent of the sludge was found to be aluminum in the form of boehmite. The iron content was minor, about one-tenth that of the aluminum. The salt content of the supernatant was relatively high, with a sodium concentration of ∼7 M. Due to these characteristics, the yield stress and plastic viscosity of the unprocessed slurry were relatively high (19 Pa and 27 cP), and the settling rate of the sludge was relatively low (∼20% settling over a two and a half week period). Prior to performing aluminum dissolution, plutonium and gadolinium were added to the slurry to simulate receipt of plutonium waste from H-Canyon. Aluminum dissolution was performed over a 26 day period at a temperature of 65 C. Approximately 60% of the insoluble aluminum dissolved during the demonstration, with the rate of dissolution slowing significantly by the end of the demonstration period. In contrast, approximately 20% of the plutonium and less than 1% of the gadolinium partitioned to the liquid phase. However, about a third of the liquid phase plutonium became solubilized prior to the dissolution period, when the H-Canyon plutonium/gadolinium simulant was added to the Tank 12 slurry. Quantification of iron dissolution was less clear, but appeared to be on the order of 1% based on the majority of data (a minor portion of the data suggested iron dissolution could be as high as 10%). The yield stress of the post-dissolution slurry (2.5 Pa) was an order of magnitude lower than the initial slurry, due most likely to the reduced insoluble solids content caused by aluminum dissolution. In contrast, the plastic viscosity remained unchanged (27 cP). The settling rate of the post-dissolution slurry was higher than the initial slurry, but still relatively low compared to settling of typical high iron content/low salt content sludges. Approximately 40% of the

  3. Advances in aluminum anodizing

    Science.gov (United States)

    Dale, K. H.

    1969-01-01

    White anodize is applied to aluminum alloy surfaces by specific surface preparation, anodizing, pigmentation, and sealing techniques. The development techniques resulted in alloys, which are used in space vehicles, with good reflectance values and excellent corrosive resistance.

  4. Anodizing of aluminum with improved corrosion properties

    International Nuclear Information System (INIS)

    John, P.; Khan, I.U.

    2010-01-01

    Anodizing of aluminum was studied in sulphuric/oxalic/boric acid electroiyte system. The corrosion resistance of the anodic oxide coating of aluminum was determined by potentiodynamic polarization test and scanning electron microscope (SEM) was used to investigate the surface morphology before and after corrosion test. It was found that the oxide coating obtained by this method showed better corrosion resistance with no significant difference in surface morphology. (author)

  5. Corrosion Inhibitors for Aluminum.

    Science.gov (United States)

    Muller, Bodo

    1995-01-01

    Describes a simple and reliable test method used to investigate the corrosion-inhibiting effects of various chelating agents on aluminum pigments in aqueous alkaline media. The experiments that are presented require no complicated or expensive electronic equipment. (DDR)

  6. Influence of fluoride on aluminum toxicity to Atlantic salmon (Salmo salar)

    Science.gov (United States)

    Hamilton, Steven J.; Haines, Terry A.

    1995-01-01

    Atlantic salmon (Salmo salar) alevins were exposed to various aluminum (0–4700 μg/L) and four fluoride (0–500 μg/L) concentrations at two pH values (5.5 and 6.5) for 4- and 30-d periods. In the 4-d tests, aluminum with fluoride was less toxic at pH 6.5 than at pH 5.5, whereas without fluoride, pH had no effect. In the 30-d test, mortality in all treatments was 17–21% at pH 5.5, but only 3–7% at pH 6.5. Fish length and weight after 30 d were reduced in all fluoride–aluminum treatments at pH 5.5, but only in the 200-μg/L aluminum without fluoride treatment at pH 6.5. At pH 5.5 and 6.5 without aluminum, histomorphological examinations revealed no abnormalities in gill tissue. However, in aluminum exposure with no fluoride, gill filaments and secondary lamellae were swollen and thickened. Addition of fluoride at pH 6.5 alleviated some gill damage. At pH 5.5 and 200 μg/L aluminum, addition of 100 μg/L fluoride reduced swelling of gill lamellae, but 200 μg/L fluoride did not reduce swelling. Low fluoride concentrations (fluoride concentrations (> 100 μg/L) may not reduce aluminum-induced effects.

  7. Drosophila melanogaster as a model system of aluminum toxicity and aging.

    Science.gov (United States)

    Kijak, Ewelina; Rosato, Ezio; Knapczyk, Katarzyna; Pyza, Elżbieta

    2014-04-01

    The aim of this study was to investigate the toxic effects of aluminum (Al) on the model organism-Drosophila melanogaster. The study is especially concerned with the effects of aluminum on the fruit fly's development, life span, and circadian rhythm in rest and activity. Flies were exposed to aluminum in concentrations from 40 to 280 mg/kg in rearing media or the flies were raised on control medium. Moreover, the life span of insects exposed to aluminum containing 40, 120, or 240 mg/kg of Al in the medium, only during their larval development, during the whole life cycle and only in their adult life was tested. To check if aluminum and aging cause changes in D. melanogaster behavior, the locomotor activity of flies at different ages was recorded. Results showed that aluminum is toxic in concentrations above 160 mg/kg in the rearing medium. Depending on Al concentration and time of exposure, the life span of the flies was shortened. At intermediate concentrations (120 mg/kg), however, Al had a stimulating effect on males increasing their life span and level of locomotor activity. At higher concentration the aluminum exposure increased or decreased the level of locomotor activity of D. melanogaster depending on age of flies. In addition, in the oldest insects reared on aluminum supplemented media and in mid-aged flies reared on the highest concentration of Al the daily rhythm of activity was disrupted. © 2013 Institute of Zoology, Chinese Academy of Sciences.

  8. Aluminum-Enhanced Underwater Electrical Discharges for Steam Explosion Triggering

    International Nuclear Information System (INIS)

    HOGELAND, STEVE R.; NELSON, LLOYD S.; ROTH, THOMAS CHRISTOPHER

    1999-01-01

    For a number of years, we have been initiating steam explosions of single drops of molten materials with pressure and flow (bubble growth) transients generated by discharging a capacitor bank through gold bridgewires placed underwater. Recent experimental and theoretical advances in the field of steam explosions, however, have made it important to substantially increase these relatively mild transients in water without using high explosives, if possible. To do this with the same capacitor bank, we have discharged similar energies through tiny strips of aluminum foil submerged in water. By replacing the gold wires with the aluminum strips, we were able to add the energy of the aluminum-water combustion to that normally deposited electrically by the bridgewire explosion in water. The chemical enhancement of the explosive characteristics of the discharges was substantial: when the same electrical energies were discharged through the aluminum strips, peak pressures increased as much as 12-fold and maximum bubble volumes as much as 5-fold above those generated with the gold wires. For given weights of aluminum, the magnitudes of both parameters appeared to exceed those produced by the underwater explosion of equivalent weights of high explosives

  9. Electrically Conductive Anodized Aluminum Surfaces

    Science.gov (United States)

    Nguyen, Trung Hung

    2006-01-01

    Anodized aluminum components can be treated to make them sufficiently electrically conductive to suppress discharges of static electricity. The treatment was conceived as a means of preventing static electric discharges on exterior satin-anodized aluminum (SAA) surfaces of spacecraft without adversely affecting the thermal-control/optical properties of the SAA and without need to apply electrically conductive paints, which eventually peel off in the harsh environment of outer space. The treatment can also be used to impart electrical conductivity to anodized housings of computers, medical electronic instruments, telephoneexchange equipment, and other terrestrial electronic equipment vulnerable to electrostatic discharge. The electrical resistivity of a typical anodized aluminum surface layer lies between 10(exp 11) and 10(exp 13) Omega-cm. To suppress electrostatic discharge, it is necessary to reduce the electrical resistivity significantly - preferably to anodized surface becomes covered and the pores in the surface filled with a transparent, electrically conductive metal oxide nanocomposite. Filling the pores with the nanocomposite reduces the transverse electrical resistivity and, in the original intended outer-space application, the exterior covering portion of the nanocomposite would afford the requisite electrical contact with the outer-space plasma. The electrical resistivity of the nanocomposite can be tailored to a value between 10(exp 7) and 10(exp 12) Omega-cm. Unlike electrically conductive paint, the nanocomposite becomes an integral part of the anodized aluminum substrate, without need for adhesive bonding material and without risk of subsequent peeling. The electrodeposition process is compatible with commercial anodizing production lines. At present, the electronics industry uses expensive, exotic, electrostaticdischarge- suppressing finishes: examples include silver impregnated anodized, black electroless nickel, black chrome, and black copper. In

  10. Synthesis of aluminum oxy-hydroxide nanofibers from porous anodic alumina

    Energy Technology Data Exchange (ETDEWEB)

    Jha, Himendra; Kikuchi, Tatsuya; Sakairi, Masatoshi; Takahashi, Hideaki [Laboratory of Interface Microstructure Analysis (LIMSA), Division of Materials Science and Engineering, Graduate School of Engineering, Hokkaido University, Sapporo 060-8628 (Japan)], E-mail: himendra@eng.hokudai.ac.jp

    2008-10-01

    A novel method for the synthesis of aluminum oxy-hydroxide nanofibers from a porous anodic oxide film of aluminum is demonstrated. In the present method, the porous anodic alumina not only acts as a template, but also serves as the starting material for the synthesis. The porous anodic alumina film is hydrothermally treated for pore-sealing, which forms aluminum oxy-hydroxide inside the pores of the oxide film as well as on the surface of the film. The hydrothermally sealed porous oxide film is immersed in the sodium citrate solution, which selectively etches the porous aluminum oxide from the film, leaving the oxy-hydroxide intact. The method is simple and gives highly uniform aluminum oxy-hydroxide nanofibers. Moreover, the diameter of the nanofibers can be controlled by controlling the pore size of the porous anodic alumina film, which depends on the anodizing conditions. Nanofibers with diameters of about 38-85 nm, having uniform shape and size, were successfully synthesized using the present method.

  11. Synthesis of aluminum oxy-hydroxide nanofibers from porous anodic alumina

    International Nuclear Information System (INIS)

    Jha, Himendra; Kikuchi, Tatsuya; Sakairi, Masatoshi; Takahashi, Hideaki

    2008-01-01

    A novel method for the synthesis of aluminum oxy-hydroxide nanofibers from a porous anodic oxide film of aluminum is demonstrated. In the present method, the porous anodic alumina not only acts as a template, but also serves as the starting material for the synthesis. The porous anodic alumina film is hydrothermally treated for pore-sealing, which forms aluminum oxy-hydroxide inside the pores of the oxide film as well as on the surface of the film. The hydrothermally sealed porous oxide film is immersed in the sodium citrate solution, which selectively etches the porous aluminum oxide from the film, leaving the oxy-hydroxide intact. The method is simple and gives highly uniform aluminum oxy-hydroxide nanofibers. Moreover, the diameter of the nanofibers can be controlled by controlling the pore size of the porous anodic alumina film, which depends on the anodizing conditions. Nanofibers with diameters of about 38-85 nm, having uniform shape and size, were successfully synthesized using the present method

  12. Superconducting structure with layers of niobium nitride and aluminum nitride

    International Nuclear Information System (INIS)

    Murduck, J.M.; Lepetre, Y.J.; Schuller, I.K.; Ketterson, J.B.

    1989-01-01

    A superconducting structure is formed by depositing alternate layers of aluminum nitride and niobium nitride on a substrate. Deposition methods include dc magnetron reactive sputtering, rf magnetron reactive sputtering, thin-film diffusion, chemical vapor deposition, and ion-beam deposition. Structures have been built with layers of niobium nitride and aluminum nitride having thicknesses in a range of 20 to 350 Angstroms. Best results have been achieved with films of niobium nitride deposited to a thickness of approximately 70 Angstroms and aluminum nitride deposited to a thickness of approximately 20 Angstroms. Such films of niobium nitride separated by a single layer of aluminum nitride are useful in forming Josephson junctions. Structures of 30 or more alternating layers of niobium nitride and aluminum nitride are useful when deposited on fixed substrates or flexible strips to form bulk superconductors for carrying electric current. They are also adaptable as voltage-controlled microwave energy sources. 8 figs

  13. Molten Triazolium Chloride Systems as New Aluminum Battery Electrolytes

    DEFF Research Database (Denmark)

    Vestergaard, B.; Bjerrum, Niels; Petrushina, Irina

    1993-01-01

    -170-degrees-C) depending on melt acidity and anode material. DMTC, being specifically adsorbed and reduced on the tungsten electrode surface, had an inhibiting effect on the aluminum reduction, but this effect was suppressed on the aluminum substrate. An electrochemical process with high current density (tens...... of milliamperes per square centimeter) was observed at 0.344 V on the acidic sodium tetrachloroaluminate background, involving a free triazolium radical mechanism. Molten DMTC-AlCl3 electrolytes are acceptable for battery performance and both the aluminum anode and the triazolium electrolyte can be used as active......The possibility of using molten mixtures of 1,4-dimethyl-1,2,4-triazolium chloride (DMTC) and aluminum chloride (AlCl3) as secondary battery electrolytes was studied, in some cases extended by the copresence of sodium chloride. DMTC-AlCl, mixtures demonstrated high specific conductivity in a wide...

  14. Alkaline corrosion properties of laser-clad aluminum/titanium coatings

    DEFF Research Database (Denmark)

    Aggerbeck, Martin; Herbreteau, Alexis; Rombouts, Marleen

    2015-01-01

    Purpose - The purpose of this paper is to study the use of titanium as a protecting element for aluminum in alkaline conditions. Design/methodology/approach - Aluminum coatings containing up to 20 weight per cent Ti6Al4V were produced using laser cladding and were investigated using light optical...... microscope, scanning electron microscope - energy-dispersive X-ray spectroscopy and X-Ray Diffraction, together with alkaline exposure tests and potentiodynamic measurements at pH 13.5. Findings - Cladding resulted in a heterogeneous solidification microstructure containing an aluminum matrix...... with supersaturated titanium ( (1 weight per cent), Al3Ti intermetallics and large partially undissolved Ti6Al4V particles. Heat treatment lowered the titanium concentration in the aluminum matrix, changed the shape of the Al3Ti precipitates and increased the degree of dissolution of the Ti6Al4V particles. Corrosion...

  15. Chemical Reduction Synthesis of Iron Aluminum Powders

    Science.gov (United States)

    Zurita-Méndez, N. N.; la Torre, G. Carbajal-De; Ballesteros-Almanza, L.; Villagómez-Galindo, M.; Sánchez-Castillo, A.; Espinosa-Medina, M. A.

    In this study, a chemical reduction synthesis method of iron aluminum (FeAl) nano-dimensional intermetallic powders is described. The process has two stages: a salt reduction and solvent evaporation by a heat treatment at 1100°C. The precursors of the synthesis are ferric chloride, aluminum foil chips, a mix of Toluene/THF in a 75/25 volume relationship, and concentrated hydrochloric acid as initiator of the reaction. The reaction time was 20 days, the product obtained was dried at 60 °C for 2 h and calcined at 400, 800, and 1100 °C for 4 h each. To characterize and confirm the obtained synthesis products, X-Ray Diffraction (XRD), and Scanning Electron Microscopy (SEM) techniques were used. The results of morphology and chemical characterization of nano-dimensional powders obtained showed a formation of agglomerated particles of a size range of approximately 150 nm to 1.0 μm. Composition of powders was identified as corundum (Al2O3), iron aluminide (FeAl3), and iron-aluminum oxides (Fe0. 53Al0. 47)2O3 phases. The oxide phases formation were associated with the reaction of atmospheric concentration-free oxygen during synthesis and sintering steps, reducing the concentration of the iron aluminum phase.

  16. Reinforcement of Aluminum Castings with Dissimilar Metals

    Energy Technology Data Exchange (ETDEWEB)

    Han, Q

    2004-01-07

    The project ''Reinforcement of Aluminum Casting with Dissimilar Metal'' was a Cooperative Research and Development Agreements (CRADAs) between Oak Ridge National Laboratory (ORNL) and Cummins Inc. This project, technologies have been developed to reinforce aluminum castings with steel insert. Defect-free bond between the steel insert and the aluminum casting has been consistently obtained. The push-out experiment indicated that the bond strength is higher than that of the Al-Fin method. Two patents have been granted to the project team that is comprised of Cummins Inc. and ORNL. This report contains four sections: the coating of the steel pins, the cast-in method, microstructure characterization, and the bond strength. The section of the coating of the steel pins contains coating material selection, electro-plating technique for plating Cu and Ni on steel, and diffusion bonding of the coatings to the steel. The section of cast-in method deals with factors that affecting the quality of the metallurgical bond between the coated steel and the aluminum castings. The results of microstructure characteristics of the bonding are presented in the microstructure characterization section. A push-out experiment and the results obtained using this method is described in the section of bond strength/mechanical property.

  17. Melt quality induced failure of electrical conductor (EC grade aluminum wires

    Directory of Open Access Journals (Sweden)

    Khaliq A.

    2017-01-01

    Full Text Available The failure of electrical conductor grade (EC aluminum during wire drawing process was investigated. The fractured aluminum wires were subjected to Scanning Electron Microscopy (SEM and Energy Dispersive X-ray (EDX analyses for an initial examination. Thermodynamic analyses of molten aluminum interaction with refractories was also carried out using FactSage at 710°C to predict the stable phases. The SEM/EDX analyses has revealed the inclusions in aluminum matrix. The typical inclusions observed were Al2O3, Al3C4 (Al-Carbide and oxides of refractories elements (Al, Mg, Si and O that have particle size ranging up to 5 μm. The transition metal boride particles were not identified during SEM/EDX analyses these might be too fine to be detected with this microscope. The overall investigation suggested that the possible cause of this failure is second phase particles presence as inclusions in the aluminum matrix, and this was associated with the poor quality of melt. During wire drawing process, these inclusions were pulled out of the aluminum matrix by the wiredrawing forces to produce micro-voids which led to ductile tearing and final fracture of wires. It was recommended to use ceramic foam filters to segregate inclusions from molten aluminum.

  18. Fatigue crack propagation in aluminum-lithium alloys

    Science.gov (United States)

    Rao, K. T. V.; Ritchie, R. O.; Piascik, R. S.; Gangloff, R. P.

    1989-01-01

    The principal mechanisms which govern the fatigue crack propagation resistance of aluminum-lithium alloys are investigated, with emphasis on their behavior in controlled gaseous and aqueous environments. Extensive data describe the growth kinetics of fatigue cracks in ingot metallurgy Al-Li alloys 2090, 2091, 8090, and 8091 and in powder metallurgy alloys exposed to moist air. Results are compared with data for traditional aluminum alloys 2024, 2124, 2618, 7075, and 7150. Crack growth is found to be dominated by shielding from tortuous crack paths and resultant asperity wedging. Beneficial shielding is minimized for small cracks, for high stress ratios, and for certain loading spectra. While water vapor and aqueous chloride environments enhance crack propagation, Al-Li-Cu alloys behave similarly to 2000-series aluminum alloys. Cracking in water vapor is controlled by hydrogen embrittlement, with surface films having little influence on cyclic plasticity.

  19. Updated Life-Cycle Assessment of Aluminum Production and Semi-fabrication for the GREET Model

    Energy Technology Data Exchange (ETDEWEB)

    Dai, Qiang [Argonne National Lab. (ANL), Argonne, IL (United States); Kelly, Jarod C. [Argonne National Lab. (ANL), Argonne, IL (United States); Burnham, Andrew [Argonne National Lab. (ANL), Argonne, IL (United States); Elgowainy, Amgad [Argonne National Lab. (ANL), Argonne, IL (United States)

    2015-09-01

    This report serves as an update for the life-cycle analysis (LCA) of aluminum production based on the most recent data representing the state-of-the-art of the industry in North America. The 2013 Aluminum Association (AA) LCA report on the environmental footprint of semifinished aluminum products in North America provides the basis for the update (The Aluminum Association, 2013). The scope of this study covers primary aluminum production, secondary aluminum production, as well as aluminum semi-fabrication processes including hot rolling, cold rolling, extrusion and shape casting. This report focuses on energy consumptions, material inputs and criteria air pollutant emissions for each process from the cradle-to-gate of aluminum, which starts from bauxite extraction, and ends with manufacturing of semi-fabricated aluminum products. The life-cycle inventory (LCI) tables compiled are to be incorporated into the vehicle cycle model of Argonne National Laboratory’s Greenhouse Gases, Regulated Emissions, and Energy Use in Transportation (GREET) Model for the release of its 2015 version.

  20. Fluxless aluminum brazing

    Science.gov (United States)

    Werner, W.J.

    1974-01-01

    This invention relates to a fluxless brazing alloy for use in forming brazed composites made from members of aluminum and its alloys. The brazing alloy consists of 35-55% Al, 10--20% Si, 25-60% Ge; 65-88% Al, 2-20% Si, 2--18% In; 65--80% Al, 15-- 25% Si, 5- 15% Y. (0fficial Gazette)

  1. Dehydration of aluminum chloride hexahydrate: a technical assessment

    International Nuclear Information System (INIS)

    Miller, R.L.

    1984-04-01

    Physical and chemical properties of aluminum chloride hexahydrate, ACH, and related compounds are noted as well as the relation of these properties to the problem of dehydration of ACH to form anhydrous aluminum chloride. Several approaches to the dehydration of ACH are discussed and a rationale or each approach is given: solvent extraction, ligand exchange, azeotropic distillation, chemical dehydration, and energy specific direct heating. While the thermodynamics of dehydration are frequently favorable, the rate of reaction and the mechanisms of reaction are more frequently unfavorable. However, each approach requires experimentation to test its effectiveness. The stability of the aluminum-oxygen bond in the hydrate is such that dehydration without decomposition to the oxide will be very difficult

  2. Evaluation and Characterization of In-Line Annealed Continuous Cast Aluminum Sheet

    Energy Technology Data Exchange (ETDEWEB)

    Dr Subodh K. Das

    2006-01-17

    This R&D program will develop optimized, energy-efficient thermo-mechanical processing procedures for in-line annealing of continuously cast hot bands of two 5000 series aluminum alloys (5754 and 5052). The implementation of the R&D will result in the production of sheet with improved formability at high levels of productivity consistency and quality. The proposed R&D involves the following efforts: (1) Design and build continuous in-line annealing equipment for plant-scale trials; (2) Carry out plant-scale trials at Commonwealth Aluminum Corp.'s (CAC) plant in Carson; (3) Optimize the processing variables utilizing a metallurgical model for the kinetics of microstructure and texture evolution during thermo-mechanical processing; (4) Determine the effects of processing variables on the microstructure, texture, mechanical properties, and formability of aluminum sheet; (5) Develop design parameters for commercial implementation; and (6) Conduct techno-economic studies of the recommended process equipment to identify impacts on production costs. The research and development is appropriate for the domestic industry as it will result in improved aluminum processing capabilities and thus lead to greater application of aluminum in various industries including the automotive market. A teaming approach is critical to the success of this effort as no single company alone possesses the breadth of technical and financial resources for successfully carrying out the effort. This program will enable more energy efficient aluminum sheet production technology, produce consistent high quality product, and have The proposal addresses the needs of the aluminum industry as stated in the aluminum industry roadmap by developing new and improved aluminum processes utilizing energy efficient techniques. The effort is primarily related to the subsection on Rolling and Extrusion with the R&D to address energy and environmental efficiencies in aluminum manufacturing and will provide

  3. Thermodynamic Analysis for the Refining Ability of Salt Flux for Aluminum Recycling

    Directory of Open Access Journals (Sweden)

    Takehito Hiraki

    2014-07-01

    Full Text Available The removability of impurities during the aluminum remelting process by oxidation was previously investigated by our research group. In the present work, alternative impurity removal with chlorination has been evaluated by thermodynamic analysis. For 43 different elements, equilibrium distribution ratios among metal, chloride flux and oxide slag phases in the aluminum remelting process were calculated by assuming the binary systems of aluminum and an impurity element. It was found that the removability of impurities isn’t significantly affected by process parameters such as chloride partial pressure, temperature and flux composition. It was shown that Ho, Dy, Li, La, Mg, Gd, Ce, Yb, Ca and Sr can be potentially eliminated into flux by chlorination from the remelted aluminum. Chlorination and oxidation are not effective to remove other impurities from the melting aluminum, due to the limited parameters which can be controlled during the remelting process. It follows that a proper management of aluminum scrap such as sorting based on the composition of the products is important for sustainable aluminum recycling.

  4. Oxidation of ligand-protected aluminum clusters: An ab initio molecular dynamics study

    International Nuclear Information System (INIS)

    Alnemrat, Sufian; Hooper, Joseph P.

    2014-01-01

    We report Car-Parrinello molecular dynamics simulations of the oxidation of ligand-protected aluminum clusters that form a prototypical cluster-assembled material. These clusters contain a small aluminum core surrounded by a monolayer of organic ligand. The aromatic cyclopentadienyl ligands form a strong bond with surface Al atoms, giving rise to an organometallic cluster that crystallizes into a low-symmetry solid and is briefly stable in air before oxidizing. Our calculations of isolated aluminum/cyclopentadienyl clusters reacting with oxygen show minimal reaction between the ligand and O 2 molecules at simulation temperatures of 500 and 1000 K. In all cases, the reaction pathway involves O 2 diffusing through the ligand barrier, splitting into atomic oxygen upon contact with the aluminum, and forming an oxide cluster with aluminum/ligand bonds still largely intact. Loss of individual aluminum-ligand units, as expected from unimolecular decomposition calculations, is not observed except following significant oxidation. These calculations highlight the role of the ligand in providing a steric barrier against oxidizers and in maintaining the large aluminum surface area of the solid-state cluster material

  5. Advanced powder metallurgy aluminum alloys and composites

    Science.gov (United States)

    Lisagor, W. B.; Stein, B. A.

    1982-01-01

    The differences between powder and ingot metallurgy processing of aluminum alloys are outlined. The potential payoff in the use of advanced powder metallurgy (PM) aluminum alloys in future transport aircraft is indicated. The national program to bring this technology to commercial fruition and the NASA Langley Research Center role in this program are briefly outlined. Some initial results of research in 2000-series PM alloys and composites that highlight the property improvements possible are given.

  6. Applications of laser-induced breakdown spectroscopy in the aluminum electrolysis industry

    Science.gov (United States)

    Sun, Lanxiang; Yu, Haibin; Cong, Zhibo; Lu, Hui; Cao, Bin; Zeng, Peng; Dong, Wei; Li, Yang

    2018-04-01

    The industrial aluminum reduction cell is an electrochemistry reactor that operates under high temperatures and corrosive conditions. Monitoring the molten aluminum and electrolyte components is very important for controlling the chemical reaction process. Due to the lack of fast methods to monitor the components, controlling aluminum reduction cells is difficult. In this work, laser-induced breakdown spectroscopy (LIBS) was applied to aluminum electrolysis. A new method for calculating the molecular ratio, which is an important control parameter that represents the acidity of the electrolyte, was proposed. Experiments were first performed on solid electrolyte samples to test the performance of the proposed method. Using this method, the average relative standard deviation (RSD) of the molecular ratio measurement was 0.39%, and the average root mean square error (RMSE) was 0.0236. These results prove that LIBS can accurately measure the molecular ratio. Then, in situ measurements of the molten aluminum and electrolyte were performed in industrial aluminum induction cells using the developed LIBS equipment. The spectra of the molten electrolyte were successfully obtained and were consistent with the spectra of the solid electrolyte.

  7. GHG emissions from primary aluminum production in China: Regional disparity and policy implications

    International Nuclear Information System (INIS)

    Hao, Han; Geng, Yong; Hang, Wen

    2016-01-01

    Highlights: • GHG emissions from primary aluminum production in China were accounted. • The impact of regional disparity of power generation was considered for this study. • GHG emissions factor of China’s primary aluminum production was 16.5 t CO_2e/t Al ingot in 2013. • Total GHG emissions from China’s primary aluminum production were 421 mt CO_2e in 2013. - Abstract: China is the world-leading primary aluminum production country, which contributed to over half of global production in 2014. Primary aluminum production is power-intensive, for which power generation has substantial impact on overall Greenhouse Gas (GHG) emissions. In this study, we explore the impact of regional disparity of China’s power generation system on GHG emissions for the sector of primary aluminum production. Our analysis reveals that the national GHG emissions factor (GEF) of China’s primary aluminum production was 16.5 t CO_2e/t Al ingot in 2013, with province-level GEFs ranging from 8.2 to 21.7 t CO_2e/t Al ingot. There is a high coincidence of provinces with high aluminum productions and high GEFs. Total GHG emissions from China’s primary aluminum production were 421 mt CO_2e in 2013, approximately accounting for 4% of China’s total GHG emissions. Under the 2020 scenario, GEF shows a 13.2% reduction compared to the 2013 level, but total GHG emissions will increase to 551 mt CO_2e. Based on our analysis, we recommend that the government should further promote energy efficiency improvement, facilitate aluminum industry redistribution with low-carbon consideration, promote secondary aluminum production, and improve aluminum industry data reporting and disclosure.

  8. Study of Plasma Electrolytic Oxidation Coatings on Aluminum Composites

    Directory of Open Access Journals (Sweden)

    Leonid Agureev

    2018-06-01

    Full Text Available Coatings, with a thickness of up to 75 µm, were formed by plasma electrolytic oxidation (PEO under the alternating current electrical mode in a silicate-alkaline electrolyte on aluminum composites without additives and alloyed with copper (1–4.5%. The coatings’ structure was analyzed by scanning electron microscopy, X-ray microanalysis, X-ray photoelectron spectroscopy, nuclear backscattering spectrometry, and XRD analysis. The coatings formed for 60 min were characterized by excessive aluminum content and the presence of low-temperature modifications of alumina γ-Al2O3 and η-Al2O3. The coatings formed for 180 min additionally contained high-temperature corundum α-Al2O3, and aluminum inclusions were absent. The electrochemical behavior of coated composites and uncoated ones in 3% NaCl was studied. Alloyage of aluminum composites with copper increased the corrosion current density. Plasma electrolytic oxidation reduced it several times.

  9. Aluminum electroplating on steel from a fused bromide electrolyte

    Energy Technology Data Exchange (ETDEWEB)

    Prabhat K. Tripathy; Laura A. Wurth; Eric J. Dufek; Toni Y. Gutknecht; Natalie J. Gese; Paula Hahn; Steven M. Frank; Guy L. Frederickson; J. Stephen Herring

    2014-08-01

    A quaternary bromide bath (LiBr–KBr–CsBr–AlBr3) was used to electro-coat aluminum on steel substrates. The electrolytewas prepared by the addition of AlBr3 into the eutectic LiBr–KBr–CsBr melt. A smooth, thick, adherent and shiny aluminum coating could be obtained with 80 wt.% AlBr3 in the ternary melt. The SEM photographs of the coated surfaces suggest the formation of thick and dense coatings with good aluminum coverage. Both salt immersion and open circuit potential measurement suggested that the coatings did display a good corrosionresistance behavior. Annealing of the coated surfaces, prior to corrosion tests, suggested the robustness of the metallic aluminum coating in preventing the corrosion of the steel surfaces. Studies also indicated that the quaternary bromide plating bath can potentially provide a better aluminumcoating on both ferrous and non-ferrous metals, including complex surfaces/geometries.

  10. Shielding gas effect to diffusion activities of magnesium and copper on aluminum clad

    Science.gov (United States)

    Manurung, Charles SP; Napitupulu, Richard AM

    2017-09-01

    Aluminum is the second most metal used in many application, because of its corrosion resistance. The Aluminum will be damaged in over time if it’s not maintained in good condition. That is important to give protection to the Aluminums surface. Cladding process is one of surface protection methodes, especially for metals. Aluminum clad copper (Al/Cu) or copper clad aluminum (Cu/Al) composite metals have been widely used for many years. These mature protection method and well tested clad metal systems are used industrially in a variety application. The inherent properties and behavior of both copper and aluminum combine to provide unique performance advantages. In this paper Aluminum 2024 series will be covered with Aluminum 1100 series by hot rolling process. Observations will focus on diffusion activities of Mg and Cu that not present on Aluminum 1100 series. The differences of clad material samples is the use of shielding gas during heating before hot rolling process. The metallurgical characteristics will be examined by using optical microscopy. Transition zone from the interface cannot be observed but from Energy Dispersive Spectrometry it’s found that Mg and Cu are diffused from base metal (Al 2024) to the clad metal (Al 1100). Hardness test proved that base metals hardness to interface was decrease.

  11. Incremental binding free energies of aluminum (III) vs. magnesium (II) complexes

    International Nuclear Information System (INIS)

    Mercero, Jose M.; Mujika, Jon I.; Matxain, Jon M.; Lopez, Xabier; Ugalde, Jesus M.

    2003-01-01

    A sequential ligand addition to the aluminum (III) cation has been studied using the B3LYP functional and a combined all-electron/pseudopotentials basis set. The aluminum complexes are compared with analogous magnesium (II) complexes. Different thermodynamical data, such as incremental binding energies, enthalpies, entropies and free energies, are presented for these addition reactions. While the magnesium (II) cation can only accommodate three negatively charged ligands, aluminum (III) accommodates four even after including bulk solvent effects. The main differences between both cations complexing with the neutral ligands, is that aluminum (III) is not able to form complexes with methanol until the number of methanol ligands is equal to 3. Magnesium (II) prefers to bind methanol and formamide when the number of ligands is small, while aluminum prefers formamide. For the largest complexes both cations prefer to bind water

  12. The effects of ultrasonic solidification on aluminum

    OpenAIRE

    Đorđević Slavko 1

    2003-01-01

    The effect of ultrasound on characteristics of solidified aluminum was shown. An ultrasonic head and ultrasonic system for modification was designed and applied to the crystallizing aluminum melt. The ultrasonic generator allows power of 50-500 W, amplitude of oscillations 10-100 um.m and the operating frequency of 25 kHz. Ultrasonic modification was done by ultrasound introduced from above into the melt. Microstructure photographs show decreasing of the grain size more than five times.

  13. The effects of ultrasonic solidification on aluminum

    Directory of Open Access Journals (Sweden)

    Đorđević Slavko 1

    2003-01-01

    Full Text Available The effect of ultrasound on characteristics of solidified aluminum was shown. An ultrasonic head and ultrasonic system for modification was designed and applied to the crystallizing aluminum melt. The ultrasonic generator allows power of 50-500 W, amplitude of oscillations 10-100 um.m and the operating frequency of 25 kHz. Ultrasonic modification was done by ultrasound introduced from above into the melt. Microstructure photographs show decreasing of the grain size more than five times.

  14. Stress corrosion in high-strength aluminum alloys

    Science.gov (United States)

    Dorward, R. C.; Hasse, K. R.

    1980-01-01

    Report describes results of stress-corrosion tests on aluminum alloys 7075, 7475, 7050, and 7049. Tests compare performance of original stress-corrosion-resistant (SCR) aluminum, 7075, with newer, higher-strength SCR alloys. Alloys 7050 and 7049 are found superior in short-transverse cross-corrosion resistance to older 7075 alloy; all alloys are subject to self-loading effect caused by wedging of corrosion products in cracks. Effect causes cracks to continue to grow, even at very-low externally applied loads.

  15. Application of accelerator mass spectrometry in aluminum metabolism studies

    International Nuclear Information System (INIS)

    Meirav, O.; Vetterli, D.; Johnson, R.R.; Sutton, R.A.L.; Walker, V.R.; Halabe, A.; Fink, D.; Middleton, R.; Klein, J.

    1990-06-01

    The recent recognition that aluminum causes toxicity in uremic patients and may be associated with Alzheimer's disease has stimulated many studies of its biochemical effects. However, such studies were hampered by the lack of a suitable tracer. In a novel experiment, we have applied the new technique of accelerator mass spectrometry to investigate aluminum kinetics in rats, using as a marker the long-lived isotope 26 Al. We present the first aluminum kinetic model for a biological system. The results clearly demonstrate the advantage this technique holds for isotope tracer studies in animals as well as humans. (Author) (24 refs., 3 figs.)

  16. New Process for Grain Refinement of Aluminum. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Joseph A. Megy

    2000-09-22

    A new method of grain refining aluminum involving in-situ formation of boride nuclei in molten aluminum just prior to casting has been developed in the subject DOE program over the last thirty months by a team consisting of JDC, Inc., Alcoa Technical Center, GRAS, Inc., Touchstone Labs, and GKS Engineering Services. The Manufacturing process to make boron trichloride for grain refining is much simpler than preparing conventional grain refiners, with attendant environmental, capital, and energy savings. The manufacture of boride grain refining nuclei using the fy-Gem process avoids clusters, salt and oxide inclusions that cause quality problems in aluminum today.

  17. Structure/property relations of aluminum under varying rates and stress states

    Energy Technology Data Exchange (ETDEWEB)

    Tucker, Matthew T [Los Alamos National Laboratory; Horstemeyer, Mark F [MISSISSIPPI STATE UNIV; Whittington, Wilburn R [MISSISSIPPI STATE UNIV; Solanki, Kiran N [MISSISSIPPI STATE UNIV.

    2010-11-19

    In this work we analyze the plasticity, damage, and fracture characteristics of three different processed aluminum alloys (rolled 5083-H13, cast A356-T6, and extruded 6061-T6) under varying stress states (tension, compression, and torsion) and strain rates (0.001/, 1/s., and 1000/s). The stress state difference had more of a flow stress effect than the applied strain rates for those given in this study (0.001/sec up to 1000/sec). The stress state and strain rate also had a profound effect on the damage evolution of each aluminum alloy. Tension and torsional straining gave much greater damage nucleation rates than compression. Although the damage of all three alloys was found to be void nucleation dominated, the A356-T6 and 5083-H131 aluminum alloys incurred void damage via micron scale particles where the 6061-T6 aluminum alloy incurred void damage from two scales, micron-scale particles and nanoscale precipitates. Having two length scales of particles that participated in the damage evolution made the 6061-T6 incur a strain rate sensitive damage rate that was different than the other two aluminum alloys. Under tension, as the strain rate increased, the 6061-T6 aluminum alloy's void nucleation rate decreased, but the A356-T6 and 5083-H131 aluminum alloys void nucleation rate increased.

  18. Al/sub 2/S/sub 3/ preparation and use in electrolysis process for aluminum production

    Science.gov (United States)

    Hsu, C.C.; Loutfy, R.O.; Yao, N.P.

    A continuous process for producing aluminum sulfide and for electrolyzing the aluminum sulfide to form metallic aluminum in which the aluminum sulfide is produced from aluminum oxide and COS or CS/sub 2/ in the presence of a chloride melt which also serves as the electrolysis bath. Circulation between the reactor and electrolysis cell is carried out to maintain the desired concentration of aluminum sulfide in the bath.

  19. Diffusionless bonding of aluminum to Zircaloy-2

    International Nuclear Information System (INIS)

    Watson, R.D.

    1965-04-01

    Aluminum can be bonded to zirconium without difficulty even when a thin layer of oxide is present on the surface of the zirconium . No detectable diffusion takes place during the bonding process. The bond layer can be stretched as much. as 8% without affecting the bond. The bond can be heated for 1000 hours at 260 o C (500 o F), and can be water quenched from 260 o C (500 o F) without any noticeable change in the bond strength. An extrusion technique has been devised for making transition sections of aluminum bonded to zirconium which can then be used to join these metals by conventional welding. Welding can be done close to the bond zone without seriously affecting the integrity of the bond. This method of bonding aluminum to Zircaloy-2 is covered by Canadian patent 702,438 January 26, 1965. (author)

  20. Advances in the electrodeposition of aluminum from ionic liquid based electrolytes

    Science.gov (United States)

    Leadbetter, Kirt C.

    Aluminum plating is of considerable technical and economic interest because it provides an eco-friendly substitute for cadmium coatings used on many military systems. However, cadmium has been determined to be a significant environmental safety and occupational health (ESOH) hazard because of its toxicity and carcinogenic nature. Furthermore, the cost of treating and disposing of generated wastes, which often contain cyanide, is costly and is becoming prohibitive in the face of increasingly stringent regulatory standards. The non-toxic alternative aluminum is equivalent or superior in performance to cadmium. In addition, it could serve to provide an alternative to hexavalent chromium coatings used on military systems for similar reasons to that of cadmium. Aluminum is a beneficial alternative in that it demonstrates self-healing corrosion resistance in the form of a tightly-bound, impervious oxide layer. A successfully plated layer would be serviceable over a wider temperature range, 925 °F for aluminum compared to 450 oF for cadmium. In addition, an aluminum layer can be anodized to make it non-conducting and colorable. In consideration of the plating process, aluminum cannot be deposited from aqueous solutions because of its reduction potential. Therefore, nonaqueous electrolytes are required for deposition. Currently, aluminum can be electrodeposited in nonaqueous processes that use hazardous chemicals such as toluene and pyrophoric aluminum alkyls. Electrodeposition from ionic liquids provides the potential for a safer method that could be easily scaled up for industrial application. The plating process could be performed at a lower temperature and higher current density than other commercially available aluminum electrodeposition processes; thus a reduced process cost could be possible. The current ionic liquid based electrolytes are more expensive; however production on a larger scale and a long electrolyte lifetime are associated with a reduction in price

  1. Preparation of Aluminum Nanomesh Thin Films from an Anodic Aluminum Oxide Template as Transparent Conductive Electrodes

    Science.gov (United States)

    Li, Yiwen; Chen, Yulong; Qiu, Mingxia; Yu, Hongyu; Zhang, Xinhai; Sun, Xiao Wei; Chen, Rui

    2016-02-01

    We have employed anodic aluminum oxide as a template to prepare ultrathin, transparent, and conducting Al films with a unique nanomesh structure for transparent conductive electrodes. The anodic aluminum oxide template is obtained through direct anodization of a sputtered Al layer on a glass substrate, and subsequent wet etching creates the nanomesh metallic film. The optical and conductive properties are greatly influenced by experimental conditions. By tuning the anodizing time, transparent electrodes with appropriate optical transmittance and sheet resistance have been obtained. The results demonstrate that our proposed strategy can serve as a potential method to fabricate low-cost TCEs to replace conventional indium tin oxide materials.

  2. A Rare but Potentially Fatal Poisoning; Aluminum Phosphide Poisoning

    Directory of Open Access Journals (Sweden)

    Orkun Tolunay

    2017-04-01

    Full Text Available Phosphide, a very toxic gas, is used in our country as aluminium phosphide tablets impregnated in clay. It is widely used since it has a very high diffusion capacity, whereby it can eradicate all living creatures in any form of their life cycle and does not leave any remnants in agricultural products. Aluminum phosphide poisoning is among intoxications for which there are still no true antidotes. Mortality rate varies between 30% and 100%. This paper presents a case of aluminum phosphide poisoning caused by the uncompleted suicide attempt. A 14-year-old girl, who swallowed aluminum phosphate tablets, was brought to the emergency department with the complaints of nausea and vomiting. The patient was treated with gastric lavage and activated charcoal. Since the patient ingested a lethal amount of aluminum phosphide, she was referred to the pediatric intensive care unit. The patient was discharged in stable condition after supportive care and monitoring. Specific antidotes are life-saving in poisonings. However, this case was presented to show how general treatment principles and quick access to health services affect the result of treatment. Also, we aimed to highlight the uncontrolled selling of aluminum phosphate, which results in high mortality rates in case of poisoning.

  3. System dynamics analysis of strategies to reduce energy use in aluminum-intensive sectors

    Energy Technology Data Exchange (ETDEWEB)

    Hanes, Rebecca J.; Nicholson, Scott; 25-29 June 2017, Carpenter, Alberta

    2017-07-13

    Aluminum is one of the most widely used materials in industry, with applications in buildings, vehicles, aircraft, and consumer products. Its ubiquity is also on the rise: aluminum is beginning to supplant steel in lightweight vehicles and aircraft, and is used in many green or LEED-certified buildings. Although aluminum tends to be highly recycled, particularly by manufacturers of aluminum products, the sector as a whole is still far from a closed system. As a result, the increase in aluminum consumption also means an increase in primary aluminum production-an energy-intensive process-and an increase in consumption of the raw material bauxite, which in the U.S. is almost entirely imported. Our objectives for this study are to identify and analyze aluminum sector technologies and practices that reduce the energy required to manufacture aluminum products and reduce U.S. dependence on imported aluminum and bauxite. To accomplish these objectives, we will develop a system dynamics (SD) model of aluminum production, use and recycling in key application areas, including aerospace, ground vehicles and consumer products. The model will cover the entire aluminum supply chain as it exists in the U.S., from bauxite importing and refining, to the manufacture of products, to the product use phase and end-of-life processing steps. Aluminum flows throughout the model will be determined by the annual domestic demand for each application area as well as demand projections that extend to 2030. Energy consumption will be tracked based on the flows of aluminum through each step of the supply chain. Using the SD model, we will evaluate several technologies and practices that have the potential to reduce energy consumption and reliance on imported bauxite. These include implementation of advanced primary aluminum production technologies, increased recycling within and between application areas, increased material efficiency and increased product lifetimes. Each of these strategies

  4. The Solubility of Aluminum in Cryolite-Based Electrolyte-Containing KF

    Science.gov (United States)

    Zhang, Yu; Yu, Jiangyu; Gao, Bingliang; Liu, Yibai; Hu, Xianwei; Shi, Zhongning; Wang, Zhaowen

    2016-04-01

    The solubility of aluminum in NaF-AlF3-CaF2-KF-A12O3 electrolyte system at 1253 K (980 °C) has been measured by the analysis of quenched samples saturated with aluminum. The content of the dissolved metal in the quenched melt was determined by collecting the volume of hydrogen gas when a finely crushed sample is treated with HCl. Addition of 0 to 5 pct KF has no obvious effect on the solubility of aluminum in cryolite-based melts with molar ratio of NaF/AlF3 (cryolite ratio) ranging from 2.2 to 3.0. The solubility of aluminum increases from 0.015 to 0.026 wt pct with cryolite ratio increases from 2.2 to 4.0 in the NaF-AlF3-5 wt pct CaF2-3 wt pct A12O3 electrolyte at 1253 K (980 °C). Aluminum solubility was affected by both chemical replacement reaction of Al + 3NaF = AlF3 + 3Na and physical dissolution.

  5. Room Temperature Anodization of Aluminum at Low Voltage

    International Nuclear Information System (INIS)

    Kamal, A.; Abdel-Karim, R.; El-Raghy, S.; EL-Sherif, R.M.; Wheed, A.

    2013-01-01

    Membranes with nanometer-scale features have many applications, such as in optics, electronics, catalysis, selective molecule separation, filtration and purification, bio sensing, and single-molecule detection. Anodization process was conducted using 15, 20, 30 and 35% by volume phosphoric acid. Results showed that Porous Anodized Aluminum (PAA) with ideal nano pore arrays can be fabricated at room temperature by one-step anodization on high purity aluminum foil at 5 V. Morphology of the PAA was characterized by scanning electron microscopy (SEM). The electrochemical behavior of anodized aluminum was studied in 0.1 M Na 2 SO 4 solutions using electrochemical impedance spectroscopy (EIS). The highest resistance of the porous layer (R p ) was detected for the samples anodized in 20% phosphoric acid

  6. Microstructure, Friction and Wear of Aluminum Matrix Composites

    Science.gov (United States)

    Florea, R. M.

    2018-06-01

    MMCs are made by dispersing a reinforcing material into a metal matrix. They are prepared by casting, although several technical challenges exist with casting technology. Achieving a homogeneous distribution of reinforcement within the matrix is one such challenge, and this affects directly on the properties and quality of composite. The aluminum alloy composite materials consist of high strength, high stiffness, more thermal stability, more corrosion and wear resistance, and more fatigue life. Aluminum alloy materials found to be the best alternative with its unique capacity of designing the materials to give required properties. In this work a composite is developed by adding silicon carbide in Aluminum metal matrix by mass ratio 5%, 10% and 15%. Mechanical tests such as hardness test and microstructure test are conducted.

  7. Polarization properties of real aluminum mirrors; I. Influence of the aluminum oxide layer

    NARCIS (Netherlands)

    van Harten, G.; Snik, F.; Keller, C.U.

    2009-01-01

    In polarimetry, it is important to characterize the polarization properties of the instrument itself to disentangle real astrophysical signals from instrumental effects. This article deals with the accurate measurement and modeling of the polarization properties of real aluminum mirrors, as used in

  8. Aluminum concentration in hydrangeas

    International Nuclear Information System (INIS)

    Yanagawa, M.; Haruyama, Y.; Saito, M.

    2008-01-01

    We have been trying to measure concentration of aluminum in Ajisai, Hydrangea macrophylla for these days. But due to bad luck, we have encountered detector trouble for two years in a low. Thus, we have few data to analyze and obtained quite limited results. (author)

  9. Radioactivity of long-lived nuclides in the primary circuit of the reactor BOR-60 during operation with defective fuel elements

    International Nuclear Information System (INIS)

    Gryazev, V.M.; Kizin, V.D.; Lisitsyn, E.S.; Polyakov, V.I.; Chechetkin, Y.V.

    1978-06-01

    The summarized results of measurements of the enrichment and distribution of radioactive nuclides from corrosion and of fission products during the four years of operation of BOR-60, including a longer period of operation with detective fuel elements in the core, are presented. It is shown that for operation with approximately 1% leaking fuel rods radiation exposure becomes worse manily because of release and enrichment of cesium isotopes in the coolant. Of the other fission products, the largest contribution to the dose rate in pipework and components is given by 140 Ba / 140 La and 95 Nb. On operation with 0.1 to 0.2% of leaking fuel rods, this contribution is comparable to that of the corrosion products 60 Co and 54 Mn. The radioactivity of corrosion products in the circuit has not increased within the last three years and was about one order of magnitude lower than the theoretical values. The corrosion and fission products are nonuniformly distributed over the circuit. Concentration of 95 Nb and 60 Co in the pipe for 'cold' sodium is larger by a factor of 2 - 5 and of 140 Ba and 54 Mn by a factor of 10-20 than in the pipes for 'hot' sodium. Most of the cobalt was found to deposit in the heat exchanges. The effectiveness of emptying the pipes from coolant in order to reduce the dose sate is assessed. (orig.) [de

  10. Spectral studies on the interaction of acetylacetone with aluminum-containing MCM-41 mesoporous materials

    International Nuclear Information System (INIS)

    Zanjanchi, M.A.; Vaziri, M.

    2008-01-01

    Diffuse reflectance spectroscopy (DRS) was used to study the interaction of acetylacetone (acac) with the mesoporous aluminum-containing MCM-41 materials. A room temperature synthesis method was used for preparation of purely siliceous MCM-41 and for aluminum-containing MCM-41 materials. Samples with Si/Al ratios of 50, 20, 10 and 5 were synthesized. The synthesized mesoporous materials possess highly ordered structure and high surface area as evidenced from X-ray diffraction and nitrogen physisorption measurements, respectively. The treatment of the as-synthesized aluminum-containing MCM-41 samples with acac shows a distinct band at ∼290 nm. This band is assigned to six coordinated aluminum atoms in the structure which is produced by diffusion of acac molecules through surfactant micelles and their interaction with aluminum atoms. The 290-nm band disappears upon several successive washing of the sample with ethanol. The treatment of the calcined aluminum-containing MCM-41 sample with acac produces the same 290-nm band where its intensity increases with the aluminum content of the sample. The intensity of this band is reduced upon successive ethanol washing, but remains nearly constant after three times washing. This irremovable aluminum species can be assigned to framework aluminum. The measured acidity for our aluminum-containing MCM-41 samples correlates linearly with the intensity of 290-nm band for the ethanol treated samples. This supports the idea that the Bronsted acidity in aluminum-modified MCM-41 samples is a function of the amount of tetrahedral framework aluminum in the structure

  11. Aluminum metal combustion in water revealed by high-speed microphotography

    Science.gov (United States)

    Tao, William C.; Frank, Alan M.; Clements, Rochelle E.; Shepherd, Joseph E.

    1991-01-01

    In high explosives designed for air blast cratering fragmentation and underwater applications metallic additives chemically react with the oxidizer and are used to tailor the rate of energy delivery by the expansion medium. Although the specific mechanism for sustained metal combustion in the dense detonation medium remains in question it is generally accepted that the fragmentation of the molten particle and disruption of its oxide layer are a necessity. In this study we use high speed microphotography to examine the ignition and combustion of small 25-76 jim diameter and 23 mm long aluminum wires rapidly heated by a capacitor discharge system in water. Streak and framing photographs detailing the combustion phenomenon and the fragmentation of the molten aluminum were obtained over periods of 100 nsec - 100 j. tsec with a spatial resolution of 2 . im. The wire temperature was determined as a function of time by integrating the circuit equation together with the energy equation for an adiabatic wire and incorporating known aluminum electrical resistivity and temperature functions of energy density in the integration. In order for the aluminum to sustain a rapid chemical reaction with the water we found that the wire temperature has to be raised above the melting temperature of aluminum oxide. The triggering mechanism for this rapid reaction appears to be the fragmentation of the molten aluminum from the collapse of a vapor blanket about

  12. Reversible post-breakdown conduction in aluminum oxide-polymer capacitors

    NARCIS (Netherlands)

    Chen, Qian; Gomes, H.L.; Rocha, P.R.F.; Leeuw, de D.M.; Meskers, S.C.J.

    2013-01-01

    Aluminum/Al2O3/polymer/metal capacitors submitted to a low-power constant current stress undergo dielectric breakdown. The post-breakdown conduction is metastable, and over time the capacitors recover their original insulating properties. The decay of the conduction with time follows a power law

  13. The use of aluminum nitride to improve Aluminum-26 Accelerator Mass Spectrometry measurements and production of Radioactive Ion Beams

    Science.gov (United States)

    Janzen, Meghan S.; Galindo-Uribarri, Alfredo; Liu, Yuan; Mills, Gerald D.; Romero-Romero, Elisa; Stracener, Daniel W.

    2015-10-01

    We present results and discuss the use of aluminum nitride as a promising source material for Accelerator Mass Spectrometry (AMS) and Radioactive Ion Beams (RIBs) science applications of 26Al isotopes. The measurement of 26Al in geological samples by AMS is typically conducted on Al2O3 targets. However, Al2O3 is not an ideal source material because it does not form a prolific beam of Al- required for measuring low-levels of 26Al. Multiple samples of aluminum oxide (Al2O3), aluminum nitride (AlN), mixed Al2O3-AlN as well as aluminum fluoride (AlF3) were tested and compared using the ion source test facility and the stable ion beam (SIB) injector platform at the 25-MV tandem electrostatic accelerator at Oak Ridge National Laboratory. Negative ion currents of atomic and molecular aluminum were examined for each source material. It was found that pure AlN targets produced substantially higher beam currents than the other materials and that there was some dependence on the exposure of AlN to air. The applicability of using AlN as a source material for geological samples was explored by preparing quartz samples as Al2O3 and converting them to AlN using a carbothermal reduction technique, which involved reducing the Al2O3 with graphite powder at 1600 °C within a nitrogen atmosphere. The quartz material was successfully converted to AlN. Thus far, AlN proves to be a promising source material and could lead towards increasing the sensitivity of low-level 26Al AMS measurements. The potential of using AlN as a source material for nuclear physics is also very promising by placing 26AlN directly into a source to produce more intense radioactive beams of 26Al.

  14. A study on assessment of bone mass from aluminum-equivalent image by digital imaging system

    International Nuclear Information System (INIS)

    Kim, Jin Soo; Kim, Jae Duck; Choi, Eui Hwan

    1997-01-01

    The purpose of this study was to evaluated the method for quantitative assessment of bone mass from aluminum-equivalent value of hydroxyapatite by using digital imaging system consisted of Power Macintosh 7200/120, 15-inch color monitor, and GT-9000 scanner with transparency unit. After aluminum-equivalent image made from correlation between aluminum thickness and grey scale, the accuracy of conversion to mass from aluminum-equivalent value was evaluated. Measured bone mass was compared with converted bone mass from aluminum-equivalent value of hydroxyapatite block by correlation formula between aluminum-equivalent value of hydroxy apatite block and hydroxyapatite mass. The results of this study were as follows : 1. Correlation between aluminum thickness and grey level for obtaining aluminum-equivalent image was high positively associated (r2=0.99). Converted masses from aluminum-equivalent value were very similar to measured masses. There was, statistically, no significant difference (P<0.05) between them. 2. Correlation between hydroxyapatite aluminum-equivalent and hydroxyapatite mass was shown to linear relation (r2 =0.95). 3. Converted masses from aluminum-equivalent value of 3 dry mandible segments were similar to measured masses. The difference between the exposure directions was not significantly different (P<0.05).

  15. Mechanical properties of friction stir welded aluminum alloys 5083 and 5383

    Directory of Open Access Journals (Sweden)

    Jeom Kee Paik

    2009-09-01

    Full Text Available The use of high-strength aluminum alloys is increasing in shipbuilding industry, particularly for the design and construction of war ships, littoral surface craft and combat ships, and fast passenger ships. While various welding methods are used today to fabricate aluminum ship structures, namely gas metallic arc welding (GMAW, laser welding and friction stir welding (FSW, FSW technology has been recognized to have many advantages for the construction of aluminum structures, as it is a low-cost welding process. In the present study, mechanical properties of friction stir welded aluminum alloys are examined experimentally. Tensile testing is undertaken on dog-bone type test specimen for aluminum alloys 5083 and 5383. The test specimen includes friction stir welded material between identical alloys and also dissimilar alloys, as well as unwelded (base alloys. Mechanical properties of fusion welded aluminum alloys are also tested and compared with those of friction stir welded alloys. The insights developed from the present study are documented together with details of the test database. Part of the present study was obtained from the Ship Structure Committee project SR-1454 (Paik, 2009, jointly funded by its member agencies.

  16. Polyserositis: An Unusual Complication of Aluminum Phosphide Poisoning

    Directory of Open Access Journals (Sweden)

    Ashish Bhalla

    2012-12-01

    Full Text Available   Background: Aluminum phosphide is the common cause of poisoning in adults in India, with a very high case fatality ratio. We studied five patients of aluminum phosphide poisoning with polyserositis. Methods: We enrolled all patients with aluminum phosphide poisoning presenting to emergency medical department, at a tertiary care hospital in northwestern India from January to July 2006. These patients were managed according to a standard treatment protocol and their complications were recorded. Results: During the study period, total of 35 patients were admitted with 57.5% mortality in the first 12 hours. Among the rest, 5 patients were found to develop polyserositis. All these patients had severe hypotension at presentation and developed respiratory distress requiring mechanical ventilation after an average stay of 3.8 days post-ingestion. They were managed conservatively and four of them were discharged from the hospital after the average stay of 10 days. Conclusion: In this case series, features of polyserositis (pleural effusion, ascites and pericardial effusion were found in 15% patients of severe aluminum phosphide poisoning. We postulate systemic capillary leak syndrome, secondary to mitochondrial damage in the endothelium, as a possible mechanism.        

  17. Ion Flux in Roots of Chinese Fir (Cunninghamia lanceolata (Lamb.) Hook) under Aluminum Stress

    Science.gov (United States)

    Ma, Zhihui; Huang, Binlong; Xu, Shanshan; Chen, Yu; Cao, Guangqiu; Ding, Guochang; Lin, Sizu

    2016-01-01

    Chinese fir is a tall, fast-growing species that is unique to southern China. In Chinese fir plantations, successive plantings have led to a decline in soil fertility, and aluminum toxicity is thought to be one of the main reasons for this decline. In this study, Non-invasive Micro-test Technology was used to study the effect of aluminum stress on the absorption of 4 different ions in the roots of the Chinese fir clone FS01. The results are as follows: with increased aluminum concentration and longer periods of aluminum stress, the H+ ion flow gradually changed from influx into efflux; there was a large variation in the K+ efflux, which gradually decreased with increasing duration of aluminum stress; and 1 h of aluminum stress uniformly resulted in Ca2+ influx, but it changed from influx to efflux after a longer period of aluminum stress. Changes in the different concentrations of aluminum had the largest influence on Mg2+. PMID:27270726

  18. Scientific Background for Processing of Aluminum Waste

    Directory of Open Access Journals (Sweden)

    Kononchuk Olga

    2017-01-01

    of the aluminum waste A1- Zn-Cu-Si-Fe shows that depending on the content of the metal the dissolution process of an aluminum alloy should be treated as the result of the chemical interaction of the metal with an alkaline solution. It is necessary to consider the behavior of the main components of alloys in an alkaline solution as applied to the system Na2O - Al2O3 - SiO2 - CO2 - H2O.

  19. The effect of surface modification on initial ice formation on aluminum surfaces

    DEFF Research Database (Denmark)

    Rahimi, Maral; Afshari, Alireza; Fojan, Peter

    2015-01-01

    material of heat exchanger fins is aluminum, this paper focuses on the effect of aluminum wettability on the initial stages of ice formation. The ice growth was studied on bare as well as hydrophilically and hydrophobically modified surfaces of aluminum (8011A) sheets, commonly used in heat exchangers...

  20. Fabrication of high quality anodic aluminum oxide (AAO) on low purity aluminum—A comparative study with the AAO produced on high purity aluminum

    International Nuclear Information System (INIS)

    Michalska-Domańska, Marta; Norek, Małgorzata; Stępniowski, Wojciech J.; Budner, Bogusław

    2013-01-01

    Highlights: • Nanoporous alumina was fabricated by anodization in sulfuric acid solution with glycol. • The AAO manufacturing on low- and high-purity Al was compared. • The pores size was ranging between 30 and 50 nm. • No difference in the quality of the AAO fabricated on both Al types was observed. • The current vs. anodization time curves were recorded. -- Abstract: In this work the quality, arrangement, composition, and regularity of nanoporous AAO formed on the low-purity (AA1050) and high-purity aluminum during two-step anodization in a mixture of sulfuric acid solution (0.3 M), water and glycol (3:2, v/v), at various voltages (15, 20, 25, 30, 35 V) and at temperature of −1 °C, are investigated. The electrochemical conditions have allowed to obtain pores with the size ranging from 30 to 50 nm, which are much larger than those usually obtained by anodization in a pure sulfuric acid solution (<20 nm). The mechanism of the AAO growth is discussed. It was found that with the increase of applied anodizing voltage a number of incorporated sulfate ions in the aluminum oxide matrix increases, which was connected with the appearance of an unusual area in the current vs. time curves. On the surface of anodizing low- and high-purity aluminum, the formation of hillocks was observed, which was associated with the sulfate ions incorporation. The sulfate ions are replacing the oxygen atom/atoms in the AAO amorphous crystal structure and, consequently, the AAO template swells, the oxide cracks and uplifts causing the formation of hillocks. The same mechanism occurs for both low- and high-purity aluminum. Nanoporous AAO characterized by a very high regularity, not registered previously for low purity aluminum, was obtained. Furthermore, no significant difference in the regularity ratio between the AAO obtained on low- and high-purity aluminum, was observed. The electrochemical conditions applied in this study can be, thus, used for the fabrication of high quality

  1. Microstructures and properties of aluminum die casting alloys

    Energy Technology Data Exchange (ETDEWEB)

    M. M. Makhlouf; D. Apelian; L. Wang

    1998-10-01

    This document provides descriptions of the microstructure of different aluminum die casting alloys and to relate the various microstructures to the alloy chemistry. It relates the microstructures of the alloys to their main engineering properties such as ultimate tensile strength, yield strength, elongation, fatigue life, impact resistance, wear resistance, hardness, thermal conductivity and electrical conductivity. Finally, it serves as a reference source for aluminum die casting alloys.

  2. Viscosity of aluminum under shock-loading conditions

    International Nuclear Information System (INIS)

    Ma Xiao-Juan; Liu Fu-Sheng; Zhang Ming-Jian; Sun Yan-Yun

    2011-01-01

    A reliable data treatment method is critical for viscosity measurements using the disturbance amplitude damping method of shock waves. In this paper the finite difference method is used to obtain the numerical solutions for the disturbance amplitude damping behaviour of the sinusoidal shock front in a flyer-impact experiment. The disturbance amplitude damping curves are used to depict the numerical solutions of viscous flow. By fitting the experimental data to the numerical solutions of different viscosities, we find that the effective shear viscosity coefficients of shocked aluminum at pressures of 42, 78 and 101 GPa are (1500±100) Pa·s, (2800±100) Pa·s and (3500±100) Pa·s respectively. It is clear that the shear viscosity of aluminum increases with an increase in shock pressure, so aluminum does not melt below a shock pressure of 101 GPa. This conclusion is consistent with the sound velocity measurement. (interdisciplinary physics and related areas of science and technology)

  3. Analysis and Countermeasures of Wind Power Accommodation by Aluminum Electrolysis Pot-Lines in China

    Science.gov (United States)

    Zhang, Hongliang; Ran, Ling; He, Guixiong; Wang, Zhenyu; Li, Jie

    2017-10-01

    The unit energy consumption and its price have become the main obstacles for the future development of the aluminum electrolysis industry in China. Meanwhile, wind power is widely being abandoned because of its instability. In this study, a novel idea for wind power accommodation is proposed to achieve a win-win situation: the idea is for nearby aluminum electrolysis plants to absorb the wind power. The features of the wind power distribution and aluminum electrolysis industry are first summarized, and the concept of wind power accommodation by the aluminum industry is introduced. Then, based on the characteristics of aluminum reduction cells, the key problems, including the bus-bar status, thermal balance, and magnetohydrodynamics instabilities, are analyzed. In addition, a whole accommodation implementation plan for wind power by aluminum reduction is introduced to explain the theoretical value of accommodation, evaluation of the reduction cells, and the industrial experiment scheme. A numerical simulation of a typical scenario proves that there is large accommodation potential for the aluminum reduction cells. Aluminum electrolysis can accommodate wind power and remain stable under the proper technique and accommodation scheme, which will provide promising benefits for the aluminum plant and the wind energy plant.

  4. Exploration the extrudability of aluminum matrix composite (LM6/TIC ...

    African Journals Online (AJOL)

    Aluminum matrix composites (LM6/TiC) is a mix of excellent properties of aluminum ... ABAQUS/CAE software has been successfully employed for Modeling and ... Experimental results show that, many mechanical properties are improved and ...

  5. Application of accelerator mass spectrometry in aluminum metabolism studies

    Energy Technology Data Exchange (ETDEWEB)

    Meirav, O; Vetterli, D; Johnson, R R [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics; Sutton, R A.L.; Walker, V R; Halabe, A [British Columbia U.iv., Vancouver, BC (Canada). Dept. of Medicine; Fink, D; Middleton, R; Klein, J [Pennsylvania Univ., Philadelphia, PA (United States). Dept. of Physics

    1990-06-01

    The recent recognition that aluminum causes toxicity in uremic patients and may be associated with Alzheimer`s disease has stimulated many studies of its biochemical effects. However, such studies were hampered by the lack of a suitable tracer. In a novel experiment, we have applied the new technique of accelerator mass spectrometry to investigate aluminum kinetics in rats, using as a marker the long-lived isotope {sup 26}Al. We present the first aluminum kinetic model for a biological system. The results clearly demonstrate the advantage this technique holds for isotope tracer studies in animals as well as humans. (Author) (24 refs., 3 figs.).

  6. Melting, growth, and faceting of lead precipitates in aluminum

    DEFF Research Database (Denmark)

    Gråbæk, L.; Bohr, J.; Andersen, H.H.

    1992-01-01

    Aluminum single crystals cut in the direction were implanted with 2 x 10(20) m-2 Pb+ ions at 75 or 150 keV. The implanted insoluble lead precipitated as epitaxially oriented crystallites in the aluminum matrix. The precipitates were studied by x-ray diffraction at Riso, DESY, and Brookhaven...

  7. Investigation of aluminum content of imported candies and snack foods in Taiwan

    Directory of Open Access Journals (Sweden)

    Tai Sheng Yeh

    2016-10-01

    Full Text Available Candies, chewing gums, dried fruits, jellies, chocolate, and shredded squid pieces imported from 17 countries were surveyed for their aluminum content. The samples were bought from candy shops, supermarkets, and convenience stores, and through online shopping. Sample selection focused on imported candies and snacks. A total of 67 samples, including five chewing gums, seven dried fruits, 13 chocolates, two jellies, two dried squid pieces, and 38 candies, were analyzed. The content of aluminum was analyzed by inductively coupled plasma optical emission spectrometry (ICP OES. The limit of quantitation for aluminum was 1.53 mg/kg. The content of aluminum ranged from not detected (ND to 828.9 mg/kg. The mean concentrations of aluminum in chewing gums, dried fruits, chocolate, jellies, dried squid pieces, and candies were 36.62 mg/kg, 300.06 mg/kg, 9.1 mg/kg, 2.3 mg/kg, 7.8 mg/kg, and 24.26 mg/kg, respectively. Some samples had relatively high aluminum content. The highest aluminum content of 828.9 mg/kg was found in dried papaya threads imported from Thailand. Candies imported from Thailand and Vietnam had aluminum contents of 265.7 mg/kg and 333.1 mg/kg, respectively. Exposure risk assessment based on data from the Taiwan National Food Consumption Database was employed to calculate the percent provisional tolerable weekly intake (%PTWI. The percent provisional tolerable weekly intake of aluminum for adults (19–50 years and children (3–6 years based on the consumption rate of the total population showed that candies and snacks did not contribute greatly to aluminum exposure. By contrast, in the exposure assessment based on the consumers-only consumption rate, the estimated values of weekly exposure to aluminum from dried papaya threads in adults (19–50 years and children (3–6 years were 4.18 mg/kg body weight (bw/wk and 7.93 mg/kg bw/wk, respectively, for 50th percentile consumers, and 6.26 mg/kg bw/wk and 12.88 mg/kg bw

  8. The aluminum smelting process and innovative alternative technologies.

    Science.gov (United States)

    Kvande, Halvor; Drabløs, Per Arne

    2014-05-01

    The industrial aluminum production process is addressed. The purpose is to give a short but comprehensive description of the electrolysis cell technology, the raw materials used, and the health and safety relevance of the process. This article is based on a study of the extensive chemical and medical literature on primary aluminum production. At present, there are two main technological challenges for the process--to reduce energy consumption and to mitigate greenhouse gas emissions. A future step may be carbon dioxide gas capture and sequestration related to the electric power generation from fossil sources. Workers' health and safety have now become an integrated part of the aluminum business. Work-related injuries and illnesses are preventable, and the ultimate goal to eliminate accidents with lost-time injuries may hopefully be approached in the future.

  9. A study of tensile test on open-cell aluminum foam sandwich

    Science.gov (United States)

    Ibrahim, N. A.; Hazza, M. H. F. Al; Adesta, E. Y. T.; Abdullah Sidek, Atiah Bt.; Endut, N. A.

    2018-01-01

    Aluminum foam sandwich (AFS) panels are one of the growing materials in the various industries because of its lightweight behavior. AFS also known for having excellent stiffness to weight ratio and high-energy absorption. Due to their advantages, many researchers’ shows an interest in aluminum foam material for expanding the use of foam structure. However, there is still a gap need to be fill in order to develop reliable data on mechanical behavior of AFS with different parameters and analysis method approach. Least of researcher focusing on open-cell aluminum foam and statistical analysis. Thus, this research conducted by using open-cell aluminum foam core grade 6101 with aluminum sheets skin tested under tension. The data is analyzed using full factorial in JMP statistical analysis software (version 11). ANOVA result show a significant value of the model which less than 0.500. While scatter diagram and 3D plot surface profiler found that skins thickness gives a significant impact to stress/strain value compared to core thickness.

  10. Passivation and Stabilization of Aluminum Nanoparticles for Energetic Materials

    Directory of Open Access Journals (Sweden)

    Matthew Flannery

    2015-01-01

    Full Text Available In aircraft applications, fuel is used not only as a propellant but also as a coolant and improving both the thermal conductivity and combustion enthalpy of the fuel is beneficial in these applications. These properties can be enhanced by dispersing aluminum nanoparticles into the fuel; however, the nanoparticles require stabilization from agglomeration and passivation from oxidation in order for these benefits to be realized in aircraft applications. To provide this passivation and stabilization, aluminum nanoparticles were encapsulated with a coating by the plasma enhanced chemical vapor deposition (PE-CVD method from toluene precursors. The thermal conductivity, combustion and ignition properties, and stability of the nanoparticles dispersed in RP-2 fuel were subsequently evaluated. In addition, the effect of dispersing aluminum nanoparticles in RP-2 fuel on the erosion rate of fuel nozzles was evaluated. The dispersion of PE-CVD coated aluminum nanoparticles at a concentration of 3.0% by volume exhibited a 17.7% and 0.9% increase in thermal conductivity and volumetric enthalpy of combustion, respectively, compared to the baseline RP-2 fuel. Additionally, particle size analysis (PSA of the PE-CVD coated aluminum nanofuel exhibited retention of particle size over a five-month storage period and erosion testing of a 1 mm stainless steel nozzle exhibited a negligible 1% change in discharge coefficient after 100 hours of testing.

  11. Aluminum Corrosion and Turbidity

    International Nuclear Information System (INIS)

    Longtin, F.B.

    2003-01-01

    Aluminum corrosion and turbidity formation in reactors correlate with fuel sheath temperature. To further substantiate this correlation, discharged fuel elements from R-3, P-2 and K-2 cycles were examined for extent of corrosion and evidence of breaking off of the oxide film. This report discusses this study

  12. Validity of the Aluminum Equivalent Approximation in Space Radiation Shielding

    Science.gov (United States)

    Badavi, Francis F.; Adams, Daniel O.; Wilson, John W.

    2009-01-01

    The origin of the aluminum equivalent shield approximation in space radiation analysis can be traced back to its roots in the early years of the NASA space programs (Mercury, Gemini and Apollo) wherein the primary radiobiological concern was the intense sources of ionizing radiation causing short term effects which was thought to jeopardize the safety of the crew and hence the mission. Herein, it is shown that the aluminum equivalent shield approximation, although reasonably well suited for that time period and to the application for which it was developed, is of questionable usefulness to the radiobiological concerns of routine space operations of the 21 st century which will include long stays onboard the International Space Station (ISS) and perhaps the moon. This is especially true for a risk based protection system, as appears imminent for deep space exploration where the long-term effects of Galactic Cosmic Ray (GCR) exposure is of primary concern. The present analysis demonstrates that sufficiently large errors in the interior particle environment of a spacecraft result from the use of the aluminum equivalent approximation, and such approximations should be avoided in future astronaut risk estimates. In this study, the aluminum equivalent approximation is evaluated as a means for estimating the particle environment within a spacecraft structure induced by the GCR radiation field. For comparison, the two extremes of the GCR environment, the 1977 solar minimum and the 2001 solar maximum, are considered. These environments are coupled to the Langley Research Center (LaRC) deterministic ionized particle transport code High charge (Z) and Energy TRaNsport (HZETRN), which propagates the GCR spectra for elements with charges (Z) in the range I aluminum equivalent approximation for a good polymeric shield material such as genetic polyethylene (PE). The shield thickness is represented by a 25 g/cm spherical shell. Although one could imagine the progression to greater

  13. Weld Development for Aluminum Fission Chamber

    Energy Technology Data Exchange (ETDEWEB)

    Cross, Carl Edward [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Martinez, Jesse Norris [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-05-16

    The Sigma welding team was approached to help fabricate a small fission chamber (roughly ½ inch dia. x ½ inch tall cylinder). These chambers are used as radiation sensors that contain small traces of radionuclides (Cf 252, U 235, and U 238) that serve to ionize gas atoms in addition to external radiation. When a voltage is applied within the chamber, the resulting ion flow can be calibrated and monitored. Aluminum has the advantage of not forming radioactive compounds when exposed to high external radiation (except from minor Na alloy content). Since aluminum has not been used before in this application, this presented an unexplored challenge.

  14. Aluminum and Phthalates in Calcium Gluconate: Contribution From Glass and Plastic Packaging.

    Science.gov (United States)

    Yokel, Robert A; Unrine, Jason M

    2017-01-01

    Aluminum contamination of parenteral nutrition solutions has been documented for 3 decades. It can result in elevated blood, bone, and whole body aluminum levels associated with neurotoxicity, reduced bone mass and mineral content, and perhaps hepatotoxicity. The primary aluminum source among parenteral nutrition components is glass-packaged calcium gluconate, in which aluminum concentration in the past 3 decades has averaged approximately 4000 μg/L, compared with nutrition solutions; 2 packaged in glass (from France and the United States) and 1 in plastic (from Germany); in a recently released plastic-packaged solution (from the United States); and in the 2 glass containers. Phthalate concentration was determined in selected samples of each product and leachate of the plastic containers. The initial aluminum concentration was approximately 5000 μg/L in the 2 glass-packaged products and approximately 20 μg/L in the plastic-packaged product, and increased approximately 30%, 50%, and 100% in 2 years, respectively. The aluminum concentration in a recently released Calcium Gluconate Injection USP was approximately 320 μg/L. Phthalates were not detected in any calcium gluconate solutions or leachates. Plastic packaging greatly reduces the contribution of aluminum to parenteral nutrition solutions from calcium gluconate compared with the glass-packaged product.

  15. Evaluation of water chemistry on the pitting susceptibility of aluminum

    International Nuclear Information System (INIS)

    Chandler, G.T.; Sindelar, R.L.; Lam, P.S.

    1997-01-01

    Aluminum-clad spent nuclear fuels are being stored in water in the Receiving Basin for Off-site Fuels (RBOF) and the reactor disassembly (cooling) basins at the Savannah River Site (SRS). Experience shows that fuels stored in water are subject to rapid pitting corrosion if the water quality is poor. Upgrade projects and actions, including those to improve water quality, were recently undertaken to upgrade the disassembly basins for extended storage. A technical strategy was developed for continued basin storage of aluminum-clad fuel assemblies. The strategy includes development and implementation of basin technical standards for water quality to minimize attack due to pitting corrosion over a desired storage period. In the absence of localized corrosion, only slow, general corrosion of the cladding would be expected. A laboratory corrosion program is being performed to provide the bases for technical standards by identifying the region of aggressive water qualities where existing oxide films would tend to break down and pits would initiate and remain active. Initial results from corrosion potential and cyclic polarization testing of aluminum alloys in various water chemistries have shown that low conductivity water (< 50 μS/cm) should not be aggressive to cause self-pitting corrosion. Initial results from tests of 8001 and 5052 aluminum and aluminium-10% uranium alloy indicate that a strong galvanic couple should not exist between the aluminum cladding materials and the aluminum-uranium fuel. Additional laboratory testing will include immersion testing to allow characterization of the growth rate of active pits to benchmark a kinetic model. This model will form the basis for a water quality technical standard and enable prediction of the life of aluminum-clad spent nuclear fuels in basin storage

  16. Corrosion resistance of aluminum-magnesium alloys in glacial acetic acid

    International Nuclear Information System (INIS)

    Zaitseva, L.V.; Romaniv, V.I.

    1984-01-01

    Vessels for the storage and conveyance of glacial acetic acid are produced from ADO and AD1 aluminum, which are distinguished by corrosion resistance, weldability and workability in the hot and cold conditions but have low tensile strength. Aluminum-magnesium alloys are stronger materials close in corrosion resistance to technical purity aluminum. An investigation was made of the basic alloying components on the corrosion resistance of these alloys in glacial acetic acid. Both the base metal and the weld joints were tested. With an increase in temperature the corrosion rate of all of the tested materials increases by tens of times. The metals with higher magnesium content show more pitting damage. The relationship of the corrosion resistance of the alloys to magnesium content is confirmed by the similar intensity of failure of the joint metal of all of the investigated alloys and by electrochemical investigations. The data shows that AMg3 alloy is close to technically pure ADO aluminum. However, the susceptibility of even this material to local corrosion eliminates the possibility of the use of aluminum-magnesium alloys as reliable constructional materials in glacial acetic acid

  17. A study of hydrogen permeation in aluminum alloy treated by various oxidation processes

    International Nuclear Information System (INIS)

    Song Wenhai; Long Bin

    1997-01-01

    A set of oxide coatings was formed on the surface of an Al alloy (wt%: Fe, 0.24; Si, 1.16; Cu, 0.05-0.2; Zn, 0.1; Al, residual) by means of various oxidation processes. The hydrogen permeability through the aluminum alloy and its coating materials was determined by a vapor phase permeation technique at temperatures ranging from 400 to 500 C using high-purity H 2 (99.9999%) gas with an upstream hydrogen pressure of 10 4 -10 5 Pa. The experimental results show that the hydrogen permeability through aluminum oxide coating is 100-2000 times lower than that through the aluminum alloy substrate. This means that the aluminum oxide is a significant hydrogen permeation barrier. A high hydrogen permeation resistance was observed in an oxide layer prefilmed in 200 C water, while an anodized aluminum oxide film had a less obstructive effect, possibly caused by the porous structure of the anodic oxide. The hydrogen permeability through films of aluminum oxide was not a simple function of the aluminum-oxide phase configuration. (orig.)

  18. Evaluation of microstructure of A356 aluminum alloy casting ...

    Indian Academy of Sciences (India)

    The objective of this investigation was to evaluate the effect of vibrations (during solidification) on the metallurgical properties of A356 aluminum casting. Mechanical vibrations were applied to A356 aluminum alloy through set up. A356 melt has been subjected to mechanical vibration with the frequency range from 0 to 400 ...

  19. An improved stress corrosion test medium for aluminum alloys

    Science.gov (United States)

    Humphries, T. S.; Coston, J. E.

    1981-01-01

    A laboratory test method that is only mildly corrosive to aluminum and discriminating for use in classifying the stress corrosion cracking resistance of aluminum alloys is presented along with the method used in evaluating the media selected for testing. The proposed medium is easier to prepare and less expensive than substitute ocean water.

  20. Heated Aluminum Tanks Resist Corrosion

    Science.gov (United States)

    Johnson, L. E.

    1983-01-01

    Simple expedient of heating foam-insulated aluminum alloy tanks prevents corrosion by salt-laden moisture. Relatively-small temperature difference between such tank and surrounding air will ensure life of tank is extended by many years.

  1. Salt-soda sinter process for recovering aluminum from fly ash

    Science.gov (United States)

    McDowell, W.J.; Seeley, F.G.

    A method for recovering aluminum values from fly ash comprises sintering the fly ash with a mixture of NaCl and Na/sub 2/CO/sub 3/ to a temperature in the range 700/sup 0/ to 900/sup 0/C for a period of time sufficient to convert greater than 90% of the aluminum content of the fly ash into an acidsoluble fraction and then contacting the thus-treated fraction with an aqueous solution of nitric or sulfuric acid to effect dissolution of aluminum and other metal values in said solution.

  2. Nano-TiO_2 coatings on aluminum surfaces by aerosol flame synthesis

    International Nuclear Information System (INIS)

    Liberini, Mariacira; De Falco, Gianluigi; Scherillo, Fabio; Astarita, Antonello; Commodo, Mario; Minutolo, Patrizia; D'Anna, Andrea; Squillace, Antonino

    2016-01-01

    Aluminum alloys are widely used in the aeronautic industry for their high mechanical properties; however, because they are very sensitive to corrosion, surface treatments are often required. TiO_2 has excellent resistance to oxidation and it is often used to improve the corrosion resistance of aluminum surfaces. Several coating procedures have been proposed over the years, which are in some cases expensive in terms of production time and amount of deposited material. Moreover, they can damage aluminum alloys if thermal treatments are required. In this paper, a one-step method for the coating of aluminum surfaces with titania nanoparticles is presented. Narrowly sized, TiO_2 nanoparticles are synthesized by flame aerosol and directly deposited by thermophoresis onto cold plates of aluminum AA2024. Submicron coatings of different thicknesses are obtained from two flame synthesis conditions by varying the total deposition time. A fuel-lean synthesis condition was used to produce 3.5 nm pure anatase nanoparticles, while a mixture of rutile and anatase nanoparticles having 22 nm diameter — rutile being the predominant phase —, was synthesized in a fuel-rich condition. Scanning electron microscopy is used to characterize morphology of titania films, while coating thickness is measured by confocal microscopy measurements. Electrochemical impedance spectroscopy is used to evaluate corrosion resistance of coated aluminum substrates. Results show an improvement of the electrochemical behavior of titania coated surfaces as compared to pristine aluminum surfaces. The best results are obtained by covering the substrates with 3.5 nm anatase-phase nanoparticles and with lower deposition times, that assure a uniform surface coating. - Highlights: • Nanosized TiO_2 particles produced by aerosol flame synthesis • Coatings of aluminum substrates with TiO_2 nanoparticles by thermophoretic deposition in flames • Thickness measurement by confocal microscopy • Improvement of

  3. Fatigue crack initiation in hybrid boron/glass/aluminum fiber metal laminates

    International Nuclear Information System (INIS)

    Chang, P.-Y.; Yeh, P.-C.; Yang, J.-M.

    2008-01-01

    The fatigue crack initiation behavior of a high modulus and hybrid boron/glass/aluminum fiber/metal laminate (FML) was investigated experimentally and analytically. Two types of hybrid boron/glass/aluminum FMLs were fabricated and studied, which consisted of aluminum alloy sheets as the metal layers and a mixture of boron fibers and glass fibers as the composite layers. For the first type, the boron fiber/prepreg and the glass fiber/prepreg were used separately in the composite layers, and for the second type, the boron fibers and the glass fibers were mingled together to form a hybrid boron/glass/prepreg composite layer. These hybrid FMLs were consolidated using an autoclave curing process. The incorporation of the boron fibers improved the Young's modulus of the composite layer in FMLs, which in turn, would improve the fatigue crack initiation life of the Al sheet. The experimental results clearly showed that the fatigue crack initiation lives for both types of hybrid boron/glass/aluminum FMLs were superior to the monolithic aluminum alloy under the same loading condition. An analytical approach was proposed to calculate the fatigue crack initiation lives of hybrid boron/glass/aluminum FMLs based on the classical laminate theory and the small-crack theory. A good correlation was obtained between the predictions and the experimental results

  4. Effect of Aluminum Purity on the Pore Formation of Porous Anodic Alumina

    International Nuclear Information System (INIS)

    Kim, Byeol; Lee, Jin Seok

    2014-01-01

    Anodic alumina oxide (AAO), a self-ordered hexagonal array, has various applications in nanofabrication such as the fabrication of nanotemplates and other nanostructures. In order to obtain highly ordered porous alumina membranes, a two-step anodization or prepatterning of aluminum are mainly conducted with straight electric field. Electric field is the main driving force for pore growth during anodization. However, impurities in aluminum can disturb the direction of the electric field. To confirm this, we anodized two different aluminum foil samples with high purity (99.999%) and relatively low purity (99.8%), and compared the differences in the surface morphologies of the respective aluminum oxide membranes produced in different electric fields. Branched pores observed in porous alumina surface which was anodized in low-purity aluminum and the size; dimensions of the pores were found to be usually smaller than those obtained from high-purity aluminum. Moreover, anodization at high voltage proceeds to a significant level of conversion because of the high speed of the directional electric field. Consequently, anodic alumina membrane of a specific morphology, i. e., meshed pore, was produced

  5. Effect of Aluminum Purity on the Pore Formation of Porous Anodic Alumina

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Byeol; Lee, Jin Seok [Sookmyung Women' s Univ., Seoul (Korea, Republic of)

    2014-02-15

    Anodic alumina oxide (AAO), a self-ordered hexagonal array, has various applications in nanofabrication such as the fabrication of nanotemplates and other nanostructures. In order to obtain highly ordered porous alumina membranes, a two-step anodization or prepatterning of aluminum are mainly conducted with straight electric field. Electric field is the main driving force for pore growth during anodization. However, impurities in aluminum can disturb the direction of the electric field. To confirm this, we anodized two different aluminum foil samples with high purity (99.999%) and relatively low purity (99.8%), and compared the differences in the surface morphologies of the respective aluminum oxide membranes produced in different electric fields. Branched pores observed in porous alumina surface which was anodized in low-purity aluminum and the size; dimensions of the pores were found to be usually smaller than those obtained from high-purity aluminum. Moreover, anodization at high voltage proceeds to a significant level of conversion because of the high speed of the directional electric field. Consequently, anodic alumina membrane of a specific morphology, i. e., meshed pore, was produced.

  6. Aluminum access to the brain: A role for transferrin and its receptor

    International Nuclear Information System (INIS)

    Roskams, A.J.; Connor, J.R.

    1990-01-01

    The toxicity of aluminum in plant and animal cell biology is well established, although poorly understood. Several recent studies have identified aluminum as a potential, although highly controversial, contributory factor in the pathology of Alzheimer's disease, amyotrophic lateral sclerosis, and dialysis dementia. For example, aluminum has been found in high concentrations in senile plaques and neurofibrillary tangles, which occur in the brains of subjects with Alzheimer's disease. However, a mechanism for the entry of aluminum (Al 3+ ) into the cells of the central nervous system (CNS) has yet to be found. Here the authors describe a possible route of entry for aluminum into the cells of the CNS via the same high-affinity receptor-ligand system that has been postulated for iron (Fe 3 ) aluminum is able to gain access to the central nervous system under normal physiological conditions. Furthermore, these data suggest that the interaction between transferrin and its receptor may function as a general metal ion regulatory system in the CNS, extending beyond its postulated role in iron regulation

  7. Inserting Stress Analysis of Combined Hexagonal Aluminum Honeycombs

    Directory of Open Access Journals (Sweden)

    Xiangcheng Li

    2016-01-01

    Full Text Available Two kinds of hexagonal aluminum honeycombs are tested to study their out-of-plane crushing behavior. In the tests, honeycomb samples, including single hexagonal aluminum honeycomb (SHAH samples and two stack-up combined hexagonal aluminum honeycombs (CHAH samples, are compressed at a fixed quasistatic loading rate. The results show that the inserting process of CHAH can erase the initial peak stress that occurred in SHAH. Meanwhile, energy-absorbing property of combined honeycomb samples is more beneficial than the one of single honeycomb sample with the same thickness if the two types of honeycomb samples are completely crushed. Then, the applicability of the existing theoretical model for single hexagonal honeycomb is discussed, and an area equivalent method is proposed to calculate the crushing stress for nearly regular hexagonal honeycombs. Furthermore, a semiempirical formula is proposed to calculate the inserting plateau stress of two stack-up CHAH, in which structural parameters and mechanics properties of base material are concerned. The results show that the predicted stresses of three kinds of two stack-up combined honeycombs are in good agreement with the experimental data. Based on this study, stress-displacement curve of aluminum honeycombs can be designed in detail, which is very beneficial to optimize the energy-absorbing structures in engineering fields.

  8. The Aluminum Smelting Process and Innovative Alternative Technologies

    Science.gov (United States)

    Drabløs, Per Arne

    2014-01-01

    Objective: The industrial aluminum production process is addressed. The purpose is to give a short but comprehensive description of the electrolysis cell technology, the raw materials used, and the health and safety relevance of the process. Methods: This article is based on a study of the extensive chemical and medical literature on primary aluminum production. Results: At present, there are two main technological challenges for the process—to reduce energy consumption and to mitigate greenhouse gas emissions. A future step may be carbon dioxide gas capture and sequestration related to the electric power generation from fossil sources. Conclusions: Workers' health and safety have now become an integrated part of the aluminum business. Work-related injuries and illnesses are preventable, and the ultimate goal to eliminate accidents with lost-time injuries may hopefully be approached in the future. PMID:24806723

  9. Nanoscale aluminum concaves for light-trapping in organic thin-films

    DEFF Research Database (Denmark)

    Goszczak, Arkadiusz Jaroslaw; Adam, Jost; Cielecki, Pawel Piotr

    2016-01-01

    Anodic aluminum oxide (AAO) templates, fabricated from oxalic acid and phosphoric acid, lead to non-periodic nanoscale concave structures in their underlying aluminum layer, which are investigated for their field-enhancement properties by applying a thin-film polymer coating based laser ablation...

  10. Fatigue behavior in rheocast aluminum 357 suspension arms using the SEED process

    Science.gov (United States)

    Samuel, Ehab; Zheng, Chang-Qing; Bouaicha, Amine; Bouazara, Mohamed

    Extensive studies have been devoted to the use of aluminum alloys in the automotive industry, by virtue of the favourable mechanical properties that can be attained. Moreover, the aluminum casting method employed has also been the subject of scrutiny, given the multitude of casting options available. The present work serves to illustrate the advancements made in the area of rheocasting, using the SEED method, as carried out at the National Research Council Canada — Aluminum Technology Centre. The SEED (Swirled Enthalpy Equilibration Device) process, which relies on heat extraction of the liquid aluminum alloy via mechanical agitation in a confined cylinder to form the semi-solid billet, has already proven successful in producing sound aluminum castings having an excellent combination of strength and ductility. Moreover, fatigue testing on the cast alloy parts has shown enormous potential for this emerging technology.

  11. Failure Analysis of Alumina Reinforced Aluminum Microtruss and Tube Composites

    Science.gov (United States)

    Chien, Hsueh Fen (Karen)

    The energy absorption capacity of cellular materials can be dramatically increased by applying a structural coating. This thesis examined the failure mechanisms of alumina reinforced 3003 aluminum alloy microtrusses and tubes. Alumina coatings were produced by hard anodizing and by plasma electrolytic oxidation (PEO). The relatively thin and discontinuous oxide coating at the hinge acted as a localized weak spot which triggered a chain reaction of failure, including oxide fracture, oxide spallation, oxide penetration to the aluminum core and severe local plastic deformation of the core. For the PEO microtrusses, delamination occurred within the oxide coating resulting in a global strut buckling failure mode. A new failure mode for the anodized tubes was observed: (i) axisymmetric folding of the aluminum core, (ii) longitudinal fracture, and (iii) alumina pulverization. Overall, the alumina coating enhanced the buckling resistance of the composites, while the aluminum core supported the oxide during the damage propagation.

  12. Cryogenic aluminum-wound generator rotor concept for nuclear power conversion

    International Nuclear Information System (INIS)

    Schlicher, R.L.; Oberly, C.E.

    1987-01-01

    This paper presents a design outline for a liquid hydrogen cooled generator rotor that could be used to fabricate a 20-megawatt cryogenic generator. The armature of an existing 20-megawatt superconducting generator could be utilized in this new cryogenic generator concept without electrical modification and with minimum modification to its housing. The acquisition and operating expense of liquid helium liquefiers, refrigeration requirements and the expense of fabricating a superconductor wound generator rotor make an aluminum-wound rotor a viable alternative. Ideally, the aluminum rotor could use the higher cryogenic temperatures of liquid hydrogen at 21 K as conductor coolant and not require the more difficult fabrication techniques of a superconducting generator rotor. A most likely conductor candidate is high purity aluminum which has 0.2% its room temperature resistance at liquid hydrogen temperatures. Recent research has indicated the feasibility of fabricating high-purity aluminum conductors in a composite conductor form

  13. Internal Heterogeneous Processes in Aluminum Combustion

    Science.gov (United States)

    Dreizin, E. L.

    1999-01-01

    This paper discusses the aluminum particle combustion mechanism which has been expanded by inclusion of gas dissolution processes and ensuing internal phase transformations. This mechanism is proposed based on recent normal and microgravity experiments with particles formed and ignited in a pulsed micro-arc. Recent experimental findings on the three stages observed in Al particle combustion in air and shows the burning particle radiation, trajectory (streak), smoke cloud shapes, and quenched particle interiors are summarized. During stage I, the radiation trace is smooth and the particle flame is spherically symmetric. The temperature measured using a three-color pyrometer is close to 3000 K. Because it exceeds the aluminum boiling point (2730 K), this temperature most likely characterizes the vapor phase flame zone rather than the aluminum surface. The dissolved oxygen content within particles quenched during stage I was below the detection sensitivity (about 1 atomic %) for Wavelength Dispersive Spectroscopy (WDS). After an increase in the radiation intensity (and simultaneous decrease in the measured color temperature from about 3000 to 2800 K) indicative of the transition to stage II combustion, the internal compositions of the quenched particles change. Both oxygen-rich (approx. 10 atomic %) and oxygen-lean (combustion behavior and the evolution of its internal composition, the change from the spherically symmetric to asymmetric flame shape occurring upon the transition from stage I to stage II combustion could not be understood based only on the fact that dissolved oxygen is detected in the particles. The connection between the two phenomena appeared even less significant because in earlier aluminum combustion studies carried in O2/Ar mixtures, flame asymmetry was not observed as opposed to experiments in air or O2/CO mixtures. It has been proposed that the presence of other gases, i.e., hydrogen, or nitrogen causes the change in the combustion regime.

  14. Identification of a novel EYA1 splice-site mutation in a Danish branchio-oto-renal syndrome family

    DEFF Research Database (Denmark)

    Henriksen, Ann Marie; Tümer, Zeynep; Tommerup, Niels

    2004-01-01

    Branchio-oto-renal (BOR) syndrome is an autosomal dominant disorder characterized by variable clinical manifestations including branchial fistulae, preauricular pits, ear malformations, hearing impairment, and renal anomalies. BOR is caused by mutations in the genes EYA1 and SIX1. A Danish BOR...

  15. Aluminum break-point contacts

    NARCIS (Netherlands)

    Heinemann, Martina; Groot, R.A. de

    1997-01-01

    Ab initio molecular dynamics is used to study the contribution of a single Al atom to an aluminum breakpoint contact during the final stages of breaking and the initial stages of the formation of such a contact. A hysteresis effect is found in excellent agreement with experiment and the form of the

  16. Analysis of Aluminum Resource Supply Structure and Guarantee Degree in China Based on Sustainable Perspective

    Directory of Open Access Journals (Sweden)

    Shaoli Liu

    2016-12-01

    Full Text Available Aluminum is a strategic mineral resource, and China’s aluminum production and consumption is fairly large. However, its supply guarantee is uncertain because of a high dependency on external raw materials. This uncertainty may expand, so finding a way to reduce the uncertainty of aluminum resource supply is especially important. This paper applies the SFA method to analyze the aluminum flows in mainland China from 1996 to 2014, and establishes a supply structure model to measure its supply guarantee degree. The results claim that: (1 China’s aluminum production can satisfy demand and even create a surplus; (2 Domestic self-productive primary and secondary aluminum increased at an annual rate of 12% and 24%; (3 The proportion of self-productive secondary aluminum in the supply structure increased from 7.7% in 1996 to 12.8% in 2014, while that of primary aluminum decreased from 79.6% to 42.8%; (4 The total supply guarantee degree decreased from 87.3% to 55.6% in this period. These results provide a feasible way to solve this plight: the proportion of secondary aluminum in the supply structure should be enhanced, and an efficient aluminum resource recycling system needs to be established as soon as possible to ensure its sustainable supply.

  17. Aluminum coordination chemistry and the inhibition of phosphoryl-transferring enzymes

    International Nuclear Information System (INIS)

    Furumo, N.C.; Viola, R.E.

    1986-01-01

    Aluminium ion is a potent inhibitor of the enzymes hexokinase (K/sub i/ = 0.16 μM) and glycerokinase (K/sub i/ = 4.0 μM). It has been shown that aluminum forms a complex with ATP that is 80 times more stable than the magnesium complex with ATP which is the normal substrate for phosphoryl-transferring enzymes. Kinetic studies performed on several kinases at pH 7.0 have shown that Al-ATP is a competitive inhibitor vs. Mg-ATP with moderate K/sub i/ values (0.1-0.5 mM) for creatine kinase(CK) and myokinase(MK), and weakly competitive (K/sub i/ > 0.5 mM) with acetate, galactose, arginine and gluconate kinases. Equilibrium dialysis binding studies indicate no significant binding of aluminum ion by the enzymes, while the interaction of aluminum ion with ADP and ATP has been characterized by 13 C, 27 Al, and 31 P NMR spectroscopy. It appears that the inhibition by aluminum is as the Al-nucleotide complex rather than direct binding of free aluminum ion by the enzyme. Kinetic studies indicate that Al 3+ inhibition of CK and MK is pH dependent with decreased values of K/sub i/ at lower pH. At pH 6.1 K/sub i/ = 25 μM for MK (160 μM at pH 7.0) and 53 μM for CK (240 μM at pH 7.0). This may be due to an increased effective concentration of aluminum ion at lower pH

  18. MICROSTRUCTURE CHARACTERISTIC OF ALUMINUM TITANATE SYNTHESIED BY BOTH SOLID- STATE AND SOL-GEL PROCESSES

    Directory of Open Access Journals (Sweden)

    M. Khosravi Saghezchi

    2015-12-01

    Full Text Available A comparing study on formation and microstructure features of aluminum titanate is investigated through both solid-state and sol-gel processes. Aluminum titanate formed by firing at 1350ºC and 1450ºC for 4h in solid-state process. In the sol-gel process formation of submicron sized particles is followed by addition of sucrose into the transparent sol. XRD analysis was confirmed the formation of aluminum titanate at 1400ºC  in lower duration of calcination (3h without any additives in the sol-gel process. In this work 2wt% MgO is added to the samples as the additive for forming acceleration of aluminum titanate. The influence of MgO addition and heat treatment are studied on phase formation and microstructure development of aluminum titanate in both procedures. Additive optimizes aluminum titanate formation at lower temperatures (1300-1350ºC. Phase and microstructure studies of Mg containing samples optimally show significance in aluminum titanate formation.

  19. Volcanogenic Turonian and epiclastics of senonian in the Timok magmatic complex between Bor and the Tupižnica mountain, eastern Serbia

    Directory of Open Access Journals (Sweden)

    Đorđević Miodrag

    2005-01-01

    Full Text Available In the light of the findings presented in this paper, among the volcanic products of the Upper Cretaceous, referred to as "the first volcanic phase" (Drovenik, 1961, two lithostratigraphic units can be singled out within the Timok Magmatic Complex (TMC: - The lower one, consisting of volcanogenic, subaerial, dominantly hornblende andésite volcaniclastic, formed on land, and less abundant volcanic and sub-volcanic-hypoabyssal rocks. It is the main source of sulfide mine­ralization in Bor. It was formed before the Upper Turonian and consists of hornblende andésite and occasionally low biotite. Minor constituents are biotite-hornblende dacite and some andésite and dacite materials con­taining augite in addition to hornblende and biotite. - The upper one, from the Upper Turonian period when the volcanic activity of the region had ended, is marine deposited and epiclastic. Intercalated with Senonian marls, it is composed of land deposited Turonian volcanogenic material of all generations. Fresh material mostly consisting of hornblende andésite volcanoclastics prevails in it. Fresh epiclastics include ore mineral epiclasts. Epiclastics composed of epiclasts of hydro thermally altered rocks were observed which also include ore epiclasts. The ore epiclasts originate from copper ore. The boundary between the volcanogenic Turonian and the epiclastic deposits is a well-recognized unconformity. Table 1 in the text summarizes the main characteristics of the Turonian volcanogenic rocks, primarily those of volcaniclastics, as well as those of epiclastic deposits.

  20. Thermally sprayed coatings: Aluminum on lead

    International Nuclear Information System (INIS)

    Usmani, S.; Czajkowski, C.J.; Zatorski, R.

    1999-01-01

    An experimental program to determine the feasibility of thermally spraying aluminum on a lead substrate was initiated in support of the accelerator production of tritium (APT) Project for the US Department of Energy. The program consisted of two distinct parts: (1) the characterization of the thermally sprayed coatings, including microhardness testing, effects of heating, and microstructure and porosity determinations, and (2) effects of mercury doping and heat treatments on the thermally sprayed composite. The project determined that aluminum could successfully be thermally sprayed onto the lead. The coatings had a dense microstructure, with a Vicker's Pyramid Hardness (VPH) of about 60, and a maximum porosity (found in strips on the samples) of 12%

  1. Synthesis of oxide-free aluminum nanoparticles for application to conductive film

    Science.gov (United States)

    Jong Lee, Yung; Lee, Changsoo; Lee, Hyuck Mo

    2018-02-01

    Aluminum nanoparticles are considered promising as alternatives to conventional ink materials, replacing silver and copper nanoparticles, due to their extremely low cost and low melting temperature. However, a serious obstacle to realizing their use as conductive ink materials is the oxidation of aluminum. In this research, we synthesized the oxide-free aluminum nanoparticles using catalytic decomposition and an oleic acid coating method, and these materials were applied to conductive ink for the first time. The injection time of oleic acid determines the size of the aluminum nanoparticles by forming a self-assembled monolayer on the nanoparticles instead of allowing the formation of an oxide phase. Fabricated nanoparticles were analyzed by transmission electron microscopy and x-ray photoelectron spectroscopy to verify their structural and chemical composition. In addition, conductive inks made of these nanoparticles exhibit electrical properties when they are sintered at over 300 °C in a reducing atmosphere. This result shows that aluminum nanoparticles can be used as an alternative conductive material in printed electronics and can solve the cost issues associated with noble metals.

  2. Aluminum deoxidation equilibria and inclusion modification mechanism by calcium treatment of stainless steel melts

    International Nuclear Information System (INIS)

    Park, Joo Hyun; Kim, Dong Sik; Kim, Yong Hwan; Lee, Sang Beom

    2005-01-01

    A thermodynamic equilibrium between aluminum and oxygen along with the inclusion morphology in Fe-16%Cr stainless steel was investigated to understand the fundamentals of aluminum deoxidation technology for ferritic stainless steels. Further, the effects of calcium addition on the changes in chemistry and morphology of inclusions were discussed. The measured results for aluminum-oxygen equilibria exhibit relatively good agreement with the calculated values, indicating that the introduction of the first- and second-order interaction parameters, recently reported, is reasonable to numerically express aluminum deoxidation equilibrium in a ferritic stainless steel. In the composition of dissolved aluminum content greater than about 60 ppm, pure alumina particles were observed, while the alumino-manganese silicates containing Cr 2 O 3 were appeared at less than 20 mass ppm of dissolved aluminum. The formation of calcium aluminate inclusions after Ca treatment could be discussed based on the thermodynamic equilibrium with calcium, aluminum, and oxygen in the steel melts. In the composition of steel melt with relatively high content of calcium and low aluminum, the log(X CaO /X Al 2 O 3 ) of inclusions linearly increases with increasing the log [a Ca /a Al 2 ·a O 2 ] with the slope close to unity. However, the slope of the line is significantly lower than the expected value in the composition of steel melt with relatively low calcium and high aluminum contents

  3. Using Neural Networks to Predict the Hardness of Aluminum Alloys

    Directory of Open Access Journals (Sweden)

    B. Zahran

    2015-02-01

    Full Text Available Aluminum alloys have gained significant industrial importance being involved in many of the light and heavy industries and especially in aerospace engineering. The mechanical properties of aluminum alloys are defined by a number of principal microstructural features. Conventional mathematical models of these properties are sometimes very complex to be analytically calculated. In this paper, a neural network model is used to predict the correlations between the hardness of aluminum alloys in relation to certain alloying elements. A backpropagation neural network is trained using a thorough dataset. The impact of certain elements is documented and an optimum structure is proposed.

  4. 40 CFR 440.20 - Applicability; description of the aluminum ore subcategory.

    Science.gov (United States)

    2010-07-01

    ... subpart B are applicable to discharges from facilities engaged in the mining of bauxite as an aluminum ore. ... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS ORE MINING AND DRESSING POINT SOURCE CATEGORY Aluminum Ore...

  5. Effect of grain size on the melting point of confined thin aluminum films

    Energy Technology Data Exchange (ETDEWEB)

    Wejrzanowski, Tomasz; Lewandowska, Malgorzata; Sikorski, Krzysztof; Kurzydlowski, Krzysztof J. [Materials Design Division, Faculty of Materials Science and Engineering, Warsaw University of Technology, Woloska 141, 02-507 Warsaw (Poland)

    2014-10-28

    The melting of aluminum thin film was studied by a molecular dynamics (MD) simulation technique. The effect of the grain size and type of confinement was investigated for aluminum film with a constant thickness of 4 nm. The results show that coherent intercrystalline interface suppress the transition of solid aluminum into liquid, while free-surface gives melting point depression. The mechanism of melting of polycrystalline aluminum thin film was investigated. It was found that melting starts at grain boundaries and propagates to grain interiors. The melting point was calculated from the Lindemann index criterion, taking into account only atoms near to grain boundaries. This made it possible to extend melting point calculations to bigger grains, which require a long time (in the MD scale) to be fully molten. The results show that 4 nm thick film of aluminum melts at a temperature lower than the melting point of bulk aluminum (933 K) only when the grain size is reduced to 6 nm.

  6. Composite superconductors with copper-aluminum stabilizing matrix

    International Nuclear Information System (INIS)

    Keilin, V.E.; Anashkin, O.P.; Krivikh, A.V.; Kiriya, I.V.; Kovalev, I.A.; Dolgosheev, P.I.; Rychagov, A.V.; Sytnikov, V.E.

    1992-01-01

    A new type of composite superconductors has been developed. They consist of one or several (cabled) multifilamentary wires with low Cu-to-Sc ratio which are embedded and soldered into grooves made in matrix of rectangular cross-section. The latter consists of aluminum core metallurgically plated with a thin copper sheath. Such conductors combine the advantages of both aluminum and copper as stabilizing materials. They have low density, exhibit almost not magnetoresistance, are relatively cheap and can be produced in very long pieces. Copper plating offers the possibility of soft soldering thus ensuring good electrical and thermal contact between superconducting wires and stabilizing matrix, and helping to join pieces to each other. the properties of two Nb-Ti conductors (3.5 x 2 mm 2 and 7x4 mm 2 ) are described in more detail. The first is used in SC coils for whole-body magnetoresonance tomography, and the second will be used in a open-quotes thinclose quotes coil for charged particles detector. The influence of aluminum purity on SC magnet behavior is also briefly discussed

  7. Advances on aluminum first-surface solar reflectors

    Science.gov (United States)

    Almanza, Rafael; Chen, Jiefeng; Mazari, Marcos

    1992-11-01

    Aluminum first surface mirrors have some advantages over second surface mirrors as has been discussed. At this stage of development some advantages are obtained: the first advantage was using two electron guns, one for aluminum evaporation permitting us to eliminate or to minimize the pinholes and the other to allow the evaporation of SiO without any mirror contamination as it was before due to the air when the chamber was opened to introduce the SiO, despite having only one e-gun in the laboratory. The second advantage was a better adherence between the aluminum film and the Si2O3, this last substance obtained with an oxidation of SiO with some oxygen inside the evaporation chamber (10-4 Torr). This improvement was due to the use of two e-guns that permit us not to open the chamber. These mirrors are actually under test in the environmental chamber for accelerated weather evaluations. One important aspect is the cleaning of the glass substrate. The chromic mixture cleaning is one of the most effective.

  8. Removal of heavy metals from aluminum anodic oxidation wastewaters by membrane filtration.

    Science.gov (United States)

    Ates, Nuray; Uzal, Nigmet

    2018-05-27

    Aluminum manufacturing has been reported as one of the largest industries and wastewater produced from the aluminum industry may cause significant environmental problems due to variable pH, high heavy metal concentration, conductivity, and organic load. The management of this wastewater with a high pollution load is of great importance for practitioners in the aluminum sector. There are hardly any studies available on membrane treatment of wastewater originated from anodic oxidation. The aim of this study is to evaluate the best treatment and reuse alternative for aluminum industry wastewater using membrane filtration. Additionally, the performance of chemical precipitation, which is the existing treatment used in the aluminum facility, was also compared with membrane filtration. Wastewater originated from anodic oxidation coating process of an aluminum profile manufacturing facility in Kayseri (Turkey) was used in the experiments. The characterization of raw wastewater was in very low pH (e.g., 3) with high aluminum concentration and conductivity values. Membrane experiments were carried out with ultrafiltration (PTUF), nanofiltration (NF270), and reverse osmosis (SW30) membranes with MWCO 5000, 200-400, and 100 Da, respectively. For the chemical precipitation experiments, FeCl 3 and FeSO 4 chemicals presented lower removal performances for aluminum and chromium, which were below 35% at ambient wastewater pH ~ 3. The membrane filtration experimental results show that, both NF and RO membranes tested could effectively remove aluminum, total chromium and nickel (>90%) from the aluminum production wastewater. The RO (SW30) membrane showed a slightly higher performance at 20 bar operating pressure in terms of conductivity removal values (90%) than the NF 270 membrane (87%). Although similar removal performances were observed for heavy metals and conductivity by NF270 and SW30, significantly higher fluxes were obtained in NF270 membrane filtration at any pressure

  9. Response to Thermal Exposure of Ball-Milled Aluminum-Borax Powder Blends

    Science.gov (United States)

    Birol, Yucel

    2013-04-01

    Aluminum-borax powder mixtures were ball milled and heated above 873 K (600 °C) to produce Al-B master alloys. Ball-milled powder blends reveal interpenetrating layers of deformed aluminum and borax grains that are increasingly refined with increasing milling time. Thermal exposure of the ball-milled powder blends facilitates a series of thermite reactions between these layers. Borax, dehydrated during heating, is reduced by Al, and B thus generated reacts with excess Al to produce AlB2 particles dispersed across the aluminum grains starting at 873 K (600 °C). AlB2 particles start to form along the interface of the aluminum and borax layers. Once nucleated, these particles grow readily to become hexagonal-shaped crystals that traverse the aluminum grains with increasing temperatures as evidenced by the increase in the size as well as in the number of the AlB2 particles. Ball milling for 1 hour suffices to achieve a thermite reaction between borax and aluminum. Ball milling further does not impact the response of the powder blend to thermal exposure. The nucleation-reaction sites are multiplied, however, with increasing milling time and thus insure a higher number of smaller AlB2 particles. The size of the AlB2 platelets may be adjusted with the ball milling time.

  10. Origin of 6-fold coordinated aluminum at (010-type pyrophyllite edges

    Directory of Open Access Journals (Sweden)

    M. Okumura

    2017-05-01

    Full Text Available To better understand the aqueous chemical reactivity of clay mineral edges we explored the relationships between hydration and the structure of (010-type edges of pyrophyllite. In particular, we used density functional theory and the quantum theory of atoms in molecules to evaluate the stability of 6-fold coordinated hydrated aluminum at the edge in terms of the electron density distribution. Geometrical optimization revealed an intra-edge hydrogen bond network between aluminol hydroxyls and water ligands completing the aluminum coordination shell. From the electron density isosurfaces one water ligand is not covalently bonded to aluminum. Bader charge analysis revealed that OH2 ligands have small negative charge. In addition, it is also found that the charge of the 6-fold coordinated aluminum is larger than one of the 5-fold aluminum. From these results, the charging of the OH2 ligands is interpreted as charge transfer originated from the formation of the hydrogen bond network and not from Al-OH2 interaction per se. This suggests that the weakly bound water ligand in question, and more generally 6-fold hydrated edge Al coordination, is stabilized primarily by the hydrogen bond network which in turn leads to weak ionic attraction to the aluminum center itself. The finding highlights the importance of cooperative effects between solvent structure and the coordination of metal cations exposed at clay mineral edges.

  11. Nitrogen bonding in aluminum oxynitride films

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Paul W., E-mail: pwang@bradley.edu [Department of Physics, Bradley University, 1501 W. Bradley Ave., Peoria, IL 61625 (United States); Hsu, Jin-Cherng [Department of Physics, Fu Jen Catholic University, Hsinchuang, Taipei Hsien 24205, Taiwan (China); Lin, Yung-Hsin; Chen, Huang-Lu [Graduate Institute of Applied Science and Engineering, Fu Jen Catholic University, Hsinchuang, Taipei Hsien 24205, Taiwan (China)

    2010-04-15

    Assignment of oxidation states of N{sub 1s} in XPS spectra of aluminum oxynitride by curve fitting is difficult. The XPS curve fitting was previously discussed in the paper published in J. Non-Cryst. Solids, 224 (1998) 31, in which O{sub 1s} photoelectrons from GeO{sub 2} glass were used to illustrate how to fit the XPS spectra. Three different ways were pointed out to eliminate the ambiguity caused by curve fitting such as comparing the data to data from standard samples, investigating the continuous surface modifications caused by slowly sputtering the surface, and monitoring the continuous surface modifications due to gradual increases in surface species under heating, cooling, or irradiation. Our recent work in aluminum oxynitride films provides another example of how to fit the XPS spectra of N{sub 1s} by three different oxidation states of N{sup +}, N{sup 2+}, and N{sup 3+}, by comparison of the measured data to data from previously published results, and by the gradual changes of spectra as functions of the oxygen contents in the films. Three oxidation states in different nitrogen bonding in the aluminum oxynitride, AlO{sub 2}N, Al{sub 2}O{sub 5}N{sub 2}, and AlO{sub 3}N, were clearly deduced.

  12. Effect of zirconium addition on welding of aluminum grain refined by titanium

    International Nuclear Information System (INIS)

    Zaid, A.I.O.

    2011-01-01

    Aluminum and its alloys solidify in large grains columnar structure which tends to reduce their mechanical behaviour and surface quality. Therefore, they are industrially grain refined by titanium or titanium + boron. Furthermore, aluminum oxidizes in ordinary atmosphere which makes its weldability difficult and weak. Therefore, it is anticipated that the effect of addition of zirconium at a weight percentages of 0.1% (which proved to be an effective grain refiner on the weldability of aluminum grain refined by Ti) is worthwhile investigating. This formed the objective of this research work. In this paper, the effect of zirconium addition at a weight percentage of 0.1%, which corresponds to the peritctic limit on the aluminum-zirconium phase diagram, on the weldability of aluminum grain refined by Ti is investigated. Rolled sheets of commercially pure aluminum, Al grain refined Ti of 3 mm thickness were welded together using Gas Tungsten Arc Welding method (GTAW), formerly known as TIG. A constant air gap was maintained at a constant current level, 30 ampere AC, was used because it removes the oxides of the welding process under the same process parameters. Metallographic examination of weldments of the different combinations of aluminum and its microalloys at the heat affected zone, HAZ, and base metal was carried out and examined for width, porosity, cracks and microhardness. It was found that grain refining of commercially pure aluminum by Ti resulted in enhancement of its weldability. Similarly, addition of zirconium to Al grain refined by Ti resulted in further enhancement of the weldment. Photomicrographs of the HAZ regions are presented and discussed. (author)

  13. The microstructure of aluminum A5083 butt joint by friction stir welding

    International Nuclear Information System (INIS)

    Jasri, M. A. H. M.; Afendi, M.; Ismail, A.; Ishak, M.

    2015-01-01

    This study presents the microstructure of the aluminum A5083 butt joint surface after it has been joined by friction stir welding (FSW) process. The FSW process is a unique welding method because it will not change the chemical properties of the welded metals. In this study, MILKO 37 milling machine was modified to run FSW process on 4 mm plate of aluminum A5083 butt joint. For the experiment, variables of travel speed and tool rotational speed based on capability of machine were used to run FSW process. The concentrated heat from the tool to the aluminum plate changes the plate form from solid to plastic state. Two aluminum plates is merged to become one plate during plastic state and return to solid when concentrated heat is gradually further away. After that, the surface and cross section of the welded aluminum were investigated with a microscope by 400 x multiplication zoom. The welding defect in the FSW aluminum was identified. Then, the result was compared to the American Welding Society (AWS) FSW standard to decide whether the plate can be accepted or rejected

  14. The microstructure of aluminum A5083 butt joint by friction stir welding

    Energy Technology Data Exchange (ETDEWEB)

    Jasri, M. A. H. M.; Afendi, M. [School of Mechatronic Engineering, Universiti Malaysia Perlis, Pauh, 02600, Arau, Perlis (Malaysia); Ismail, A. [UniKL MIMET, JalanPantaiRemis, 32200, Lumut, Perak (Malaysia); Ishak, M. [Faculty of Mechanical Engineering, Universiti Malaysia Pahang, 02600, Pekan, Pahang (Malaysia)

    2015-05-15

    This study presents the microstructure of the aluminum A5083 butt joint surface after it has been joined by friction stir welding (FSW) process. The FSW process is a unique welding method because it will not change the chemical properties of the welded metals. In this study, MILKO 37 milling machine was modified to run FSW process on 4 mm plate of aluminum A5083 butt joint. For the experiment, variables of travel speed and tool rotational speed based on capability of machine were used to run FSW process. The concentrated heat from the tool to the aluminum plate changes the plate form from solid to plastic state. Two aluminum plates is merged to become one plate during plastic state and return to solid when concentrated heat is gradually further away. After that, the surface and cross section of the welded aluminum were investigated with a microscope by 400 x multiplication zoom. The welding defect in the FSW aluminum was identified. Then, the result was compared to the American Welding Society (AWS) FSW standard to decide whether the plate can be accepted or rejected.

  15. TiN coated aluminum electrodes for DC high voltage electron guns

    International Nuclear Information System (INIS)

    Mamun, Md Abdullah A.; Elmustafa, Abdelmageed A.; Taus, Rhys; Forman, Eric; Poelker, Matthew

    2015-01-01

    Preparing electrodes made of metals like stainless steel, for use inside DC high voltage electron guns, is a labor-intensive and time-consuming process. In this paper, the authors report the exceptional high voltage performance of aluminum electrodes coated with hard titanium nitride (TiN). The aluminum electrodes were comparatively easy to manufacture and required only hours of mechanical polishing using silicon carbide paper, prior to coating with TiN by a commercial vendor. The high voltage performance of three TiN-coated aluminum electrodes, before and after gas conditioning with helium, was compared to that of bare aluminum electrodes, and electrodes manufactured from titanium alloy (Ti-6Al-4V). Following gas conditioning, each TiN-coated aluminum electrode reached −225 kV bias voltage while generating less than 100 pA of field emission (<10 pA) using a 40 mm cathode/anode gap, corresponding to field strength of 13.7 MV/m. Smaller gaps were studied to evaluate electrode performance at higher field strength with the best performing TiN-coated aluminum electrode reaching ∼22.5 MV/m with field emission less than 100 pA. These results were comparable to those obtained from our best-performing electrodes manufactured from stainless steel, titanium alloy and niobium, as reported in references cited below. The TiN coating provided a very smooth surface and with mechanical properties of the coating (hardness and modulus) superior to those of stainless steel, titanium-alloy, and niobium electrodes. These features likely contributed to the improved high voltage performance of the TiN-coated aluminum electrodes

  16. Forensic discrimination of aluminum foil by SR-XRF and ICP-AES

    International Nuclear Information System (INIS)

    Kasamatsu, Masaaki; Suzuki, Yasuhiro; Suzuki, Shinichi; Miyamoto, Naoki; Watanabe, Seiya; Shimoda, Osamu; Takatsu, Masahisa; Nakanishi, Toshio

    2010-01-01

    The application of synchrotron radiation X-ray fluorescence spectrometry (SR-XRF) was investigated for the forensic discrimination of aluminum foil by comparisons of the elemental components. Small fragments (1 x 1 mm) were taken from 4 kinds of aluminum foils produced by different manufactures and used for measurements of the XRF spectrum at BL37XU of SPring-8. A comparison of the XRF spectra was effective for the discrimination of aluminum foils from different sources, because significant differences were observed in the X-ray peak intensities of Fe, Cu, Zn, Ga, Zr and Sn. These elements, except for Zr and Sn in the aluminum foils and NIST SRM1258 (Aluminium Alloy 6011), were also determined by inductively coupled plasma atomic emission spectrometry (ICP-AES). The observed values of Fe, Cu, Zn and Ga in NIST standard samples by ICP-AES showed satisfactorily good agreements with the certified or information values with relative standard deviations from 1.1% for Zn to 6.7% for Ga. The observed values for the aluminum foils by ICP-AES were compared with those by SR-XRF. Correlation coefficients from 0.997 for Cu/Fe to 0.999 for Zn/Fe and Ga/Fe were obtained between the ratio of the elemental concentration by ICP-AES and normalized the X-ray intensity by SR-XRF. This result demonstrates that a comparison of the normalized X-ray intensity is nearly as effective for the discrimination of aluminum foils as quantitative analysis by ICP-AES. Comparisons of the analytical results by SR-XRF allow the discrimination of all aluminum foils using only a 1 mm 2 fragment with no destruction of the samples. (author)

  17. Effect of mechanical activation on structure and thermal decomposition of aluminum sulfate

    International Nuclear Information System (INIS)

    Ghasri-Khouzani, M.; Meratian, M.; Panjepour, M.

    2009-01-01

    The thermal decompositions of both non-activated and mechanically activated aluminum sulfates were studied by thermogravimetry (TG). The structural disorder, the specific surface area (SSA) and the morphology of mechanically activated aluminum sulfates were analyzed by X-ray diffraction (XRD), laser particle-size analyzer, and scanning electron microscopy (SEM), respectively. Thermal analyses results indicated that the initial temperature of thermal decomposition (T i ) in TG curves for mechanically activated aluminum sulfates decreased gradually with increasing the milling time. It was also found that the SSA of mechanically activated aluminum sulfates remained almost constant after a certain milling time, and lattice strains (ε) rose but the crystallite sizes (D) decreased with increasing the milling time. These results showed that the decrease of T i in TG curves of mechanically activated aluminum sulfates was mainly caused by the increase of lattice distortions and decrease of the crystallite sizes with increasing the milling time

  18. Corrosion properties of aluminum based alloys deposited by ion beam assisted deposition

    International Nuclear Information System (INIS)

    Enders, B.; Krauss, S.; Wolf, G.K.

    1994-01-01

    The replacement of cadmium coatings by other protective measures is an important task because of the environmentally detrimental properties of cadmium. Therefore, aluminum and aluminum alloy coatings containing elements such as silicon or magnesium with more positive or negative positions in the galvanic series in relation to pure aluminum were deposited by ion beam assisted deposition onto glass and low carbon steel. Pure aluminum films were deposited onto low carbon steel in order to study the influence of the ion-to-atom arrival ratio and the angle of ion incidence on the corrosion properties. For examination of the pitting behavior as a function of the concentration of alloying element, quasipotentiostatic current-potential and potentiostatic current-time plots were measured in chlorine-containing acetate buffer. It is shown that these alloys can protect steel substrates under uniform and pitting corrosion conditions considerably better than pure aluminum coatings. ((orig.))

  19. Revisiting the Corrosion of the Aluminum Current Collector in Lithium-Ion Batteries.

    Science.gov (United States)

    Ma, Tianyuan; Xu, Gui-Liang; Li, Yan; Wang, Li; He, Xiangming; Zheng, Jianming; Liu, Jun; Engelhard, Mark H; Zapol, Peter; Curtiss, Larry A; Jorne, Jacob; Amine, Khalil; Chen, Zonghai

    2017-03-02

    The corrosion of aluminum current collectors and the oxidation of solvents at a relatively high potential have been widely investigated with an aim to stabilize the electrochemical performance of lithium-ion batteries using such components. The corrosion behavior of aluminum current collectors was revisited using a home-build high-precision electrochemical measurement system, and the impact of electrolyte components and the surface protection layer on aluminum foil was systematically studied. The electrochemical results showed that the corrosion of aluminum foil was triggered by the electrochemical oxidation of solvent molecules, like ethylene carbonate, at a relative high potential. The organic radical cations generated from the electrochemical oxidation are energetically unstable and readily undergo a deprotonation reaction that generates protons and promotes the dissolution of Al 3+ from the aluminum foil. This new reaction mechanism can also shed light on the dissolution of transitional metal at high potentials.

  20. Coupling a PEM fuel cell and the hydrogen generation from aluminum waste cans

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Susana Silva; Albanil Sanchez, Loyda; Alvarez Gallegos, Alberto A. [Centro de Investigacion en Ingenieria y Ciencias Aplicadas, Av. Universidad 1001, Col. Chamilpa, Cuernavaca, Mor. CP 62210 (Mexico); Sebastian, P.J. [Centro de Investigacion en Energia-UNAM, 62580 Temixco, Morelos (Mexico); Cuerpo Academico de Energia y Sustentabilidad, UPCH, Tuxtla Gutierrez, Chiapas (Mexico)

    2007-10-15

    High purity hydrogen was generated from the chemical reaction of aluminum and sodium hydroxide. The aluminum used in this study was obtained from empty soft drink cans and treated with concentrated sulfuric acid to remove the paint and plastic film. One gram of aluminum was reacted with a solution of 2moldm{sup -3} of sodium hydroxide to produce hydrogen. The hydrogen produced from aluminum cans and oxygen obtained from a proton exchange membrane electrolyzer or air, was fed to a proton exchange membrane (PEM) fuel cell to produce electricity. Yields of 44 mmol of hydrogen contained in a volume of 1.760dm{sup 3} were produced from one gram of aluminum in a time period of 20 min. (author)

  1. Characterization of 2024-T3: An aerospace aluminum alloy

    International Nuclear Information System (INIS)

    Huda, Zainul; Taib, Nur Iskandar; Zaharinie, Tuan

    2009-01-01

    The 2024-T3 aerospace aluminum alloy, reported in this investigation, was acquired from a local aerospace industry: Royal Malaysian Air Force (RMAF). The heat treatable 2024-T3 aluminum alloy has been characterized by use of modern metallographic and material characterization techniques (e.g. EPMA, SEM). The microstructural characterization of the metallographic specimen involved use of an optical microscope linked with a computerized imaging system using MSQ software. The use of EPMA and electron microprobe elemental maps enabled us to detect three types of inclusions: Al-Cu, Al-Cu-Fe-Mn, and Al-Cu-Fe-Si-Mn enriched regions. In particular, the presence of Al 2 CuMg (S-phase) and the CuAl 2 (θ') phases indicated precipitation strengthening in the aluminum alloy

  2. Aluminum chloride restoration of in situ leached uranium ores

    International Nuclear Information System (INIS)

    Grant, D.C.; Burgman, M.A.

    1982-01-01

    During in situ uranium mining using ammonium bicarbonate lixiviant, the ammonium exchanges with cations on the ore's clay. After mining is complete, the ammonium may desorb into post-leach ground water. For the particular ore studied, other chemicals (i.e., uranium and selenium) which are mobilized during the leach process, have also been found in the post-leach ground water. Laboratory column tests, used to simulate the leaching process, have shown that aluminum chloride can rapidly remove ammonium from the ore and thus greatly reduce the subsequent ammonium leakage level into ground water. The aluminum chloride has also been found to reduce the leakage levels of uranium and selenium. In addition, the aluminum chloride treatment produces a rapid improvement in permeability

  3. Assessment of Aluminum FSW Joints Using Ultrasonic Testing

    Directory of Open Access Journals (Sweden)

    Adamus K.

    2017-12-01

    Full Text Available The paper concerns aluminum joints made using friction stir welding. Although in the aerospace industry there is a tendency to replace metal components with composites, aluminum continues to be a valuable material. Its share in the aircraft structures is the biggest among all structural metals. Lots of aluminum components are made of sheets and most of them require joining. Friction stir welding is a relatively new joining technology, particularly with regard to the sheets having a thickness of 1 mm or lower. The paper is dedicated to non-destructive testing of such joints using ultrasonic inspection. It was found that ultrasonic testing allows for distinguishing between joints without material discontinuities, joint with material discontinuities at the advancing side and joint with discontinuities extending through the whole width of the stir zone. During research only horizontally aligned defects were taken into account.

  4. DESIGN AND APPLICATION OF TRANSPARENT AND TRANSLUCENT ENAMELS ON ALUMINUM

    Directory of Open Access Journals (Sweden)

    H. AHMADI MOGHADDAM

    2012-09-01

    Full Text Available Transparent and opaque glass enamels for aluminum plates were designed with a minimum or with no heavy atom oxides such as lead and bismuth oxides. The thermal properties of the enamels were studied by DTA and their stability as measured by the difference of glass transition and crystallization onset temperatures was determined. Bending and rapid deformation (impact tests indicated the interfacial adhesion. The enamel/aluminum interfacial qualities were viewed and examined by scanning electron microscopy (SEM. A large amount of NaF and P2O5 in their formulation created opaque enamels. The three methods of melt dipping, pouring, and sintering were used to apply layers of enamels on aluminum plates. The novelty of the pouring and spreading method and its advantages over other methods, were in the use of lower stability and higher melting point enamels, without thermally/mechanically damaging the aluminum. Observations suggested that the interfacial contact and adhesion properties were good, particularly with the transparent or glassy state enamels.

  5. Digital laser printing of aluminum micro-structure on thermally sensitive substrates

    International Nuclear Information System (INIS)

    Zenou, Michael; Sa’ar, Amir; Kotler, Zvi

    2015-01-01

    Aluminum metal is of particular interest for use in printed electronics due to its low cost, high conductivity and low migration rate in electrically driven organic-based devices. However, the high reactivity of Al particles at the nano-scale is a major obstacle in preparing stable inks from this metal. We describe digital printing of aluminum micro-structures by laser-induced forward transfer in a sub-nanosecond pulse regime. We manage to jet highly stable molten aluminum micro-droplets with very low divergence, less than 2 mrad, from 500 nm thin metal donor layers. We analyze the micro-structural properties of the print geometry and their dependence on droplet volume, print gap and spreading. High quality printing of aluminum micro-patterns on plastic and paper is demonstrated. (paper)

  6. Evaluating the Effects of Aluminum-Containing and Non-Aluminum Containing Deodorants on Axillary Skin Toxicity During Radiation Therapy for Breast Cancer: A 3-Armed Randomized Controlled Trial

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Lucy, E-mail: Lucy.lewis@curtin.edu.au [Centre for Nursing Research, Sir Charles Gairdner Hospital, Nedlands, Western Australia (Australia); School of Nursing and Midwifery Curtin University, Perth (Australia); Carson, Sharron [Radiation Oncology, Sir Charles Gairdner Hospital, Nedlands, Western Australia (Australia); Bydder, Sean [Radiation Oncology, Sir Charles Gairdner Hospital, Nedlands, Western Australia (Australia); School of Surgery, The University of Western Australia, Crawley, Western Australia (Australia); Athifa, Mariyam [School of Nursing and Midwifery Curtin University, Perth (Australia); Williams, Anne M. [School of Nursing and Midwifery Curtin University, Perth (Australia); School of Nursing and Midwifery, Edith Cowan University, Perth, Western Australia (Australia); Bremner, Alexandra [School of Population Health, The University of Western Australia, Crawley, Western Australia (Australia)

    2014-11-15

    Purpose: Deodorant use during radiation therapy for breast cancer has been controversial as there are concerns deodorant use may exacerbate axillary skin toxicity. The present study prospectively determined the use of both aluminum-containing and non aluminum containing deodorants on axillary skin toxicity during conventionally fractionated postoperative radiation therapy for breast cancer. Methods and Materials: This 3-arm randomized controlled study was conducted at a single center, tertiary cancer hospital between March 2011 and April 2013. Participants were randomized to 1 of 2 experimental groups (aluminum-containing deodorant and soap or non–aluminum containing deodorant and soap) or a control group (soap). A total of 333 participants were randomized. Generalized estimating equations were used to estimate and compare the odds of experiencing high levels of sweating and skin toxicity in each of the deodorant groups to the odds in the control group. The study evaluated a range of endpoints including objective measurements of axilla sweating, skin toxicity, pain, itch and burning. Quality of life was assessed with a validated questionnaire. Results: Radiation characteristics were similar across all groups. Patients in the deodorant groups did not report significantly different ratings for axillary pain, itch, or burning compared with the control group. Patients in the aluminum-containing deodorant group experienced significantly less sweating than the control; the odds of their sweating being barely tolerable and frequently or always interfering with their daily activities was decreased by 85% (odds ratio, 0.15; 95% confidence interval, 0.03-0.91). Conclusions: We found no evidence that the use of either aluminum-containing or non–aluminum containing deodorant adversely effects axillary skin reaction during conventionally fractionated radiation therapy for breast cancer. Our analysis also suggests patients in the aluminum-containing deodorant arm had

  7. Evaluating the Effects of Aluminum-Containing and Non-Aluminum Containing Deodorants on Axillary Skin Toxicity During Radiation Therapy for Breast Cancer: A 3-Armed Randomized Controlled Trial

    International Nuclear Information System (INIS)

    Lewis, Lucy; Carson, Sharron; Bydder, Sean; Athifa, Mariyam; Williams, Anne M.; Bremner, Alexandra

    2014-01-01

    Purpose: Deodorant use during radiation therapy for breast cancer has been controversial as there are concerns deodorant use may exacerbate axillary skin toxicity. The present study prospectively determined the use of both aluminum-containing and non aluminum containing deodorants on axillary skin toxicity during conventionally fractionated postoperative radiation therapy for breast cancer. Methods and Materials: This 3-arm randomized controlled study was conducted at a single center, tertiary cancer hospital between March 2011 and April 2013. Participants were randomized to 1 of 2 experimental groups (aluminum-containing deodorant and soap or non–aluminum containing deodorant and soap) or a control group (soap). A total of 333 participants were randomized. Generalized estimating equations were used to estimate and compare the odds of experiencing high levels of sweating and skin toxicity in each of the deodorant groups to the odds in the control group. The study evaluated a range of endpoints including objective measurements of axilla sweating, skin toxicity, pain, itch and burning. Quality of life was assessed with a validated questionnaire. Results: Radiation characteristics were similar across all groups. Patients in the deodorant groups did not report significantly different ratings for axillary pain, itch, or burning compared with the control group. Patients in the aluminum-containing deodorant group experienced significantly less sweating than the control; the odds of their sweating being barely tolerable and frequently or always interfering with their daily activities was decreased by 85% (odds ratio, 0.15; 95% confidence interval, 0.03-0.91). Conclusions: We found no evidence that the use of either aluminum-containing or non–aluminum containing deodorant adversely effects axillary skin reaction during conventionally fractionated radiation therapy for breast cancer. Our analysis also suggests patients in the aluminum-containing deodorant arm had

  8. All-Aluminum Thin Film Transistor Fabrication at Room Temperature

    Directory of Open Access Journals (Sweden)

    Rihui Yao

    2017-02-01

    Full Text Available Bottom-gate all-aluminum thin film transistors with multi conductor/insulator nanometer heterojunction were investigated in this article. Alumina (Al2O3 insulating layer was deposited on the surface of aluminum doping zinc oxide (AZO conductive layer, as one AZO/Al2O3 heterojunction unit. The measurements of transmittance electronic microscopy (TEM and X-ray reflectivity (XRR revealed the smooth interfaces between ~2.2-nm-thick Al2O3 layers and ~2.7-nm-thick AZO layers. The devices were entirely composited by aluminiferous materials, that is, their gate and source/drain electrodes were respectively fabricated by aluminum neodymium alloy (Al:Nd and pure Al, with Al2O3/AZO multilayered channel and AlOx:Nd gate dielectric layer. As a result, the all-aluminum TFT with two Al2O3/AZO heterojunction units exhibited a mobility of 2.47 cm2/V·s and an Ion/Ioff ratio of 106. All processes were carried out at room temperature, which created new possibilities for green displays industry by allowing for the devices fabricated on plastic-like substrates or papers, mainly using no toxic/rare materials.

  9. Inability to produce a model of dialysis encephalopathy in the rat by aluminum administration.

    Science.gov (United States)

    Perry, T L; Yong, V W; Godolphin, W J; Sutter, M; Hansen, S; Kish, S J; Foulks, J G; Ito, M

    1987-04-01

    We attempted to produce a rat model of brain aluminum toxicity in order to explore whether or not aluminum accumulation produces the neurochemical changes observed in brains of patients who die with dialysis encephalopathy. Daily subcutaneous injection of Al(OH)3 caused marked elevation of serum aluminum concentrations, but did not increase brain aluminum contents, either in rats with normal renal function, or in rats with unilateral or 5/6 nephrectomies. LiCl pretreatment, which has been reported to cause irreversible renal failure, did not impair renal function nor aid in achieving elevated brain aluminum contents. No reductions in brain contents of gamma-aminobutyric acid (GABA) or in glutamic acid decarboxylase (GAD, E.C.4.1.1.15) and choline acetyltransferase (ChAT, E.C.2.3.1.6) activities were observed in aluminum-treated rats. We conclude that the rat is not a suitable laboratory animal to explore the role of aluminum toxicity in causing the GABA and ChAT deficits present in brains of hemodialyzed human patients.

  10. Corrosion control of aluminum surfaces by polypyrrole films: influence of electrolyte

    Directory of Open Access Journals (Sweden)

    Andréa Santos Liu

    2007-06-01

    Full Text Available Polypyrrole (PPy films were galvanostatically deposited on 99.9 wt. (% aluminum electrodes from aqueous solutions containing each carboxylic acid: tartaric, oxalic or citric. Scanning Electron Microscopy (SEM was used to analyze the morphology of the aluminum surfaces coated with the polymeric films. It was observed that the films deposited from tartaric acid medium presented higher homogeneity than those deposited from oxalic and citric acid. Furthermore, the corrosion protection of aluminum surfaces by PPy films was also investigated by potentiodynamic polarization experiments.

  11. Guangdong Aluminum to Raise RMB 3 billion for New Production Base in Guizhou

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    <正>On July 7, a loan signing ceremony was held between the Guangdong Aluminum Group, China Construction Bank, Hua Xia Bank and Guangzhou Bank Consortium. It is reported that these banks will provide Guangdong Aluminum Group with RMB 30 billion for an alu-minum oxide and supporting bauxite mining project in Guizhou.

  12. High-strength and high-RRR Al-Ni alloy for aluminum-stabilized superconductor

    CERN Document Server

    Wada, K; Sakamoto, H; Yamamoto, A; Makida, Y

    2000-01-01

    The precipitation type aluminum alloys have excellent performance as the increasing rate in electric resistivity with additives in the precipitation state is considerably low, compared to that of the aluminum alloy with additives in the solid-solution state. It is possible to enhance the mechanical strength without remarkable degradation in residual resistivity ratio (RRR) by increasing content of selected additive elements. Nickel is the suitable additive element because it has very low solubility in aluminum and low increasing rate in electric resistivity, and furthermore, nickel and aluminum form intermetallic compounds which effectively resist the motion of dislocations. First, Al-0.1wt%Ni alloy was developed for the ATLAS thin superconducting solenoid. This alloy achieved high yield strength of 79 MPa (R.T.) and 117 MPa (4.2 K) with high RRR of 490 after cold working of 21% in area reduction. These highly balanced properties could not be achieved with previously developed solid-solution aluminum alloys. ...

  13. 75 FR 51243 - Aluminum Extrusions from the People's Republic of China: Postponement of Preliminary...

    Science.gov (United States)

    2010-08-19

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-967] Aluminum Extrusions from the... Department of Commerce (``the Department'') initiated an antidumping duty investigation on Aluminum... Aluminum Extrusions from the People's Republic of China: Initiation of Antidumping Duty Investigation, 75...

  14. 75 FR 69403 - Aluminum Extrusions From the People's Republic of China: Notice of Preliminary Determination of...

    Science.gov (United States)

    2010-11-12

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-967] Aluminum Extrusions From the... Commerce (``Department'') preliminarily determines that aluminum extrusions from the People's Republic of... of aluminum extrusions from the PRC filed in proper form by the Aluminum Extrusions Fair Trade...

  15. Fatigue in Aluminum Highway Bridges under Random Loading

    DEFF Research Database (Denmark)

    Rom, Søren; Agerskov, Henning

    2014-01-01

    Fatigue damage accumulation in aluminum highway bridges under random loading is studied. The fatigue life of welded joints has been determined both experimentally and from a fracture mechanics analysis. In the experimental part of the investigation, fatigue test series on welded plate test...... is normally used in the design against fatigue in aluminum bridges, may give results which are unconservative. The validity of the results obtained from Miner’s rule will depend on the distribution of the load history in tension and compression....

  16. Etching Behavior of Aluminum Alloy Extrusions

    Science.gov (United States)

    Zhu, Hanliang

    2014-11-01

    The etching treatment is an important process step in influencing the surface quality of anodized aluminum alloy extrusions. The aim of etching is to produce a homogeneously matte surface. However, in the etching process, further surface imperfections can be generated on the extrusion surface due to uneven materials loss from different microstructural components. These surface imperfections formed prior to anodizing can significantly influence the surface quality of the final anodized extrusion products. In this article, various factors that influence the materials loss during alkaline etching of aluminum alloy extrusions are investigated. The influencing variables considered include etching process parameters, Fe-rich particles, Mg-Si precipitates, and extrusion profiles. This study provides a basis for improving the surface quality in industrial extrusion products by optimizing various process parameters.

  17. Aluminum recycling—An integrated, industrywide approach

    Science.gov (United States)

    Das, Subodh K.; Green, John A. S.; Kaufman, J. Gilbert; Emadi, Daryoush; Mahfoud, M.

    2010-02-01

    The aluminum industry is a leading proponent of global sustainability and strongly advocates the use of recycled metal. As the North American primary aluminum industry continues to move offshore to other geographic areas such as Iceland and the Middle East, where energy is more readily available at lower cost, the importance of the secondary (i.e., recycled metal) market in the U.S. will continue to increase. The purpose of this paper is to take an integrated, industry-wide look at the recovery of material from demolished buildings, shredded automobiles, and aging aircraft, as well as from traditional cans and other rigid containers. Attempts will be made to assess how the different alloys used in these separate markets can be recycled in the most energy-efficient manner.

  18. Nano-TiO{sub 2} coatings on aluminum surfaces by aerosol flame synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Liberini, Mariacira; De Falco, Gianluigi; Scherillo, Fabio; Astarita, Antonello [Dipartimento di Ingegneria Chimica, dei Materiali e della Produzione Industriale, Università degli Studi di Napoli Federico II, Napoli 80125 (Italy); Commodo, Mario; Minutolo, Patrizia [Istituto di Ricerche sulla Combustione, CNR, Napoli 80125 (Italy); D' Anna, Andrea, E-mail: anddanna@unina.it [Dipartimento di Ingegneria Chimica, dei Materiali e della Produzione Industriale, Università degli Studi di Napoli Federico II, Napoli 80125 (Italy); Squillace, Antonino [Dipartimento di Ingegneria Chimica, dei Materiali e della Produzione Industriale, Università degli Studi di Napoli Federico II, Napoli 80125 (Italy)

    2016-06-30

    Aluminum alloys are widely used in the aeronautic industry for their high mechanical properties; however, because they are very sensitive to corrosion, surface treatments are often required. TiO{sub 2} has excellent resistance to oxidation and it is often used to improve the corrosion resistance of aluminum surfaces. Several coating procedures have been proposed over the years, which are in some cases expensive in terms of production time and amount of deposited material. Moreover, they can damage aluminum alloys if thermal treatments are required. In this paper, a one-step method for the coating of aluminum surfaces with titania nanoparticles is presented. Narrowly sized, TiO{sub 2} nanoparticles are synthesized by flame aerosol and directly deposited by thermophoresis onto cold plates of aluminum AA2024. Submicron coatings of different thicknesses are obtained from two flame synthesis conditions by varying the total deposition time. A fuel-lean synthesis condition was used to produce 3.5 nm pure anatase nanoparticles, while a mixture of rutile and anatase nanoparticles having 22 nm diameter — rutile being the predominant phase —, was synthesized in a fuel-rich condition. Scanning electron microscopy is used to characterize morphology of titania films, while coating thickness is measured by confocal microscopy measurements. Electrochemical impedance spectroscopy is used to evaluate corrosion resistance of coated aluminum substrates. Results show an improvement of the electrochemical behavior of titania coated surfaces as compared to pristine aluminum surfaces. The best results are obtained by covering the substrates with 3.5 nm anatase-phase nanoparticles and with lower deposition times, that assure a uniform surface coating. - Highlights: • Nanosized TiO{sub 2} particles produced by aerosol flame synthesis • Coatings of aluminum substrates with TiO{sub 2} nanoparticles by thermophoretic deposition in flames • Thickness measurement by confocal microscopy

  19. Friction reducing behavior of stearic acid film on a textured aluminum substrate

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Quan [School of Mechanical Engineering, Qingdao Technological University, Qingdao 266033 (China); Wan, Yong, E-mail: wanyong@qtech.edu.cn [School of Mechanical Engineering, Qingdao Technological University, Qingdao 266033 (China); Li, Yang; Yang, Shuyan [School of Mechanical Engineering, Qingdao Technological University, Qingdao 266033 (China); Yao, Wenqing [Analysis Center of Tsinghua University, Beijing 100084 (China)

    2013-09-01

    A simple two-step process was developed to render the aluminum hydrophobicity with lower friction. The textured aluminum substrate was firstly fabricated by immersed in a sodium hydroxide solution at 100 °C for 1 h. Stearic acid film was then deposited to acquire high hydrophobicity. Scanning electron microscopy, IR spectroscopy and water contact angle measurements were used to analyze the morphological features, chemical structure and hydrophobicity of prepared samples, respectively. Moreover, the friction reducing behavior of the organic–inorganic composite film on aluminum sliding against steel was evaluated in a ball-on-plate configuration. It was found that the stearic acid film on the textured aluminum led to decreased friction with significantly extended life.

  20. Passivation process for superfine aluminum powders obtained by electrical explosion of wires

    International Nuclear Information System (INIS)

    Kwon, Young-Soon; Gromov, Alexander A.; Ilyin, Alexander P.; Rim, Geun-Hie

    2003-01-01

    The process of passivation of superfine aluminum powders (SFAPs) (a s ≤100 nm), obtained with the electrical explosion of wires (EEW) method, has been studied. The passivation coatings of different nature (oxides, stearic acid and aluminum diboride) were covered on the particle surface. The process of passivation and analysis of passivated powders was studied by X-ray photoelectron spectroscopy (XPS), XRD, TEM, infrared spectroscopy (IR), mass spectrometry (MS), thermocouple method and bomb calorimetry. After the comprehensive testing of coatings, a model of stabilization of the superfine aluminum particles was suggested, explaining the anomalous high content of aluminum metal in the electroexplosive powders. The main characteristic of the model is a formation of charged structures, which prevent metal oxidation

  1. 49 CFR 178.506 - Standards for metal drums other than steel or aluminum.

    Science.gov (United States)

    2010-10-01

    ... aluminum. 178.506 Section 178.506 Transportation Other Regulations Relating to Transportation PIPELINE AND... drums other than steel or aluminum. (a) The following are the identification codes for metal drums other than steel or aluminum: (1) 1N1 for a non-removable head metal drum; and (2) 1N2 for a removable head...

  2. Oxidation of zirconium-aluminum alloys

    International Nuclear Information System (INIS)

    Cox, B.

    1967-10-01

    Examination of the processes occurring during the oxidation of Zr-1% A1, Zr-3% A1, and Zr-1.5% A1-0.5% Mo alloys has shown that in steam rapid oxidation occurs predominantly around the Zr 3 A1 particles, which at low temperatures appear to be relatively unattacked. The unoxidised particles become incorporated in the oxide, and become fully oxidised as the film thickens. This rapid localised oxidation is preceded by a short period of uniform film growth, during which the oxide film thickness does not exceed ∼200A-o. Thus the high oxidation rates can probably be ascribed to aluminum in solution in the zirconium matrix, although its precise mode of operation has not been determined. Once the solubility limit of aluminum is exceeded, the size, distribution and number of intermetallic particles affects the oxidation rate merely by altering the distribution of regions of metal giving high oxidation rates. The controlling process during the early stages of oxidation is electron transport and not ionic transport. Thus, the aluminum in the oxide film is presumably increasing the ionic conductivity more than the electronic. The oxidation rates in atmospheric pressure steam are very high and their irregular temperature dependence suggests that the oxidation rate will be pressure dependent. This was confirmed, in part, by a comparison with oxidation in moist air. It was found that the rate of development of white oxide around intermetallic particles was considerably reduced by the decrease in the partial pressure of H 2 O; the incubation period was not much different, however. (author)

  3. Torsion Property of the Structure Bonded Aluminum Foam Due to Impact

    Directory of Open Access Journals (Sweden)

    Hwang G.W.

    2017-06-01

    Full Text Available An aluminum foam added with foaming agent, is classified into an open-cell type for heat transfer and a closed-cell type for shock absorption. This study investigates the characteristic on the torsion of aluminum foam for a closed-cell type under impact. The fracture characteristics are investigated through the composite of five types of aluminum foam (the thicknesses of 25, 35, 45, 55 and 65 mm, when applying the torsional moment of impact energy on the junction of a porous structure attached by an adhesive. When applying the impact energy of 100, 200 and 300J, the aluminum foams with thicknesses of 25 mm and 35 mm broke off under all conditions. For the energy over 200J, aluminums thicker than 55 mm continued to be attached. Furthermore, the aluminum specimens with thicknesses of 55 mm and 65 mm that were attached with more than 30% of bonding interface remained, proving that they could maintain bonding interface against impact energy. By comparing the data based on the analysis and test result, an increase in the thickness of specimen leads to the plastic deformation as the stress at the top and bottom of bonding interface moves to the middle by spreading the stress horizontally. Based on this fracture characteristic, this study can provide the data on the destruction and separation of bonding interface and may contribute to the safety design.

  4. The corrosion behavior of iron and aluminum under waste disposal conditions

    International Nuclear Information System (INIS)

    Fujisawa, R.; Cho, T.; Sugahara, K.; Takizawa, Y.; Hironaga, M.

    1997-01-01

    The generation of hydrogen gas from metallic waste in corrosive disposal environment is an important issue for the safety analysis of low-level radioactive waste disposal facilities in Japan. In particular iron and aluminum are the possibly important elements regarding the gas generation. However, the corrosion behavior of these metals has not been sufficiently investigated under the highly alkaline non-oxidizing disposal conditions yet. The authors studied the corrosion behavior of iron and aluminum under simulated disposal environments. The quantity of hydrogen gas generated from iron was measured in a closed cell under highly alkaline non-oxidizing conditions. The observed corrosion rate of iron in the initial period of immersion was 4 nm/year at 15 C, 20 nm/year at 30 C, and 200 nm/year at 45 C. The activation energy was found to be 100 kJ/mol from Arrhenius plotting of the above corrosion rates. The corrosion behavior of aluminum was studied under an environment simulating conditions in which aluminum was solidified with mortar. In the initial period aluminum corroded rapidly with a corrosion rate of 20 mm/year. However, the corrosion rate decreased with time, and after 1,000 hours the rate reached 0.001 to 0.01 mm/year. Thus the authors obtained data on hydrogen gas generation from iron and aluminum under the disposal environment relevant to the safety analysis of low-level radioactive disposal facilities in Japan

  5. Electroerosion formation and technology of cast iron coatings on aluminum alloys

    Directory of Open Access Journals (Sweden)

    Smolentsev Vladislav P.

    2017-01-01

    Full Text Available At present in the course of designing basic production parts and industrial equipment designers pay more and more attention to aluminum alloys having a number of properties compared favorably with other materials. In particular, technological aluminum tool electrodes without coating in the presence of products of processing with alkali in the composition of operation environment are being destroyed at the expense of intensified material dissolution. It is shown in the paper that the method offered by the authors and covered by the patents on cast iron coating of products made of aluminum alloys, allows obtaining on a product surface the layers with high adhesion durability ensuring a high protection against destruction in the friction units including operation in hostile environment. Thereupon, aluminum, as compared with iron-based alloys used at manufacturing technological equipment for electrical methods of processing, has a high electrical and thermal conduction, its application will allow achieving considerable energy-saving in the course of parts production. A procedure for the design of a technological process of qualitative cast iron coatings upon aluminum tool electrodes and parts of basic production used in different branches of mechanical engineering is developed.

  6. Electrochemical Deposition of Aluminum from NaCl-AlCl3 Melts

    DEFF Research Database (Denmark)

    Li, Qingfeng; Hjuler, H. A.; Berg, Rolf W.

    1990-01-01

    Electrochemical deposition of aluminum from NaAlCl4 melts saturated with NaCl onto a glassy carbon electrode at175°C has been studied by voltammetry, chronoamperometry, and constant current deposition. The deposition of aluminumwas found to proceed via a nucleation/growth mechanism, and the nucle......Electrochemical deposition of aluminum from NaAlCl4 melts saturated with NaCl onto a glassy carbon electrode at175°C has been studied by voltammetry, chronoamperometry, and constant current deposition. The deposition of aluminumwas found to proceed via a nucleation/growth mechanism......, and the nucleation process was found to be progressive.The morphology of aluminum deposits was examined with photomicroscopy. It was shown that depending on the currentdensities (c.d.) applied, three types of aluminum deposits could be obtained, namely, spongy deposits formed at lower c.d.(below 0.7 mA/cm2), smooth...... layers deposited at intermediate c.d. (between 2 and 10 mA/cm2), and dendritic or porous depositsobtained at high c.d. (above 15 mA/cm2). However, the smooth aluminum deposits were about five times more voluminousthan the theoretical value. The spongy deposits were formed due to difficulties...

  7. 75 FR 1596 - Grant of Authority for Subzone Status, Reynolds Packaging LLC (Aluminum Foil Liner Stock...

    Science.gov (United States)

    2010-01-12

    ... Status, Reynolds Packaging LLC (Aluminum Foil Liner Stock), Louisville, Kentucky Pursuant to its...-purpose subzone at the aluminum foil liner stock manufacturing and distribution facilities of Reynolds... manufacturing and distribution of aluminum foil liner stock and aluminum foil at the facilities of Reynolds...

  8. Rule of formation of aluminum electroplating layer on Q235 steel.

    Science.gov (United States)

    Ding, Zhimin; Feng, Qiuyuan; Shen, Changbin; Gao, Hong

    2011-06-01

    Aluminum electroplating layer on Q235 steel in AlCl3-NaCl-KCl molten salt was obtained, and the rule of its nucleation and growth were investigated. The results showed that aluminum electroplating layer formed through nucleating and growing of aluminum particles, and thickened by delaminating growth pattern. At low current density, the morphology of aluminum particles took on flake-like, while at high current density they changed to spherical. The thickness of plating layer increases with increasing current density and electroplating time. The relationship between the plating thickness (δ) and electroplating time (t) or current density (i) can be expressed as δ = 0.28f(137), and δ = 1.1i(1-39). Copyright © 2011 The Research Centre for Eco-Environmental Sciences, Chinese Academy of Sciences. Published by Elsevier B.V. All rights reserved.

  9. Cerium oxide as conversion coating for the corrosion protection of aluminum

    Directory of Open Access Journals (Sweden)

    JELENA GULICOVSKI

    2013-11-01

    Full Text Available CeO2 coatings were formed on the aluminum after Al surface preparation, by dripping the ceria sol, previously prepared by forced hydrolysis of Ce(NO34. The anticorrosive properties of ceria coatings were investigated by the electrochemical impedance spectroscopy (EIS during the exposure to 0.03 % NaCl. The morphology of the coatings was examined by the scanning electron microscopy (SEM. EIS data indicated considerably larger corrosion resistance of CeO2-coated aluminum than for bare Al. The corrosion processes on Al below CeO2 coating are subjected to more pronounced diffusion limitations in comparison to the processes below passive aluminum oxide film, as the consequence of the formation of highly compact protective coating. The results show that the deposition of ceria coatings is an effective way to improve corrosion resistance for aluminum.

  10. Environment assisted degradation mechanisms in aluminum-lithium alloys

    Science.gov (United States)

    Gangloff, Richard P.; Stoner, Glenn E.; Swanson, Robert E.

    1988-01-01

    Section 1 of this report records the progress achieved on NASA-LaRC Grant NAG-1-745 (Environment Assisted Degradation Mechanisms in Al-Li Alloys), and is based on research conducted during the period April 1 to November 30, 1987. A discussion of work proposed for the project's second year is included. Section 2 provides an overview of the need for research on the mechanisms of environmental-mechanical degradation of advanced aerospace alloys based on aluminum and lithium. This research is to provide NASA with the basis necessary to permit metallurgical optimization of alloy performance and engineering design with respect to damage tolerance, long term durability and reliability. Section 3 reports on damage localization mechanisms in aqueous chloride corrosion fatigue of aluminum-lithium alloys. Section 4 reports on progress made on measurements and mechanisms of localized aqueous corrosion in aluminum-lithium alloys. Section 5 provides a detailed technical proposal for research on environmental degradation of Al-Li alloys, and the effect of hydrogen in this.

  11. Controlling harmful algae blooms using aluminum-modified clay.

    Science.gov (United States)

    Liu, Yang; Cao, Xihua; Yu, Zhiming; Song, Xiuxian; Qiu, Lixia

    2016-02-15

    The performances of aluminum chloride modified clay (AC-MC), aluminum sulfate modified clay (AS-MC) and polyaluminum chloride modified clay (PAC-MC) in the removal of Aureococcus anophagefferens were compared, and the potential mechanisms were analyzed according to the dispersion medium, suspension pH and clay surface charges. The results showed that AC-MC and AS-MC had better efficiencies in removing A.anophagefferens than PAC-MC. The removal mechanisms of the three modified clays varied. At optimal coagulation conditions, the hydrolysates of AC and AS were mainly monomers, and they transformed into Al(OH)3(am) upon their addition to algae culture, with the primary mechanism being sweep flocculation. The PAC mainly hydrolyzed to the polyaluminum compounds, which remained stable when added to the algae culture, and the flocculation mainly occurred through polyaluminum compounds. The suspension pH significantly influenced the aluminum hydrolysate and affected the flocculation between the modified clay and algae cells. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Mechanical failure of anodized aluminum under three and four-point bending tests

    International Nuclear Information System (INIS)

    Bargui, M.; Bensalah, W.; Elleuch, K.; Ayedi, H.F.

    2013-01-01

    Highlights: • We study the flexural behavior of anodic oxide layers formed on aluminum. • Three and four-point bending tests were used as techniques. • Changing the beam configuration will change the flexural response. - Abstract: In this work, three and four-point bending tests were adopted as methods for characterizing anodized aluminum beams in a sulfuric acid bath. The failure behavior of sandwich beams having aluminum oxide face sheets and aluminum core were tested. In so doing, many configurations were adopted by anodizing aluminum beams on one and both sides to investigate faces in place of tension and compression. Bending tests showed different behaviors. When the oxide was only on the top side of the beam (working in compression) a slight sudden decrease of the load was observed. This fact was absent on beams with oxide layers working in tensile. The bending behavior of sandwich beams was similar to those with oxide on top sides but with much higher loads. The mechanical failure of the oxide was mainly caused by its failure when it is placed in compression beneath the loading rollers. Finally, a morphological study of the aluminum oxide layers after bending tests was conducted by optical microscopy

  13. Typical corrosion of alumina refractory in aluminum reflow oven

    International Nuclear Information System (INIS)

    Baldo, Jaoa B.

    2014-01-01

    The refractory linings of furnaces for secondary melting of aluminum, are exposed to intense attack by the molten metal. This occurs, because molten aluminum has a strong reducing power over the refractory oxide components, particularly Fe 2 O 3 , SiO 2 and TiO 2 . In this work, based on X-ray diffraction and scanning electron microscopy, it is presented a post mortem study of the mechanisms that lead to a premature wear of a 80% Al2O3 chemically bonded refractory bricks, used in the metal line of an aluminum re-melting furnace. The SEM analysis demonstrated that the oxides SiO 2 and TiO 2 contained in the refractory were reduced and transformed into their metallic elements causing an intense structural spalling. (author)

  14. Comments on process of duplex coatings on aluminum alloys

    Institute of Scientific and Technical Information of China (English)

    Samir H.A.; QIAN Han-cheng(钱翰城); XIA Bo-cai(夏伯才); WU Shi-ming(吴仕明)

    2004-01-01

    Despite the great achievements made in improvement of wear resistance properties of aluminum alloys,their applications in heavy surface load-bearing are limited. Single coating is insufficient to produce the desired combination of surface properties. These problems can be solved through the duplex coatings. The aim of the present study is to overview the research advances on processes of duplex coatings on aluminum alloys combined with micro plasma oxidation process and with other modern processes such as physical vapour deposition and plasma assisted chemical vapour deposition and also to evaluate the performance of micro plasma oxidation coatings in improving the load-bearing, friction and wear resistance properties of aluminum alloys in comparison with other coatings. Wherein, a more detailed presentation of the processes and their performances and disadvantages are given as well.

  15. Diffusionless bonding of aluminum to type 304 stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Watson, R D

    1963-03-15

    High strength diffusionless bonds can be produced between 1S aluminum and oxidized 304 stainless steel by hot pressing and extrusion bonding. Both the hot pressing and extrusion bonding techniques have been developed to a point where consistently good bonds can be obtained. Although the bonding is performed at elevated temperatures (about 510{sup o}C) a protective atmosphere is not required to produce strong bonds. The aluminum-stainless steel bonded specimens can be used to join aluminum and stainless steel by conventional welding. Welding close to the bond zone does not appear to affect the integrity of the bond. The extrusion bonding technique is covered by Canadian patent 702,438 January 26, 1965 and the hot press bonding technique by Canadian patent application 904,548 June 6, 1964. (author)

  16. Extraction of lithium from sea water with metallic aluminum

    International Nuclear Information System (INIS)

    Takeuchi, Takeji

    1980-01-01

    Extraction of lithium from sea water was investigated. It was found that a corrosion product of metallic aluminum immersed in sea water extracts lithium from it selectively. Effects of the temperature and the pH of sea water, and of the initial concentration of lithium in it were examined. On the basis of the analysis of the surface deposit on aluminum, which is a corrosion product of aluminum, the selectivity coefficients were calculated. For the extraction of lithium from natural sea water, the values of K sub(Na)sup(Li), K sub(Mg)sup(Li), K sub(Ca)sup(Li) and K sub(K)sup(Li) were 9.9 x 10 2 , 1.1 x 10, 4.5 x 10 and 4.4 x 10 2 , respectively. (author)

  17. Characterization of 2024-T3: An aerospace aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    Huda, Zainul [Department of Mechanical Engineering, University of Malaya, Kuala Lumpur (Malaysia)], E-mail: drzainulhuda@hotmail.com; Taib, Nur Iskandar [Department of Geology, University of Malaya, Kuala Lumpur (Malaysia)], E-mail: ntaib@alumni.indiana.edu; Zaharinie, Tuan [Department of Mechanical Engineering, University of Malaya, Kuala Lumpur (Malaysia)], E-mail: rinie_3483@hotmail.com

    2009-02-15

    The 2024-T3 aerospace aluminum alloy, reported in this investigation, was acquired from a local aerospace industry: Royal Malaysian Air Force (RMAF). The heat treatable 2024-T3 aluminum alloy has been characterized by use of modern metallographic and material characterization techniques (e.g. EPMA, SEM). The microstructural characterization of the metallographic specimen involved use of an optical microscope linked with a computerized imaging system using MSQ software. The use of EPMA and electron microprobe elemental maps enabled us to detect three types of inclusions: Al-Cu, Al-Cu-Fe-Mn, and Al-Cu-Fe-Si-Mn enriched regions. In particular, the presence of Al{sub 2}CuMg (S-phase) and the CuAl{sub 2} ({theta}') phases indicated precipitation strengthening in the aluminum alloy.

  18. Diffusionless bonding of aluminum to type 304 stainless steel

    International Nuclear Information System (INIS)

    Watson, R.D.

    1963-03-01

    High strength diffusionless bonds can be produced between 1S aluminum and oxidized 304 stainless steel by hot pressing and extrusion bonding. Both the hot pressing and extrusion bonding techniques have been developed to a point where consistently good bonds can be obtained. Although the bonding is performed at elevated temperatures (about 510 o C) a protective atmosphere is not required to produce strong bonds. The aluminum-stainless steel bonded specimens can be used to join aluminum and stainless steel by conventional welding. Welding close to the bond zone does not appear to affect the integrity of the bond. The extrusion bonding technique is covered by Canadian patent 702,438 January 26, 1965 and the hot press bonding technique by Canadian patent application 904,548 June 6, 1964. (author)

  19. Aluminum metabolism studied by [sup 26]Al tracer using AMS technique

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Koichi (Tokyo Univ. (Japan). Research Center for Nuclear Science and Technology); Yumoto, Sakae; Nagai, Hisao; Hosoyama, Yoshiyuki; Imamura, Mineo; Hotta, Masayoshi; Ohashi, Hideo

    1992-01-01

    By accelerator mass spectrometry (AMS), we studied aluminum metabolism using [sup 26]Al as a tracer. To investigate the role of aluminum toxicity in the etiology of amyotrophic lateral sclerosis (ALS) and Alzheimer's disease, aluminum incorporation into the rat cerebrum was studied. When healthy rats were injected intraperitoneally with [sup 26]Al, a considerable amount of the tracer was incorporated into the brain within only 5 days after the injection. This [sup 26]Al accumulation was apparently irreversible, since it persisted even after 75 days. (author).

  20. Mechanical properties of composite coatings of chromium and nanodiamonds on aluminum

    Directory of Open Access Journals (Sweden)

    Gidikova Nelly

    2018-01-01

    Full Text Available Aluminum offers engineers weight saving advantages in their product design. However, aluminum has poor wear and friction properties. In addition, the surface oxide layer of this chemically active metal, which gives it the corrosion resistance, makes it a very difficult metal to plate [1]. Specific pre-treatment must be applied to remove the oxide layer from the aluminum surface. The nanodiamond particles additionally facilitates the process of chromium deposition. The object of this study is to evaluate the impact of nanodiamonds on the mechanical properties of the chromium coating plated on

  1. Aluminum and iron contents in phosphate treated swamp rice farm ...

    African Journals Online (AJOL)

    In 2006 aluminum and iron contents were determined in phosphate treated swamp rice farm of Mbiabet, Akwa Ibom State. The objectives were to determine the aluminum and iron contents, the effect of drying, phosphate and lime application in an acid sulphate soil grown to rice in Nigeria. The soil samples used were ...

  2. exploration the extrudability of aluminum matrix composite (lm6/tic)

    African Journals Online (AJOL)

    lanez

    2017-11-24

    Nov 24, 2017 ... Aluminum matrix composites (LM6/TiC) is a mix of excellent properties of aluminum casting alloy (LM6), and particles of (TiC) which make it the first choice in many applications like airplane and marine industries. During this research the extrudability and mechanical specifications of this composite ...

  3. 75 FR 57441 - Aluminum Extrusions From the People's Republic of China: Alignment of Final Countervailing Duty...

    Science.gov (United States)

    2010-09-21

    ... DEPARTMENT OF COMMERCE International Trade Administration [C-570-968] Aluminum Extrusions From the... countervailing duty investigation of aluminum extrusions from the People's Republic of China (PRC) with the final... antidumping duty investigations on aluminum extrusions from the PRC. See Aluminum Extrusions from the People's...

  4. Static and Dynamic Behavior of High Modulus Hybrid Boron/Glass/Aluminum Fiber Metal Laminates

    Science.gov (United States)

    Yeh, Po-Ching

    2011-12-01

    This dissertation presents the investigation of a newly developed hybrid fiber metal laminates (FMLs) which contains commingled boron fibers, glass fibers, and 2024-T3 aluminum sheets. Two types of hybrid boron/glass/aluminum FMLs are developed. The first, type I hybrid FMLs, contained a layer of boron fiber prepreg in between two layers of S2-glass fiber prepreg, sandwiched by two aluminum alloy 2024-T3 sheets. The second, type II hybrid FMLs, contained three layer of commingled hybrid boron/glass fiber prepreg layers, sandwiched by two aluminum alloy 2024-T3 sheets. The mechanical behavior and deformation characteristics including blunt notch strength, bearing strength and fatigue behavior of these two types of hybrid boron/glass/aluminum FMLs were investigated. Compared to traditional S2-glass fiber reinforced aluminum laminates (GLARE), the newly developed hybrid boron/glass/aluminum fiber metal laminates possess high modulus, high yielding stress, and good blunt notch properties. From the bearing test result, the hybrid boron/glass/aluminum fiber metal laminates showed outstanding bearing strength. The high fiber volume fraction of boron fibers in type II laminates lead to a higher bearing strength compared to both type I laminates and traditional GLARE. Both types of hybrid FMLs have improved fatigue crack initiation lives and excellent fatigue crack propagation resistance compared to traditional GLARE. The incorporation of the boron fibers improved the Young's modulus of the composite layer in FMLs, which in turn, improved the fatigue crack initiation life and crack propagation rates of the aluminum sheets. Moreover, a finite element model was established to predict and verify the properties of hybrid boron/glass/aluminum FMLs. The simulated results showed good agreement with the experimental results.

  5. Electron-beam welding of aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Brillant, Marcel; de Bony, Yves

    1980-08-15

    The objective of this article is to describe the status of the application of electron-beam welding to aluminum alloys. These alloys are widely employed in the aeronautics, space and nuclear industries.

  6. Preparation of Phosphonic Acid Functionalized Graphene Oxide-modified Aluminum Powder with Enhanced Anticorrosive Properties

    Science.gov (United States)

    He, Lihua; Zhao, Yan; Xing, Liying; Liu, Pinggui; Wang, Zhiyong; Zhang, Youwei; Liu, Xiaofang

    2017-07-01

    To improve the anticorrosive performance of aluminum powder, a common functional filler in polymer coatings, we report a novel method to prepare graphene oxide modified aluminum powder (GO-Al) using 3-aminoproplyphosphoic acid as "link" agent. The GO nanosheets were firstly functionalized with 3-aminoproplyphosphoic acid (APSA) by the reaction of amine groups of APSA and the epoxy groups of GO. Subsequently, a layer of GO nanosheets uniformly and tightly covered the surface of flaky aluminum particle though the strong linking strength between -PO(OH)2 functional groups of the modified GO and aluminum. The hydrogen evolution experiment suggests that the GO attached on the aluminum powder could effectively improve the anticorrosive performance of the pigments.

  7. Plug-welding of ODS cladding tube for BOR-60 irradiation. Welding condition setting. Device remodeling and welding

    International Nuclear Information System (INIS)

    Seki, Masayuki; Ishibashi, Fujio; Kono, Syusaku; Hirako, Kazuhito; Tsukada, Tatsuya

    2003-04-01

    Irradiation test in BOR-60 at RIAR to judge practical use prospect of ODS cladding tube at early stage is planned as Japan-Russia a joint research. RIAR does fuel design of fuel pin used for this joint research. JNC manufactures ODS cladding tube and bar materials (two steel kind of martensite and ferrite), upper endplug production. They are welded by pressurized resistance welding, and are inspected in JNC Tokai, transported to RIAR. And RIAR manufactures vibration packing fuel pin. On the upper endplug welding by pressurized resistance welding method, we worded on the problems such as decision of welding condition by changing the size and crystallization of cladding tube and the design of endplug, and the chucking device remodeling to correspond to the long scale cladding tube welding system (included handling) and of quality assurance method. Especially, use of long scale cladding tube caused problem that bending transformation occurred in cladding tube by welding pressure. However, we solved this problem by shortening the distance of cladding tube colette chuck and pressure receiving, and by putting the sleeve in an internal space of welding machine, losing the bending of cladding tube. Moreover, welding defects were occurred by the difference of an inside state, an inside defect and recrystallization of cladding tube. We solved the problem by inside grinding for the edge of tube, angle beam method by ultrasonic wave, and ultrasonic wave form confirmation. Manufacturing process with long scale cladding tube including heat-treatment to remove combustion return and remaining stress was established besides, Afterwards, welding of ODS cladding tube and upper endplug. As the quality assurance system, we constructed [Documented procedure (referred to JOYO)] based on [Document of the QA plan] by OEC. Welding and inspection were executed by the document procedure. It is thought that the quality assurance method become references for the irradiation test in JOYO in the

  8. 76 FR 30650 - Aluminum Extrusions from the People's Republic of China: Antidumping Duty Order

    Science.gov (United States)

    2011-05-26

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-967] Aluminum Extrusions from the...''), the Department is issuing an antidumping duty order on aluminum extrusions from the People's Republic... of material injury by reason of imports of certain aluminum extrusions from the PRC, and its negative...

  9. Yttrium aluminum garnet coating on glass substrate

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Camila M.A.; Freiria, Gabriela S.; Faria, Emerson H. de; Rocha, Lucas A.; Ciuffi, Katia J.; Nassar, Eduardo J., E-mail: eduardo.nassar@unifran.edu.br

    2016-02-15

    Thin luminescent films have seen great technological advances and are applicable in the production of a variety of materials such as sensors, solar cells, photovoltaic devices, optical magnetic readers, waveguides, lasers, and recorders. Systems that contain yttrium aluminum oxide are important hosts for lanthanide ions and serve as light emission devices. This work deals with the deposition of yttrium aluminum garnet (YAG) film doped with Eu{sup 3+} onto a glass substrate obtained by the sol–gel methodology. Spray pyrolysis furnished the yttrium aluminum oxide powder. Dip-coating at a withdrawal speed of 10 mm min{sup −1} and evaporation led to deposition of different numbers of layers of the YAG:Eu{sup 3+} film onto the glass substrate from a YAG:Eu{sup 3+} powder suspension containing ethanol, water, and tetraethylorthosilicate. Photoluminescence, X-ray diffraction, scanning electron microscopy, and transparency measurements aided film characterization. The emission spectra revealed that the number of layers influenced film properties. - Highlights: • The spray pyrolysis was used to obtain luminescent YAG:Eu{sup 3+}. • The matrix was deposited as transparent films. • The YAG:Eu{sup 3+} was deposited by sol–gel process onto glass substrate.

  10. Yttrium aluminum garnet coating on glass substrate

    International Nuclear Information System (INIS)

    Ferreira, Camila M.A.; Freiria, Gabriela S.; Faria, Emerson H. de; Rocha, Lucas A.; Ciuffi, Katia J.; Nassar, Eduardo J.

    2016-01-01

    Thin luminescent films have seen great technological advances and are applicable in the production of a variety of materials such as sensors, solar cells, photovoltaic devices, optical magnetic readers, waveguides, lasers, and recorders. Systems that contain yttrium aluminum oxide are important hosts for lanthanide ions and serve as light emission devices. This work deals with the deposition of yttrium aluminum garnet (YAG) film doped with Eu 3+ onto a glass substrate obtained by the sol–gel methodology. Spray pyrolysis furnished the yttrium aluminum oxide powder. Dip-coating at a withdrawal speed of 10 mm min −1 and evaporation led to deposition of different numbers of layers of the YAG:Eu 3+ film onto the glass substrate from a YAG:Eu 3+ powder suspension containing ethanol, water, and tetraethylorthosilicate. Photoluminescence, X-ray diffraction, scanning electron microscopy, and transparency measurements aided film characterization. The emission spectra revealed that the number of layers influenced film properties. - Highlights: • The spray pyrolysis was used to obtain luminescent YAG:Eu 3+ . • The matrix was deposited as transparent films. • The YAG:Eu 3+ was deposited by sol–gel process onto glass substrate.

  11. Masking of aluminum surface against anodizing

    Science.gov (United States)

    Crawford, G. B.; Thompson, R. E.

    1969-01-01

    Masking material and a thickening agent preserve limited unanodized areas when aluminum surfaces are anodized with chromic acid. For protection of large areas it combines well with a certain self-adhesive plastic tape.

  12. Aluminum titanate crucible for molten uranium

    International Nuclear Information System (INIS)

    Asbury, J.J.

    1975-01-01

    An improved crucible for molten uranium is described. The crucible or crucible liner is formed of aluminum titanate which essentially eliminates contamination of uranium and uranium alloys during molten states thereof. (U.S.)

  13. Strong, corrosion-resistant aluminum tubing

    Science.gov (United States)

    Reed, M. W.; Adams, F. F.

    1980-01-01

    When aluminum tubing having good corrosion resistance and postweld strength is needed, type 5083 alloy should be considered. Chemical composition is carefully controlled and can be drawn into thin-wall tubing with excellent mechanical properties. Uses of tubing are in aircraft, boats, docks, and process equipment.

  14. Polymer nanoimprinting using an anodized aluminum mold for structural coloration

    Science.gov (United States)

    Kikuchi, Tatsuya; Nishinaga, Osamu; Natsui, Shungo; Suzuki, Ryosuke O.

    2015-06-01

    Polymer nanoimprinting of submicrometer-scale dimple arrays with structural coloration was demonstrated. Highly ordered aluminum dimple arrays measuring 530-670 nm in diameter were formed on an aluminum substrate via etidronic acid anodizing at 210-270 V and subsequent anodic oxide dissolution. The nanostructured aluminum surface led to bright structural coloration with a rainbow spectrum, and the reflected wavelength strongly depends on the angle of the specimen and the period of the dimple array. The reflection peak shifts gradually with the dimple diameter toward longer wavelength, reaching 800 nm in wavelength at 670 nm in diameter. The shape of the aluminum dimple arrays were successfully transferred to a mercapto-ester ultra-violet curable polymer via self-assembled monolayer coating and polymer replications using a nanoimprinting technique. The nanostructured polymer surfaces with positively and negatively shaped dimple arrays also exhibited structural coloration based on the periodic nanostructure, and reflected light mostly in the visible region, 400-800 nm. This nanostructuring with structural coloration can be easily realized by simple techniques such as anodizing, SAM coating, and nanoimprinting.

  15. Effect of sealing on the morphology of anodized aluminum oxide

    International Nuclear Information System (INIS)

    Hu, Naiping; Dong, Xuecheng; He, Xueying; Browning, James F.; Schaefer, Dale W.

    2015-01-01

    Highlights: • We explored structural change of anodizing aluminum oxide induced by sealing. • All sealing methods decrease pore size as shown by X-ray/neutron scattering. • Cold sealing and hot water sealing do not alter the aluminum oxide framework. • Hot nickel acetate sealing both fills the pores and deposits on air oxide interface. • Samples with hot nickel acetate sealing outperform other sealing methods. - Abstract: Ultra-small angle X-ray scattering (USAXS), small-angle neutron scattering (SANS), X-ray reflectometry (XRR) and neutron reflectometry (NR) were used to probe structure evolution induced by sealing of anodized aluminum. While cold nickel acetate sealing and hot-water sealing decrease pore size, these methods do not alter the cylindrical porous framework of the anodic aluminum oxide layer. Hot nickel acetate both fills the pores and deposits on the air surface (air–oxide interface), leading to low porosity and small mean pore radius (39 Å). Electrochemical impedance spectroscopy and direct current polarization show that samples sealed by hot nickel acetate outperform samples sealed by other sealing methods

  16. Understanding of radiation effect on sink in aluminum base structure materials

    International Nuclear Information System (INIS)

    Choi, Sang Il; Kim, Ji Hyun

    2014-01-01

    In case of aluminum, a slightly different approach is needed for the evaluation of radiation damage. Unlikely other structure materials such as zirconium alloy and iron based alloy, aluminum generate not only matrix defect but also much transmutation. Quantitative analysis of radiation damage of aluminum have been done in two research method. First research method is calculation of radiation damage quantity in the matrix. In this research, quantity of transmutation and matrix damage are evaluated by KMC simulation from ENDF database of IAEA. Most recently, radiation damage such as defect and transmutation are calculated in the MNSR reactor environment. The second research method is evaluation of sink morphology change by irradiation, which research method focus on accumulating behavior of radiation defects. Matrix defect and transmutation are clustering or dissolved by thermal diffusion and energy statue. These clustering defect such as dislocation loop, void and bubble directly affect mechanical properties. In this research area, it is hard to using deterministic method because it should describe envious and various reaction module in detail. However, in case of probabilistic method, it could be explained without detail reaction module. Most recently, there was KMC modeling about vacancy and helium cluster. From this cluster modeling, transmutation is quantitatively analyzed. After that cluster effect on swelling are explained. Unfortunately, silicon, which is another transmutation of aluminum, effect are neglected. Also primary cluster, which is generated by cascade, effect are neglected. For the fundamental understanding of radiation effect on aluminum alloy, it is needed that more various parameter such as alloy element and primary cluster effect should be researched. However, until now there was not general modeling which include alloy element and primary cluster effect on aluminum. However, there was not specified KMC platform for the quantitative analysis of

  17. Influence of Ag thickness of aluminum-doped ZnO/Ag/aluminum-doped ZnO thin films

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Hung-Wei, E-mail: hwwu@mail.ksu.edu.tw [Department of Computer and Communication, Kun Shan University, No. 949, Dawan Rd., Yongkang Dist., Tainan City 710, Taiwan (China); Yang, Ru-Yuan [Graduate Institute of Materials Engineering, National Pingtung University of Science and Technology, 1, Shuefu Rd., Neipu, Pingtung City 912, Taiwan (China); Hsiung, Chin-Min; Chu, Chien-Hsun [Department of Mechanical Engineering, National Pingtung University of Science and Technology, 1, Shuefu Rd., Neipu, Pingtung City 912, Taiwan (China)

    2012-10-01

    Highly conducting aluminum-doped ZnO (30 nm)/Ag (5-15 nm)/aluminum-doped ZnO (30 nm) multilayer thin films were deposited on glass substrate by rf magnetron sputtering (for top/bottom aluminum-doped ZnO films) and e-beam evaporation (for Ag film). The transmittance is more than 70% for wavelengths above 400 nm with the Ag layer thickness of 10 nm. The resistivity is 3.71 Multiplication-Sign 10{sup -4} {Omega}-cm, which can be decreased to 3.8 Multiplication-Sign 10{sup -5} {Omega}-cm with the increase of the Ag layer thickness to 15 nm. The Haacke figure of merit has been calculated for the films with the best value being 8 Multiplication-Sign 10{sup -3} {Omega}{sup -1}. It was shown that the multilayer thin films have potential for applications in optoelectronics. - Highlights: Black-Right-Pointing-Pointer High-quality Al-doped ZnO (AZO)/Ag/AZO Transparent Conducting Oxide films. Black-Right-Pointing-Pointer AZO films (30 nm) made by RF sputtering; E-beam evaporation for Ag film (5-15 nm). Black-Right-Pointing-Pointer Influence of Ag thickness on optical and electrical properties were analyzed. Black-Right-Pointing-Pointer High quality multilayer film with optimal intermediate Ag layer thickness of 10 nm. Black-Right-Pointing-Pointer 3.71 Multiplication-Sign 10{sup -4} {Omega}-cm resistivity, 91.89% transmittance at 470 nm obtained and reproducible.

  18. A Dislocation based Constitutive Model for Warm Forming of Aluminum Sheet

    NARCIS (Netherlands)

    Kurukuri, S.; Ghosh, M.; van den Boogaard, Antonius H.

    2008-01-01

    The formability of aluminum sheet can be improved considerably by increasing the temperature. At elevated temperatures, the mechanical response of the material becomes strain rate dependent. To accurately simulate warm forming of aluminum sheet, a material model is required that incorporates the

  19. Aluminum precipitation from Hanford DSSF

    International Nuclear Information System (INIS)

    Borgen, D.; Frazier, P.; Staton, G.

    1994-01-01

    A series of pilot scale tests using simulated Double Shell Slurry Feed (DSSF) showed that well-settled aluminum precipitate can be produced in Hanford double shell tank (DST) high level waste by slow neutralization with carbon dioxide. This pretreatment could provide an early grout feed and free tank space, as well as facilitate downstream processes such as ion exchange by providing a less caustic feed. A total of eight test runs were completed using a 10-ft tall 3-in i.d. glass column. The 10-ft height corresponds to about one third of the vertical height of a DST, hence providing a reasonable basis for extrapolating the observed precipitate settling and compaction to the actual waste tank environment. Four runs (three with a simplified simulant and one with a chemically complete simulant) produced well settled precipitates averaging 1.5 to 2 feet high. Aluminum gel rather than settled precipitate resulted from one test where neutralization was too rapid

  20. Aluminum corrosion product release kinetics

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, Matt, E-mail: Matthew.Edwards@cnl.ca; Semmler, Jaleh; Guzonas, Dave; Chen, Hui Qun; Toor, Arshad; Hoendermis, Seanna

    2015-07-15

    Highlights: • Release of Al corrosion product was measured in simulated post-LOCA sump solutions. • Increased boron was found to enhance Al release kinetics at similar pH. • Models of Al release as functions of time, temperature, and pH were developed. - Abstract: The kinetics of aluminum corrosion product release was examined in solutions representative of post-LOCA sump water for both pressurized water and pressurized heavy-water reactors. Coupons of AA 6061 T6 were exposed to solutions in the pH 7–11 range at 40, 60, 90 and 130 °C. Solution samples were analyzed by inductively coupled plasma atomic emission spectroscopy, and coupon samples were analyzed by secondary ion mass spectrometry. The results show a distinct “boron effect” on the release kinetics, expected to be caused by an increase in the solubility of the aluminum corrosion products. New models were developed to describe both sets of data as functions of temperature, time, and pH (where applicable)