WorldWideScience

Sample records for sosnovy bor aluminum

  1. Evaluation of BOR-60 operation safety

    International Nuclear Information System (INIS)

    Minakov, A.A.; Antipin, G.K.; Efimov, V.N.; Kuzin, G.G.; Eschenko, L.V.; Eschenko, S.N.

    1987-12-01

    In this communication, BOR-60 reactor operation anomalies capable to produce a dangerous overheating of the core (SDC) is examined. On bases of calculations and reactor operation experience an event tree for SDC is built. Evaluations of probable anomalies entering in the event tree and reactor parameters modifications in case of anomalies are presented. In conclusion BOR-60 agree with the sovietic nuclear safety [fr

  2. Possibilities of sustainable development the RTB Bor

    Directory of Open Access Journals (Sweden)

    Zeković Slavka

    2006-01-01

    Full Text Available The paper analysis the medium and long-term perspectives, framework and considered possibilities of sustainable development of RTB "Bor" in the period of transition. It is today the giant in the best quality copper production in the Balkans. In the paper are elaborated the problems of privatization, debt, investment, growth of copper production from own mines (and imported raw, opening of new mines, economical efficiency of production, environmental problems and impacts in the last time. The RTB "Bor" is a serious hot spot in Serbia. Unsustainability trends and process are identified, as follows: open-pit waste dumps, flotation tailings, mining and processing waste waters, air pollution; inefficiency useful of energy water and other inputs in copper complex; trans boundary character of emissions of dust; environmental degradation and quality of wide area and ecologically highly risk, etc.

  3. MARKETING MIX BY BED OCCUPANCY RATIO (BOR

    Directory of Open Access Journals (Sweden)

    Abdul Muhith

    2017-04-01

    Full Text Available Introduction: Bed Occupancy Ratio (BOR in RSI Arafah Mojosari during the last three years are at under ideal rate and the lowest of the three existing hospitals in the area of Mojosari. The purpose of this study was to determine the relationship marketing mix with Bed Occupancy Ratio in RSI Arafah Mojosari. Methods: This research uses analytic methods with crossectional approach. Variables in the study is marketing mix and Bed Occupancy Ratio (BOR. The population in this study were all patients hospitalized in the RSI Arafah Mojosari. Samples amounted 44 respondents taken by the Stratified random sampling technique. Data were collected using the questionnaire and analyzed using Fisher's Exact test. Result: The results obtained more than 50% of respondents (59.1% rate well against the marketing mix is developed by the hospital management and the majority of respondents (79.5% are in the treatment room that has a number BOR is not ideal. Fisher Exact test test results obtained probabililty value=0.02<0.05 so that H0 is rejected, which means there is a relationship marketing mix with the Bed Occupancy Ratio in RSI Arafah Mojosari. Discussion: Hospitals which able to develop the marketing mix very well, can attract consumers to use inpatient services at the hospital, with that BOR value will increase as the increased use of inpatient services. Hospital management must be able to formulate a good marketing mix strategy that hospital marketing objectives can be achieved. Conformity between service quality and service rates must be addressed, otherwise it extent of media promotions can attract patients to inpatient services.

  4. Calculated investigation of actinide transmutation in the BOR-60 reactor

    International Nuclear Information System (INIS)

    Zhemkov, I.Yu.; Ishunina, O.V.; Yakovleva, I.V.

    2000-01-01

    One of the prospective actinide burner reactor type is the fast reactor with a 'hard' spectrum and small breeding factor, which is the BOR-60. The calculated investigations demonstrate that Loading up to 40% of minor-actinides to the BOR-60 reactor did not lead to the considerable change of neutron-physical characteristics. The performed calculations show that the BOR- 60 reactor possesses a high efficiency of the minor-actinide and plutonium bum-up (up to 37 kg/(TW · h)) hat is comparable with properties of the actinide burner-reactors under design. The BOR-60 reactor can provide a homogeneous minor-actinide Loading (minor-actinide addition to the standard fuel) to the core and heterogeneous Loading (as separate assemblies-targets with a high minor-actinide fraction) to the first rows of a radial blanket that allows the optimum usage of the reactor and its characteristics. (authors)

  5. Functional characterization of Citrus macrophylla BOR1 as a boron transporter.

    Science.gov (United States)

    Cañon, Paola; Aquea, Felipe; Rodríguez-Hoces de la Guardia, Amparo; Arce-Johnson, Patricio

    2013-11-01

    Plants have evolved to develop an efficient system of boron uptake and transport using a range of efflux carriers named BOR proteins. In this work we isolated and characterized a boron transporter of citrus (Citrus macrophylla), which was named CmBOR1 for its high homology to AtBOR1. CmBOR1 has 4403 bp and 12 exons. Its coding region has 2145 bp and encodes for a protein of 714 amino acids. CmBOR1 possesses the molecular features of BORs such as an anion exchanger domain and the presence of 10 transmembrane domains. Functional analysis in yeast indicated that CmBOR1 has an efflux boron transporter activity, and transformants have increased tolerance to excess boron. CmBOR1 is expressed in leaves, stem and flowers and shows the greatest accumulation in roots. The transcript accumulation was significantly increased under boron deficiency conditions in shoots. In contrast, the accumulation of the transcript did not change in boron toxicity conditions. Finally, we observed that constitutive expression of CmBOR1 was able to increase tolerance to boron deficiency conditions in Arabidopsis thaliana, suggesting that CmBOR1 is a xylem loading boron transporter. Based on these results, it was determined that CmBOR1 encodes a boric acid/borate transporter involved in tolerance to boron deficiency in plants. © 2013 Scandinavian Plant Physiology Society.

  6. Shear Punch Testing of BOR-60 Irradiated TEM Specimens

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-06-13

    As a part of the project “High Fidelity Ion Beam Simulation of High Dose Neutron Irradiation” an Integrated Research Program (IRP) project from the U.S. Department of Energy, Nuclear Energy University Programs (NEUP), TEM geometry samples of ferritic cladding alloys, Ni based super alloys and model alloys were irradiated in the BOR-60 reactor to ~16 dpa at ~370°C and ~400°C. Samples were sent to Los Alamos National Laboratory and subjected to shear punch testing. This report presents the results from this testing.

  7. Acoustic monitoring of the BOR-60 reactor circulating pump state

    International Nuclear Information System (INIS)

    Efimov, V.N.; Myntsov, A.A.

    1988-01-01

    Diagnostics methods for circulation pumps of the experimental BOR-60 fast reactor are described. The results of signal processing during a microcompain, as well as detected anomalies in pump operation in the earth stage are presented. Analysis carried out for an acoustic signal envelope has shown high efficiency of the method. When oscillations of a mechanical shaft are present, the envelope level increases 1.5 times. More detailed investigation is carried out by the analysis of the spectrum of the pump acoustic signal envelope. During abnormal operation there are peaks, corresponding to the circulation frequency, and harmonics multiple of it, in the spectrum. 6 figs

  8. İçme ve sulama sularında bor kirliliği ve bor giderme yöntemleri

    Directory of Open Access Journals (Sweden)

    Meltem Bilici Başkan

    2014-03-01

    Full Text Available Periyodik cetvelin 3A grubunda yer alan bor yüksek iyonlaşma potansiyeline sahip olması nedeniyle yarı metal olarak kabul edilir. Yerkabuğundaki ortalama bor konsantrasyonu 10 mg/kg'dır. Bor doğada Ca, Na ve Mg'un tuzları şeklinde bulunur. Yüksek konsantrasyonlarda ve ekonomik boyutlardaki bor yatakları; borun oksijen ile bağlanmış bileşikleri şeklinde daha çok Türkiye ve ABD'nin kurak, volkanik ve hidrotermal aktivitesi olan bölgelerinde bulunmaktadır. Bor, bitkiler için gerekli bir mikro besin elementi olmanın yanı sıra, gerekli tüm besin elementleri içerisinde, eksiklik belirtilerine neden olan miktarı ile toksik etki yapan miktarı, birbirine çok yakın olan tek elementtir. Bor su ortamında genellikle borik asit ve kısmen de borat tuzları formlarında bulunmaktadır. Pek çok endüstride kullanım alanı bulan bor bileşiklerinin endüstriyel gelişmelere bağlı olarak yüzeysel sularda bulunan konsantrasyonu artış göstermektedir. Yüzeysel sularda bulunan bor aynı zamanda evsel atıksulardan da kaynaklanmaktadır. Türkiye'de içme ve sulama sularını en çok kirleten toksik elementlerin başında bor gelmektedir. Bu nedenle bor giderimi hem insan sağlığı açısından hem de sağlıklı tarım ürünü yetiştirilebilmesi açısından oldukça önemlidir. Sulardan bor giderimi için uygulanan temel yöntemler arasında iyon değişimi, ultrafiltrasyon, ters osmoz ve adsorbsiyon gelmektedir.

  9. Optimization of heavy metals total emission, case study: Bor (Serbia)

    Science.gov (United States)

    Ilić, Ivana; Bogdanović, Dejan; Živković, Dragana; Milošević, Novica; Todorović, Boban

    2011-07-01

    The town of Bor (Serbia) is one of the most polluted towns in southeastern Europe. The copper smelter which is situated in the centre of the town is the main pollutant, mostly because of its old technology, which leads to environmental pollution caused by higher concentrations of SO 2 and PM 10. These facts show that the word is about a very polluted region in Europe which, apart from harming human health in the region itself, poses a particular danger for wider area of southeastern Europe. Optimization of heavy metal's total emission was undertaken because years of long contamination of the soil with heavy metals of anthropogenic origin created a danger that those heavy metals may enter the food chains of animals and people, which can lead to disastrous consequences. This work represents the usage of Geographic Information System (GIS) for establishing a multifactor assessment model to quantitatively divide polluted zones and for selecting control sites in a linear programming model, combined with PROMETHEE/GAIA method, Screen View modeling system, and linear programming model. The results show that emissions at some control sites need to be cut for about 40%. In order to control the background of heavy metal pollution in Bor, the ecological environment must be improved.

  10. Impact assessment of mine drainage water and municipal wastewater on the surface water in the vicinity of Bor

    OpenAIRE

    Gardić Vojka R.; Petrović Jelena V.; Đurđevac-Ignjatović Lidija V.; Kolaković Srđan R.; Vujović Svetlana R.

    2015-01-01

    Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB) activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj ...

  11. One-Step Leapfrog LOD-BOR-FDTD Algorithm with CPML Implementation

    Directory of Open Access Journals (Sweden)

    Yi-Gang Wang

    2016-01-01

    Full Text Available An unconditionally stable one-step leapfrog locally one-dimensional finite-difference time-domain (LOD-FDTD algorithm towards body of revolution (BOR is presented. The equations of the proposed algorithm are obtained by the algebraic manipulation of those used in the conventional LOD-BOR-FDTD algorithm. The equations for z-direction electric and magnetic fields in the proposed algorithm should be treated specially. The new algorithm obtains a higher computational efficiency while preserving the properties of the conventional LOD-BOR-FDTD algorithm. Moreover, the convolutional perfectly matched layer (CPML is introduced into the one-step leapfrog LOD-BOR-FDTD algorithm. The equation of the one-step leapfrog CPML is concise. Numerical results show that its reflection error is small. It can be concluded that the similar CPML scheme can also be easily applied to the one-step leapfrog LOD-FDTD algorithm in the Cartesian coordinate system.

  12. Eogenetic caves in conglomerate: an example from Udin Boršt, Slovenia

    Directory of Open Access Journals (Sweden)

    Lipar Matej

    2011-01-01

    Full Text Available Udin Boršt is a karstified terrace of carbonate rock, which is of fluvioglacial origin, and is situated in the north-western part of Slovenia. There are 15 registered caves, which have been interpreted as caves in conglomerate, while karst of Udin Boršt itself was interpreted as conglomerate karst, shallow karst or isolated karst. In this article, caves in Udin Boršt have been interpreted as eogenetic caves. Based on porosity and bedding material, different types of caves and cave passages have developed. Four general types of eogenetic caves found in Udin Boršt are; linear stream caves, shelter caves, breakdown caves and vadose shafts.

  13. Necropolis on Bor lake: New reports on Bronze age burial

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar

    2011-01-01

    Full Text Available This article deals with the social and anthropological aspects of burial rituals during the Middle Bronze Age in Timočka Krajina. Decades of systematic research of necropolises and reconnaissance in the basin of the Crni Timok proved an increase in number of sites around ore - rich areas of the east Kučaj mountains as well as around Romuliana site and the fertile valleys of Džanovo polje (Map. 1. The quantitative increase in settlements was reflected by the emergence of large necropolises, only three of which have been systematically explored; those in Trnjani, Magura and Bor Lake (Fig. 1; Plan 1. Analysis of geographical features of many settlements and their position in relation to natural resources helped define two communities, one of which carried out mining and metallurgical activities, while the other group engaged in the production of food. Both groups lived in the immediate vicinity and mutual dependence, functioning within a developed market for copper production. During the exploration of the necropolis near Bor Lake in 1997, the remains of burnt skeletons were collected from burial structures 2/97 and 13/97 (Fig. 2; Plans 2 and 3. Anthropological analysis of the cremated remains of the deceased showed that high temperatures were used during the cremation process, which we assume could have only been achieved in metallurgical furnaces. This is confirmed by the fact that the skeletal fragments contain traces of melted metal, as well as finds of bronze slag inside urns and grave structures in the necropolis in Trnjani (Figs. 3 and 4; Tables 1-4. Burial ritual of this kind was not proved by systematic archaeological research of necropolises in the basin of Crni Timok, although anthropological data collected from necropolises linked to metallurgical settlements may indicate some guidelines in the ritual cremation of prominent members of these communities. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Arheologija Srbije

  14. A hypothetical severe reactor accident in Sosnovyj Bor, Russia

    International Nuclear Information System (INIS)

    Lahtinen, J.; Toivonen, H.; Poellaenen, R.; Nordlund, G.

    1993-12-01

    Individual doses and short-term radiological consequences from a hypothetical severe accident at the Russian nuclear power plant in Sosnovyj Bor were estimated for two sites in Finland. The sites are Kotka, located 140 km from the plant, and Helsinki, 220 km from the plant. The release was assumed to start immediately after the shutdown of the reactor (a 1000 MW RBMK unit) which had been operating at nominal power level for a long time. An effective release height of 500 m was assumed. The prevailing meteorological conditions during the release were taken to present the situation typical of the area (effective wind speed 9 m/s, neutral dispersion conditions). The release fractions applied in the study were of the same order as in the Chernobyl accident, i.e. 100% for noble gases, 60% for iodines, 40% for cesium and 1-10% for other radiologically important nuclides. The release was assumed to last 24 hours. However, half of the nuclides were released during the first hour. No attention was paid to the actual sequence of events that could lead to such release characteristics and time behaviour. The concentration and dose calculations were performed with a modified version of the computer code OIVA developed in Finnish Centre for Radiation and Nuclear Safety. Inhalation dose and external doses from the release plume and from the deposited activity were calculated for adults only, and no sheltering was considered. (11 refs., 4 figs., 6 tabs.)

  15. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji; Mineta, Katsuhiko; Amano, Taro; Toyoda, Atsushi; Fujiwara, Toru; Naito, Satoshi; Takano, Junpei

    2015-01-01

    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range

  16. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  17. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji

    2015-01-24

    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range of conditions. In this study, we examined the evolutionary divergence of BORs among terrestrial plants and showed that the lycophyte Selaginella moellendorffii and angiosperms have evolved two types of BOR (clades I and II). Clade I includes AtBOR1 and homologs previously shown to be involved in efficient transport of B under conditions of limited B availability. AtBOR1 shows polar localization in the plasma membrane and high-B-induced vacuolar sorting, important features for efficient B transport under low-B conditions, and rapid down-regulation to avoid B toxicity. Clade II includes AtBOR4 and barley Bot1 involved in B exclusion for high-B tolerance. We showed, using yeast complementation and B transport assays, that three genes in S. moellendorffii, SmBOR1 in clade I and SmBOR3 and SmBOR4 in clade II, encode functional BORs. Furthermore, amino acid sequence alignments identified an acidic di-leucine motif unique in clade I BORs. Mutational analysis of AtBOR1 revealed that the acidic di-leucine motif is required for the polarity and high-B-induced vacuolar sorting of AtBOR1. Our data clearly indicated that the common ancestor of vascular plants had already acquired two types of BOR for low- and high-B tolerance, and that the BOR family evolved to establish B tolerance in each lineage by adapting to their environments. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.

  18. A new approach to the spectral analysis of liquid membrane oscillators by Gábor transformation

    DEFF Research Database (Denmark)

    Płocharska-Jankowska, E.; Szpakowska, M.; Mátéfi-Tempfli, Stefan

    2006-01-01

    Liquid membrane oscillators very frequently have an irregular oscillatory behavior. Fourier transformation cannot be used for these nonstationary oscillations to establish their power spectra. This important point seems to be overlooked in the field of chemical oscillators. A new approach...... is presented here based on Gábor transformation allowing one to obtain power spectra of any kind of oscillations that can be met experimentally. The proposed Gábor analysis is applied to a liquid membrane oscillator containing a cationic surfactant. It was found that the power spectra are strongly influenced...

  19. Transgenic tobacco plants expressing BoRS1 gene from Brassica ...

    Indian Academy of Sciences (India)

    Water stress is by far the leading environmental stress limiting crop yields worldwide. Genetic engineering techniques hold great promise for developing crop cultivars with high tolerance to water stress. In this study, the Brassica oleracea var. acephala BoRS1 gene was transferred into tobacco through ...

  20. Aspects of energy reduction by autogenous copper production in the copper smelting plant Bor

    International Nuclear Information System (INIS)

    Najdenov, Ivan; Raić, Karlo T.; Kokeza, Gordana

    2012-01-01

    This work presents a comparative analysis of the energy consumption during copper production by the “standard” procedure (roasting in a fluo–solid reactor and smelting in a reverberatory furnace) in the Smelting Plant in Bor with modern autogenous procedures. All forms of expended energy were reduced to primary energy or to the same energy form, i.e., to the energy equivalent of the process (EEP), the raw material and the process materials. In addition, the energy equivalent of the process and waste products (water vapour, thermal energy and similar) were balanced. To complete the consumption of all energy generating products in copper production, they were reduced to conditional fuel (coal equivalent = 29.3 MJ/kg). Additionally, this study suggests replacement of the existing technology by an appropriate autogenous procedure and considers the prospects for further development of mining and metallurgy in Bor. Estimates of development perspectives for copper production should be comprehensive, based on complete and relevant data, as well as on real considerations of future development in world production. -- Highlights: ► “Standard” autogenous copper production in the Smelting Plant, Bor, Serbia. ► Comparation of energy consumption in “standard” with other autogenous procedures. ► All forms of energy are reduced to energy equivalent and conditional fuel. ► Replacement of existing technology with the appropriate autogenous procedure. ► Perspectives of further development of mining and metallurgy in Bor.

  1. Polarized localization and borate-dependent degradation of the Arabidopsis borate transporter BOR1 in tobacco BY-2 cells.

    Science.gov (United States)

    Yamauchi, Noboru; Gosho, Tadashi; Asatuma, Satoru; Toyooka, Kiminori; Fujiwara, Toru; Matsuoka, Ken

    2013-01-01

    In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP) in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM). This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.

  2. Aluminum Hydroxide

    Science.gov (United States)

    Aluminum hydroxide is used for the relief of heartburn, sour stomach, and peptic ulcer pain and to ... Aluminum hydroxide comes as a capsule, a tablet, and an oral liquid and suspension. The dose and ...

  3. Evaluation of signal processing for boiling noise detection. Further analysis of BOR-60 reactor noise data

    International Nuclear Information System (INIS)

    Ledwidge, T.J.; Black, J.L.

    1989-01-01

    The present paper deals with investigations of acoustic signals from a boiling experiment performed on the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is described. (author). 3 refs, 16 figs

  4. Survey of population health in towns with nuclear and fossil fuel power plants

    International Nuclear Information System (INIS)

    Ivanov, E.; Shubik, V. M.

    2004-01-01

    Comparative assessment of population health in Sosnovy Bor with nuclear power plant and Kirovsk with fossil fuel power station was made for public and administration information. Both towns are located in Leningrad administrative region at 150 km distance from each other. In nuclear power town radiological situation was assessed as normal and in Kirovsk up to 1995 yr. with coal fuel, maximum permissible levels of suspended particle of sulfur oxide in atmosphere were exceeded in 6-9% of samples. After 1995 yr. the natural gas was used as fuel. Demographic data for 1991-2000 yrs indicate that mortality including infants mortality and stillborns was lower in Sosnovy Bor (NOS) then in Kirovsk (fossil fuel) and on average Leningrad administrative region. Birth rate and population growth was higher in Sosnovy Bor at the same time surprisingly the recorded morbidity was higher in Sosnovy Bor which might be explained by extensive medical supervision and improved diagnostics. However, cancer and tuberculosis morbidity was lower in Sosnovy Bor. In Kirovsk in 1997-2000 yrs. oncological morbidity was higher on average comparing to Leningrad administrative region. Oncological mortality in Sosnovy Bor in 1997-2000 yrs. was lower than in Kirovsk and Leningrad region Standardized annual mortality in Sosnovy Bor, Kirovsk and Leningrad administrative region was 128.3, 209.6 and 211.7 on 100 000 respectively. Health state of pregnant women, deliveries, new-born condition were all in normal range in Sosnovy Bor, contrary to higher increased abortion rate and pregnancy complications in Kirovsk. These findings need further studies. (Author)

  5. Survey of population health in towns with nuclear and fossil fuel power plants

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, E.; Shubik, V. M.

    2004-07-01

    Comparative assessment of population health in Sosnovy Bor with nuclear power plant and Kirovsk with fossil fuel power station was made for public and administration information. Both towns are located in Leningrad administrative region at 150 km distance from each other. In nuclear power town radiological situation was assessed as normal and in Kirovsk up to 1995 yr. with coal fuel, maximum permissible levels of suspended particle of sulfur oxide in atmosphere were exceeded in 6-9% of samples. After 1995 yr. the natural gas was used as fuel. Demographic data for 1991-2000 yrs indicate that mortality including infants mortality and stillborns was lower in Sosnovy Bor (NOS) then in Kirovsk (fossil fuel) and on average Leningrad administrative region. Birth rate and population growth was higher in Sosnovy Bor at the same time surprisingly the recorded morbidity was higher in Sosnovy Bor which might be explained by extensive medical supervision and improved diagnostics. However, cancer and tuberculosis morbidity was lower in Sosnovy Bor. In Kirovsk in 1997-2000 yrs. oncological morbidity was higher on average comparing to Leningrad administrative region. Oncological mortality in Sosnovy Bor in 1997-2000 yrs. was lower than in Kirovsk and Leningrad region Standardized annual mortality in Sosnovy Bor, Kirovsk and Leningrad administrative region was 128.3, 209.6 and 211.7 on 100 000 respectively. Health state of pregnant women, deliveries, new-born condition were all in normal range in Sosnovy Bor, contrary to higher increased abortion rate and pregnancy complications in Kirovsk. These findings need further studies. (Author)

  6. Structure of Bor1 supports an elevator transport mechanism for SLC4 anion exchangers.

    Science.gov (United States)

    Thurtle-Schmidt, Bryan H; Stroud, Robert M

    2016-09-20

    Boron is essential for plant growth because of its incorporation into plant cell walls; however, in excess it is toxic to plants. Boron transport and homeostasis in plants is regulated in part by the borate efflux transporter Bor1, a member of the solute carrier (SLC) 4 transporter family with homology to the human bicarbonate transporter Band 3. Here, we present the 4.1-Å resolution crystal structure of Arabidopsis thaliana Bor1. The structure displays a dimeric architecture in which dimerization is mediated by centralized Gate domains. Comparisons with a structure of Band 3 in an outward-open state reveal that the Core domains of Bor1 have rotated inwards to achieve an occluded state. Further structural comparisons with UapA, a xanthine transporter from the nucleobase-ascorbate transporter family, show that the downward pivoting of the Core domains relative to the Gate domains may access an inward-open state. These results suggest that the SLC4, SLC26, and nucleobase-ascorbate transporter families all share an elevator transport mechanism in which alternating access is provided by Core domains that carry substrates across a membrane.

  7. Basic principles of accounting and control of nuclear materials in the BOR-60 experimental fast reactor

    International Nuclear Information System (INIS)

    Gryazev, V.M.; Gadzhiev, G.I.; Alekseev, I.N.

    1979-01-01

    Under a contract with the International Atomic Energy Agency, the V.I. Lenin Atomic Reactor Research Institute is currently carrying out a study of ways of organizing a nuclear materials accounting and control system for the BOR-60 fast reactor. Some results of this study are presented in the paper. The special physical and technological features of fast reactors create additional difficulties in safeguards systems and give rise to a number of new possibilities for the illicit removal of nuclear materials. These questions are discussed with reference to the BOR-60 reactor but the conclusions are probably applicable to all fast reactors. The proposed accounting and control system is based on non-destructive measurements of the amount of fissile materials in the operating fuel assemblies and screened bundles of the reactor, on the independent control of the principal facility parameters (a list of which is given) and on an automated information collection and evaluation system. Visual means of inspection can be very effective in fast reactor safeguards systems, especially for controlling storage, but they are not used with the BOR-60 reactor. (author)

  8. Cracking behavior and microstructure of austenitic stainless steels and alloy 690 irradiated in BOR-60 reactor, phase I.

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Y.; Chopra, O. K.; Soppet, W. K.; Shack, W. J.; Yang, Y.; Allen, T. R.; Univ. of Wisconsin at Madison

    2010-02-16

    Cracking behavior of stainless steels specimens irradiated in the BOR-60 at about 320 C is studied. The primary objective of this research is to improve the mechanistic understanding of irradiation-assisted stress corrosion cracking (IASCC) of core internal components under conditions relevant to pressurized water reactors. The current report covers several baseline tests in air, a comparison study in high-dissolved-oxygen environment, and TEM characterization of irradiation defect structure. Slow strain rate tensile (SSRT) tests were conducted in air and in high-dissolved-oxygen (DO) water with selected 5- and 10-dpa specimens. The results in high-DO water were compared with those from earlier tests with identical materials irradiated in the Halden reactor to a similar dose. The SSRT tests produced similar results among different materials irradiated in the Halden and BOR-60 reactors. However, the post-irradiation strength for the BOR-60 specimens was consistently lower than that of the corresponding Halden specimens. The elongation of the BOR-60 specimens was also greater than that of their Halden specimens. Intergranular cracking in high-DO water was consistent for most of the tested materials in the Halden and BOR-60 irradiations. Nonetheless, the BOR-60 irradiation was somewhat less effective in stimulating IG fracture among the tested materials. Microstructural characterization was also carried out using transmission electron microscopy on selected BOR-60 specimens irradiated to {approx}25 dpa. No voids were observed in irradiated austenitic stainless steels and cast stainless steels, while a few voids were found in base and grain-boundary-engineered Alloy 690. All the irradiated microstructures were dominated by a high density of Frank loops, which varied in mean size and density for different alloys.

  9. Impact assessment of mine drainage water and municipal wastewater on the surface water in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Gardić Vojka R.

    2015-01-01

    Full Text Available Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj River, which still flow into the Timok River and Danube River. These pollutions are often presented by low pH value, increased content of heavy metal ions, suspended particles and fine particles of flotation tailings, which is deposited in the valleys of these rivers on the area of over 2000 hectares. During the decades of exploitation of ore from the open pit Bor at different locations ("Visoki Planir" - also called “Oštreljski planir”, "Severni planir" dump of ore body "H" (RTH gangue and tailings were delayed. The largest amount of tailings, about 150 million tons, was postponed on location Visoki planir. The effect of the mining waste and the impact of the whole process of processing copper ore to the final products on the environment, was conducted during the 4th study period of the project "Management of mining waste-tailing dump in the Bor region," supported by the Japan Society for the Promotion Science (Eng. Japan Society for the Promotion of Science and the Japan international cooperation Agency and the Ministry of environment, Mining and Spatial planning of the Republic of Serbia. Influence of season on the level of pollutants in soil and water, the impact on water quality in the river Timok and the River Danube, was conducted during first three periods of project. This paper presents the results of the third study period. The third period of research, which was conducted over a period of 17. 10. 2012 to 17. 01.2013 year, included a review of pollution sources and define their

  10. Characterization of BOR-60 Irradiated 14YWT-NFA1 Tubes

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Maloy, Stuart Andrew [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Aydogan, Eda [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-15

    Tubes of FCRD 14YWT-NFA1 Alloy were placed in the BOR-60 reactor and irradiated under a fast flux neutron environment to two conditions: 7 dpa at 360-370 °C and 6 dpa at 385-430 °C. Small sections of the tube were cut and sent to UC Berkeley for nanohardness testing and focused ion beam (FIB) milling of TEM specimens. FIB specimens were sent back to LANL for final FIB milling and TEM imaging. Hardness data and TEM images are presented in this report. This is the first fast reactor neutron irradiated information on the 14YWT-NFA1 alloy.

  11. Peculiarities of 137Cs accumulation by macromycetes in dry bors of Ukrainian Polessye

    International Nuclear Information System (INIS)

    Orlov, O.O.; Kurbet, T.B.; Kalyish, O.B.; Prishchepa, O.L.

    2001-01-01

    The main ecological peculiarities of dry bor in Ukrainian Polessye were given. Research were carried out in Central Polessie of Ukraine during 1997 - 1999. Results were obtained due to spectrometric measurement of specific activity of 137 Cs in fruit bodies of mushrooms and in the soil. Species composition of macromycetes was divided on homogeneous groups on intensity of 13 7Cs accumulation. Amanita porphyria, A. muscaria and Tricholoma portentosum belong to the group of weak 137 Cs accumulation from the soil (TF = 15 - 20); Amanita pantherina, A. phalloides, Cantharellus cibarius, Boletus edulis, Tricholoma flavovirens and Laccaria laccata - to the group of moderate radionuclide accumulation (TF = 30 - 55). The group of strong 137 Cs accumulation (TF = 100 - 180) consists of Suillus variegates, S. bovines and Hydnum imbricatum; and group of very strong accumulation (TF 200 - 280) - of Xerocomus badius, Lactarius rufus, Russula xerampelina, Cortinarius varius and Paxillus involutus. Cortinarius sanguineus (with TF 400) is an accumulator of 137 Cs. Comparative evaluation of dry bor was given from the point of view of purchase of edible macromycetes in it

  12. Finanční analýza podniku BRISK Tábor, a.s.

    OpenAIRE

    Hašek, Jan

    2008-01-01

    Diploma is focused on Financial analysis, importance of it, users, implementation analysis on factual company -- BRISK Tábor, a.s., evaluation based on analysis financial statements, ratio indicators, working capital, balance order, scheme of indicators, analysis of financial arm and comparison intercompany.

  13. Finanční analýza podniku IDEAL AUTOMOTIVE Bor, s.r.o.

    OpenAIRE

    Velebová, Štěpánka

    2009-01-01

    The aim of this bachelor thesis is to identify the financial situation of IDEAL AUTOMOTIVE Bor, Ltd., determine the strenghts and weaknesses of the company, and suggest some ideas of what to do in the future, so that the company could prosper

  14. Monitoring the Effect of Internet Use on Students Behavior Case Study: Technical Faculty Bor, University of Belgrade

    Science.gov (United States)

    Niculovic, Milica; Zivkovic, Dragana; Manasijevic, Dragan; Strbac, Nada

    2012-01-01

    A large number of criteria for evaluating Internet addiction have been developed recently. The research of Internet addiction among students of the Technical faculty in Bor, University of Belgrade has been conducted and its results are presented in this paper. The study included 270 students using criteria of Young's Internet Addiction Test. In…

  15. DRP1-Dependent Endocytosis is Essential for Polar Localization and Boron-Induced Degradation of the Borate Transporter BOR1 in Arabidopsis thaliana.

    Science.gov (United States)

    Yoshinari, Akira; Fujimoto, Masaru; Ueda, Takashi; Inada, Noriko; Naito, Satoshi; Takano, Junpei

    2016-09-01

    Boron (B) is essential for plants but toxic in excess. The borate efflux transporter BOR1 is expressed in various root cells and localized to the inner/stele-side domain of the plasma membrane (PM) under low-B conditions. BOR1 is rapidly degraded through endocytosis upon sufficient B supply. The polar localization and degradation of BOR1 are considered important for efficient B translocation and avoidance of B toxicity, respectively. In this study, we first analyzed the subcellular localization of BOR1 in roots, cotyledons and hypocotyls, and revealed a polar localization in various cell types. We also found that the inner polarity of BOR1 is established after completion of cytokinesis in the root meristem. Moreover, variable-angle epifluorescence microscopy visualized BOR1-green fluorescent protein (GFP) as particles in the PM with significant lateral movements but in restricted areas. Importantly, a portion of BOR1-GFP particles co-localized with DYNAMIN-RELATED PROTEIN 1A (DRP1A), which is involved in scission of the clathrin-coated vesicles, and they disappeared together from the PM. To examine the contribution of DRP1A-mediated endocytosis to BOR1 localization and degradation, we developed an inducible expression system of the DRP1A K47A variant. The DRP1A variant prolonged the residence time of clathrin on the PM and inhibited endocytosis of membrane lipids. The dominant-negative DRP1A blocked endocytosis of BOR1 and disturbed its polar localization and B-induced degradation. Our results provided insight into the endocytic mechanisms that modulate the subcellular localization and abundance of a mineral transporter for nutrient homeostasis in plant cells. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  16. Mechanical properties and TEM examination of RAFM steels irradiated up to 70 dpa in BOR-60

    Energy Technology Data Exchange (ETDEWEB)

    Gaganidze, E., E-mail: Ermile.Gaganidze@kit.edu [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Petersen, C.; Materna-Morris, E.; Dethloff, C.; Weiss, O.J.; Aktaa, J. [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Povstyanko, A.; Fedoseev, A.; Makarov, O.; Prokhorov, V. [Joint Stock Company ' State Scientific Centre Research Institute of Atomic Reactors' , 433510 Dimitrovgrad-10, Ulyanovsk Region (Russian Federation)

    2011-10-01

    Mechanical properties of Reduced Activation Ferritic/Martensitic (RAFM) steels were studied after irradiation in BOR-60 reactor to a neutron displacement damage of 70 dpa at 330-340 deg. C. Yield stress and Ductile-to-Brittle-Transition-Temperature of EUROFER97 indicate saturation of hardening and embrittlement. The phenomenological models for description of microstructure evolution and resulting irradiation hardening and embrittlement are discussed. The evolution of yield stress with dose is qualitatively understood within a Whapham and Makin model. Dislocation loops examined in TEM are considered a main source for low-temperature irradiation hardening. The analysis of the fatigue data in terms of the inelastic strain reveals comparable fatigue behaviour both for unirradiated and irradiated conditions, which can be described by a common Manson-Coffin relation. The study of helium effects in B-doped model steels indicated progressive material embrittlement with helium content. Post-irradiation annealing of RAFM steels yielded substantial recovery of mechanical properties.

  17. New evidence for prehistoric copper metallurgy in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar

    2016-01-01

    Full Text Available The last three years of archaeological investigations at the site Ru`ana in Banjsko Polje, in the immediate vicinity of Bor, have provided new evidence regarding the role of non-ferrous metallurgy in the economy of the prehistoric communities of north-eastern Serbia. The remains of metallurgical furnaces and a large amount of metallic slags at two neighbouring sites in the mentioned settlement reveal that locations with many installations for the thermal processing of copper ore existed in the Bronze Age. We believe, judging by the finds of material culture, that metallurgical activities in this area also continued into the Iron Age and, possibly, into the 4th century AD. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Archaeology of Serbia: Cultural identity, integration factors, technological processes and the role of the central Balkans in the development of European prehistory

  18. Study of the accumulation and distribution of the radioactivity in the cooling circuit of the BOR-60 reactor

    International Nuclear Information System (INIS)

    Kizin, V.D.; Konyashov, V.V.; Lisitsyn, E.S.; Polyakov, V.I.; Chechetkin, Yu.V.

    1976-04-01

    The results of measurements of the radioactivity of the coolant and the deposits in the primary circuit of the BOR-60 reactor during its five years of operation are discussed. The values calculated for the exposure dose rate from the piping system and the contribution of the γ-radiation from the corrosion and fission product nuclides are given. The efficiency of coolant draining from the pipes in reducing the dose rate is estimated. (orig.) [de

  19. Some Genetic Characteristics of the Population Residing Nearby Nuclear Power Plant. The First Step

    International Nuclear Information System (INIS)

    Mkheidze, M.

    2007-01-01

    There is Sosnovy Bor with 60 thousands of inhabitants located 80 km to the west from the centre of St. Petersburg. Here is the greatest and the oldest nuclear power plant, LNPP, with four reactors of the RMBK-1000 (Chernobyl) type. In fact every Sosnovy Bor inhabitant is connected with nuclear technologies. The strategy of the city development is formed and controlled by the policy of federal bodies. It is very difficult to have access to any demographic data and documents reflecting status of population health. Low doses of ionizing radiation are known to cause mutations in germ cells. A great part of the population of Sosnovy Bor works in the NPP and is exposed to low dose ionizing radiation. This paper presents some genetic characteristics of Sosnovy Bor inhabitants including monogenic diseases (phenylketonuria, Duchenne muscular dystrophy, lysosomal diseases, hypothyroidism etc), chromosomal pathology (Down syndrome, Turner and Klinefelter diseases), multiple malformation syndromes and results of aFP screening of pregnant women with high rate of abnormal values of aFP and hHG. These results are obligatory basis and the first step to conduct a study on possible genetic effects of LNPP on genetic structure of Sosnovy Bor population.(author)

  20. Interpenetrated Uranyl-Organic Frameworks with bor and pts Topology: Structure, Spectroscopy, and Computation.

    Science.gov (United States)

    Liu, Chao; Chen, Fang-Yuan; Tian, Hong-Rui; Ai, Jing; Yang, Weiting; Pan, Qing-Jiang; Sun, Zhong-Ming

    2017-11-20

    Two novel three-dimensional interpenetrated uranyl-organic frameworks, (NH 4 ) 4 [(UO 2 ) 4 (L 1 ) 3 ]·6H 2 O (1) and [(UO 2 ) 2 (H 2 O) 2 L 2 ]·2H 2 O (2), where L 1 = tetrakis(3-carboxyphenyl)silicon and L 2 = tetrakis(4-carboxyphenyl)silicon, were synthesized by a combination of two isomeric tetrahedral silicon-centered ligands with 3-connected triangular [(UO 2 )(COO) 3 ] - and 4-connected dinuclear [(UO 2 ) 2 (COO) 4 ] units, respectively. Structural analyses indicate that 1 possesses a 2-fold interpenetrating anion bor network, while 2 exhibits a 3-fold interpenetrated 4,4-connected neutral network with pts topology. Both compounds were characterized by thermogravimetric analysis and IR, UV-vis, and photoluminescence spectroscopy. A relativistic density functional theory (DFT) investigation on 10 model compounds of 1 and 2 shows good agreement of the structural parameters, stretching vibrational frequencies, and absorption with experimental results; the time-dependent DFT calculations unravel that low-energy absorption bands originate from ligand-to-uranium charge transfer.

  1. 1x2M steel performance in the BOR-60 steam generator

    International Nuclear Information System (INIS)

    Golovanov, V.N.; Shamardin, V.K.; Kondratiev, V.I.; Kryukov, F.N.; Chernobrovkin, Yu.V.; Bulanova, T.M.; Bai, V.F.

    The results from studies of 1x2M steel characteristics are presented. This steel was used as the material for the BOR-60 steam generator that had been in operation under the steam generating mode for 18,000 hs (35,000 hs in sodium). It was revealed that the pit corrosion depth on the water/steam side evaporative tube surfaces was about 0.25 μm and less and the total corrosion rate was less than 0.06 mm/y. The mechanical properties of the material were essentially similar both in the evaporator and superheater and met all the requirements imposed on. Based on the analysis of data on the decarbonizaton depth in sodium and on the corrosion damage in water and steam it was concluded that 1x2M steel can be successfully used as the steam generator material at the operating temperatures up to 470 deg. C and had sufficiently longer service-life as compared to 18,000 hs. (author)

  2. Acoustic noises of the BOR-60 reactor steam generators when simulating leaks with argon and steam

    International Nuclear Information System (INIS)

    Sokolov, V.M.; Golushko, V.V.; Afanas'ev, V.A.; Grebenkin, Yu.P.; Muralev, A.B.

    1985-01-01

    Background acoustic noises of stea generators in different operational regimes and noises of argon and steam small leads (about 0.1 g/s) are studied to determine the possibility of designing the acoustic system for leak detection in sodium-water steamgenerators. Investigations are carried out at the 30 MW micromodule steam generator being in operation at the BOR-60 reactor as well as at the 20 MW tank type steam generator. Immersed ransduceres made of lithium niobate 6 mm in-diameter and waveguide transducers made of a stainless steel in the form of rods 10 mm in-diameter and 500 mm long are used as acoustic monitors. It is shown that the leak noise is more wide-band than the background noise of the steam generator and both high and low frequencies appear in the spectrum. The use of monitors of different types results in similar conslusions inrelation to the character of background noises and leak signals (spectral density, signal to-noise ratio) in the ase of similar bandroidths of the transduceres. A conclusion is made that the change of operational regimes leads to changes of background noise level, which can be close to the reaction of

  3. Radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor

    International Nuclear Information System (INIS)

    Ilvonen, M.; Rossi, J.; Salonoja, M.

    1994-06-01

    The present study is an application of the long range transport and dose model TRADOS developed jointly by the Finnish Meteorological Institute and Technical Research Centre of Finland. The aim of the study is to assess the radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor near St. Petersburg in Russia. Probabilities of reaching different parts of the country, transport time and time spent over Finland by the trajectories are presented. Also breadth of the radioactive cloud and incidence of rain are estimated. The calculated radiation doses are based on one single hypothetical release, in which all noble gases are released, together with 10 % of easily vaporizing elements and 1 % of others. All results are based on the assumption that the probability of the release is 100 %. The dose pathways calculated are cloud gamma, fallout gamma, inhalation, and ingestion of milk, meat, green vegetables, grain and roots. External dose rates have been calculated. The necessity of countermeasures and the ratio of the avertable dose to the costs are also assessed. (13 refs., 156 figs., 12 tabs.)

  4. Spatial and functional city structure with examples of Valjevo, Bor and Knjaževac

    Directory of Open Access Journals (Sweden)

    Spasić Nenad

    2005-01-01

    Full Text Available Cities represent such social environments which develop under the influence of their resource hinterland, yet at the same time they vigorously affect changes in their immediate or broader surroundings, depending on dynamics of city limits change. From city origins to the present day, interdependences between its spatial and functional structures can be noticed. Historical context plays a significant role in city development, both in terms of its spatial structure formation as well as in terms of development of city functions and territorial distribution of urban services. Spatial structure of a city is also defined by a set of geographical, economic, social functional and other features in their interdependency. Functional structure of a city depends on its size and position it takes in the functional distribution on a regional level as well as it is related to the functional capacity of a city. This paper analyses concrete examples of spatial and functional structures featuring three Serbian towns: Valjevo, Bor and Knjaževac. From the analysis of their common attributes in this respect, the following can be noticed: formation of the case study towns happened around inherited historical city cores, which even now perform a number of public functions; basic road networks significantly influenced formation of spatial patterns of these towns; spatial development of the towns in the last decade or so was slowed down because of economic and social stagnation, which didn't show major influence on change of spatial and functional structures of the towns involved.

  5. Studying the processes of sodium-water interaction in the BOR-60 reactor micromodule steam generator

    International Nuclear Information System (INIS)

    Tsykanov, V.A.; Antipin, G.K.; Borisov, V.V.

    1981-01-01

    Main results of experimental studies of emergency regimes of micromodule steam generator (MSG) at small and big leaks of water into sodium, realized using the 30 MW MSG, operating in the BOR-o0 reactor, are considered. The aims of the study are as follows: the modelling of macroleak in ''Nadja'' steam generator for the BN-350 reactor; testing the conceptions of alarm signalling and MSG protection; testing under real conditions of new perspective systems of leak detection; gaining the experimence and development of the ways to eliminate the consequences of accident caused by big water leak into sodium; accumulation of knowledge on restoration of MSG operating ability after accident; experimental test of calculational techniques for big leak accidents to use them in future for calculational studies of similar situations at other reactors equipped with sodium-water steam generators; refinement of characteristics of hydrodynamic and thermal effects interaction zone for big leak in real circuit during the plant operation. A series of experiments with the imitation of water leak into sodium by means of argon and steam supply through injection devices, located before the steam superheater module of one of the sections and between evaporator module of the same section, is conducted. The range of steam flow rate is 0.02-0.45 g/s. Duration of steam supply is 100-400 s. A conclusion is made that the results obtained can be used for steam generator of the BN-350 reactor [ru

  6. New approach to the reclamation of the old flotation tailings in Bor

    Directory of Open Access Journals (Sweden)

    Dožić Stevan

    2010-01-01

    Full Text Available The old flotation tailings of the Bor copper mine have not been reclaimed for several decades, although it is a serious threat to the environment, especially to some parts of the town. To date, there have been no efficacious attempts of solving the problem by indirect rehabilitation, only several cases of direct reclamation. This paper presents some results of the experiment established on a part of the tailings in the vicinity of the town, where various variants of meliorated and sterile substrates were applied in the biological reclamation with several tree and grass species. The analysis shows that, in the rehabilitation of sterile substrate of the copper mine, it is possible to grow several woody species. The best results were achieved by the species that were planted in the fertile soil layer on the sterile copper mine substrate, and on the mixture of soil and waste. Among the woody species, Robinia pseudoaccacia, Fraxinus excelsior and Acer pseudoplatanus showed the best survival percent, growth, and physiological vitality and the poorest were spruce and common oak.

  7. Bioleaching of copper from old flotation tailings samples (Copper Mine Bor, Serbia

    Directory of Open Access Journals (Sweden)

    Stanković Srđan

    2015-01-01

    Full Text Available Bioleaching of samples taken from depths of 10, 15, and 20 meters from old flotation tailings of the Copper Mine Bor was conducted in shaken flasks using extremely acidic water of Lake Robuleas lixiviant. Yield of copper after five weeks of the bioleaching experiment was 68.34±1.21% for 15 m sample, 72.57±0.57% for 20 m sample and 97.78±5.50% for 10 m sample. The obtained results were compared to the results of acid leaching of the same samples and it was concluded that bioleaching was generally more efficient for the treatment of samples taken from depths of 10 m and 20 m. The content of pyrite in the 20 m sample, which contained the highest amount of this mineral, was reduced after bioleaching. Benefits of this approach are: recovery of substantial amounts of copper, reducing the environmental impact of flotation tailings and the application of abundant and free water from the Robule acidic lake as lixiviant. Results of the experiment showed that bioleaching can be more efficient than acid leaching for copper extraction from flotation tailings with higher sulfide contents. [Projekat Ministarstva nauke Republike Srbije, br. 176016 i br. 173048

  8. The Novo Okno copper deposit of olistostrome origin (Bor, Eastern Serbia

    Directory of Open Access Journals (Sweden)

    Antonijević Ivan

    2011-01-01

    Full Text Available The copper deposit Novo Okno, uncovered at present, with non-ore and ore clasts of massive sulphides (from 0.5 to 50 m3 in size, has many distinctive features that indicate its olistostrome origin. The deposit is chaotic in structure, unstratified, with the lower surface unconformable over the underlying parent rock of the basin. It is a lens-like body, with the longer axis directed east and west, variable in thickness from 15 to 28 metres, about 335 metres long and less than 140 metres wide. These and other characteristics of the body indicate a unified, reworked, olistostrome copper deposit formed from primary ore bodies of the Bor mineral deposit and vulcanite, destroyed by volcanic explosion into blocks and rocks of Turonian age and extrusion and concurrent deposition on the land surface. Gravitational massive sliding of the consolidated rocks down the slopes of the volcanic relief and chaotic accumulation of ore and non-ore clasts (olistoliths in a marine basin evolved in the Upper Turonian and the Lower Senonian.

  9. Environmental impact of mining activity in Bor area as indicated by the distribution of heavy metals and bacterial population dynamics in sediment

    Directory of Open Access Journals (Sweden)

    Filimon M. N.

    2016-01-01

    Full Text Available The environmental impact of inorganic pollution is pronounced in water adjacent to Bor Copper Smelter Complex (RTB Bor, Serbia, with Cu, Zn, Pb, and As being the main determinants of aquatic pollution pattern. Communities of microorganisms present in the sediments are mainly affected by heavy metal pollution. Some groups of bacteria can be considered pollution bio-indicators, due to their sensibility and ability to bioaccumulate heavy metals, thus contributing to reducing pollution. This study investigates the relationships between trace element accumulation and heterogeneity in sediment bacteria community structure found in water streams adjacent to the Bor Copper Smelter Complex (RTB Bor, Serbia. Our results showed no contamination with copper, zinc, nickel, iron, and chromium, but did show a low to moderate contamination with lead and a moderate to high contamination with arsenic in aquatic sediments within the area of interest. Spatial heterogeneity in sediment-associated bacterial communities did not relate significantly to location of sampling sites, except for iron reducing bacteria. Iron reducing bacteria and nitrifying bacteria were the best distinguishing groups of bacteria. However, only iron reducing bacteria were significantly influenced by sampling locations. The iron reducing bacteria has correlated negatively with the degree of sediment contamination with lead, and therefore, we suggest that this group of bacteria could serve as potential bio-indicators of inorganic water contamination in Bor RTB area.

  10. The Evaluation of Alkali Grass (Puccinellia ciliata Bor Populations in Aydin Province of Turkey

    Directory of Open Access Journals (Sweden)

    İlkay Yavaş

    2017-08-01

    Full Text Available Alkali grass grows in waterlogged, saline and alaline soils. The main problem in these soils is minerals at toxic level. The toxic ions are chloride, sodium and boron. A number of techniques have been investigated for removing toxic metals from the soil. Today, the cost-effective and environmentally technique is phytoremediation, using hyperaccumulator plants. Alkali grass (Puccinellia ciliata Bor is suggested as a hyperaccumulator plant by the combination of more favourable characteristics with salt and waterlogging tolerance, high biomass value and convincing nutritive value for adverse environmental conditions. For this reason, we collected alkali grass and soil samples from five different locations in Aydın-Muğla highway, Turanlar and Sınırteke villages in Germencik-Aydın. In the soil analysis, we observed that K accumulation varies between root, shoot and panicle at least whereas Na and B shows more variation on whole plant portions among locations. Intense aerenchyma development on the root tips of Puccinellia plant was observed and it is determined as radial lysogenic aerenchyma formation. Average plant height and dry matter values were between 47.2-74.4 cm and 15.61-80.85 g/plant according to locations. The highest plant height value was obtained from the first location whereas the highest dry matter yield was detected in the fifth location. In conclusion, plants from fifth location can be regarded as fodder plants in these areas. Our results indicated that alkali grass can be effective for phytoextraction of sodium and boron from contaminated sites.

  11. IWGFR benchmark test on signal processing for boiling noise detection, stage 2: Analysis of data from BOR-60

    International Nuclear Information System (INIS)

    Rowley, R.; Waites, C.; Macleod, I.D.

    1989-01-01

    Data from boiling experiments in the BOR 60 reactor in USSR has been supplied by IAEA to enable analysis techniques to be compared. The signals have been analysed at RNL using two basic techniques, High Frequency RMS analysis and Pulse Counting analysis and two more sophisticated methods, Pattern Recognition and Pulse Timing Analysis. All methods indicated boiling successfully, pulse counting proved more sensitive than RMS for the detection of the onset of boiling. Pattern Recognition shows promise of a very reliable detector provided the background can be defined. Data from an Ionisation chamber was also supplied and there was good correlation between the neutronic and acoustic signals. (author). 25 figs, 4 tabs

  12. Neutron irradiation of V-Cr-Ti alloys in the BOR-60 fast reactor: Description of the fusion-1 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Rowcliffe, A.F. [Oak Ridge National Laboratory, TN (United States); Tsai, H.C.; Smith, D.L. [Argonne National Lab., IL (United States)] [and others

    1997-08-01

    The FUSION-1 irradiation capsule was inserted in Row 5 of the BOR-60 fast reactor in June 1995. The capsule contains a collaborative RF/U.S. experiment to investigate the irradiation performance of V-Cr-Ti alloys in the temperature range 310 to 350{degrees}C. This report describes the capsule layout, specimen fabrication history, and the detailed test matrix for the U.S. specimens. A description of the operating history and neutronics will be presented in the next semiannual report.

  13. IAEA/IWGFR benchmark tests on sodium boiling noise detection. Part 2: Decision making and BOR-60 data

    International Nuclear Information System (INIS)

    Brown, C.J.; Hughes, G.; Overton, R.S.; Wey, B.O.

    1989-01-01

    The present paper deals with the second stage of investigations of acoustic signals from a boiling experiment performed on the KNS I loop at KfK Karlsruhe and first results of analysis of data from a series of boiling experiments carried out in the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is briefly described. (author). 5 refs, 23 figs

  14. Multi-criteria Analysis of Air Pollution with SO(2) and PM(10) in Urban Area Around the Copper Smelter in Bor, Serbia.

    Science.gov (United States)

    Nikolić, Djordje; Milošević, Novica; Mihajlović, Ivan; Zivković, Zivan; Tasić, Viša; Kovačević, Renata; Petrović, Nevenka

    2010-02-01

    This work presents the results of 4 years long monitoring of concentrations of SO(2) gas and PM(10) in the urban area around the copper smelter in Bor. The contents of heavy metals Pb, Cd, Cu, Ni, and As in PM(10) were determined and obtained values were compared to the limit values provided in EU Directives. Manifold excess concentrations of all the components in the atmosphere of the urban area of the townsite Bor were registered. Through application of a multi-criteria analysis by using PROMETHEE/GAIA method, the zones were ranked according to the level of pollution.

  15. Polarized localization and borate-dependent degradation of the Arabidopsis borate transporter BOR1 in tobacco BY-2 cells [v1; ref status: indexed, http://f1000r.es/kv

    Directory of Open Access Journals (Sweden)

    Noboru Yamauchi

    2013-09-01

    Full Text Available In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM. This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.

  16. ALUMINUM BOX BUNDLING PRESS

    Directory of Open Access Journals (Sweden)

    Iosif DUMITRESCU

    2015-05-01

    Full Text Available In municipal solid waste, aluminum is the main nonferrous metal, approximately 80- 85% of the total nonferrous metals. The income per ton gained from aluminum recuperation is 20 times higher than from glass, steel boxes or paper recuperation. The object of this paper is the design of a 300 kN press for aluminum box bundling.

  17. Irradiation Microstructure of Austenitic Steels and Cast Steels Irradiated in the BOR-60 Reactor at 320°C

    Science.gov (United States)

    Yang, Yong; Chen, Yiren; Huang, Yina; Allen, Todd; Rao, Appajosula

    Reactor internal components are subjected to neutron irradiation in light water reactors, and with the aging of nuclear power plants around the world, irradiation-induced material degradations are of concern for reactor internals. Irradiation-induced defects resulting from displacement damage are critical for understanding degradation in structural materials. In the present work, microstructural changes due to irradiation in austenitic stainless steels and cast steels were characterized using transmission electron microscopy. The specimens were irradiated in the BOR-60 reactor, a fast breeder reactor, up to 40 dpa at 320°C. The dose rate was approximately 9.4x10-7 dpa/s. Void swelling and irradiation defects were analyzed for these specimens. A high density of faulted loops dominated the irradiated-altered microstructures. Along with previous TEM results, a dose dependence of the defect structure was established at 320°C.

  18. A Study of the Optimal Model of the Flotation Kinetics of Copper Slag from Copper Mine BOR

    Science.gov (United States)

    Stanojlović, Rodoljub D.; Sokolović, Jovica M.

    2014-10-01

    In this study the effect of mixtures of copper slag and flotation tailings from copper mine Bor, Serbia on the flotation results of copper recovery and flotation kinetics parameters in a batch flotation cell has been investigated. By simultaneous adding old flotation tailings in the ball mill at the rate of 9%, it is possible to increase copper recovery for about 20%. These results are compared with obtained copper recovery of pure copper slag. The results of batch flotation test were fitted by MatLab software for modeling the first-order flotation kinetics in order to determine kinetics parameters and define an optimal model of the flotation kinetics. Six kinetic models are tested on the batch flotation copper recovery against flotation time. All models showed good correlation, however the modified Kelsall model provided the best fit.

  19. Preliminary analysis of levels of arsenic and other metalic elements in PM10 sampled near Copper Smelter Bor (Serbia

    Directory of Open Access Journals (Sweden)

    Renata Kovačević

    2010-09-01

    Full Text Available In this paper, the levels of twenty one elements (Ag, Al, As, B, Ba, Ca, Cd, Cr, Cu, Fe, K, Mg, Mn, Mo, Na, Ni, Pb, S, Se, Sr and Zn in PM10 are presented, as well as SO2 concentration, measured at the sampling site in an urban area of the town of Bor (40,000 inhabitants in eastern Serbia. The sampling site was located in a densely populated city center about 0.65 km away from one of the largest copper mines and copper smelters in Europe. For the first time PM10 was collected using the European standard sampler, during a preliminary campaign in duration of 7 days in early spring 2009. PM10 were sampled on PTFE membrane filters and element concentrations were quantified by GF AAS and ICP AES. Concentration levels and correlations within trace elements, PM10 and SO2 indicated that industrial activities underpinned with meteorological conditions of low wind speed (calm are the main factors that influence air pollution in a densely populated area. It was evident that both PM10 mass concentration and SO2 concentration once exceeded the daily limit values during a measuring period of seven days. Strong relationship was found between PM10 and Mn, Mg, Ca and B daily average concentrations. On the other hand, SO2 correlated strongly with As, Pb, Cd, Cu and S daily average concentrations. These results confirm the relationship between emissions of SO2 from the Copper Smelter Bor and calm meteorological conditions (wind speed less than 0.5 m/sec with the concentration levels of carcinogenic substances of arsenic, lead and cadmium in ambient air.

  20. Graphene-aluminum nanocomposites

    International Nuclear Information System (INIS)

    Bartolucci, Stephen F.; Paras, Joseph; Rafiee, Mohammad A.; Rafiee, Javad; Lee, Sabrina; Kapoor, Deepak; Koratkar, Nikhil

    2011-01-01

    Highlights: → We investigated the mechanical properties of aluminum and aluminum nanocomposites. → Graphene composite had lower strength and hardness compared to nanotube reinforcement. → Processing causes aluminum carbide formation at graphene defects. → The carbides in between grains is a source of weakness and lowers tensile strength. - Abstract: Composites of graphene platelets and powdered aluminum were made using ball milling, hot isostatic pressing and extrusion. The mechanical properties and microstructure were studied using hardness and tensile tests, as well as electron microscopy, X-ray diffraction and differential scanning calorimetry. Compared to the pure aluminum and multi-walled carbon nanotube composites, the graphene-aluminum composite showed decreased strength and hardness. This is explained in the context of enhanced aluminum carbide formation with the graphene filler.

  1. BONDING ALUMINUM METALS

    Science.gov (United States)

    Noland, R.A.; Walker, D.E.

    1961-06-13

    A process is given for bonding aluminum to aluminum. Silicon powder is applied to at least one of the two surfaces of the two elements to be bonded, the two elements are assembled and rubbed against each other at room temperature whereby any oxide film is ruptured by the silicon crystals in the interface; thereafter heat and pressure are applied whereby an aluminum-silicon alloy is formed, squeezed out from the interface together with any oxide film, and the elements are bonded.

  2. Aluminum powder metallurgy processing

    Energy Technology Data Exchange (ETDEWEB)

    Flumerfelt, J.F.

    1999-02-12

    The objective of this dissertation is to explore the hypothesis that there is a strong linkage between gas atomization processing conditions, as-atomized aluminum powder characteristics, and the consolidation methodology required to make components from aluminum powder. The hypothesis was tested with pure aluminum powders produced by commercial air atomization, commercial inert gas atomization, and gas atomization reaction synthesis (GARS). A comparison of the GARS aluminum powders with the commercial aluminum powders showed the former to exhibit superior powder characteristics. The powders were compared in terms of size and shape, bulk chemistry, surface oxide chemistry and structure, and oxide film thickness. Minimum explosive concentration measurements assessed the dependence of explosibility hazard on surface area, oxide film thickness, and gas atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization oxidation of aluminum powder. An Al-Ti-Y GARS alloy exposed in ambient air at different temperatures revealed the effect of reactive alloy elements on post-atomization powder oxidation. The pure aluminum powders were consolidated by two different routes, a conventional consolidation process for fabricating aerospace components with aluminum powder and a proposed alternative. The consolidation procedures were compared by evaluating the consolidated microstructures and the corresponding mechanical properties. A low temperature solid state sintering experiment demonstrated that tap densified GARS aluminum powders can form sintering necks between contacting powder particles, unlike the total resistance to sintering of commercial air atomization aluminum powder.

  3. Mobility and natural attenuation of metals and arsenic in acidic waters of the drainage system of Timok River from Bor copper mines (Serbia) to Danube River.

    Science.gov (United States)

    Đorđievski, Stefan; Ishiyama, Daizo; Ogawa, Yasumasa; Stevanović, Zoran

    2018-06-22

    Bor, Krivelj, and Bela Rivers belong to the watershed of Timok River, which is a tributary of transboundary Danube River. These rivers receive metal-rich acidic wastewater from metallurgical facilities and acid mine drainage (AMD) from mine wastes around Bor copper mines. The aim of this study was to determine the mobility and natural attenuation of metals and arsenic in rivers from Bor copper mines to Danube River during the year 2015. The results showed that metallurgical facilities had the largest impact on Bor River by discharging about 400 t of Cu per year through highly acidic wastewater (pH = 2.6). The highest measured concentrations of Cu in river water and sediments were 40 mg L -1 and 1.6%, respectively. Dissolution of calcite from limestone bedrock and a high concentration of bicarbonate ions in natural river water (about 250 mg L -1 ) enhanced the neutralization of acidic river water and subsequent chemical precipitation of metals and arsenic. Decreases in the concentrations of Al, Fe, Cu, As, and Pb in river water were mainly due to precipitation on the river bed. On the other hand, dilution played an important role in the decreases in concentrations of Mn, Ni, Zn, and Cd. Chemically precipitated materials and flotation tailings containing Fe-rich minerals (fayalite, magnetite, and pyrite) were transported toward Danube River during the periods of high discharge. This study showed that processes of natural attenuation in catchments with limestone bedrock play an important role in reducing concentrations of metals and arsenic in AMD-bearing river water.

  4. SHB1/HY1 Alleviates Excess Boron Stress by Increasing BOR4 Expression Level and Maintaining Boron Homeostasis in Arabidopsis Roots

    Directory of Open Access Journals (Sweden)

    Qiang Lv

    2017-05-01

    Full Text Available Boron is an essential mineral nutrient for higher plant growth and development. However, excessive amounts of boron can be toxic. Here, we report on the characterization of an Arabidopsis mutant, shb1 (sensitive to high-level of boron 1, which exhibits hypersensitivity to excessive boron in roots. Positional cloning demonstrated that the shb1 mutant bears a point mutation in a gene encoding a heme oxygenase 1 (HO1 corresponding to the HY1 gene involved in photomorphogenesis. The transcription level of the SHB1/HY1 gene in roots is up-regulated under excessive boron stimulation. Either overexpressing SHB1/HY1 or applying the HO1 inducer hematin reduces boron accumulation in roots and confers high boron tolerance. Furthermore, carbon monoxide and bilirubin, catalytic products of HO1, partially rescue the boron toxicity-induced inhibition of primary root growth in shb1. Additionally, the mRNA level of BOR4, a boron efflux transporter, is reduced in shb1 roots with high levels of boron supplementation, and hematin cannot relieve the boron toxicity-induced root inhibition in bor4 mutants. Taken together, our study reveals that HO1 acts via its catalytic by-products to promote tolerance of excessive boron by up-regulating the transcription of the BOR4 gene and therefore promoting the exclusion of excessive boron in root cells.

  5. Anodizing Aluminum with Frills.

    Science.gov (United States)

    Doeltz, Anne E.; And Others

    1983-01-01

    "Anodizing Aluminum" (previously reported in this journal) describes a vivid/relevant laboratory experience for general chemistry students explaining the anodizing of aluminum in sulfuric acid and constrasting it to electroplating. Additions to this procedure and the experiment in which they are used are discussed. Reactions involved are…

  6. Is the Aluminum Hypothesis Dead?

    Science.gov (United States)

    2014-01-01

    The Aluminum Hypothesis, the idea that aluminum exposure is involved in the etiology of Alzheimer disease, dates back to a 1965 demonstration that aluminum causes neurofibrillary tangles in the brains of rabbits. Initially the focus of intensive research, the Aluminum Hypothesis has gradually been abandoned by most researchers. Yet, despite this current indifference, the Aluminum Hypothesis continues to attract the attention of a small group of scientists and aluminum continues to be viewed with concern by some of the public. This review article discusses reasons that mainstream science has largely abandoned the Aluminum Hypothesis and explores a possible reason for some in the general public continuing to view aluminum with mistrust. PMID:24806729

  7. The aluminum smelting process.

    Science.gov (United States)

    Kvande, Halvor

    2014-05-01

    This introduction to the industrial primary aluminum production process presents a short description of the electrolytic reduction technology, the history of aluminum, and the importance of this metal and its production process to modern society. Aluminum's special qualities have enabled advances in technologies coupled with energy and cost savings. Aircraft capabilities have been greatly enhanced, and increases in size and capacity are made possible by advances in aluminum technology. The metal's flexibility for shaping and extruding has led to architectural advances in energy-saving building construction. The high strength-to-weight ratio has meant a substantial reduction in energy consumption for trucks and other vehicles. The aluminum industry is therefore a pivotal one for ecological sustainability and strategic for technological development.

  8. On the re-emergence of motion and innovations in the Gábor Bódy's intermedia experiments

    Directory of Open Access Journals (Sweden)

    Kamil Lipiński

    2015-06-01

    Full Text Available The article explores the main cases of Hungarian neo-avant-garde cinema in terms of re-emergence of visual material and the introduction of electronic innovations resulting in the transformation of reality. Among the research conducted in Béla Balázs Studio based on reframing the perception limits in the 1960s and the 1970s, the most innovative were Gábor Bódy's intermedia experiments. Along with launching K/3 subgroup within BBS, Bódy directed its objectives to reduce the material derived from reality and to visually intervene into media image electronically transforming the landscape of his films. Innovatively adapting the Sándor Weöres's verse, the film Narcissus and Psyche (1983 aimed at using hyper-real aesthetics to reframe the film reality. Starting from 1980, Bódy founded an international magazine Infermental to disseminate the advent of the video and electronics by creating a community drew on sharing news about emerging media image.

  9. Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp.

    Directory of Open Access Journals (Sweden)

    Julia Bock

    2016-10-01

    Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.

  10. Advances in aluminum anodizing

    Science.gov (United States)

    Dale, K. H.

    1969-01-01

    White anodize is applied to aluminum alloy surfaces by specific surface preparation, anodizing, pigmentation, and sealing techniques. The development techniques resulted in alloys, which are used in space vehicles, with good reflectance values and excellent corrosive resistance.

  11. Corrosion Inhibitors for Aluminum.

    Science.gov (United States)

    Muller, Bodo

    1995-01-01

    Describes a simple and reliable test method used to investigate the corrosion-inhibiting effects of various chelating agents on aluminum pigments in aqueous alkaline media. The experiments that are presented require no complicated or expensive electronic equipment. (DDR)

  12. Corrosion Protection of Aluminum

    Science.gov (United States)

    Dalrymple, R. S.; Nelson, W. B.

    1963-07-01

    Treatment of aluminum-base metal surfaces in an autoclave with an aqueous chromic acid solution of 0.5 to 3% by weight and of pH below 2 for 20 to 50 hrs at 160 to 180 deg C produces an extremely corrosion-resistant aluminum oxidechromium film on the surface. A chromic acid concentration of 1 to 2% and a pH of about 1 are preferred.

  13. Pengaruh Perbedaan Kelas Umur terhadap Produktivitas Getah Pinus merkusii Jungh et de Vriese Ras Lahan Jawa melalui Penyadapan Getah Metode Bor

    Directory of Open Access Journals (Sweden)

    Agus Sukarno

    2013-09-01

    Full Text Available Pinus merkusii Jungh et de Vriese merupakan tanaman asli Indonesia, yang sebaran alaminya di Aceh, Tapanuli dan Kerinci. Penyadapan getah dengan metode bor pada kelas umur yang berbeda belum pernah dilakukan. Tujuan penelitian untuk mengetahui perbedaan produksi getah pinus di antara  kelas umur. Penelitian dilakukan di RPH Oro-oro Ombo, BKPH Pujon, KPH Malang pada tanaman pinus kelas umur III, IV,  V  dan VI  dengan ketinggian tempat antara 1.100 m –1.250 m dari permukaan air laut.  Waktu penelitian bulan September sampai dengan Nopember 2010.  Jumlah pohon yang disadap di setiap kelas umur sebanyak 150 - 160 pohon dengan dua lubang per pohon.  Penyadapan getah menggunakan bor mesin, kantong plastik tahan minyak diikatkan pada ujung pipa untuk menampung getah.  Pemungutan getah dilakukan sehari setelah penyadapan. Analisis  data  menggunakan  one way anova, apabila terdapat perbedaan yang nyata,  dilakukan uji lanjut dengan orthogonal polynomial. Produksi getah di antara kelas umur, menunjukkan perbedaan yang nyata. Produksi getah kelas umur III (36,5 g/ 2 lubang/1 hari meningkat pada kelas umur IV (62,9 g/2 lubang/1 hari dan menurun pada kelas umur V  (24,61 g/2 lubang/1 hari.  Produksi getah pada kelas umur VI (38,3 g/ 2 lubang/1 hari hampir sama dengan kelas umur III. Hasil uji lanjut orthogonal polynomial  menunjukkan respons  bersifat kuadratik (p=0,09 antara produksi getah dengan kelas umur. Kata Kunci: Pinus, kelas umur, getah, metode bor

  14. Aluminum industry options paper

    International Nuclear Information System (INIS)

    1999-10-01

    In 1990, Canada's producers of aluminum (third largest in the world) emitted 10 million tonnes of carbon dioxide and equivalent, corresponding to 6.4 tonnes of greenhouse gas intensity per tonne of aluminum. In 2000, the projection is that on a business-as-usual (BAU) basis Canadian producers now producing 60 per cent more aluminum than in 1990, will emit 10.7 million tonnes of carbon dioxide and equivalent, corresponding to a GHG intensity of 4.2 tonnes per tonne of aluminum. This improvement is due to production being based largely on hydro-electricity, and partly because in general, Canadian plants are modern, with technology that is relatively GHG-friendly. The Aluminum Association of Canada estimates that based on anticipated production, and under a BAU scenario, GHG emissions from aluminum production will rise by 18 per cent by 2010 and by 30 per cent by 2020. GHG emissions could be reduced below the BAU forecast first, by new control and monitoring systems at some operations at a cost of $4.5 to 7.5 million per smelter. These systems could reduce carbon dioxide equivalent emissions by 0.8 million tonnes per year. A second alternative would require installation of breaker feeders which would further reduce perfluorocarbon (PFC) emissions by 0.9 million tonnes of carbon dioxide equivalent. Cost of the breakers feeders would be in the order of $200 million per smelter. The third option calls for the the shutting down of some of the smelters with older technology by 2015. In this scenario GHG emissions would be reduced by 2010 by 0.8 million tonnes per year of carbon dioxide equivalent. However, the cost in this case would be about $1.36 billion. The industry would support measures that would encourage the first two sets of actions, which would produce GHG emissions from aluminum production in Canada of about 10.2 million tonnes per year of carbon dioxide equivalent, or about two per cent above 1990 levels with double the aluminum production of 1990. Credit for

  15. Mesoporous aluminum phosphite

    International Nuclear Information System (INIS)

    El Haskouri, Jamal; Perez-Cabero, Monica; Guillem, Carmen; Latorre, Julio; Beltran, Aurelio; Beltran, Daniel; Amoros, Pedro

    2009-01-01

    High surface area pure mesoporous aluminum-phosphorus oxide-based derivatives have been synthesized through an S + I - surfactant-assisted cooperative mechanism by means of a one-pot preparative procedure from aqueous solution and starting from aluminum atrane complexes and phosphoric and/or phosphorous acids. A soft chemical extraction procedure allows opening the pore system of the parent as-prepared materials by exchanging the surfactant without mesostructure collapse. The nature of the pore wall can be modulated from mesoporous aluminum phosphate (ALPO) up to total incorporation of phosphite entities (mesoporous aluminum phosphite), which results in a gradual evolution of the acidic properties of the final materials. While phosphate groups in ALPO act as network building blocks (bridging Al atoms), the phosphite entities become basically attached to the pore surface, what gives practically empty channels. The mesoporous nature of the final materials is confirmed by X-ray diffraction (XRD), transmission electron microscopy (TEM) and N 2 adsorption-desorption isotherms. The materials present regular unimodal pore systems whose order decreases as the phosphite content increases. NMR spectroscopic results confirm the incorporation of oxo-phosphorus entities to the framework of these materials and also provide us useful information concerning the mechanism through which they are formed. - Abstract: TEM image of the mesoporous aluminum phosphite showing the hexagonal disordered pore array that is generated by using surfactant micelles as template. Also a scheme emphasizing the presence of an alumina-rich core and an ALPO-like pore surface is presented.

  16. Plug-welding of ODS cladding tube for BOR-60 irradiation. Welding condition setting. Device remodeling and welding

    International Nuclear Information System (INIS)

    Seki, Masayuki; Ishibashi, Fujio; Kono, Syusaku; Hirako, Kazuhito; Tsukada, Tatsuya

    2003-04-01

    Irradiation test in BOR-60 at RIAR to judge practical use prospect of ODS cladding tube at early stage is planned as Japan-Russia a joint research. RIAR does fuel design of fuel pin used for this joint research. JNC manufactures ODS cladding tube and bar materials (two steel kind of martensite and ferrite), upper endplug production. They are welded by pressurized resistance welding, and are inspected in JNC Tokai, transported to RIAR. And RIAR manufactures vibration packing fuel pin. On the upper endplug welding by pressurized resistance welding method, we worded on the problems such as decision of welding condition by changing the size and crystallization of cladding tube and the design of endplug, and the chucking device remodeling to correspond to the long scale cladding tube welding system (included handling) and of quality assurance method. Especially, use of long scale cladding tube caused problem that bending transformation occurred in cladding tube by welding pressure. However, we solved this problem by shortening the distance of cladding tube colette chuck and pressure receiving, and by putting the sleeve in an internal space of welding machine, losing the bending of cladding tube. Moreover, welding defects were occurred by the difference of an inside state, an inside defect and recrystallization of cladding tube. We solved the problem by inside grinding for the edge of tube, angle beam method by ultrasonic wave, and ultrasonic wave form confirmation. Manufacturing process with long scale cladding tube including heat-treatment to remove combustion return and remaining stress was established besides, Afterwards, welding of ODS cladding tube and upper endplug. As the quality assurance system, we constructed [Documented procedure (referred to JOYO)] based on [Document of the QA plan] by OEC. Welding and inspection were executed by the document procedure. It is thought that the quality assurance method become references for the irradiation test in JOYO in the

  17. Analysis of copper losses throughout weak acid effluent flows generated during off-gas treatment in the New Copper Smelter RTB Bor

    Directory of Open Access Journals (Sweden)

    Dragana Ivšić-Bajčeta

    2013-09-01

    Full Text Available The previous inadequate treatment of off-gas in RTB Bor in Serbia has resulted in serious pollution of the environment and the possibly high losses of copper through the effluent flows. The project of New Copper Smelter RTB Bor, besides the new flash smelting furnace (FSF and the reconstruction of Pierce-Smith converter (PSC, includes more effective effluent treatment. Paper presents an analysis of the new FSF and PSC off-gas treatment, determination of copper losses throughout generated wastewaters and discussion of its possible valorization. Assumptions about the solubility of metals phases present in the FSF and PSC off-gas, obtained by the treatment process simulation, were compared with the leaching results of flue dusts. Determined wastewaters characteristics indicate that the PSC flow is significantly richer in copper, mostly present in insoluble metallic/sulfide form, while the FSF flow has low concentration of copper in the form of completely soluble oxide/sulfate. The possible scenario for the copper valorization, considering arsenic and lead as limiting factors, is the separation of the FSF and PSC flows, return of the metallic/sulfide solid phase to the smelting process and recovery from the sulfate/oxide liquid phase.

  18. Regeneration of aluminum hydride

    Science.gov (United States)

    Graetz, Jason Allan; Reilly, James J; Wegrzyn, James E

    2012-09-18

    The present invention provides methods and materials for the formation of hydrogen storage alanes, AlH.sub.x, where x is greater than 0 and less than or equal to 6 at reduced H.sub.2 pressures and temperatures. The methods rely upon reduction of the change in free energy of the reaction between aluminum and molecular H.sub.2. The change in free energy is reduced by lowering the entropy change during the reaction by providing aluminum in a state of high entropy, and by increasing the magnitude of the change in enthalpy of the reaction or combinations thereof.

  19. Regeneration of aluminum hydride

    Science.gov (United States)

    Graetz, Jason Allan; Reilly, James J.

    2009-04-21

    The present invention provides methods and materials for the formation of hydrogen storage alanes, AlH.sub.x, where x is greater than 0 and less than or equal to 6 at reduced H.sub.2 pressures and temperatures. The methods rely upon reduction of the change in free energy of the reaction between aluminum and molecular H.sub.2. The change in free energy is reduced by lowering the entropy change during the reaction by providing aluminum in a state of high entropy, by increasing the magnitude of the change in enthalpy of the reaction or combinations thereof.

  20. Aluminum Hydroxide and Magnesium Hydroxide

    Science.gov (United States)

    Aluminum Hydroxide, Magnesium Hydroxide are antacids used together to relieve heartburn, acid indigestion, and upset stomach. They ... They combine with stomach acid and neutralize it. Aluminum Hydroxide, Magnesium Hydroxide are available without a prescription. ...

  1. Electrically conductive anodized aluminum coatings

    Science.gov (United States)

    Alwitt, Robert S. (Inventor); Liu, Yanming (Inventor)

    2001-01-01

    A process for producing anodized aluminum with enhanced electrical conductivity, comprising anodic oxidation of aluminum alloy substrate, electrolytic deposition of a small amount of metal into the pores of the anodized aluminum, and electrolytic anodic deposition of an electrically conductive oxide, including manganese dioxide, into the pores containing the metal deposit; and the product produced by the process.

  2. Fluxless aluminum brazing

    Science.gov (United States)

    Werner, W.J.

    1974-01-01

    This invention relates to a fluxless brazing alloy for use in forming brazed composites made from members of aluminum and its alloys. The brazing alloy consists of 35-55% Al, 10--20% Si, 25-60% Ge; 65-88% Al, 2-20% Si, 2--18% In; 65--80% Al, 15-- 25% Si, 5- 15% Y. (0fficial Gazette)

  3. Aluminum Corrosion and Turbidity

    International Nuclear Information System (INIS)

    Longtin, F.B.

    2003-01-01

    Aluminum corrosion and turbidity formation in reactors correlate with fuel sheath temperature. To further substantiate this correlation, discharged fuel elements from R-3, P-2 and K-2 cycles were examined for extent of corrosion and evidence of breaking off of the oxide film. This report discusses this study

  4. Aluminum concentration in hydrangeas

    International Nuclear Information System (INIS)

    Yanagawa, M.; Haruyama, Y.; Saito, M.

    2008-01-01

    We have been trying to measure concentration of aluminum in Ajisai, Hydrangea macrophylla for these days. But due to bad luck, we have encountered detector trouble for two years in a low. Thus, we have few data to analyze and obtained quite limited results. (author)

  5. Borated aluminum alloy manufacturing technology

    International Nuclear Information System (INIS)

    Shimojo, Jun; Taniuchi, Hiroaki; Kajihara, Katsura; Aruga, Yasuhiro

    2003-01-01

    Borated aluminum alloy is used as the basket material of cask because of its light weight, thermal conductivity and superior neutron absorbing abilities. Kobe Steel has developed a unique manufacturing process for borated aluminum alloy using a vacuum induction melting method. In this process, aluminum alloy is melted and agitated at higher temperatures than common aluminum alloy fabrication methods. It is then cast into a mold in a vacuum atmosphere. The result is a high quality aluminum alloy which has a uniform boron distribution and no impurities. (author)

  6. STUDI KONEKTIVITAS AKUIFER ANTARA SUMUR BOR DENGAN SUMBER DAYA AIR DI BAWAHNYA (Study on Aquifer Connectivity, between Boreholes with water resources underneath

    Directory of Open Access Journals (Sweden)

    Agus Budhie Wijatna

    2013-11-01

    Full Text Available ABSTRAK Untuk memenuhi kebutuhan air bersih bagi penduduk di daerah bekas bencana letusan Gunung Merapi, Kabupaten Sleman, DIY, telah dibuat 5 sumur bor di Dusun Srunen (BH1, Pagerjurang (BH2, Ngepring (BH3, Kuweron (BH4, dan di Dusun Bubur (BH5. Pembuatan sumur bor pada elevasi antara 544 sampai 846 m.dpl, dengan kedalaman antara 98-146 m dan debit pengambilan airtanah rerata 9-10 liter per detik tersebut dikawatirkan akan mempengaruhi kondisi muka airtanah sumur gali di Dusun Pendowoharjo (W7, Ngaglik (W8, Gebang (W9, Condong Catur (W10, sumur UGM (W11 dan mempengaruhi debit umbul (mataair Ngepas (S8, Umbul Jogopaten (S9, Umbul Pajangan (S10, Umbul Londo (S11, Umbul Permai (S12, dan Umbul Seturan (S13, yang berada pada elevasi 148-329 m.dpl. Secara teoritis, pengambilan airtanah di sumur bor akan berpengaruh jika terdapat interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair. Pada penelitian ini, interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair dilakukan menggunakan isotop lingkungan (D, 3H dan 18O. Penelitian diawali dengan menentukan lokasi pengambilan sampel airtanah berdasarkan peta topografi dan kondisi hidrologi; sampel airtanah diambil dari sumur bor, sumur gali dan mataair sebanyak 30 ml dan 1.000 ml; rasio isotop δD dan δ18O pada sampel airtanah diukur dengan liquid-water stable isotope analyzer LGR DLT-100, sedangkan kadar tritium diukur dengan Liquid Scientillation Counter (LSC Tri Carb 1900 TR. Genesis sampel airtanah ditentukan berdasarkan komposisi isotop (δ18O, δD dengan mengacu pada persamaan Merapi Meteoric Water Line (MMWL; sedangkan untuk memastikan adanya interkoneksi hidraulik, maka hasil pengukuran kadar tritium dianalisis dengan tritium dating method. Hasil penelitian menunjukkan bahwa genesis airtanah di BH1, BH2, BH3, dan BH4 berbeda dengan genesis airtanah sumur gali dan mataair di bawahnya. Sehingga dapat disimpulkan airtanah sumur bor di BH1, BH2, BH3, dan BH4 tidak memiliki

  7. 21 CFR 73.1645 - Aluminum powder.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Aluminum powder. 73.1645 Section 73.1645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1645 Aluminum powder. (a) Identity. (1) The color additive aluminum powder shall be composed of finely divided particles of aluminum prepared from virgin aluminum. It...

  8. Aluminum fin-stock alloys

    International Nuclear Information System (INIS)

    Gul, R.M.; Mutasher, F.

    2007-01-01

    Aluminum alloys have long been used in the production of heat exchanger fins. The comparative properties of the different alloys used for this purpose has not been an issue in the past, because of the significant thickness of the finstock material. However, in order to make fins lighter in weight, there is a growing demand for thinner finstock materials, which has emphasized the need for improved mechanical properties, thermal conductivity and corrosion resistance. The objective of this project is to determine the effect of iron, silicon and manganese percentage increment on the required mechanical properties for this application by analyzing four different aluminum alloys. The four selected aluminum alloys are 1100, 8011, 8079 and 8150, which are wrought non-heat treatable alloys with different amount of the above elements. Aluminum alloy 1100 serve as a control specimen, as it is commercially pure aluminum. The study also reports the effect of different annealing cycles on the mechanical properties of the selected alloys. Metallographic examination was also preformed to study the effect of annealing on the precipitate phases and the distribution of these phases for each alloy. The microstructure analysis of the aluminum alloys studied indicates that the precipitated phase in the case of aluminum alloys 1100 and 8079 is beta-FeAI3, while in 8011 it is a-alfa AIFeSi, and the aluminum alloy 8150 contains AI6(Mn,Fe) phase. The comparison of aluminum alloys 8011 and 8079 with aluminum alloy 1100 show that the addition of iron and silicon improves the percent elongation and reduces strength. The manganese addition increases the stability of mechanical properties along the annealing range as shown by the comparison of aluminum alloy 8150 with aluminum alloy 1100. Alloy 8150 show superior properties over the other alloys due to the reaction of iron and manganese, resulting in a preferable response to thermal treatment and improved mechanical properties. (author)

  9. Production of aluminum metal by electrolysis of aluminum sulfide

    Science.gov (United States)

    Minh, Nguyen Q.; Loutfy, Raouf O.; Yao, Neng-Ping

    1984-01-01

    Production of metallic aluminum by the electrolysis of Al.sub.2 S.sub.3 at 700.degree.-800.degree. C. in a chloride melt composed of one or more alkali metal chlorides, and one or more alkaline earth metal chlorides and/or aluminum chloride to provide improved operating characteristics of the process.

  10. Applied Electrochemistry of Aluminum

    DEFF Research Database (Denmark)

    Li, Qingfeng; Qiu, Zhuxian

    Electrochemistry of aluminum is of special importance from both theoretical and technological point of view. It covers a wide range of electrolyte systems from molten fluoride melts at around 1000oC to room temperature molten salts, from aqueous to various organic media and from liquid to solid...... electrolytes. The book is an updated review of the technological advances in the fields of electrolytic production and refining of metals, electroplating, anodizing and other electrochemical surface treatments, primary and secondary batteries, electrolytic capacitors; corrosion and protection and others....

  11. Helium trapping in aluminum and sintered aluminum powders

    International Nuclear Information System (INIS)

    Das, S.K.; Kaminsky, M.; Rossing, T.

    1975-01-01

    The surface erosion of annealed aluminum and of sintered aluminum powder (SAP) due to blistering from implantation of 100-keV 4 He + ions at room temperature has been investigated. A substantial reduction in the blistering erosion rate in SAP was observed from that in pure annealed aluminum. In order to determine whether the observed reduction in blistering is due to enhanced helium trapping or due to helium released, the implanted helium profiles in annealed aluminum and in SAP have been studied by Rutherford backscattering. The results show that more helium is trapped in SAP than in aluminum for identical irradiation conditions. The observed reduction in erosion from helium blistering in SAP is more likely due to the dispersion of trapped helium at the large Al-Al 2 O 3 interfaces and at the large grain boundaries in SAP than to helium release

  12. Selective Adsorption of Sodium Aluminum Fluoride Salts from Molten Aluminum

    Energy Technology Data Exchange (ETDEWEB)

    Leonard S. Aubrey; Christine A. Boyle; Eddie M. Williams; David H. DeYoung; Dawid D. Smith; Feng Chi

    2007-08-16

    Aluminum is produced in electrolytic reduction cells where alumina feedstock is dissolved in molten cryolite (sodium aluminum fluoride) along with aluminum and calcium fluorides. The dissolved alumina is then reduced by electrolysis and the molten aluminum separates to the bottom of the cell. The reduction cell is periodically tapped to remove the molten aluminum. During the tapping process, some of the molten electrolyte (commonly referred as “bath” in the aluminum industry) is carried over with the molten aluminum and into the transfer crucible. The carryover of molten bath into the holding furnace can create significant operational problems in aluminum cast houses. Bath carryover can result in several problems. The most troublesome problem is sodium and calcium pickup in magnesium-bearing alloys. Magnesium alloying additions can result in Mg-Na and Mg-Ca exchange reactions with the molten bath, which results in the undesirable pickup of elemental sodium and calcium. This final report presents the findings of a project to evaluate removal of molten bath using a new and novel micro-porous filter media. The theory of selective adsorption or removal is based on interfacial surface energy differences of molten aluminum and bath on the micro-porous filter structure. This report describes the theory of the selective adsorption-filtration process, the development of suitable micro-porous filter media, and the operational results obtained with a micro-porous bed filtration system. The micro-porous filter media was found to very effectively remove molten sodium aluminum fluoride bath by the selective adsorption-filtration mechanism.

  13. Aluminum anode for aluminum-air battery - Part I: Influence of aluminum purity

    Science.gov (United States)

    Cho, Young-Joo; Park, In-Jun; Lee, Hyeok-Jae; Kim, Jung-Gu

    2015-03-01

    2N5 commercial grade aluminum (99.5% purity) leads to the lower aluminum-air battery performances than 4N high pure grade aluminum (99.99% purity) due to impurities itself and formed impurity complex layer which contained Fe, Si, Cu and others. The impurity complex layer of 2N5 grade Al declines the battery voltage on standby status. It also depletes discharge current and battery efficiency at 1.0 V which is general operating voltage of aluminum-air battery. However, the impurity complex layer of 2N5 grade Al is dissolved with decreasing discharge voltage to 0.8 V. This phenomenon leads to improvement of discharge current density and battery efficiency by reducing self-corrosion reaction. This study demonstrates the possibility of use of 2N5 grade Al which is cheaper than 4N grade Al as the anode for aluminum-air battery.

  14. Calidad de abonos orgánicos empleados en la depresión de Quíbor-Venezuela bajo ambientes protegidos

    Directory of Open Access Journals (Sweden)

    Duilio Torres Rodríguez

    2017-01-01

    Full Text Available La depresión de Quíbor es una de las zonas agrícolas más importante de Venezuela, donde en los últimos años se han introducido sistemas de producción bajo ambientes protegidos, los cuales están acompañados por el uso de abonos orgánicos, no certi cados. El objetivo de esta investigación fue evaluar la calidad de los abonos orgánicos empleados en sistemas de producción bajo ambientes protegidos en la depresión de Quíbor, Venezuela. Se realizó un diseño experimental completamente al azar y se evaluaron once (11 abonos orgánicos (cuatro sólidos y siete líquidos por triplicados. Los abonos sólidos fueron colectados en la parte superior, inferior y media de las pilas, mientras que los líquidos fueron tomados directamente de los tanques de almacenamiento. Para la caracterización de los abonos se empleó el protocolo TMECC, la materia orgánica se determinó por calcinación a 450°C, el nitrógeno por Kjeldahl y los macronutrientes (potasio y calcio y micronutrientes (cobre, manganeso, hierro y zinc en extracto acuoso 1/20 (v/v del material y cuantificación por absorción atómica. Los resultados obtenidos muestran que el vermicompost y compost de gallinaza presentaron los valores más altos de macronutrientes, mientras, para los abonos líquidos Macro®, fue quien presentó la mayor concentración de nitrógeno, humus1 los valores más altos de Ca y Mg y Micro® y humus2 los mayores contenidos de manganeso, hierro, cobre y zinc fueron encontrados, todos los abonos sólidos presentaron valores bajos de micronutrientes.

  15. Invisible Display in Aluminum

    DEFF Research Database (Denmark)

    Prichystal, Jan Phuklin; Hansen, Hans Nørgaard; Bladt, Henrik Henriksen

    2005-01-01

    Bang & Olufsen a/s has been working with ideas for invisible integration of displays in metal surfaces. Invisible integration of information displays traditionally has been possible by placing displays behind transparent or semitransparent materials such as plastic or glass. The wish for an integ......Bang & Olufsen a/s has been working with ideas for invisible integration of displays in metal surfaces. Invisible integration of information displays traditionally has been possible by placing displays behind transparent or semitransparent materials such as plastic or glass. The wish...... for an integrated display in a metal surface is often ruled by design and functionality of a product. The integration of displays in metal surfaces requires metal removal in order to clear the area of the display to some extent. The idea behind an invisible display in Aluminum concerns the processing of a metal...

  16. [Microbiological corrosion of aluminum alloys].

    Science.gov (United States)

    Smirnov, V F; Belov, D V; Sokolova, T N; Kuzina, O V; Kartashov, V R

    2008-01-01

    Biological corrosion of ADO quality aluminum and aluminum-based construction materials (alloys V65, D16, and D16T) was studied. Thirteen microscopic fungus species and six bacterial species proved to be able to attack aluminum and its alloys. It was found that biocorrosion of metals by microscopic fungi and bacteria was mediated by certain exometabolites. Experiments on biocorrosion of the materials by the microscopic fungus Alternaria alternata, the most active biodegrader, demonstrated that the micromycete attack started with the appearance of exudate with pH 8-9 on end faces of the samples.

  17. Aluminum hydroxide issue closure package

    International Nuclear Information System (INIS)

    Bergman, T.B.

    1998-01-01

    Aluminum hydroxide coatings on fuel elements stored in aluminum canisters in K West Basin were measured in July and August 1998. Good quality data was produced that enabled statistical analysis to determine a bounding value for aluminum hydroxide at a 99% confidence level. The updated bounding value is 10.6 kg per Multi-Canister Overpack (MCO), compared to the previously estimated bounding value of 8 kg/MCO. Thermal analysis using the updated bounding value, shows that the MCO generates oxygen concentrate that are below the lower flammability limits during the 40-year interim storage period and are, therefore, acceptable

  18. Packaging material and aluminum. Hoso zairyo to aluminum

    Energy Technology Data Exchange (ETDEWEB)

    Itaya, T [Mitsubishi Aluminum Co. Ltd., Tokyo (Japan)

    1992-02-01

    The present paper introduces aluminum foil packaging materials among the relation between packing materials and aluminum. The characteristics of aluminum foil in the packaging area are in its barrier performance, non-toxicity, tastelessness and odorlessness. Its excellent functions and processibility suit best as functional materials for food, medicine and industrial material packaging. While an aluminum foil may be used as a single packing material as in foils used in homes, many of it as a packaging material are used in combination with adhesives, papers or plastic films, or coated or printed. It is used as composite materials laminated or coated with other materials according to their use for the purpose of complementing the aluminum foil as the base material. Representative method to laminate aluminum foils include the wet lamination, dry lamination, thermally dissolved lamination and extruded lamination. The most important quality requirement in lamination is the adhesion strength, which requires a close attention in selecting the kinds of adhesive, laminating conditions, and aging conditions. 8 figs., 6 tabs.

  19. Volcanogenic Turonian and epiclastics of senonian in the Timok magmatic complex between Bor and the Tupižnica mountain, eastern Serbia

    Directory of Open Access Journals (Sweden)

    Đorđević Miodrag

    2005-01-01

    Full Text Available In the light of the findings presented in this paper, among the volcanic products of the Upper Cretaceous, referred to as "the first volcanic phase" (Drovenik, 1961, two lithostratigraphic units can be singled out within the Timok Magmatic Complex (TMC: - The lower one, consisting of volcanogenic, subaerial, dominantly hornblende andésite volcaniclastic, formed on land, and less abundant volcanic and sub-volcanic-hypoabyssal rocks. It is the main source of sulfide mine­ralization in Bor. It was formed before the Upper Turonian and consists of hornblende andésite and occasionally low biotite. Minor constituents are biotite-hornblende dacite and some andésite and dacite materials con­taining augite in addition to hornblende and biotite. - The upper one, from the Upper Turonian period when the volcanic activity of the region had ended, is marine deposited and epiclastic. Intercalated with Senonian marls, it is composed of land deposited Turonian volcanogenic material of all generations. Fresh material mostly consisting of hornblende andésite volcanoclastics prevails in it. Fresh epiclastics include ore mineral epiclasts. Epiclastics composed of epiclasts of hydro thermally altered rocks were observed which also include ore epiclasts. The ore epiclasts originate from copper ore. The boundary between the volcanogenic Turonian and the epiclastic deposits is a well-recognized unconformity. Table 1 in the text summarizes the main characteristics of the Turonian volcanogenic rocks, primarily those of volcaniclastics, as well as those of epiclastic deposits.

  20. Radioactivity of long-lived nuclides in the primary circuit of the reactor BOR-60 during operation with defective fuel elements

    International Nuclear Information System (INIS)

    Gryazev, V.M.; Kizin, V.D.; Lisitsyn, E.S.; Polyakov, V.I.; Chechetkin, Y.V.

    1978-06-01

    The summarized results of measurements of the enrichment and distribution of radioactive nuclides from corrosion and of fission products during the four years of operation of BOR-60, including a longer period of operation with detective fuel elements in the core, are presented. It is shown that for operation with approximately 1% leaking fuel rods radiation exposure becomes worse manily because of release and enrichment of cesium isotopes in the coolant. Of the other fission products, the largest contribution to the dose rate in pipework and components is given by 140 Ba / 140 La and 95 Nb. On operation with 0.1 to 0.2% of leaking fuel rods, this contribution is comparable to that of the corrosion products 60 Co and 54 Mn. The radioactivity of corrosion products in the circuit has not increased within the last three years and was about one order of magnitude lower than the theoretical values. The corrosion and fission products are nonuniformly distributed over the circuit. Concentration of 95 Nb and 60 Co in the pipe for 'cold' sodium is larger by a factor of 2 - 5 and of 140 Ba and 54 Mn by a factor of 10-20 than in the pipes for 'hot' sodium. Most of the cobalt was found to deposit in the heat exchanges. The effectiveness of emptying the pipes from coolant in order to reduce the dose sate is assessed. (orig.) [de

  1. Heated Aluminum Tanks Resist Corrosion

    Science.gov (United States)

    Johnson, L. E.

    1983-01-01

    Simple expedient of heating foam-insulated aluminum alloy tanks prevents corrosion by salt-laden moisture. Relatively-small temperature difference between such tank and surrounding air will ensure life of tank is extended by many years.

  2. Chrome - Free Aluminum Coating System

    Science.gov (United States)

    Bailey, John H.; Gugel, Jeffrey D.

    2010-01-01

    This slide presentation concerns the program to qualify a chrome free coating for aluminum. The program was required due to findings by OSHA and EPA, that hexavalent chromium, used to mitigate corrosion in aerospace aluminum alloys, poses hazards for personnel. This qualification consisted of over 4,000 tests. The tests revealed that a move away from Cr+6, required a system rather than individual components and that the maximum corrosion protection required pretreatment, primer and topcoat.

  3. "Ripples" in an Aluminum Pool?

    Science.gov (United States)

    Rohr, James; Wang, Si-Yin; Nesterenko, Vitali F.

    2018-05-01

    Our motivation for this article is for students to realize that opportunities for discovery are all around them. Discoveries that can still puzzle present day researchers. Here we explore an observation by a middle school student concerning the production of what appears to be water-like "ripples" produced in aluminum foil when placed between two colliding spheres. We both applaud and explore the student's reasoning that the ripples were formed in a melted aluminum pool.

  4. A Virtual Aluminum Reduction Cell

    Science.gov (United States)

    Zhang, Hongliang; Zhou, Chenn Q.; Wu, Bing; Li, Jie

    2013-11-01

    The most important component in the aluminum industry is the aluminum reduction cell; it has received considerable interests and resources to conduct research to improve its productivity and energy efficiency. The current study focused on the integration of numerical simulation data and virtual reality technology to create a scientifically and practically realistic virtual aluminum reduction cell by presenting complex cell structures and physical-chemical phenomena. The multiphysical field simulation models were first built and solved in ANSYS software (ANSYS Inc., Canonsburg, PA, USA). Then, the methodology of combining the simulation results with virtual reality was introduced, and a virtual aluminum reduction cell was created. The demonstration showed that a computer-based world could be created in which people who are not analysis experts can see the detailed cell structure in a context that they can understand easily. With the application of the virtual aluminum reduction cell, even people who are familiar with aluminum reduction cell operations can gain insights that make it possible to understand the root causes of observed problems and plan design changes in much less time.

  5. Anodized aluminum on LDEF

    Science.gov (United States)

    Golden, Johnny L.

    1993-01-01

    A compilation of reported analyses and results obtained for anodized aluminum flown on the Long Duration Exposure Facility (LDEF) was prepared. Chromic acid, sulfuric acid, and dyed sulfuric acid anodized surfaces were exposed to the space environment. The vast majority of the anodized surface on LDEF was chromic acid anodize because of its selection as a thermal control coating for use on the spacecraft primary structure, trays, tray clamps, and space end thermal covers. Reports indicate that the chromic acid anodize was stable in solar absorptance and thermal emittance, but that contamination effects caused increases in absorptance on surfaces exposed to low atomic oxygen fluences. There were some discrepancies, however, in that some chromic acid anodized specimens exhibited significant increases in absorptance. Sulfuric acid anodized surfaces also appeared stable, although very little surface area was available for evaluation. One type of dyed sulfuric acid anodize was assessed as an optical baffle coating and was observed to have improved infrared absorptance characteristics with exposure on LDEF.

  6. Gas evolution behavior of aluminum in mortar

    Energy Technology Data Exchange (ETDEWEB)

    Hashizume, Shuji; Matsumoto, Junko; Banba, Tsunetaka [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1996-10-01

    As a part of study of leaching behavior for solidified dry low level radioactive waste, gas evolution behavior of aluminum in mortar was investigated, and a plan of our research was proposed. The effect of pH on corrosion rate of aluminum, corrosion product, time dependency of corrosion rate of aluminum in mortar, change of corrosion mechanism, the effects of Na, Ca and Cl ions on corrosion rate of aluminum in mortar and corrosion behavior of aluminum when aluminum was used as sacrificed anode in reinforced concrete were previously clarified. Study of the effects of environmental factors such as pH, kind of ions and temperature on gas evolution behavior of aluminum and the effect of aluminum/carbon steel surface ratio no gas evolution behavior of aluminum were planed. (author). 75 refs.

  7. Gas evolution behavior of aluminum in mortar

    International Nuclear Information System (INIS)

    Hashizume, Shuji; Matsumoto, Junko; Banba, Tsunetaka

    1996-10-01

    As a part of study of leaching behavior for solidified dry low level radioactive waste, gas evolution behavior of aluminum in mortar was investigated, and a plan of our research was proposed. The effect of pH on corrosion rate of aluminum, corrosion product, time dependency of corrosion rate of aluminum in mortar, change of corrosion mechanism, the effects of Na, Ca and Cl ions on corrosion rate of aluminum in mortar and corrosion behavior of aluminum when aluminum was used as sacrificed anode in reinforced concrete were previously clarified. Study of the effects of environmental factors such as pH, kind of ions and temperature on gas evolution behavior of aluminum and the effect of aluminum/carbon steel surface ratio no gas evolution behavior of aluminum were planed. (author). 75 refs

  8. Weld Repair of Thin Aluminum Sheet

    Science.gov (United States)

    Beuyukian, C. S.; Mitchell, M. J.

    1986-01-01

    Weld repairing of thin aluminum sheets now possible, using niobium shield and copper heat sinks. Refractory niobium shield protects aluminum adjacent to hole, while copper heat sinks help conduct heat away from repair site. Technique limits tungsten/inert-gas (TIG) welding bombardment zone to melt area, leaving surrounding areas around weld unaffected. Used successfully to repair aluminum cold plates on Space Shuttle, Commercial applications, especially in sealing fractures, dents, and holes in thin aluminum face sheets or clad brazing sheet in cold plates, heat exchangers, coolers, and Solar panels. While particularly suited to thin aluminum sheet, this process also used in thicker aluminum material to prevent surface damage near weld area.

  9. Efectos de la costra microbiótica en algunas propiedades del suelo en el sur de la quebrada Los Barrancos, Valle de Quíbor, Venezuela

    Directory of Open Access Journals (Sweden)

    Franklin Antonio Nuñez Ravelo

    2013-10-01

    Full Text Available En el suelo de Quíbor crecen de manera discontinua unas costras constituidas por líquenes, briofitas y cianobacterias. El propósito de esta investigación es identificar variaciones en el comportamiento de algunas propiedades edáficas al comparar muestras del suelo con y sin costra. Se trata de una investigación de campo desarrollada en tres fases: la primera, denominada de Campo, con el fin de recolectar muestras de suelo con apoyo en la tabla de dígitos aleatorios y a partir de dos transectas longitudinales, sobre éstas se empleó cada diez metros una cuadrata cuadrada de 25 x 25 cm; la segunda fase, laboratorio, en la cual se determinaron las propiedades del suelo: a física como el %humedad; b químicas como la salinidad, pH, Conductividad Eléctrica (C.E y Carbono Orgánico (CO, y c bioquímicas, entre ellas la Materia Orgánica (MO y Dióxido de carbono (CO2 desprendido; la tercera fase, de análisis estadístico, se empleó la prueba t, a fin de identificar variaciones significativas entre ambos grupos muestrales. Se concluye que la presencia de la costra en la superficie del suelo aumenta la actividad metabólica, el CO y la MO. En cuanto al pH, C.E, salinidad y %H no se registraron variaciones significativas.

  10. Multi-criteria analysis of soil pollution by heavy metals in the vicinity of the Copper Smelting Plant in Bor (Serbia

    Directory of Open Access Journals (Sweden)

    NEVENKA PETROVIĆ

    2011-04-01

    Full Text Available This study highlights the consequences on soil pollution of one hund­red years of manufacturing in the Copper Mining and Smelting Complex RTB-Bor (Serbia. Soil sediments were taken via a probe from the surface layer of the soil at twelve different measuring points. The measuring points were all within 20 km of the smelting plant, which included both urban and rural zones. Soil sampling was performed using a soil core sampler in such way that a core of a soil of radius 5 cm and depth of 30 cm was removed. Subsequently, the samples were analyzed for pH and heavy metal concentrations (Cu, Pb, As, Cd, Mn, Ni and Hg using different spectrometric methods. The obtained results for the heavy metal contents in the samples show high values: 2,540 mg kg-1 Cu; 230 mg kg-1 Pb; 6 mg kg-1 Cd; 530 mg kg-1 Ni; 1,300 mg kg-1 Mn; 260 mg kg-1 As and 0.3 mg kg-1 Hg. In this study, critical zones of polluted soil were iden­tified and ranked according to their metal contents by the multi-criteria deci­sion method Preference Organization Method for Enrichment Evaluation/Geo­metrical Analysis for Interactive Assistance – PROMETHEE/GAIA, which is the preferred multivariate method commonly used in chemometric studies. The ranking results clearly showed that the most polluted zones are at locations holding the vital functions of the town. Therefore, due to the high bioavail­abi­lity of heavy metals through com­plex reactions with organic species in the sediments, consequences for human health could drastically emerge if these metals enter the food chain.

  11. Recrystallization in Commercially Pure Aluminum

    DEFF Research Database (Denmark)

    Bay, Bent; Hansen, Niels

    1984-01-01

    Recrystallization behavior in commercial aluminum with a purity of 99.4 pct was studied by techniques such as high voltage electron microscopy, 100 kV transmission electron microscopy, and light microscopy. Sample parameters were the initial grain size (290 and 24 microns) and the degree of defor......Recrystallization behavior in commercial aluminum with a purity of 99.4 pct was studied by techniques such as high voltage electron microscopy, 100 kV transmission electron microscopy, and light microscopy. Sample parameters were the initial grain size (290 and 24 microns) and the degree...... are discussed and compared with results from an earlier study1 covering the recrystallization behavior of commercial aluminum of the same purity deformed at higher degrees of deformation (50 to 90 pct reduction in thickness by cold-rolling)....

  12. Aluminum-air battery crystallizer

    Science.gov (United States)

    Maimoni, A.

    1987-01-01

    A prototype crystallizer system for the aluminum-air battery operated reliably through simulated startup and shutdown cycles and met its design objectives. The crystallizer system allows for crystallization and removal of the aluminium hydroxide reaction product; it is required to allow steady-state and long-term operation of the aluminum-air battery. The system has to minimize volume and maintain low turbulence and shear to minimize secondary nucleation and energy consumption while enhancing agglomeration. A lamella crystallizer satisfies system constraints.

  13. Aluminum-carbon composite electrode

    Science.gov (United States)

    Farahmandi, C. Joseph; Dispennette, John M.

    1998-07-07

    A high performance double layer capacitor having an electric double layer formed in the interface between activated carbon and an electrolyte is disclosed. The high performance double layer capacitor includes a pair of aluminum impregnated carbon composite electrodes having an evenly distributed and continuous path of aluminum impregnated within an activated carbon fiber preform saturated with a high performance electrolytic solution. The high performance double layer capacitor is capable of delivering at least 5 Wh/kg of useful energy at power ratings of at least 600 W/kg.

  14. Aluminum nitride insulating films for MOSFET devices

    Science.gov (United States)

    Lewicki, G. W.; Maserjian, J.

    1972-01-01

    Application of aluminum nitrides as electrical insulator for electric capacitors is discussed. Electrical properties of aluminum nitrides are analyzed and specific use with field effect transistors is defined. Operational limits of field effect transistors are developed.

  15. The effect of zinc on the aluminum anode of the aluminum-air battery

    Science.gov (United States)

    Tang, Yougen; Lu, Lingbin; Roesky, Herbert W.; Wang, Laiwen; Huang, Baiyun

    Aluminum is an ideal material for batteries, due to its excellent electrochemical performance. Herein, the effect of zinc on the aluminum anode of the aluminum-air battery, as an additive for aluminum alloy and electrolytes, has been studied. The results show that zinc can decrease the anodic polarization, restrain the hydrogen evolution and increase the anodic utilization rate.

  16. 75 FR 70689 - Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum-Greenwood Forge Division; Currently...

    Science.gov (United States)

    2010-11-18

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-70,376] Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum- Greenwood Forge Division; Currently Known As Contech Forgings, LLC..., applicable to workers of Kaiser Aluminum Fabricated Products, LLC, Kaiser Aluminum-Greenwood Forge Division...

  17. 75 FR 80527 - Aluminum Extrusions From China

    Science.gov (United States)

    2010-12-22

    ...)] Aluminum Extrusions From China AGENCY: United States International Trade Commission. ACTION: Scheduling of... of subsidized and less-than-fair-value imports from China of aluminum extrusions, primarily provided... contained in Aluminum Extrusions From the People's Republic of China: Notice of Preliminary Determination of...

  18. 21 CFR 73.2645 - Aluminum powder.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Aluminum powder. 73.2645 Section 73.2645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Cosmetics § 73.2645 Aluminum powder. (a) Identity and specifications. The color additive aluminum powder shall conform in identity and specifications to the requirements of...

  19. 21 CFR 582.1125 - Aluminum sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aluminum sulfate. 582.1125 Section 582.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This substance...

  20. 21 CFR 182.1125 - Aluminum sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum sulfate. 182.1125 Section 182.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This substance...

  1. Characterization of ultrafine aluminum nanoparticles

    International Nuclear Information System (INIS)

    Sandstrom, Mary M.; Jorgensen, Betty S.; Mang, Joseph T.; Smith, Bettina L.; Son, Steven F.

    2004-01-01

    Aluminum nanopowders with particle sizes ranging from ∼25 nm to 80 nm were characterized by a variety of methods. We present and compare the results from common powder characterization techniques including transmission electron microscopy (TEM), high resolution transmission electron microscopy (HRTEM), BET gas adsorption surface area analysis, thermogravimetric analysis (TGA), photon correlation spectroscopy (PCS), and low angle laser light scattering (LALLS). Aluminum nanoparticles consist of an aluminum core with an aluminum oxide coating. HRTEM measurements of both the particle diameter and oxide layer thickness tend to be larger than those obtained from BET and TGA. LALLS measurements show a large degree of particle agglomeration in solution; therefore, primary particle sizes could not be determined. Furthermore, results from small-angle scattering techniques (SAS), including small-angle neutron (SANS) and x-ray (SAXS) scattering are presented and show excellent agreement with the BET, TGA, and HRTEM. The suite of analytical techniques presented in this paper can be used as a powerful tool in the characterization of many types of nanosized powders.

  2. Aluminum break-point contacts

    NARCIS (Netherlands)

    Heinemann, Martina; Groot, R.A. de

    1997-01-01

    Ab initio molecular dynamics is used to study the contribution of a single Al atom to an aluminum breakpoint contact during the final stages of breaking and the initial stages of the formation of such a contact. A hysteresis effect is found in excellent agreement with experiment and the form of the

  3. Decarbonization process for carbothermically produced aluminum

    Science.gov (United States)

    Bruno, Marshall J.; Carkin, Gerald E.; DeYoung, David H.; Dunlap, Sr., Ronald M.

    2015-06-30

    A method of recovering aluminum is provided. An alloy melt having Al.sub.4C.sub.3 and aluminum is provided. This mixture is cooled and then a sufficient amount of a finely dispersed gas is added to the alloy melt at a temperature of about 700.degree. C. to about 900.degree. C. The aluminum recovered is a decarbonized carbothermically produced aluminum where the step of adding a sufficient amount of the finely dispersed gas effects separation of the aluminum from the Al.sub.4C.sub.3 precipitates by flotation, resulting in two phases with the Al.sub.4C.sub.3 precipitates being the upper layer and the decarbonized aluminum being the lower layer. The aluminum is then recovered from the Al.sub.4C.sub.3 precipitates through decanting.

  4. İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 / Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports

    Directory of Open Access Journals (Sweden)

    Tahir Bilirli

    2016-06-01

    Full Text Available İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 Öz Bu makale, Osmanlı Devleti'nde 1845 yılında ilan edilen Tensikât-ı mülkiye kararı çerçevesinde geçici olarak olarak kurulan İmar Meclisleri'nin görevlerini incelemektedir. Makalede, bu meclislerin özellikle halkın borç para alma durumları ile selem usulü denilen mahsulün hasattan önce satılması konusundaki faaliyetleri incelenmektedir. Hasat zamanından önce alınan vergi, ahaliyi borçlanmaya yöneltmekte, bu da halkın fahiş faiz oranlarıyla tefecilerden borç almalarına ve ürünün hasat edilmeden önce daha düşük fiyatlara satılmasına sebep olmaktaydı. Bu durum gelir kaybı nedeniyle hem tebaya hem de devlete zarar vermekteydi. İmar Meclisi memurları yaşanan bu sıkıntının giderilmesi noktasında yerinde durum tespiti yapmışlardır. Makalenin birinci bölümünde İmar Meclisleri'nin kuruluşu ve görevleri hakkında bilgi verilmektedir. İkinci bölümde makalenin ana konusu olan borçlanma ve selem usulünün uygulanmasının meclis raporlarına nasıl yansıdığı arşiv belgelerine göre ele alınmıştır. Makalenin sonuç bölümünde arşiv belgelerinde elde edilen veriler doğrultusunda değerlendirme yapılmıştır. Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports Abstract This article examines the mission of Macalis Imariyya (Develepment Counsils which were founded by the decree of Tankisat al-Mulkiyye declared in 1845. In the article, the activity of these Counsils about the indebtedness status of the people and the selling of products before the harvest -called “selem”- particularly examined. The tax collection before harvest period was impelling the people borrowing from usurers with excessive interest rates and to sell the product at nearly half price. This case was damaging both the state and the citizens because of income loss. Development Council

  5. Aluminum precipitation from Hanford DSSF

    International Nuclear Information System (INIS)

    Borgen, D.; Frazier, P.; Staton, G.

    1994-01-01

    A series of pilot scale tests using simulated Double Shell Slurry Feed (DSSF) showed that well-settled aluminum precipitate can be produced in Hanford double shell tank (DST) high level waste by slow neutralization with carbon dioxide. This pretreatment could provide an early grout feed and free tank space, as well as facilitate downstream processes such as ion exchange by providing a less caustic feed. A total of eight test runs were completed using a 10-ft tall 3-in i.d. glass column. The 10-ft height corresponds to about one third of the vertical height of a DST, hence providing a reasonable basis for extrapolating the observed precipitate settling and compaction to the actual waste tank environment. Four runs (three with a simplified simulant and one with a chemically complete simulant) produced well settled precipitates averaging 1.5 to 2 feet high. Aluminum gel rather than settled precipitate resulted from one test where neutralization was too rapid

  6. Electrically Conductive Anodized Aluminum Surfaces

    Science.gov (United States)

    Nguyen, Trung Hung

    2006-01-01

    Anodized aluminum components can be treated to make them sufficiently electrically conductive to suppress discharges of static electricity. The treatment was conceived as a means of preventing static electric discharges on exterior satin-anodized aluminum (SAA) surfaces of spacecraft without adversely affecting the thermal-control/optical properties of the SAA and without need to apply electrically conductive paints, which eventually peel off in the harsh environment of outer space. The treatment can also be used to impart electrical conductivity to anodized housings of computers, medical electronic instruments, telephoneexchange equipment, and other terrestrial electronic equipment vulnerable to electrostatic discharge. The electrical resistivity of a typical anodized aluminum surface layer lies between 10(exp 11) and 10(exp 13) Omega-cm. To suppress electrostatic discharge, it is necessary to reduce the electrical resistivity significantly - preferably to anodized surface becomes covered and the pores in the surface filled with a transparent, electrically conductive metal oxide nanocomposite. Filling the pores with the nanocomposite reduces the transverse electrical resistivity and, in the original intended outer-space application, the exterior covering portion of the nanocomposite would afford the requisite electrical contact with the outer-space plasma. The electrical resistivity of the nanocomposite can be tailored to a value between 10(exp 7) and 10(exp 12) Omega-cm. Unlike electrically conductive paint, the nanocomposite becomes an integral part of the anodized aluminum substrate, without need for adhesive bonding material and without risk of subsequent peeling. The electrodeposition process is compatible with commercial anodizing production lines. At present, the electronics industry uses expensive, exotic, electrostaticdischarge- suppressing finishes: examples include silver impregnated anodized, black electroless nickel, black chrome, and black copper. In

  7. Infrared radiation properties of anodized aluminum

    Energy Technology Data Exchange (ETDEWEB)

    Kohara, S. [Science Univ. of Tokyo, Noda, Chiba (Japan). Dept. of Materials Science and Technology; Niimi, Y. [Science Univ. of Tokyo, Noda, Chiba (Japan). Dept. of Materials Science and Technology

    1996-12-31

    The infrared radiation heating is an efficient and energy saving heating method. Ceramics have been used as an infrared radiant material, because the emissivity of metals is lower than that of ceramics. However, anodized aluminum could be used as the infrared radiant material since an aluminum oxide film is formed on the surface. In the present study, the infrared radiation properties of anodized aluminum have been investigated by determining the spectral emissivity curve. The spectral emissivity curve of anodized aluminum changed with the anodizing time. The spectral emissivity curve shifted to the higher level after anodizing for 10 min, but little changed afterwards. The infrared radiant material with high level spectral emissivity curve can be achieved by making an oxide film thicker than about 15 {mu}m on the surface of aluminum. Thus, anodized aluminum is applicable for the infrared radiation heating. (orig.)

  8. What really separates us? Survey of attitudes of young people in the cities of Kikinda (Vojvodina, Nis, Bor (South and East Serbia, and Pristina, Pec, Prizren (Kosovo

    Directory of Open Access Journals (Sweden)

    Bašić Goran

    2014-01-01

    Full Text Available The results of the survey point to a high level of agreement among youth aged between 15 and 25 years of age, high school and college students, employed and unemployed youth, men and women in the cities of Pec, Pristina, Prizren in Kosovo, and Bor, Kikinda, and Nis in Serbia, on whether the question of mutual cooperation is burdened by prejudice and events from the past, and that the possibility and the quality of cooperation is influenced by the attitudes the receive in their primary social groups such as families and peers, and also by the attitudes they receive through education and media. At the same time, the possibilities to influence the social and political change aren’t big, and the youth have no desire to take the concrete civic or political initiatives. A certain perspective in cooperation the youth see in the European constellation and the good quality education. However, youth on both sides are not open to more intensive mutual meetings - the majority would not either host peers from the other communities gladly, nor they would respond to their invitation of hosting. They are not interested in cultural values of one another, but they do think respect of human rights should be guaranteed and they are ready for toleration of differences. The necessity of youth cooperation is important for overcoming the problems that citizens of Kosovo and Serbia are facing when it comes to exercising numerous rights, which from the perspective of individual freedoms collide with the concept of state reasons and "higher" interests. The regional stability depends on overcoming the issues that governments in Serbia and Kosovo have concerning Kosovo’s status, and also from setting a network of individual and group relations among the citizens. Youth should be the carriers of social and cultural changes. In the stated attitudes there is no direct objection to such processes, but fear of changes is clearly expressed because indirectly it can be

  9. Utilización de una nueva materia prima borácica para la formulación de esmaltes

    Directory of Open Access Journals (Sweden)

    Gómez-Tena, M. P.

    2010-10-01

    contenido en B2O3 entre un 10-11 % en peso. Es en gran parte amorfo, siendo el cuarzo la fase cristalina presente de forma mayoritaria. Características tales, como presentar una baja solubilidad y formar fácilmente fase vítrea, hace que sea posible utilizar el nuevo borato, como materia prima en composiciones de esmalte. Su aptitud para la formulación de esmaltes, ha sido el resultado de varios años de investigación en colaboración con el Instituto de Tecnología Cerámica. En este trabajo se ha estudiado la viabilidad de fabricar esmaltes cerámicos haciendo uso de una nueva materia prima borácica sintética, la cual permite aportar boro a la composición de los esmaltes sin necesidad de hacerlo en forma fritada. Se ha podido obtener vidriados con similares características técnicas y estéticas que los obtenidos a partir de esmaltes de uso industrial que contienen fritas típicas en su composición, por lo que resulta posible formular esmaltes mediante el empleo de la nueva materia prima de boro sintética. De los resultados se deriva, que la utilización de esta nueva materia prima (E-4972 es especialmente adecuada para la obtención de vidriados de bajo brillo a elevada temperatura.

  10. New electrolytes for aluminum production: Ionic liquids

    Science.gov (United States)

    Zhang, Mingming; Kamavarum, Venkat; Reddy, Ramana G.

    2003-11-01

    In this article, the reduction, refining/recycling, and electroplating of aluminum from room-temperature molten salts are reviewed. In addition, the characteristics of several non-conventional organic solvents, electrolytes, and molten salts are evaluated, and the applicability of these melts for production of aluminum is discussed with special attention to ionic liquids. Also reviewed are electrochemical processes and conditions for electrodeposition of aluminum using ionic liquids at near room temperatures.

  11. PREPARATION OF ACTINIDE-ALUMINUM ALLOYS

    Science.gov (United States)

    Moore, R.H.

    1962-09-01

    BS>A process is given for preparing alloys of aluminum with plutonium, uranium, and/or thorium by chlorinating actinide oxide dissolved in molten alkali metal chloride with hydrochloric acid, chlorine, and/or phosgene, adding aluminum metal, and passing air and/or water vapor through the mass. Actinide metal is formed and alloyed with the aluminum. After cooling to solidification, the alloy is separated from the salt. (AEC)

  12. An all aluminum alloy UHV components

    International Nuclear Information System (INIS)

    Sugisaki, Kenzaburo

    1985-01-01

    An all aluminum components was developed for use with UHV system. Aluminum alloy whose advantage are little discharge gas, easy to bake out, light weight, little damage against radieactivity radiation is used. Therefore, as it is all aluminum alloy, baking is possible. Baking temperature is 150 deg C in case of not only ion pump, gate valve, angle valve but also aluminum components. Ion pump have to an ultrahigh vacuum of order 10 -9 torr can be obtained without baking, 10 -10 torr order can be obtained after 24 hour of baking. (author)

  13. Gut: An underestimated target organ for Aluminum.

    Science.gov (United States)

    Vignal, C; Desreumaux, P; Body-Malapel, M

    2016-06-01

    Since World War II, several factors such as an impressive industrial growth, an enhanced environmental bioavailability and intensified food consumption have contributed to a significant amplification of human exposure to aluminum. Aluminum is particularly present in food, beverages, some drugs and airbone dust. In our food, aluminum is superimposed via additives and cooking utensils. Therefore, the tolerable intake of aluminum is exceeded for a significant part of the world population, especially in children who are more vulnerable to toxic effects of pollutants than adults. Faced with this oral aluminum influx, intestinal tract is an essential barrier, especially as 38% of ingested aluminum accumulates at the intestinal mucosa. Although still poorly documented to date, the impact of oral exposure to aluminum in conditions relevant to real human exposure appears to be deleterious for gut homeostasis. Aluminum ingestion affects the regulation of the permeability, the microflora and the immune function of intestine. Nowadays, several arguments are consistent with an involvement of aluminum as an environmental risk factor for inflammatory bowel diseases. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  14. Investigating aluminum alloy reinforced by graphene nanoflakes

    Energy Technology Data Exchange (ETDEWEB)

    Yan, S.J., E-mail: shaojiuyan@126.com [Beijing Institute of Aeronautical Materials, Beijing 100095 (China); Dai, S.L.; Zhang, X.Y.; Yang, C.; Hong, Q.H.; Chen, J.Z. [Beijing Institute of Aeronautical Materials, Beijing 100095 (China); Lin, Z.M. [Aviation Industry Corporation of China, Beijing 100022 (China)

    2014-08-26

    As one of the most important engineering materials, aluminum alloys have been widely applied in many fields. However, the requirement of enhancing their mechanical properties without sacrificing the ductility is always a challenge in the development of aluminum alloys. Thanks to the excellent physical and mechanical properties, graphene nanoflakes (GNFs) have been applied as promising reinforcing elements in various engineering materials, including polymers and ceramics. However, the investigation of GNFs as reinforcement phase in metals or alloys, especially in aluminum alloys, is still very limited. In this study, the aluminum alloy reinforced by GNFs was successfully prepared via powder metallurgy approach. The GNFs were mixed with aluminum alloy powders through ball milling and followed by hot isostatic pressing. The green body was then hot extruded to obtain the final GNFs reinforced aluminum alloy nanocomposite. The scanning electron microscopy and transmission electron microscope analysis show that GNFs were well dispersed in the aluminum alloy matrix and no chemical reactions were observed at the interfaces between the GNFs and aluminum alloy matrix. The mechanical properties' testing results show that with increasing filling content of GNFs, both tensile and yield strengths were remarkably increased without losing the ductility performance. These results not only provided a pathway to achieve the goal of preparing high strength aluminum alloys with excellent ductilitybut they also shed light on the development of other metal alloys reinforced by GNFs.

  15. 40 CFR 180.1091 - Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Aluminum isopropoxide and aluminum... PESTICIDE CHEMICAL RESIDUES IN FOOD Exemptions From Tolerances § 180.1091 Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a tolerance. Aluminum isopropoxide (CAS Reg. No. 555...

  16. Hydrogen effects in aluminum alloys

    International Nuclear Information System (INIS)

    Louthan, M.R. Jr.; Caskey, G.R. Jr.; Dexter, A.H.

    1976-01-01

    The permeability of six commercial aluminum alloys to deuterium and tritium was determined by several techniques. Surface films inhibited permeation under most conditions; however, contact with lithium deuteride during the tests minimized the surface effects. Under these conditions phi/sub D 2 / = 1.9 x 10 -2 exp (--22,400/RT) cc (NTP)atm/sup -- 1 / 2 / s -1 cm -1 . The six alloys were also tested before, during, and after exposure to high pressure hydrogen, and no hydrogen-induced effects on the tensile properties were observed

  17. Aluminum corrosion product release kinetics

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, Matt, E-mail: Matthew.Edwards@cnl.ca; Semmler, Jaleh; Guzonas, Dave; Chen, Hui Qun; Toor, Arshad; Hoendermis, Seanna

    2015-07-15

    Highlights: • Release of Al corrosion product was measured in simulated post-LOCA sump solutions. • Increased boron was found to enhance Al release kinetics at similar pH. • Models of Al release as functions of time, temperature, and pH were developed. - Abstract: The kinetics of aluminum corrosion product release was examined in solutions representative of post-LOCA sump water for both pressurized water and pressurized heavy-water reactors. Coupons of AA 6061 T6 were exposed to solutions in the pH 7–11 range at 40, 60, 90 and 130 °C. Solution samples were analyzed by inductively coupled plasma atomic emission spectroscopy, and coupon samples were analyzed by secondary ion mass spectrometry. The results show a distinct “boron effect” on the release kinetics, expected to be caused by an increase in the solubility of the aluminum corrosion products. New models were developed to describe both sets of data as functions of temperature, time, and pH (where applicable)

  18. Aluminum alloy and associated anode and battery

    International Nuclear Information System (INIS)

    Tarcy, G.P.

    1990-01-01

    This patent describes an aluminum alloy. It comprises: eutectic amounts of at least two alloying elements selected from the group consisting of bismuth, cadmium, scandium, gallium, indium, lead, mercury, thallium, tin, and zinc with the balance being aluminum and the alloying elements being about 0.01 to 3.0 percent by weight of the alloy

  19. Assessment of secondary aluminum reserves of nations

    DEFF Research Database (Denmark)

    Maung, Kyaw Nyunt; Yoshida, Tomoharu; Liu, Gang

    2017-01-01

    aluminum resources are accumulated in landfill sites. Understanding the sizes of primary and secondary aluminum reserves enables us to extend knowledge of efficient raw material sourcing from a narrow perspective of primary reserves alone to a broader perspective of both primary and secondary reserves...

  20. 21 CFR 172.310 - Aluminum nicotinate.

    Science.gov (United States)

    2010-04-01

    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION Special Dietary and Nutritional Additives § 172.310 Aluminum nicotinate. Aluminum nicotinate may be safely...

  1. Scientific Background for Processing of Aluminum Waste

    Science.gov (United States)

    Kononchuk, Olga; Alekseev, Alexey; Zubkova, Olga; Udovitsky, Vladimir

    2017-11-01

    Changing the source of raw materials for producing aluminum and the emergence of a huge number of secondary alumina waste (foundry slag, sludge, spent catalysts, mineral parts of coal and others that are formed in various industrial enterprises) require the creation of scientific and theoretical foundations for their processing. In this paper, the aluminum alloys (GOST 4784-97) are used as an aluminum raw material component, containing the aluminum component produced as chips in the machine-building enterprises. The aluminum waste is a whole range of metallic aluminum alloys including elements: magnesium, copper, silica, zinc and iron. Analysis of the aluminum waste A1- Zn-Cu-Si-Fe shows that depending on the content of the metal the dissolution process of an aluminum alloy should be treated as the result of the chemical interaction of the metal with an alkaline solution. It is necessary to consider the behavior of the main components of alloys in an alkaline solution as applied to the system Na2O - Al2O3 - SiO2 - CO2 - H2O.

  2. Aluminum low temperature smelting cell metal collection

    Science.gov (United States)

    Beck, Theodore R.; Brown, Craig W.

    2002-07-16

    A method of producing aluminum in an electrolytic cell containing alumina dissolved in an electrolyte. The method comprises the steps of providing a molten salt electrolyte in an electrolytic cell having an anodic liner for containing the electrolyte, the liner having an anodic bottom and walls including at least one end wall extending upwardly from the anodic bottom, the anodic liner being substantially inert with respect to the molten electrolyte. A plurality of non-consumable anodes is provided and disposed vertically in the electrolyte. A plurality of cathodes is disposed vertically in the electrolyte in alternating relationship with the anodes. The anodes are electrically connected to the anodic liner. An electric current is passed through the anodic liner to the anodes, through the electrolyte to the cathodes, and aluminum is deposited on said cathodes. Oxygen bubbles are generated at the anodes and the anodic liner, the bubbles stirring the electrolyte. Molten aluminum is collected from the cathodes into a tubular member positioned underneath the cathodes. The tubular member is in liquid communication with each cathode to collect the molten aluminum therefrom while excluding electrolyte. Molten aluminum is delivered through the tubular member to a molten aluminum reservoir located substantially opposite the anodes and cathodes. The molten aluminum is collected from the cathodes and delivered to the reservoir while avoiding contact of the molten aluminum with the anodic bottom.

  3. Laboratory Powder Metallurgy Makes Tough Aluminum Sheet

    Science.gov (United States)

    Royster, D. M.; Thomas, J. R.; Singleton, O. R.

    1993-01-01

    Aluminum alloy sheet exhibits high tensile and Kahn tear strengths. Rapid solidification of aluminum alloys in powder form and subsequent consolidation and fabrication processes used to tailor parts made of these alloys to satisfy such specific aerospace design requirements as high strength and toughness.

  4. Aluminum extrusion with a deformable die

    NARCIS (Netherlands)

    Assaad, W.

    2010-01-01

    Aluminum extrusion process is one of metal forming processes. In aluminum extrusion, a work-piece (billet) is pressed through a die with an opening that closely resembles a desired shape of a profile. By this process, long profiles with an enormous variety of cross-sections can be produced to

  5. Trends in the global aluminum fabrication industry

    Science.gov (United States)

    Das, Subodh; Yin, Weimin

    2007-02-01

    The aluminum fabrication industry has become more vital to the global economy as international aluminum consumption has grown steadily in the past decades. Using innovation, value, and sustainability, the aluminum industry is strengthening its position not only in traditional packaging and construction applications but also in the automotive and aerospace markets to become more competitive and to face challenges from other industries and higher industrial standards. The aluminum fabrication industry has experienced a significant geographical shift caused by rapid growth in emerging markets in countries such as Brazil, Russia, India, and China. Market growth and distribution will vary with different patterns of geography and social development; the aluminum industry must be part of the transformation and keep pace with market developments to benefit.

  6. Aluminum-based metal-air batteries

    Science.gov (United States)

    Friesen, Cody A.; Martinez, Jose Antonio Bautista

    2016-01-12

    Provided in one embodiment is an electrochemical cell, comprising: (i) a plurality of electrodes, comprising a fuel electrode that comprises aluminum and an air electrode that absorbs gaseous oxygen, the electrodes being operable in a discharge mode wherein the aluminum is oxidized at the fuel electrode and oxygen is reduced at the air electrode, and (ii) an ionically conductive medium, comprising an organic solvent; wherein during non-use of the cell, the organic solvent promotes formation of a protective interface between the aluminum of the fuel electrode and the ionically conductive medium, and wherein at an onset of the discharge mode, at least some of the protective interface is removed from the aluminum to thereafter permit oxidation of the aluminum during the discharge mode.

  7. Aluminum phosphate shows more adjuvanticity than Aluminum hydroxide in recombinant hepatitis –B vaccine formulation

    Directory of Open Access Journals (Sweden)

    2008-08-01

    Full Text Available Background: Although a number of investigation have been carried out to find alternative adjuvants to aluminum salts in vaccine formulations, they are still extensively used due to their good track record of safety, low cost and proper adjuvanticity with a variety of antigens. Adsorption of antigens onto aluminum compounds depends heavily on electrostatic forces between adjuvant and antigen. Commercial recombinant protein hepatitis B vaccines containing aluminum hydroxide as adjuvant is facing low induction of immunity in some sections of the vaccinated population. To follow the current global efforts in finding more potent hepatitis B vaccine formulation, adjuvanticity of aluminum phosphate has been compared to aluminum hydroxide. Materials and methods: The adjuvant properties of aluminum hydroxide and aluminum phosphate in a vaccine formulation containing a locally manufactured hepatitis B (HBs surface antigen was evaluated in Balb/C mice. The formulations were administered intra peritoneally (i.p. and the titers of antibody which was induced after 28 days were determined using ELISA technique. The geometric mean of antibody titer (GMT, seroconversion and seroprotection rates, ED50 and relative potency of different formulations were determined. Results: All the adjuvanicity markers obtained in aluminum phosphate formulation were significantly higher than aluminum hydroxide. The geometric mean of antibody titer of aluminum phosphate was approximately three folds more than aluminum hydroxide. Conclusion: Aluminum phosphate showed more adjuvanticity than aluminum hydroxide in hepatitis B vaccine. Therefore the use of aluminum phosphate as adjuvant in this vaccine may lead to higher immunity with longer duration of effects in vaccinated groups.

  8. Aluminum recovery as a product with high added value using aluminum hazardous waste

    International Nuclear Information System (INIS)

    David, E.; Kopac, J.

    2013-01-01

    Highlights: • Granular and compact aluminum dross were physically and chemically characterized. • A relationship between density, porosity and metal content from dross was established. • Chemical reactions involving aluminum in landfill and negative consequences are shown. • A processing method for aluminum recovering from aluminum dross was developed. • Aluminum was recovered as an value product with high grade purity such as alumina. -- Abstract: The samples of hazardous aluminum solid waste such as dross were physically and chemically characterized. A relationship between density, porosity and metal content of dross was established. The paper also examines the chemical reactions involving aluminum dross in landfill and the negative consequences. To avoid environmental problems and to recovery the aluminum, a processing method was developed and aluminum was recovered as an added value product such as alumina. This method refers to a process at low temperature, in more stages: acid leaching, purification, precipitation and calcination. At the end of this process aluminum was extracted, first as Al 3+ soluble ions and final as alumina product. The composition of the aluminum dross and alumina powder obtained were measured by applying the leaching tests, using atomic absorption spectrometry (AAS) and chemical analysis. The mineralogical composition of aluminum dross samples and alumina product were determined by X-ray diffraction (XRD) and the morphological characterization was performed by scanning electron microscopy (SEM). The method presented in this work allows the use of hazardous aluminum solid waste as raw material to recover an important fraction from soluble aluminum content as an added value product, alumina, with high grade purity (99.28%)

  9. Status of Irradiation Control of Insects in Grain; Radiodesinsection des Cereales; Sostoyanie bor'by s hasekomymi-vreditelyami zerna putem oblucheniya; Radiodesinsectacion de Cereales Almacenados

    Energy Technology Data Exchange (ETDEWEB)

    Cornwell, P. B. [Rentokil Laboratories Ltd., East Grinstead, Sussex (United Kingdom)

    1966-11-15

    comestibilidad de los granos irradiados indican que estos no pierden propiedades nutritivas, lo que ha dado lugar a que en los Estados Unidos se autorizara el consumo humano del trigo irradiado y de sus productos. Consideraciones de orden tecnico indican que, en los grandes centros de exportacion o almacenamiento de granos, la irradiacion puede competir economicamente con los metodos quimicos. Una vez establecido que el almacenamiento en grandes cantidades y los sistemas automaticos de transporte son los procedimientos mas rapidos y economicos para hacer llegar el grano a los consumidores, se puede predecir con bastante seguridad que en un futuro no muy lejano la irradiacion constituira una de las etapas del proceso de distribucion del grano. En la memoria se informa sobre algunos de los problemas que plantea la infestacion y se expone la forma en que la distribucion esta organizada en diversos paises a fin de ilustrar las ventajas que encierra la irradiacion para el tratamiento de granos en una escala internacional. (author) [Russian] Issledovanija v oblasti primenenija ionizirujushhego izluchenija dlja bor'by s naseko- mymi-vrediteljami hranimyh na skladah pishhevyh produktov prodemonstrirovali tehnicheskuju osushhestvimost' obluchenija dlja obrabotki zerna. Issledovanija v oblasti radiacionnoj jetimologii vyjavili porazhaemost' glavnyh nasekomyh-vreditelej skladirovannogo zerna i ustanovili prostranstvo, v predelah kotorogo faktory okruzhajushhej sredy mogut vlijat' na dejstvennost' obrabotki. Issledovanija himicheskih i fizicheskih svojstv obluchennogo zerna pokazali otsutstvie kakogo-libo vrednogo vozdejstvija na organolepticheskie svojstva i svojstva, otnosjashhiesja k processu izgotovlenija pri obluchenii dozami, trebujushhimisja dlja dezinfekcii. Raboty nad voprosami, otnosjashhimisja k sohraneniju pitatel'nyh i vkusovyh kachestv obluchennogo zerna pokazali otsutstvie poter' pitatel'nyh svojstv, chto imelo re zul'tatom vydachu razreshenija v SShA na ispol'zovanie v

  10. Process for anodizing aluminum foil

    International Nuclear Information System (INIS)

    Ball, J.A.; Scott, J.W.

    1984-01-01

    In an integrated process for the anodization of aluminum foil for electrolytic capacitors including the formation of a hydrous oxide layer on the foil prior to anodization and stabilization of the foil in alkaline borax baths during anodization, the foil is electrochemically anodized in an aqueous solution of boric acid and 2 to 50 ppm phosphate having a pH of 4.0 to 6.0. The anodization is interrupted for stabilization by passing the foil through a bath containing the borax solution having a pH of 8.5 to 9.5 and a temperature above 80 0 C. and then reanodizing the foil. The process is useful in anodizing foil to a voltage of up to 760 V

  11. Oxidation dynamics of aluminum nanorods

    Energy Technology Data Exchange (ETDEWEB)

    Li, Ying [Argonne Leadership Computing Facility, Argonne National Laboratory, Argonne, Illinois 60439 (United States); Kalia, Rajiv K.; Nakano, Aiichiro; Vashishta, Priya [Collaboratory for Advanced Computing and Simulations, Department of Physics and Astronomy, Department of Chemical Engineering and Materials Science, Department of Computer Science, University of Southern California, Los Angeles, California 90089-0242 (United States)

    2015-02-23

    Aluminum nanorods (Al-NRs) are promising fuels for pyrotechnics due to the high contact areas with oxidizers, but their oxidation mechanisms are largely unknown. Here, reactive molecular dynamics simulations are performed to study thermally initiated burning of oxide-coated Al-NRs with different diameters (D = 26, 36, and 46 nm) in oxygen environment. We found that thinner Al-NRs burn faster due to the larger surface-to-volume ratio. The reaction initiates with the dissolution of the alumina shell into the molten Al core to generate heat. This is followed by the incorporation of environmental oxygen atoms into the resulting Al-rich shell, thereby accelerating the heat release. These results reveal an unexpectedly active role of the alumina shell as a “nanoreactor” for oxidation.

  12. Decontamination and reuse of ORGDP aluminum scrap

    International Nuclear Information System (INIS)

    Compere, A.L.; Griffith, W.L.; Hayden, H.W.; Wilson, D.F.

    1996-12-01

    The Gaseous Diffusion Plants, or GDPs, have significant amounts of a number of metals, including nickel, aluminum, copper, and steel. Aluminum was used extensively throughout the GDPs because of its excellent strength to weight ratios and good resistance to corrosion by UF 6 . This report is concerned with the recycle of aluminum stator and rotor blades from axial compressors. Most of the stator and rotor blades were made from 214-X aluminum casting alloy. Used compressor blades were contaminated with uranium both as a result of surface contamination and as an accumulation held in surface-connected voids inside of the blades. A variety of GDP studies were performed to evaluate the amounts of uranium retained in the blades; the volume, area, and location of voids in the blades; and connections between surface defects and voids. Based on experimental data on deposition, uranium content of the blades is 0.3%, or roughly 200 times the value expected from blade surface area. However, this value does correlate with estimated internal surface area and with lengthy deposition times. Based on a literature search, it appears that gaseous decontamination or melt refining using fluxes specific for uranium removal have the potential for removing internal contamination from aluminum blades. A melt refining process was used to recycle blades during the 1950s and 1960s. The process removed roughly one-third of the uranium from the blades. Blade cast from recycled aluminum appeared to perform as well as blades from virgin material. New melt refining and gaseous decontamination processes have been shown to provide substantially better decontamination of pure aluminum. If these techniques can be successfully adapted to treat aluminum 214-X alloy, internal and, possibly, external reuse of aluminum alloys may be possible

  13. Lead exposure from aluminum cookware in Cameroon

    International Nuclear Information System (INIS)

    Weidenhamer, Jeffrey D.; Kobunski, Peter A.; Kuepouo, Gilbert; Corbin, Rebecca W.; Gottesfeld, Perry

    2014-01-01

    Blood lead levels have decreased following the removal of lead from gasoline in most of the world. However, numerous recent studies provide evidence that elevated blood lead levels persist in many low and middle-income countries around the world at much higher prevalence than in the more developed countries. One potential source of lead exposure that has not been widely investigated is the leaching of lead from artisanal aluminum cookware, which is commonly used in the developing world. Twenty-nine samples of aluminum cookware and utensils manufactured by local artisans in Cameroon were collected and analyzed for their potential to release lead during cooking. Source materials for this cookware included scrap metal such as engine parts, radiators, cans, and construction materials. The lead content of this cookware is relatively low (< 1000 ppm by X-ray fluorescence), however significant amounts of lead, as well as aluminum and cadmium were released from many of the samples using dilute acetic acid extractions at boiling and ambient temperatures. Potential exposures to lead per serving were estimated to be as high as 260 μg, indicating that such cookware can pose a serious health hazard. We conclude that lead, aluminum and cadmium can migrate from this aluminum cookware during cooking and enter food at levels exceeding recommended public health guidelines. Our results support the need to regulate lead content of materials used to manufacture these pots. Artisanal aluminum cookware may be a major contributor to lead poisoning throughout the developing world. Testing of aluminum cookware in other developing countries is warranted. - Highlights: • Cookware is manufactured in Cameroon from scrap aluminum including car parts. • Twenty-nine cookware samples were evaluated for their potential to leach lead. • Boiling extractions to simulate the effects of cooking released significant lead. • Potential lead exposures per serving are estimated as high as 260 μg.

  14. Lead exposure from aluminum cookware in Cameroon

    Energy Technology Data Exchange (ETDEWEB)

    Weidenhamer, Jeffrey D.; Kobunski, Peter A. [Department of Chemistry, Geology and Physics, 401 College Ave., Ashland University, Ashland, OH 44805 (United States); Kuepouo, Gilbert [Research and Education Centre for Development (CREPD), Yaounde (Cameroon); Corbin, Rebecca W. [Department of Chemistry, Geology and Physics, 401 College Ave., Ashland University, Ashland, OH 44805 (United States); Gottesfeld, Perry, E-mail: pgottesfeld@okinternational.org [Occupational Knowledge International, San Francisco, CA (United States)

    2014-10-15

    Blood lead levels have decreased following the removal of lead from gasoline in most of the world. However, numerous recent studies provide evidence that elevated blood lead levels persist in many low and middle-income countries around the world at much higher prevalence than in the more developed countries. One potential source of lead exposure that has not been widely investigated is the leaching of lead from artisanal aluminum cookware, which is commonly used in the developing world. Twenty-nine samples of aluminum cookware and utensils manufactured by local artisans in Cameroon were collected and analyzed for their potential to release lead during cooking. Source materials for this cookware included scrap metal such as engine parts, radiators, cans, and construction materials. The lead content of this cookware is relatively low (< 1000 ppm by X-ray fluorescence), however significant amounts of lead, as well as aluminum and cadmium were released from many of the samples using dilute acetic acid extractions at boiling and ambient temperatures. Potential exposures to lead per serving were estimated to be as high as 260 μg, indicating that such cookware can pose a serious health hazard. We conclude that lead, aluminum and cadmium can migrate from this aluminum cookware during cooking and enter food at levels exceeding recommended public health guidelines. Our results support the need to regulate lead content of materials used to manufacture these pots. Artisanal aluminum cookware may be a major contributor to lead poisoning throughout the developing world. Testing of aluminum cookware in other developing countries is warranted. - Highlights: • Cookware is manufactured in Cameroon from scrap aluminum including car parts. • Twenty-nine cookware samples were evaluated for their potential to leach lead. • Boiling extractions to simulate the effects of cooking released significant lead. • Potential lead exposures per serving are estimated as high as 260 μg.

  15. Fatigue analysis of aluminum drill pipes

    Directory of Open Access Journals (Sweden)

    João Carlos Ribeiro Plácido

    2005-12-01

    Full Text Available An experimental program was performed to investigate the fundamental fatigue mechanisms of aluminum drill pipes. Initially, the fatigue properties were determined through small-scale tests performed in an optic-mechanical fatigue apparatus. Additionally, full-scale fatigue tests were carried out with three aluminum drill pipe specimens under combined loading of cyclic bending and constant axial tension. Finally, a finite element model was developed to simulate the stress field along the aluminum drill pipe during the fatigue tests and to estimate the stress concentration factors inside the tool joints. By this way, it was possible to estimate the stress values in regions not monitored during the fatigue tests.

  16. Nanshan Aluminum Reached Strategic Cooperation with CSR Corporation Limited

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    As a key supplier of aluminum profiles and aluminum plate,sheet and trip products for CSR Corporation Limited,Nanshan Aluminum will join hands with CSR Corporation Limited to reach strategic cooperation.On January 5,Nanshan Aluminum signed strategic cooperation agreement with CSR Sifang Locomotive&Rolling; Stock Co.,Ltd,both

  17. 49 CFR 178.505 - Standards for aluminum drums.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for aluminum drums. 178.505 Section 178... PACKAGINGS Non-bulk Performance-Oriented Packaging Standards § 178.505 Standards for aluminum drums. (a) The following are the identification codes for aluminum drums: (1) 1B1 for a non-removable head aluminum drum...

  18. Formulation and method for preparing gels comprising hydrous aluminum oxide

    Science.gov (United States)

    Collins, Jack L.

    2014-06-17

    Formulations useful for preparing hydrous aluminum oxide gels contain a metal salt including aluminum, an organic base, and a complexing agent. Methods for preparing gels containing hydrous aluminum oxide include heating a formulation to a temperature sufficient to induce gel formation, where the formulation contains a metal salt including aluminum, an organic base, and a complexing agent.

  19. 46 CFR 154.195 - Aluminum cargo tank: Steel enclosure.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Aluminum cargo tank: Steel enclosure. 154.195 Section... Equipment Hull Structure § 154.195 Aluminum cargo tank: Steel enclosure. (a) An aluminum cargo tank and its... the aluminum cargo tank must meet the steel structural standards of the American Bureau of Shipping...

  20. A simple aluminum gasket for use with both stainless steel and aluminum flanges

    Energy Technology Data Exchange (ETDEWEB)

    Langley, R.A.

    1991-01-01

    A technique has been developed for making aluminum wire seal gaskets of various sizes and shapes for use with both stainless steel and aluminum alloy flanges. The gasket material used is 0.9999 pure aluminum, drawn to a diameter of 3 mm. This material can be easily welded and formed into various shapes. A single gasket has been successfully used up to five times without baking. The largest gasket tested to date is 3.5 m long and was used in the shape of a parallelogram. Previous use of aluminum wire gaskets, including results for bakeout at temperatures from 20 to 660{degree}C, is reviewed. A search of the literature indicates that this is the first reported use of aluminum wire gaskets for aluminum alloy flanges. The technique is described in detail, and the results are summarized. 11 refs., 4 figs.

  1. Coordination Structure of Aluminum in Magnesium Aluminum Hydroxide Studied by 27Al NMR

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The coordination structure of aluminum in magnesium aluminum hydroxide was studiedby 27Al NMR. The result showed that tetrahedral aluminum (AlⅣ) existed in magnesiumaluminum hydroxide, and the contents of AlⅣ increased with the increase of the ratio of Al/Mg andwith the peptizing temperature. AlⅣ originated from the so-called Al13 polymer with the structureof one Al tetrahedron surrounded by twelve Al octahedrons.

  2. Aluminum exclusion and aluminum tolerance in woody plants.

    Science.gov (United States)

    Brunner, Ivano; Sperisen, Christoph

    2013-01-01

    The aluminum (Al) cation Al(3) (+) is highly rhizotoxic and is a major stress factor to plants on acid soils, which cover large areas of tropical and boreal regions. Many woody plant species are native to acid soils and are well adapted to high Al(3) (+) conditions. In tropical regions, both woody Al accumulator and non-Al accumulator plants occur, whereas in boreal regions woody plants are non-Al accumulators. The mechanisms of these adaptations can be divided into those that facilitate the exclusion of Al(3) (+) from root cells (exclusion mechanisms) and those that enable plants to tolerate Al(3) (+) once it has entered the root and shoot symplast (internal tolerance mechanisms). The biochemical and molecular basis of these mechanisms have been intensively studied in several crop plants and the model plant Arabidopsis. In this review, we examine the current understanding of Al(3) (+) exclusion and tolerance mechanisms from woody plants. In addition, we discuss the ecology of woody non-Al accumulator and Al accumulator plants, and present examples of Al(3) (+) adaptations in woody plant populations. This paper complements previous reviews focusing on crop plants and provides insights into evolutionary processes operating in plant communities that are widespread on acid soils.

  3. The Oxidation Products of Aluminum Hydride and Boron Aluminum Hydride Clusters

    Science.gov (United States)

    2016-01-04

    AFRL-AFOSR-VA-TR-2016-0075 The Oxidation Products of Aluminum Hydride and Boron Aluminum Hydride Clusters KIT BOWEN JOHNS HOPKINS UNIV BALTIMORE MD...2. REPORT TYPE Final Performance 3. DATES COVERED (From - To) 30-09-2014 to 29-09-2015 4. TITLE AND SUBTITLE The Oxidation Products of Aluminum ...Hydride and Boron Aluminum Hydride Clusters 5a.  CONTRACT NUMBER 5b.  GRANT NUMBER FA9550-14-1-0324 5c.  PROGRAM ELEMENT NUMBER 61102F 6. AUTHOR(S) KIT

  4. 40 CFR 63.5753 - How do I calculate the combined organic HAP content of aluminum wipedown solvents and aluminum...

    Science.gov (United States)

    2010-07-01

    ... HAP content of aluminum wipedown solvents and aluminum recreational boat surface coatings? 63.5753... Standards for Hazardous Air Pollutants for Boat Manufacturing Standards for Aluminum Recreational Boat Surface Coating Operations § 63.5753 How do I calculate the combined organic HAP content of aluminum...

  5. Electron-beam welding of aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Brillant, Marcel; de Bony, Yves

    1980-08-15

    The objective of this article is to describe the status of the application of electron-beam welding to aluminum alloys. These alloys are widely employed in the aeronautics, space and nuclear industries.

  6. Electrometallurgical treatment of aluminum-based fuels

    International Nuclear Information System (INIS)

    Willit, J. L.

    1998-01-01

    We have successfully demonstrated aluminum electrorefining from a U-Al-Si alloy that simulates spent aluminum-based reactor fuel. The aluminum product contains less than 200 ppm uranium. All the results obtained have been in agreement with predictions based on equilibrium thermodynamics. We have also demonstrated the need for adequate stirring to achieve a low-uranium product. Most of the other process steps have been demonstrated in other programs. These include uranium electrorefining, transuranic fission product scrubbing, fission product oxidation, and product consolidation by melting. Future work will focus on the extraction of active metal and rare earth fission products by a molten flux salt and scale-up of the aluminum electrorefining

  7. Masking of aluminum surface against anodizing

    Science.gov (United States)

    Crawford, G. B.; Thompson, R. E.

    1969-01-01

    Masking material and a thickening agent preserve limited unanodized areas when aluminum surfaces are anodized with chromic acid. For protection of large areas it combines well with a certain self-adhesive plastic tape.

  8. Aluminum titanate crucible for molten uranium

    International Nuclear Information System (INIS)

    Asbury, J.J.

    1975-01-01

    An improved crucible for molten uranium is described. The crucible or crucible liner is formed of aluminum titanate which essentially eliminates contamination of uranium and uranium alloys during molten states thereof. (U.S.)

  9. Interpretation of aluminum-alloy weld radiography

    Science.gov (United States)

    Duren, P. C.; Risch, E. R.

    1971-01-01

    Report proposes radiographic terminology standardization which allows scientific interpretation of radiographic films to replace dependence on individual judgement and experience. Report includes over 50 photographic pages where radiographs of aluminum welds with defects are compared with prepared weld sections photomacrographs.

  10. Recycling of aluminum to produce green energy

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Susana Silva; Lopez Benites, Wendy; Alvarez Gallegos, Alberto A. [Centro de Investigacion en Ingenieria y Ciencias Aplicadas, Av. Universidad 1001, Col. Chamilpa, Cuernavaca, Morelos C.P. 62210 (Mexico); Sebastian, P.J. [Centro de Investigacion en Energia-UNAM, 62580 Temixco, Morelos (Mexico)

    2005-07-15

    High-purity hydrogen gas was generated from the chemical reaction of aluminum with sodium hydroxide. Several molar relations of sodium hydroxide/aluminum were investigated in this study. The experimental results showed that hydrogen yields are acceptable and its purity was good enough to be used in a proton exchange membrane (PEM) fuel cell to produce electricity. An estimation of the amount of energy produced from the reaction of 100 aluminum cans with caustic soda showed that the hydrogen production is feasible to be scaled up to reach up to 5kWh in a few hours. This study is environmentally friendly and also shows that green energy can be produced from aluminum waste at a low cost.

  11. Aluminum alloy excellent in neutron absorbing performance

    International Nuclear Information System (INIS)

    Iida, Tetsuya; Tamamura, Tadao; Morimoto, Hiroyuki; Ouchi, Ken-ichiro.

    1987-01-01

    Purpose: To obtain structural materials made of aluminum alloys having favorable neutron absorbing performance and excellent in the performance as structural materials such as processability and strength. Constitution: Powder of Gd 2 O 3 as a gadolinium compound or metal gadolinium is uniformly mixed with the powder of aluminum or aluminum alloy. The amount of the gadolinium compound added is set to 0.1 - 30 % by weight. No sufficient neutron absorbing performance can be obtained if it is less than 0.1 % by weight, whereas the processability and mechanical property of the alloy are degraded if it exceeds 30 % by weight. Further, the grain size is set to less about 50 μm. Further, since the neutron absorbing performance varies greatly if the aluminum powder size exceeds 100 μm, the diameter is set to less than about 100 μm. These mixtures are molded in a hot press. This enables to obtain aimed structural materials. (Takahashi, M.)

  12. Seacoast stress corrosion cracking of aluminum alloys

    Science.gov (United States)

    Humphries, T. S.; Nelson, E. E.

    1981-01-01

    The stress corrosion cracking resistance of high strength, wrought aluminum alloys in a seacoast atmosphere was investigated and the results were compared with those obtained in laboratory tests. Round tensile specimens taken from the short transverse grain direction of aluminum plate and stressed up to 100 percent of their yield strengths were exposed to the seacoast and to alternate immersion in salt water and synthetic seawater. Maximum exposure periods of one year at the seacoast, 0.3 or 0.7 of a month for alternate immersion in salt water, and three months for synthetic seawater were indicated for aluminum alloys to avoid false indications of stress corrosion cracking failure resulting from pitting. Correlation of the results was very good among the three test media using the selected exposure periods. It is concluded that either of the laboratory test media is suitable for evaluating the stress corrosion cracking performance of aluminum alloys in seacoast atmosphere.

  13. Inhibition of aluminum corrosion using Opuntia extract

    International Nuclear Information System (INIS)

    El-Etre, A.Y.

    2003-01-01

    The inhibitive action of the mucilage extracted from the modified stems of prickly pears, toward acid corrosion of aluminum, is tested using weight loss, thermometry, hydrogen evolution and polarization techniques. It was found that the extract acts as a good corrosion inhibitor for aluminum corrosion in 2.0 M HCl solution. The inhibition action of the extract was discussed in view of Langmuir adsorption isotherm. It was found that the adsorption of the extract on aluminum surface is a spontaneous process. The inhibition efficiency (IE) increases as the extract concentration is increased. The effect of temperature on the IE was studied. It was found that the presence of extract increases the activation energy of the corrosion reaction. Moreover, the thermodynamic parameters of the adsorption process were calculated. It was found also that the Opuntia extract provides a good protection to aluminum against pitting corrosion in chloride ion containing solutions

  14. Corrosion of aluminum components and remedial measures

    International Nuclear Information System (INIS)

    Sheikh, S.T.; Khalique, A.; Malik, F.A.

    2006-01-01

    Aluminum has versatile physical properties, mechanical strength, corrosion resistance, and is used in special applications like aerospace, automobiles and other strategic industries. The outdoor exposed structural components of aluminum have very good corrosion resistance due to the thick oxide layer (0.2 -0.4 micro). This study involves the corrosion of aluminum based components, though aluminum is protected by an oxide layer but due to extreme weather and environmental conditions the oxide layer was damaged. The corroded product was removed, pits or cavities formed due to the material removal were filled with epoxy resins and acrylic-based compounds containing fibreglass as reinforcement. Optimum results were obtained with epoxy resins incorporated with 5% glass fibers. The inner surface of the components was provided further protection with a cellulose nitrate compound. (author)

  15. Beryllium-aluminum alloys for investment castings

    International Nuclear Information System (INIS)

    Nachtrab, W.T.; Levoy, N.

    1997-01-01

    Beryllium-aluminum alloys containing greater than 60 wt % beryllium are very favorable materials for applications requiring light weight and high stiffness. However, when produced by traditional powder metallurgical methods, these alloys are expensive and have limited applications. To reduce the cost of making beryllium-aluminum components, Nuclear Metals Inc. (NMI) and Lockheed Martin Electronics and Missiles have recently developed a family of patented beryllium-aluminum alloys that can be investment cast. Designated Beralcast, the alloys can achieve substantial weight savings because of their high specific strength and stiffness. In some cases, weight has been reduced by up to 50% over aluminum investment casting. Beralcast is now being used to make thin wall precision investment castings for several advanced aerospace applications, such as the RAH-66 Comanche helicopter and F-22 jet fighter. This article discusses alloy compositions, properties, casting method, and the effects of cobalt additions on strength

  16. Fast LIBS Identification of Aluminum Alloys

    Directory of Open Access Journals (Sweden)

    Tawfik W.

    2007-04-01

    Full Text Available Laser-induced breakdown spectroscopy (LIBS has been applied to analysis aluminum alloy targets. The plasma is generated by focusing a 300 mJ pulsed Nd: YAG laser on the target in air at atmospheric pressure. Such plasma emission spectrum was collected using a one-meter length wide band fused-silica optical fiber connected to a portable Echelle spectrometer with intensified CCD camera. Spectroscopic analysis of plasma evolution of laser produced plasmas has been characterized in terms of their spectra, electron density and electron temperature assuming the LTE and optically thin plasma conditions. The LIBS spectrum was optimized for high S/N ratio especially for trace elements. The electron temperature and density were determined using the emission intensity and stark broadening, respectively, of selected aluminum spectral lines. The values of these parameters were found to change with the aluminum alloy matrix, i.e. they could be used as a fingerprint character to distinguish between different aluminum alloy matrices using only one major element (aluminum without needing to analysis the rest of elements in the matrix. Moreover, It was found that the values of T e and N e decrease with increasing the trace elements concentrations in the aluminum alloy samples. The obtained results indicate that it is possible to improve the exploitation of LIBS in the remote on-line industrial monitoring application, by following up only the values of T e and N e for aluminum in aluminum alloys as a marker for the correct alloying using an optical fiber probe.

  17. Fast LIBS Identification of Aluminum Alloys

    Directory of Open Access Journals (Sweden)

    Tawfik W.

    2007-04-01

    Full Text Available Laser-induced breakdown spectroscopy (LIBS has been applied to analysis aluminum alloy targets. The plasma is generated by focusing a 300 mJ pulsed Nd: YAG laser on the target in air at atmospheric pressure. Such plasma emission spectrum was collected using a one-meter length wide band fused-silica optical fiber connected to a portable Echelle spectrometer with intensified CCD camera. Spectroscopic analysis of plasma evolution of laser produced plasmas has been characterized in terms of their spectra, electron density and electron temperature assuming the LTE and optically thin plasma conditions. The LIBS spectrum was optimized for high S/N ratio especially for trace elements. The electron temperature and density were determined using the emission intensity and stark broadening, respectively, of selected aluminum spectral lines. The values of these parameters were found to change with the aluminum alloy matrix, i.e. they could be used as a fingerprint character to distinguish between different aluminum alloy matrices using only one major element (aluminum without needing to analysis the rest of elements in the matrix. Moreover, It was found that the values of T(e and N(e decrease with increasing the trace elements concentrations in the aluminum alloy samples. The obtained results indicate that it is possible to improve the exploitation of LIBS in the remote on-line industrial monitoring application, by following up only the values of T(e and N(e for the aluminum in aluminum alloys using an optical fiber probe.

  18. Anodizing of aluminum with improved corrosion properties

    International Nuclear Information System (INIS)

    John, P.; Khan, I.U.

    2010-01-01

    Anodizing of aluminum was studied in sulphuric/oxalic/boric acid electroiyte system. The corrosion resistance of the anodic oxide coating of aluminum was determined by potentiodynamic polarization test and scanning electron microscope (SEM) was used to investigate the surface morphology before and after corrosion test. It was found that the oxide coating obtained by this method showed better corrosion resistance with no significant difference in surface morphology. (author)

  19. The effects of ultrasonic solidification on aluminum

    OpenAIRE

    Đorđević Slavko 1

    2003-01-01

    The effect of ultrasound on characteristics of solidified aluminum was shown. An ultrasonic head and ultrasonic system for modification was designed and applied to the crystallizing aluminum melt. The ultrasonic generator allows power of 50-500 W, amplitude of oscillations 10-100 um.m and the operating frequency of 25 kHz. Ultrasonic modification was done by ultrasound introduced from above into the melt. Microstructure photographs show decreasing of the grain size more than five times.

  20. The effects of ultrasonic solidification on aluminum

    Directory of Open Access Journals (Sweden)

    Đorđević Slavko 1

    2003-01-01

    Full Text Available The effect of ultrasound on characteristics of solidified aluminum was shown. An ultrasonic head and ultrasonic system for modification was designed and applied to the crystallizing aluminum melt. The ultrasonic generator allows power of 50-500 W, amplitude of oscillations 10-100 um.m and the operating frequency of 25 kHz. Ultrasonic modification was done by ultrasound introduced from above into the melt. Microstructure photographs show decreasing of the grain size more than five times.

  1. Scientific Background for Processing of Aluminum Waste

    Directory of Open Access Journals (Sweden)

    Kononchuk Olga

    2017-01-01

    of the aluminum waste A1- Zn-Cu-Si-Fe shows that depending on the content of the metal the dissolution process of an aluminum alloy should be treated as the result of the chemical interaction of the metal with an alkaline solution. It is necessary to consider the behavior of the main components of alloys in an alkaline solution as applied to the system Na2O - Al2O3 - SiO2 - CO2 - H2O.

  2. Advanced powder metallurgy aluminum alloys and composites

    Science.gov (United States)

    Lisagor, W. B.; Stein, B. A.

    1982-01-01

    The differences between powder and ingot metallurgy processing of aluminum alloys are outlined. The potential payoff in the use of advanced powder metallurgy (PM) aluminum alloys in future transport aircraft is indicated. The national program to bring this technology to commercial fruition and the NASA Langley Research Center role in this program are briefly outlined. Some initial results of research in 2000-series PM alloys and composites that highlight the property improvements possible are given.

  3. Research of plating aluminum and aluminum foil on internal surface of carbon fiber composite material centrifuge rotor drum

    International Nuclear Information System (INIS)

    Lu Xiuqi; Dong Jinping; Dai Xingjian

    2014-01-01

    In order to improve the corrosion resistance, thermal conductivity and sealability of the internal surface of carbon fiber/epoxy composite material centrifuge rotor drum, magnetron sputtering aluminum and pasting an aluminum foil on the inner wall of the drum are adopted to realize the aim. By means of XRD, SEM/EDS and OM, the surface topography of aluminum coated (thickness of 5 μm and 12 μm) and aluminum foil (12 μm) are observed and analyzed; the cohesion of between aluminum coated (or aluminum foil) and substrate material (CFRP) is measured by scratching experiment, direct drawing experiment, and shear test. Besides, the ultra-high-speed rotation experiment of CFRP ring is carried out to analyze stress and strain of coated aluminum (or aluminum foil) which is adhered on the ring. The results showed aluminum foil pasted on inner surface do better performance than magnetron sputtering aluminum on CFRP centrifuge rotor drum. (authors)

  4. Studies of aluminum in rat brain

    Energy Technology Data Exchange (ETDEWEB)

    Lipman, J.J.; Brill, A.B.; Som, P.; Jones, K.W.; Colowick, S.; Cholewa, M.

    1985-01-01

    The effects of high aluminum concentrations in rat brains were studied using /sup 14/C autoradiography to measure the uptake of /sup 14/C 2-deoxy-D-glucose (/sup 14/C-2DG) and microbeam proton-induced x-ray emission (microPIXE) with a 20-..mu..m resolution to measure concentrations of magnesium, aluminum, potassium, and calcium. The aluminum was introduced intracisternally in the form of aluminum tartrate (Al-T) while control animals were given sodium tartrate (Na-T). The /sup 14/C was administered intravenously. The animals receiving Al-T developed seizure disorders and had pathological changes that included cerebral cortical atrophy. The results showed that there was a decreased uptake of /sup 14/C-2DG in cortical regions in which increased aluminum levels were measured, i.e., there is a correlation between the aluminum in the rat brain and decreased brain glucose metabolism. A minimum detection limit of about 16 ppM (mass fraction) or 3 x 10/sup 9/ Al atoms was obtained for Al under the conditions employed. 14 refs., 4 figs., 1 tab.

  5. Aluminum neurotoxicity in the rat brain

    Energy Technology Data Exchange (ETDEWEB)

    Yumoto, S [Tokyo Univ. (Japan). Faculty of Medicine; Ohashi, H; Nagai, H; Kakimi, S; Ogawa, Y; Iwata, Y; Ishii, K

    1993-12-31

    To investigate the etiology of Alzheimer`s disease, we administered aluminum to healthy rats and examined the aluminum uptake in the brain and isolated brain cell nuclei by particle-induced X-ray emission (PIXE) analysis. Ten days after the last injection, Al was detected in the rat brain and in isolated brain cell nuclei by PIXE analysis. Al was also demonstrated in the brain after 15 months of oral aluminum administration. Moreover, Al was detected in the brain and isolated brain cell nuclei from the patients with Alzheimer`s disease. Silver impregnation studies revealed that spines attached to the dendritic processes of cortical nerve cells decreased remarkably after aluminum administration. Electron microscopy revealed characteristic inclusion bodies in the hippocampal nerve cells 75 days after the injection. These morphological changes in the rat brain after the aluminum administration were similar to those reportedly observed in the brain of Alzheimer`s disease patients. Our results indicate that Alzheimer`s disease is caused by irreversible accumulation of aluminum in the brain, as well as in the nuclei of brain cells. (author).

  6. Aluminum neurotoxicity in the rat brain

    International Nuclear Information System (INIS)

    Yumoto, S.; Ohashi, H.; Nagai, H.; Kakimi, S.; Ogawa, Y.; Iwata, Y.; Ishii, K.

    1992-01-01

    To investigate the etiology of Alzheimer's disease, we administered aluminum to healthy rats and examined the aluminum uptake in the brain and isolated brain cell nuclei by particle-induced X-ray emission (PIXE) analysis. Ten days after the last injection, Al was detected in the rat brain and in isolated brain cell nuclei by PIXE analysis. Al was also demonstrated in the brain after 15 months of oral aluminum administration. Moreover, Al was detected in the brain and isolated brain cell nuclei from the patients with Alzheimer's disease. Silver impregnation studies revealed that spines attached to the dendritic processes of cortical nerve cells decreased remarkably after aluminum administration. Electron microscopy revealed characteristic inclusion bodies in the hippocampal nerve cells 75 days after the injection. These morphological changes in the rat brain after the aluminum administration were similar to those reportedly observed in the brain of Alzheimer's disease patients. Our results indicate that Alzheimer's disease is caused by irreversible accumulation of aluminum in the brain, as well as in the nuclei of brain cells. (author)

  7. Studies of aluminum in rat brain

    International Nuclear Information System (INIS)

    Lipman, J.J.; Brill, A.B.; Som, P.; Jones, K.W.; Colowick, S.; Cholewa, M.

    1985-01-01

    The effects of high aluminum concentrations in rat brains were studied using 14 C autoradiography to measure the uptake of 14 C 2-deoxy-D-glucose ( 14 C-2DG) and microbeam proton-induced x-ray emission (microPIXE) with a 20-μm resolution to measure concentrations of magnesium, aluminum, potassium, and calcium. The aluminum was introduced intracisternally in the form of aluminum tartrate (Al-T) while control animals were given sodium tartrate (Na-T). The 14 C was administered intravenously. The animals receiving Al-T developed seizure disorders and had pathological changes that included cerebral cortical atrophy. The results showed that there was a decreased uptake of 14 C-2DG in cortical regions in which increased aluminum levels were measured, i.e., there is a correlation between the aluminum in the rat brain and decreased brain glucose metabolism. A minimum detection limit of about 16 ppM (mass fraction) or 3 x 10 9 Al atoms was obtained for Al under the conditions employed. 14 refs., 4 figs., 1 tab

  8. Spray rolling aluminum alloy strip

    Energy Technology Data Exchange (ETDEWEB)

    McHugh, Kevin M.; Delplanque, J.-P.; Johnson, S.B.; Lavernia, E.J.; Zhou, Y.; Lin, Y

    2004-10-10

    Spray rolling combines spray forming with twin-roll casting to process metal flat products. It consists of atomizing molten metal with a high velocity inert gas, cooling the resultant droplets in flight and directing the spray between mill rolls. In-flight convection heat transfer from atomized droplets teams with conductive cooling at the rolls to rapidly remove the alloy's latent heat. Hot deformation of the semi-solid material in the rolls results in fully consolidated, rapidly solidified product. While similar in some ways to twin-roll casting, spray rolling has the advantage of being able to process alloys with broad freezing ranges at high production rates. This paper describes the process and summarizes microstructure and tensile properties of spray-rolled 2124 and 7050 aluminum alloy strips. A Lagrangian/Eulerian poly-dispersed spray flight and deposition model is described that provides some insight into the development of the spray rolling process. This spray model follows droplets during flight toward the rolls, through impact and spreading, and includes oxide film formation and breakup when relevant.

  9. Aluminum bioavailability from tea infusion.

    Science.gov (United States)

    Yokel, Robert A; Florence, Rebecca L

    2008-12-01

    The objective was to estimate oral Al bioavailability from tea infusion in the rat, using the tracer (26)Al. (26)Al citrate was injected into tea leaves. An infusion was prepared from the dried leaves and given intra-gastrically to rats which received concurrent intravenous (27)Al infusion. Oral Al bioavailability (F) was calculated from the area under the (26)Al, compared to (27)Al, serum concentration x time curves. Bioavailability from tea averaged 0.37%; not significantly different from water (F=0.3%), or basic sodium aluminum phosphate (SALP) in cheese (F=0.1-0.3%), but greater than acidic SALP in a biscuit (F=0.1%). Time to maximum serum (26)Al concentration was 1.25, 1.5, 8 and 4.8h, respectively. These results of oral Al bioavailability x daily consumption by the human suggest tea can provide a significant amount of the Al that reaches systemic circulation. This can allow distribution to its target organs of toxicity, the central nervous, skeletal and hematopoietic systems. Further testing of the hypothesis that Al contributes to Alzheimer's disease may be more warranted with studies focusing on total average daily food intake, including tea and other foods containing appreciable Al, than drinking water.

  10. Anodized aluminum on LDEF: A current status of measurements on chromic acid anodized aluminum

    International Nuclear Information System (INIS)

    Golden, J.L.

    1992-01-01

    Chromic acid anodize was used as the exterior coating for aluminum surfaces on LDEF to provide passive thermal control. Chromic acid anodized aluminum was also used as test specimens in thermal control coatings experiments. The following is a compilation and analysis of the data obtained thus far

  11. Anodized aluminum on LDEF: A current status of measurements on chromic acid anodized aluminum

    Science.gov (United States)

    Golden, Johnny L.

    1992-01-01

    Chromic acid anodize was used as the exterior coating for aluminum surfaces on LDEF to provide passive thermal control. Chromic acid anodized aluminum was also used as test specimens in thermal control coatings experiments. The following is a compilation and analysis of the data obtained thus far.

  12. Casting Characteristics of High Cerium Content Aluminum Alloys

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, D; Rios, O R; Sims, Z C; McCall, S K; Ott, R T

    2017-09-05

    This paper compares the castability of the near eutectic aluminum-cerium alloy system to the aluminum-silicon and aluminum-copper systems. The alloys are compared based on die filling capability, feeding characteristics and tendency to hot tear in both sand cast and permanent mold applications. The castability ranking of the binary Al–Ce systems is as good as the aluminum-silicon system with some deterioration as additional alloying elements are added. In alloy systems that use cerium in combination with common aluminum alloying elements such as silicon, magnesium and/or copper, the casting characteristics are generally better than the aluminum-copper system. In general, production systems for melting, de-gassing and other processing of aluminum-silicon or aluminum-copper alloys can be used without modification for conventional casting of aluminum-cerium alloys.

  13. Progress in Aluminum Electrolysis Control and Future Direction for Smart Aluminum Electrolysis Plant

    Science.gov (United States)

    Zhang, Hongliang; Li, Tianshuang; Li, Jie; Yang, Shuai; Zou, Zhong

    2017-02-01

    The industrial aluminum reduction cell is an electrochemistry reactor that operates under high temperatures and highly corrosive conditions. However, these conditions have restricted the measurement of key control parameters, making the control of aluminum reduction cells a difficult problem in the industry. Because aluminum electrolysis control systems have a significant economic influence, substantial research has been conducted on control algorithms, control systems and information systems for aluminum reduction cells. This article first summarizes the development of control systems and then focuses on the progress made since 2000, including alumina concentration control, temperature control and electrolyte molecular ratio control, fault diagnosis, cell condition prediction and control system expansion. Based on these studies, the concept of a smart aluminum electrolysis plant is proposed. The frame construction, key problems and current progress are introduced. Finally, several future directions are discussed.

  14. Deposition behavior of residual aluminum in drinking water distribution system: Effect of aluminum speciation.

    Science.gov (United States)

    Zhang, Yue; Shi, Baoyou; Zhao, Yuanyuan; Yan, Mingquan; Lytle, Darren A; Wang, Dongsheng

    2016-04-01

    Finished drinking water usually contains some residual aluminum. The deposition of residual aluminum in distribution systems and potential release back to the drinking water could significantly influence the water quality at consumer taps. A preliminary analysis of aluminum content in cast iron pipe corrosion scales and loose deposits demonstrated that aluminum deposition on distribution pipe surfaces could be excessive for water treated by aluminum coagulants including polyaluminum chloride (PACl). In this work, the deposition features of different aluminum species in PACl were investigated by simulated coil-pipe test, batch reactor test and quartz crystal microbalance with dissipation monitoring. The deposition amount of non-polymeric aluminum species was the least, and its deposition layer was soft and hydrated, which indicated the possible formation of amorphous Al(OH)3. Al13 had the highest deposition tendency, and the deposition layer was rigid and much less hydrated, which indicated that the deposited aluminum might possess regular structure and self-aggregation of Al13 could be the main deposition mechanism. While for Al30, its deposition was relatively slower and deposited aluminum amount was relatively less compared with Al13. However, the total deposited mass of Al30 was much higher than that of Al13, which was attributed to the deposition of particulate aluminum matters with much higher hydration state. Compared with stationary condition, stirring could significantly enhance the deposition process, while the effect of pH on deposition was relatively weak in the near neutral range of 6.7 to 8.7. Copyright © 2015. Published by Elsevier B.V.

  15. Electrochemically replicated smooth aluminum foils for anodic alumina nanochannel arrays

    International Nuclear Information System (INIS)

    Biring, Sajal; Tsai, K-T; Sur, Ujjal Kumar; Wang, Y-L

    2008-01-01

    A fast electrochemical replication technique has been developed to fabricate large-scale ultra-smooth aluminum foils by exploiting readily available large-scale smooth silicon wafers as the masters. Since the adhesion of aluminum on silicon depends on the time of surface pretreatment in water, it is possible to either detach the replicated aluminum from the silicon master without damaging the replicated aluminum and master or integrate the aluminum film to the silicon substrate. Replicated ultra-smooth aluminum foils are used for the growth of both self-organized and lithographically guided long-range ordered arrays of anodic alumina nanochannels without any polishing pretreatment

  16. Precision forging technology for aluminum alloy

    Science.gov (United States)

    Deng, Lei; Wang, Xinyun; Jin, Junsong; Xia, Juchen

    2018-03-01

    Aluminum alloy is a preferred metal material for lightweight part manufacturing in aerospace, automobile, and weapon industries due to its good physical properties, such as low density, high specific strength, and good corrosion resistance. However, during forging processes, underfilling, folding, broken streamline, crack, coarse grain, and other macro- or microdefects are easily generated because of the deformation characteristics of aluminum alloys, including narrow forgeable temperature region, fast heat dissipation to dies, strong adhesion, high strain rate sensitivity, and large flow resistance. Thus, it is seriously restricted for the forged part to obtain precision shape and enhanced property. In this paper, progresses in precision forging technologies of aluminum alloy parts were reviewed. Several advanced precision forging technologies have been developed, including closed die forging, isothermal die forging, local loading forging, metal flow forging with relief cavity, auxiliary force or vibration loading, casting-forging hybrid forming, and stamping-forging hybrid forming. High-precision aluminum alloy parts can be realized by controlling the forging processes and parameters or combining precision forging technologies with other forming technologies. The development of these technologies is beneficial to promote the application of aluminum alloys in manufacturing of lightweight parts.

  17. Determination of aluminum by four analytical methods

    International Nuclear Information System (INIS)

    Hanson, T.J.; Smetana, K.M.

    1975-11-01

    Four procedures have been developed for determining the aluminum concentration in basic matrices. Atomic Absorption Spectroscopy (AAS) was the routine method of analysis. Citrate was required to complex the aluminum and eliminate matrix effects. AAS was the least accurate of the four methods studied and was adversely affected by high aluminum concentrations. The Fluoride Electrode Method was the most accurate and precise of the four methods. A Gran's Plot determination was used to determine the end point and average standard recovery was 100% +- 2%. The Thermometric Titration Method was the fastest method for determining aluminum and could also determine hydroxide concentration at the same time. Standard recoveries were 100% +- 5%. The pH Electrode Method also measures aluminum and hydroxide content simultaneously, but is less accurate and more time consuming that the thermal titration. Samples were analyzed using all four methods and results were compared to determine the strengths and weaknesses of each. On the basis of these comparisons, conclusions were drawn concerning the application of each method to our laboratory needs

  18. Lithium-aluminum-magnesium electrode composition

    Science.gov (United States)

    Melendres, Carlos A.; Siegel, Stanley

    1978-01-01

    A negative electrode composition is presented for use in a secondary, high-temperature electrochemical cell. The cell also includes a molten salt electrolyte of alkali metal halides or alkaline earth metal halides and a positive electrode including a chalcogen or a metal chalcogenide as the active electrode material. The negative electrode composition includes up to 50 atom percent lithium as the active electrode constituent and a magnesium-aluminum alloy as a structural matrix. Various binary and ternary intermetallic phases of lithium, magnesium, and aluminum are formed but the electrode composition in both its charged and discharged state remains substantially free of the alpha lithium-aluminum phase and exhibits good structural integrity.

  19. Lithium-aluminum-iron electrode composition

    Science.gov (United States)

    Kaun, Thomas D.

    1979-01-01

    A negative electrode composition is presented for use in a secondary electrochemical cell. The cell also includes an electrolyte with lithium ions such as a molten salt of alkali metal halides or alkaline earth metal halides that can be used in high-temperature cells. The cell's positive electrode contains a a chalcogen or a metal chalcogenide as the active electrode material. The negative electrode composition includes up to 50 atom percent lithium as the active electrode constituent in an alloy of aluminum-iron. Various binary and ternary intermetallic phases of lithium, aluminum and iron are formed. The lithium within the intermetallic phase of Al.sub.5 Fe.sub.2 exhibits increased activity over that of lithium within a lithium-aluminum alloy to provide an increased cell potential of up to about 0.25 volt.

  20. Diffusionless bonding of aluminum to Zircaloy-2

    International Nuclear Information System (INIS)

    Watson, R.D.

    1965-04-01

    Aluminum can be bonded to zirconium without difficulty even when a thin layer of oxide is present on the surface of the zirconium . No detectable diffusion takes place during the bonding process. The bond layer can be stretched as much. as 8% without affecting the bond. The bond can be heated for 1000 hours at 260 o C (500 o F), and can be water quenched from 260 o C (500 o F) without any noticeable change in the bond strength. An extrusion technique has been devised for making transition sections of aluminum bonded to zirconium which can then be used to join these metals by conventional welding. Welding can be done close to the bond zone without seriously affecting the integrity of the bond. This method of bonding aluminum to Zircaloy-2 is covered by Canadian patent 702,438 January 26, 1965. (author)

  1. NASA-427: A New Aluminum Alloy

    Science.gov (United States)

    Nabors, Sammy A.

    2015-01-01

    NASA's Marshall Space Flight Center researchers have developed a new, stronger aluminum alloy, ideal for cast aluminum products that have powder or paint-baked thermal coatings. With advanced mechanical properties, the NASA-427 alloy shows greater tensile strength and increased ductility, providing substantial improvement in impact toughness. In addition, this alloy improves the thermal coating process by decreasing the time required for heat treatment. With improvements in both strength and processing time, use of the alloy provides reduced materials and production costs, lower product weight, and better product performance. The superior properties of NASA-427 can benefit many industries, including automotive, where it is particularly well-suited for use in aluminum wheels.

  2. ALUMINUM AND CHROMIUM LEACHING WORKSHOP WHITEPAPER

    International Nuclear Information System (INIS)

    McCabe, D; Jeff Pike, J; Bill Wilmarth, B

    2007-01-01

    A workshop was held on January 23-24, 2007 to discuss the status of processes to leach constituents from High Level Waste (HLW) sludges at the Hanford and Savannah River Sites. The objective of the workshop was to examine the needs and requirements for the HLW flowsheet for each site, discuss the status of knowledge of the leaching processes, communicate the research plans, and identify opportunities for synergy to address knowledge gaps. The purpose of leaching of non-radioactive constituents from the sludge waste is to reduce the burden of material that must be vitrified in the HLW melter systems, resulting in reduced HLW glass waste volume, reduced disposal costs, shorter process schedules, and higher facility throughput rates. The leaching process is estimated to reduce the operating life cycle of SRS by seven years and decrease the number of HLW canisters to be disposed in the Repository by 1000 [Gillam et al., 2006]. Comparably at Hanford, the aluminum and chromium leaching processes are estimated to reduce the operating life cycle of the Waste Treatment Plant by 20 years and decrease the number of canisters to the Repository by 15,000-30,000 [Gilbert, 2007]. These leaching processes will save the Department of Energy (DOE) billions of dollars in clean up and disposal costs. The primary constituents targeted for removal by leaching are aluminum and chromium. It is desirable to have some aluminum in glass to improve its durability; however, too much aluminum can increase the sludge viscosity, glass viscosity, and reduce overall process throughput. Chromium leaching is necessary to prevent formation of crystalline compounds in the glass, but is only needed at Hanford because of differences in the sludge waste chemistry at the two sites. Improving glass formulations to increase tolerance of aluminum and chromium is another approach to decrease HLW glass volume. It is likely that an optimum condition can be found by both performing leaching and improving

  3. Aluminum phosphate ceramics for waste storage

    Science.gov (United States)

    Wagh, Arun; Maloney, Martin D

    2014-06-03

    The present disclosure describes solid waste forms and methods of processing waste. In one particular implementation, the invention provides a method of processing waste that may be particularly suitable for processing hazardous waste. In this method, a waste component is combined with an aluminum oxide and an acidic phosphate component in a slurry. A molar ratio of aluminum to phosphorus in the slurry is greater than one. Water in the slurry may be evaporated while mixing the slurry at a temperature of about 140-200.degree. C. The mixed slurry may be allowed to cure into a solid waste form. This solid waste form includes an anhydrous aluminum phosphate with at least a residual portion of the waste component bound therein.

  4. Study of aluminum-doped silicon clusters

    International Nuclear Information System (INIS)

    Zhan Shichang; Li Baoxing; Yang Jiansong

    2007-01-01

    Using full-muffin-tin-orbital molecular-dynamics (FP-LMTO-MD) method, we have investigated the effect of aluminum heteroatoms on the geometric structures and bond characteristics of Si n (n=5-10) clusters in detail. It is found that the geometric framework of the ground state structures for Si n (n=5-10) clusters change to some extent upon the substitution of Al atoms in some Si atoms. The effect of aluminum doping on the silicon clusters depends on the geometric structures of Si n (n=5-10) clusters. In particular, the calculations suggest that the aluminum doping would improve the bond strength of some Si-Si bonds in the mixed Si n - m Al m clusters

  5. Study on Explosive Forming of Aluminum Alloy

    Directory of Open Access Journals (Sweden)

    H Iyama

    2016-09-01

    Full Text Available Now, the aluminum alloy is often used as auto parts, for example, body, engine. For example, there are the body, a cylinder block, a piston, a connecting rod, interior, exterior parts, etc. These are practical used the characteristic of a light and strong aluminum alloy efficiently. However, although an aluminum alloy is lighter than steel, the elongation is smaller than that. Therefore, in press forming, some problems often occur. We have proposed use of explosive forming, in order to solve this problem. In the explosive forming, since a blank is formed at high speed, a strain rate effect becomes large and it can be made the elongation is larger. Then, in order to clarify this feature, we carried out experimental research and numerical analysis. In this paper, these contents will be discussed.

  6. Air-Impregnated Nanoporous Anodic Aluminum Oxide Layers for Enhancing the Corrosion Resistance of Aluminum.

    Science.gov (United States)

    Jeong, Chanyoung; Lee, Junghoon; Sheppard, Keith; Choi, Chang-Hwan

    2015-10-13

    Nanoporous anodic aluminum oxide layers were fabricated on aluminum substrates with systematically varied pore diameters (20-80 nm) and oxide thicknesses (150-500 nm) by controlling the anodizing voltage and time and subsequent pore-widening process conditions. The porous nanostructures were then coated with a thin (only a couple of nanometers thick) Teflon film to make the surface hydrophobic and trap air in the pores. The corrosion resistance of the aluminum substrate was evaluated by a potentiodynamic polarization measurement in 3.5 wt % NaCl solution (saltwater). Results showed that the hydrophobic nanoporous anodic aluminum oxide layer significantly enhanced the corrosion resistance of the aluminum substrate compared to a hydrophilic oxide layer of the same nanostructures, to bare (nonanodized) aluminum with only a natural oxide layer on top, and to the latter coated with a thin Teflon film. The hydrophobic nanoporous anodic aluminum oxide layer with the largest pore diameter and the thickest oxide layer (i.e., the maximized air fraction) resulted in the best corrosion resistance with a corrosion inhibition efficiency of up to 99% for up to 7 days. The results demonstrate that the air impregnating the hydrophobic nanopores can effectively inhibit the penetration of corrosive media into the pores, leading to a significant improvement in corrosion resistance.

  7. Oxidation of nano-sized aluminum powders

    International Nuclear Information System (INIS)

    Vorozhtsov, A.B.; Lerner, M.; Rodkevich, N.; Nie, H.; Abraham, A.; Schoenitz, M.; Dreizin, E.L.

    2016-01-01

    Highlights: • Weight gain measured in TG oxidation experiments was split between particles of different sizes. • Reaction kinetics obtained by isoconversion explicitly accounting for the effect of size distribution. • Activation energy is obtained as a function of oxide thickness for growth of amorphous alumina. • Oxidation mechanism for nanopowders remains the same as for coarser aluminum powders. - Abstract: Oxidation of aluminum nanopowders obtained by electro-exploded wires is studied. Particle size distributions are obtained from transmission electron microscopy (TEM) images. Thermo-gravimetric (TG) experiments are complemented by TEM and XRD studies of partially oxidized particles. Qualitatively, oxidation follows the mechanism developed for coarser aluminum powder and resulting in formation of hollow oxide shells. Sintering of particles is also observed. The TG results are processed to account explicitly for the particle size distribution and spherical shapes, so that oxidation of particles of different sizes is characterized. The apparent activation energy is obtained as a function of the reaction progress using model-free isoconversion processing of experimental data. A complete phenomenological oxidation model is then proposed assuming a spherically symmetric geometry. The oxidation kinetics of aluminum powder is shown to be unaffected by particle sizes reduced down to tens of nm. The apparent activation energy describing growth of amorphous alumina is increasing at the very early stages of oxidation. The higher activation energy is likely associated with an increasing homogeneity in the growing amorphous oxide layer, initially containing multiple defects and imperfections. The trends describing changes in both activation energy and pre-exponent of the growing amorphous oxide are useful for predicting ignition delays of aluminum particles. The kinetic trends describing activation energies and pre-exponents in a broader range of the oxide

  8. Thermally sprayed coatings: Aluminum on lead

    International Nuclear Information System (INIS)

    Usmani, S.; Czajkowski, C.J.; Zatorski, R.

    1999-01-01

    An experimental program to determine the feasibility of thermally spraying aluminum on a lead substrate was initiated in support of the accelerator production of tritium (APT) Project for the US Department of Energy. The program consisted of two distinct parts: (1) the characterization of the thermally sprayed coatings, including microhardness testing, effects of heating, and microstructure and porosity determinations, and (2) effects of mercury doping and heat treatments on the thermally sprayed composite. The project determined that aluminum could successfully be thermally sprayed onto the lead. The coatings had a dense microstructure, with a Vicker's Pyramid Hardness (VPH) of about 60, and a maximum porosity (found in strips on the samples) of 12%

  9. Weld Development for Aluminum Fission Chamber

    Energy Technology Data Exchange (ETDEWEB)

    Cross, Carl Edward [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Martinez, Jesse Norris [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-05-16

    The Sigma welding team was approached to help fabricate a small fission chamber (roughly ½ inch dia. x ½ inch tall cylinder). These chambers are used as radiation sensors that contain small traces of radionuclides (Cf 252, U 235, and U 238) that serve to ionize gas atoms in addition to external radiation. When a voltage is applied within the chamber, the resulting ion flow can be calibrated and monitored. Aluminum has the advantage of not forming radioactive compounds when exposed to high external radiation (except from minor Na alloy content). Since aluminum has not been used before in this application, this presented an unexplored challenge.

  10. Anodization process produces opaque, reflective coatings on aluminum

    Science.gov (United States)

    1965-01-01

    Opaque, reflective coatings are produced on aluminum articles by an anodizing process wherein the anodizing bath contains an aqueous dispersion of finely divided insoluble inorganic compounds. These particles appear as uniformly distributed occlusions in the anodic deposit on the aluminum.

  11. Evaluation of aluminum migration into foodstuffs from aluminium cookware

    Directory of Open Access Journals (Sweden)

    M Radi

    2014-05-01

    Full Text Available Nowadays, the existence of aluminum in human diet as a food contaminant has attracted the concerns of many researchers. It seems that the cooking pans are common sources of aluminum exposure through foodstuffs in Iran. The aim of this study was to evaluate the migration of aluminum from cooking containers into foodstuffs. For this purpose, solutions with different concentrations of citric acid, sodium chloride, fat, protein and sugar were prepared and migration of aluminum into these solutions was measured using atomic absorption spectrometry. Results showed that salt and citric acid concentrations could enhance aluminum migration; whereas, acid concentration was more effective than salt due to its corrosive effect. The intensity of heat processing and the duration of heat treatment had direct relation with aluminum migration. The aluminum content of cooked foods in aluminum cooking pans was also significantly more than control samples.

  12. Low Mass, Aluminum NOFBX Combustion Chamber Development, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Our team proposes to define a diffusion bonding process for aluminum as an enabling step to ultimately develop an innovative, lightweight, long life, aluminum...

  13. Exploration the extrudability of aluminum matrix composite (LM6/TIC ...

    African Journals Online (AJOL)

    Aluminum matrix composites (LM6/TiC) is a mix of excellent properties of aluminum ... ABAQUS/CAE software has been successfully employed for Modeling and ... Experimental results show that, many mechanical properties are improved and ...

  14. Effect of the aluminum flow pattern on the bonding of aluminum to oxidized Zircaloy-2

    International Nuclear Information System (INIS)

    Watson, R.D.; Lambert, J.P.

    1965-04-01

    The bonds produced when hot aluminum is allowed to flow smoothly from an extrusion die to the oxidized surface of a heated tube of Zircaloy-2 are consistently inferior to those produced with back-extruded flow. The difference is believed to be due to the reduction in, or elimination of, the oxide layer on the aluminum that comes in contact with the surface of the Zircaloy-2. This method of bonding aluminum to Zircaloy-2 is covered by Canadian patent 702,438 January 1965. (author)

  15. Transition of hydrated oxide layer for aluminum electrolytic capacitors

    International Nuclear Information System (INIS)

    Chi, Choong-Soo; Jeong, Yongsoo; Ahn, Hong-Joo; Lee, Jong-Ho; Kim, Jung-Gu; Lee, Jun-Hee; Jang, Kyung-Wook; Oh, Han-Jun

    2007-01-01

    A hydrous oxide film for the application as dielectric film is synthesized by immersion of pure aluminum in hot water. From a Rutherford backscattering analysis, the ratio of aluminum to oxygen atoms was found to be 3:2 in the anodized aluminum oxide film, and 2:1 in the hydrous oxide layer. Anodization of the hydrous oxide layer was more effective for the transition of amorphous anodic oxides to the crystalline aluminum oxides

  16. Defect reduction in seeded aluminum nitride crystal growth

    Science.gov (United States)

    Bondokov, Robert T.; Schowalter, Leo J.; Morgan, Kenneth; Slack, Glen A; Rao, Shailaja P.; Gibb, Shawn Robert

    2017-09-26

    Bulk single crystal of aluminum nitride (AlN) having an areal planar defect density.ltoreq.100 cm.sup.-2. Methods for growing single crystal aluminum nitride include melting an aluminum foil to uniformly wet a foundation with a layer of aluminum, the foundation forming a portion of an AlN seed holder, for an AlN seed to be used for the AlN growth. The holder may consist essentially of a substantially impervious backing plate.

  17. Membrane Purification Cell for Aluminum Recycling

    Energy Technology Data Exchange (ETDEWEB)

    David DeYoung; James Wiswall; Cong Wang

    2011-11-29

    Recycling mixed aluminum scrap usually requires adding primary aluminum to the scrap stream as a diluent to reduce the concentration of non-aluminum constituents used in aluminum alloys. Since primary aluminum production requires approximately 10 times more energy than melting scrap, the bulk of the energy and carbon dioxide emissions for recycling are associated with using primary aluminum as a diluent. Eliminating the need for using primary aluminum as a diluent would dramatically reduce energy requirements, decrease carbon dioxide emissions, and increase scrap utilization in recycling. Electrorefining can be used to extract pure aluminum from mixed scrap. Some example applications include producing primary grade aluminum from specific scrap streams such as consumer packaging and mixed alloy saw chips, and recycling multi-alloy products such as brazing sheet. Electrorefining can also be used to extract valuable alloying elements such as Li from Al-Li mixed scrap. This project was aimed at developing an electrorefining process for purifying aluminum to reduce energy consumption and emissions by 75% compared to conventional technology. An electrolytic molten aluminum purification process, utilizing a horizontal membrane cell anode, was designed, constructed, operated and validated. The electrorefining technology could also be used to produce ultra-high purity aluminum for advanced materials applications. The technical objectives for this project were to: - Validate the membrane cell concept with a lab-scale electrorefining cell; - Determine if previously identified voltage increase issue for chloride electrolytes holds for a fluoride-based electrolyte system; - Assess the probability that voltage change issues can be solved; and - Conduct a market and economic analysis to assess commercial feasibility. The process was tested using three different binary alloy compositions (Al-2.0 wt.% Cu, Al-4.7 wt.% Si, Al-0.6 wt.% Fe) and a brazing sheet scrap composition (Al-2

  18. Use of low-cost aluminum in electric energy production

    Science.gov (United States)

    Zhuk, Andrey Z.; Sheindlin, Alexander E.; Kleymenov, Boris V.; Shkolnikov, Eugene I.; Lopatin, Marat Yu.

    Suppression of the parasitic corrosion while maintaining the electrochemical activity of the anode metal is one of the serious problems that affects the energy efficiency of aluminum-air batteries. The need to use high-purity aluminum or special aluminum-based alloys results in a significant increase in the cost of the anode, and thus an increase in the total cost of energy generated by the aluminum-air battery, which narrows the range of possible applications for this type of power source. This study considers the process of parasitic corrosion as a method for hydrogen production. Hydrogen produced in an aluminum-air battery by this way may be further employed in a hydrogen-air fuel cell (Hy-air FC) or in a heat engine, or it may be burnt to generate heat. Therefore, anode materials may be provided by commercially pure aluminum, commercially produced aluminum alloys, and secondary aluminum. These materials are much cheaper and more readily available than special anode alloys of aluminum and high-purity aluminum. The aim of present study is to obtain experimental data for comparison of energy and cost parameters of some commercially produced aluminum alloys, of high-purity aluminum, and of a special Al-ln anode alloy in the context of using these materials as anodes for an Al-air battery and for combined production of electrical power and hydrogen.

  19. 21 CFR 582.2122 - Aluminum calcium silicate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent. (c...

  20. 21 CFR 182.2122 - Aluminum calcium silicate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum calcium silicate. 182.2122 Section 182.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent. (c...

  1. Activated aluminum hydride hydrogen storage compositions and uses thereof

    Science.gov (United States)

    Sandrock, Gary; Reilly, James; Graetz, Jason; Wegrzyn, James E.

    2010-11-23

    In one aspect, the invention relates to activated aluminum hydride hydrogen storage compositions containing aluminum hydride in the presence of, or absence of, hydrogen desorption stimulants. The invention particularly relates to such compositions having one or more hydrogen desorption stimulants selected from metal hydrides and metal aluminum hydrides. In another aspect, the invention relates to methods for generating hydrogen from such hydrogen storage compositions.

  2. Passivation of aluminum with alkyl phosphonic acids for biochip applications

    Science.gov (United States)

    Attavar, Sachin; Diwekar, Mohit; Linford, Matthew R.; Davis, Mark A.; Blair, Steve

    2010-09-01

    Self-assembly of decylphosphonic acid (DPA) and octadecylphosphonic acid (ODPA) was studied on aluminum films using XPS, ToF-SIMS and surface wettability. Modified aluminum films were tested for passivation against silanization and subsequent oligonucleotide attachment. Passivation ratios of at least 450:1 compared to unprotected aluminum were obtained, as quantified by attachment of radio-labeled oligos.

  3. 21 CFR 73.1010 - Alumina (dried aluminum hydroxide).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Alumina (dried aluminum hydroxide). 73.1010... GENERAL LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1010 Alumina (dried aluminum hydroxide). (a) Identity. (1) The color additive alumina (dried aluminum hydroxide) is a white, odorless...

  4. 21 CFR 582.1781 - Sodium aluminum phosphate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Sodium aluminum phosphate. 582.1781 Section 582.1781 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Additives § 582.1781 Sodium aluminum phosphate. (a) Product. Sodium aluminum phosphate. (b) Conditions of...

  5. 21 CFR 73.1015 - Chromium-cobalt-aluminum oxide.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Chromium-cobalt-aluminum oxide. 73.1015 Section 73... LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1015 Chromium-cobalt-aluminum oxide. (a) Identity. The color additive chromium-cobalt-aluminum oxide is a blue-green pigment obtained by calcining a...

  6. 21 CFR 182.1781 - Sodium aluminum phosphate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium aluminum phosphate. 182.1781 Section 182.1781 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Food Substances § 182.1781 Sodium aluminum phosphate. (a) Product. Sodium aluminum phosphate. (b...

  7. Bearing capacity check of aluminum profiles

    Directory of Open Access Journals (Sweden)

    Cristian Grigoraşenco

    2013-06-01

    Full Text Available Because of suspended ceiling options to be customizable they are the choice for implementation in spaces like offices buildings, schools, hospitals and commercial premises. Recent problems with suspended gypsum ceilings falling in some commercial premises led to verification by tensile test and flexural bearing capacity of 5 types of aluminum elements used to suspend the ceilings.

  8. Absorptive coating for aluminum solar panels

    Science.gov (United States)

    Desmet, D.; Jason, A.; Parr, A.

    1979-01-01

    Method for coating forming coating of copper oxide from copper component of sheet aluminum/copper alloy provides strong durable solar heat collector panels. Copper oxide coating has solar absorption characteristics similar to black chrome and is much simpler and less costly to produce.

  9. Aluminum Solubility in Complex Electrolytes - 13011

    Energy Technology Data Exchange (ETDEWEB)

    Agnew, S.F. [Columbia Energy and Environmental Services, Inc., 1806 Terminal Dr., Richland, WA 99354 (United States); Johnston, C.T. [Dept. of Crop, Soil, and Environmental Sciences, Purdue University, West Lafayette, IN 47907 (United States)

    2013-07-01

    Predicting aluminum solubility for Hanford and Savannah River waste liquids is very important for their disposition. It is a key mission goal at each Site to leach as much aluminum as practical from sludges in order to minimize the amount of vitrified high level waste. And it is correspondingly important to assure that any soluble aluminum does not precipitate during subsequent decontamination of the liquid leachates with ion exchange. This report shows a very simple and yet thermodynamic model for aluminum solubility that is consistent with a wide range of Al liquors, from simple mixtures of hydroxide and aluminate to over 300 Hanford concentrates and to a set of 19 Bayer liquors for temperatures from 20-100 deg. C. This dimer-dS{sub mix} (DDS) model incorporates an ideal entropy of mixing along with previous reports for the Al dimer, water activities, gibbsite, and bayerite thermodynamics. We expect this model will have broad application for nuclear wastes as well as the Bayer gibbsite process industry. (authors)

  10. Chemical Reduction Synthesis of Iron Aluminum Powders

    Science.gov (United States)

    Zurita-Méndez, N. N.; la Torre, G. Carbajal-De; Ballesteros-Almanza, L.; Villagómez-Galindo, M.; Sánchez-Castillo, A.; Espinosa-Medina, M. A.

    In this study, a chemical reduction synthesis method of iron aluminum (FeAl) nano-dimensional intermetallic powders is described. The process has two stages: a salt reduction and solvent evaporation by a heat treatment at 1100°C. The precursors of the synthesis are ferric chloride, aluminum foil chips, a mix of Toluene/THF in a 75/25 volume relationship, and concentrated hydrochloric acid as initiator of the reaction. The reaction time was 20 days, the product obtained was dried at 60 °C for 2 h and calcined at 400, 800, and 1100 °C for 4 h each. To characterize and confirm the obtained synthesis products, X-Ray Diffraction (XRD), and Scanning Electron Microscopy (SEM) techniques were used. The results of morphology and chemical characterization of nano-dimensional powders obtained showed a formation of agglomerated particles of a size range of approximately 150 nm to 1.0 μm. Composition of powders was identified as corundum (Al2O3), iron aluminide (FeAl3), and iron-aluminum oxides (Fe0. 53Al0. 47)2O3 phases. The oxide phases formation were associated with the reaction of atmospheric concentration-free oxygen during synthesis and sintering steps, reducing the concentration of the iron aluminum phase.

  11. Corrosion of Graphite Aluminum Metal Matrix Composites

    Science.gov (United States)

    1991-02-01

    cathodic protection of G/AI MMCs resulted in overprotection 13. Overprotection resulted from a local increase in pH near cathodic sites during...34Cathodic Overprotection of SiC/6061-T6 and G/6061- T6 Aluminum Alloy Metal Matrix Composites," Scripta Metallurgica, 22 (1988) 413-418. 14. R

  12. Electrometallurgical treatment of aluminum-matrix fuels

    International Nuclear Information System (INIS)

    Willit, J.L.; Gay, E.C.; Miller, W.E.; McPheeters, C.C.; Laidler, J.J.

    1996-01-01

    The electrometallurgical treatment process described in this paper builds on our experience in treating spent fuel from the Experimental Breeder Reactor (EBR-II). The work is also to some degree, a spin-off from applying electrometallurgical treatment to spent fuel from the Hanford single pass reactors (SPRs) and fuel and flush salt from the Molten Salt Reactor Experiment (MSRE) in treating EBR-II fuel, we recover the actinides from a uranium-zirconium fuel by electrorefining the uranium out of the chopped fuel. With SPR fuel, uranium is electrorefined out of the aluminum cladding. Both of these processes are conducted in a LiCl-KCl molten-salt electrolyte. In the case of the MSRE, which used a fluoride salt-based fuel, uranium in this salt is recovered through a series of electrochemical reductions. Recovering high-purity uranium from an aluminum-matrix fuel is more challenging than treating SPR or EBR-II fuel because the aluminum- matrix fuel is typically -90% (volume basis) aluminum

  13. Strong, corrosion-resistant aluminum tubing

    Science.gov (United States)

    Reed, M. W.; Adams, F. F.

    1980-01-01

    When aluminum tubing having good corrosion resistance and postweld strength is needed, type 5083 alloy should be considered. Chemical composition is carefully controlled and can be drawn into thin-wall tubing with excellent mechanical properties. Uses of tubing are in aircraft, boats, docks, and process equipment.

  14. Explosion hazards of aluminum finishing operations

    NARCIS (Netherlands)

    Taveau, J.R.; Hochgreb, Simone; Lemkowitz, S.M.; Roekaerts, D.J.E.M.

    2018-01-01

    Metal dust deflagrations have become increasingly common in recent years. They are also more devastating than deflagrations involving organic materials, owing to metals' higher heat of combustion, rate of pressure rise, explosion pressure and flame temperature. Aluminum finishing operations offer

  15. Explosion hazards of aluminum finishing operations

    NARCIS (Netherlands)

    Taveau, J.; Hochgreb, S.; Lemkowitz, S.M.; Roekaerts, D.J.E.M.

    2018-01-01

    Metal dust deflagrations have become increasingly common in recent years. They are also more devastating than deflagrations involving organic materials, owing to metals' higher heat of combustion, rate of pressure rise, explosion pressure and flame temperature. Aluminum finishing operations offer a

  16. The use of aluminum dome tank roofs

    International Nuclear Information System (INIS)

    Morovich, G.L.

    1992-01-01

    Since the late 1970's the aluminum dome tank roof has gained wide usage for both new and retrofit applications. The increased application for the structure results from a need for maintenance reduction, environmental considerations, concern for product quality and economics. The American Petroleum Institute (API) has approved Standard API 650, Appendix G - Structurally Supported Aluminum Dome Roofs for publication. The aluminum dome was originally used as weather cover for retrofiting external floating roof tanks. The roof was considered for the reduction of maintenance related to draining water from the external floating roofs and problems resulting from freezing of drain lines and snow accumulation. This paper reports that environmental concerns have expanded the value of aluminum dome roofs. Rainwater bypassing the seals of an external floating roof became classified as a hazardous material requiring special and expensive disposal procedures. The marketing terminal facilities typically do not have the capacity for proper treatment of contaminated bottom water. With new fuel additives being water soluble, water contamination not only created a hazardous waste disposal problem, but resulted in reduced product quality

  17. Molybdate Coatings for Protecting Aluminum Against Corrosion

    Science.gov (United States)

    Calle, Luz Marina; MacDowell, Louis G.

    2005-01-01

    Conversion coatings that comprise mixtures of molybdates and several additives have been subjected to a variety of tests to evaluate their effectiveness in protecting aluminum and alloys of aluminum against corrosion. Molybdate conversion coatings are under consideration as replacements for chromate conversion coatings, which have been used for more than 70 years. The chromate coatings are highly effective in protecting aluminum and its alloys against corrosion but are also toxic and carcinogenic. Hexavalent molybdenum and, hence, molybdates containing hexavalent molybdenum, have received attention recently as replacements for chromates because molybdates mimic chromates in a variety of applications but exhibit significantly lower toxicity. The tests were performed on six proprietary formulations of molybdate conversion coatings, denoted formulations A through F, on panels of aluminum alloy 2024-T3. A bare alloy panel was also included in the tests. The tests included electrochemical impedance spectroscopy (EIS), measurements of corrosion potentials, scanning electron microscopy (SEM) with energy-dispersive spectroscopy (EDS), and x-ray photoelectron spectroscopy (XPS).

  18. Radiation corrosion in aluminum alloy bellows

    International Nuclear Information System (INIS)

    Konno, Osamu

    1987-01-01

    Testing was carried out in which materials for vacuum devices (Al, Ti, Cu, SUS) are exposed to electron beams (50 MeV, average current 80 μA) to determine the changes in the quantity, partial pressure and composition of the gases released from the materials. The test appratus used are made of Al alloys alone. During the test, vacuum leak is found in the Al alloy bellows used in the drive device. The leak is found to result from corrosion caused by water. The surface structure is analyzed by SEM, EPMA, ESCA and IMA. It is confirmed that the Al alloy used as material for the bellows if highly resistant to corrosion. It is concluded that it is necessary to use high purity cooling water to prevent the cooling water from causing corrosion. It has been reported that high purity aluminum is very high in resistance to corrosion. Based on these measurements and considerations, it is suggested that when aluminum is to be used as material for vacuum devices in an accelerator, it is required to provide protection film on its surface to prevent corrosion or to use cooling water pipes cladded with pure aluminum and an aluminum alloy. In addition, the temperature of the cooling water should be set after adequately considering the environmental conditions in the room. (Nogami, K.)

  19. Stress Corrosion Cracking of Certain Aluminum Alloys

    Science.gov (United States)

    Hasse, K. R.; Dorward, R. C.

    1983-01-01

    SC resistance of new high-strength alloys tested. Research report describes progress in continuing investigation of stress corrosion (SC) cracking of some aluminum alloys. Objective of program is comparing SC behavior of newer high-strength alloys with established SC-resistant alloy.

  20. Reinforcement of Aluminum Castings with Dissimilar Metals

    Energy Technology Data Exchange (ETDEWEB)

    Han, Q

    2004-01-07

    The project ''Reinforcement of Aluminum Casting with Dissimilar Metal'' was a Cooperative Research and Development Agreements (CRADAs) between Oak Ridge National Laboratory (ORNL) and Cummins Inc. This project, technologies have been developed to reinforce aluminum castings with steel insert. Defect-free bond between the steel insert and the aluminum casting has been consistently obtained. The push-out experiment indicated that the bond strength is higher than that of the Al-Fin method. Two patents have been granted to the project team that is comprised of Cummins Inc. and ORNL. This report contains four sections: the coating of the steel pins, the cast-in method, microstructure characterization, and the bond strength. The section of the coating of the steel pins contains coating material selection, electro-plating technique for plating Cu and Ni on steel, and diffusion bonding of the coatings to the steel. The section of cast-in method deals with factors that affecting the quality of the metallurgical bond between the coated steel and the aluminum castings. The results of microstructure characteristics of the bonding are presented in the microstructure characterization section. A push-out experiment and the results obtained using this method is described in the section of bond strength/mechanical property.

  1. Preparation of aluminum nitride-silicon carbide nanocomposite powder by the nitridation of aluminum silicon carbide

    NARCIS (Netherlands)

    Itatani, K.; Tsukamoto, R.; Delsing, A.C.A.; Hintzen, H.T.J.M.; Okada, I.

    2002-01-01

    Aluminum nitride (AlN)-silicon carbide (SiC) nanocomposite powders were prepared by the nitridation of aluminum-silicon carbide (Al4SiC4) with the specific surface area of 15.5 m2·g-1. The powders nitrided at and above 1400°C for 3 h contained the 2H-phases which consisted of AlN-rich and SiC-rich

  2. Investigation of Methods for Selectively Reinforcing Aluminum and Aluminum-Lithium Materials

    Science.gov (United States)

    Bird, R. Keith; Alexa, Joel A.; Messick, Peter L.; Domack, Marcia S.; Wagner, John A.

    2013-01-01

    Several studies have indicated that selective reinforcement offers the potential to significantly improve the performance of metallic structures for aerospace applications. Applying high-strength, high-stiffness fibers to the high-stress regions of aluminum-based structures can increase the structural load-carrying capability and inhibit fatigue crack initiation and growth. This paper discusses an investigation into potential methods for applying reinforcing fibers onto the surface of aluminum and aluminum-lithium plate. Commercially-available alumina-fiber reinforced aluminum alloy tapes were used as the reinforcing material. Vacuum hot pressing was used to bond the reinforcing tape to aluminum alloy 2219 and aluminum-lithium alloy 2195 base plates. Static and cyclic three-point bend testing and metallurgical analysis were used to evaluate the enhancement of mechanical performance and the integrity of the bond between the tape and the base plate. The tests demonstrated an increase in specific bending stiffness. In addition, no issues with debonding of the reinforcing tape from the base plate during bend testing were observed. The increase in specific stiffness indicates that selectively-reinforced structures could be designed with the same performance capabilities as a conventional unreinforced structure but with lower mass.

  3. Method of melting and decontaminating radioactive contaminated aluminum material

    International Nuclear Information System (INIS)

    Uda, Tatsuhiko; Miura, Noboru; Kawasaki, Katsuo; Iba, Hajime.

    1986-01-01

    Purpose: To improve the decontaminating efficiency upon melting decontamination of radioactive-contaminated aluminum materials. Method: This invention concerns an improvement for the method of melting decontamination by adding slug agent composed of organic compound to contaminated aluminum material and extracting the radioactive materials into the slug thereby decontaminating the aluminum material. Specifically metals effective for reducing the active amount of aluminum are added such that the content is greater than a predetermined value in the heat melting process. The metal comprises Mg, Cu or a mixture thereof and the content is more than 4 % including those previously contained in the aluminum material. (Ikeda, J.)

  4. FLOWSHEET FOR ALUMINUM REMOVAL FROM SLUDGE BATCH 6

    International Nuclear Information System (INIS)

    Pike, J.; Gillam, J.

    2008-01-01

    Samples of Tank 12 sludge slurry show a substantially larger fraction of aluminum than originally identified in sludge batch planning. The Liquid Waste Organization (LWO) plans to formulate Sludge Batch 6 (SB6) with about one half of the sludge slurry in Tank 12 and one half of the sludge slurry in Tank 4. LWO identified aluminum dissolution as a method to mitigate the effect of having about 50% more solids in High Level Waste (HLW) sludge than previously planned. Previous aluminum dissolution performed in a HLW tank in 1982 was performed at approximately 85 C for 5 days and dissolved nearly 80% of the aluminum in the sludge slurry. In 2008, LWO successfully dissolved 64% of the aluminum at approximately 60 C in 46 days with minimal tank modifications and using only slurry pumps as a heat source. This report establishes the technical basis and flowsheet for performing an aluminum removal process in Tank 51 for SB6 that incorporates the lessons learned from previous aluminum dissolution evolutions. For SB6, aluminum dissolution process temperature will be held at a minimum of 65 C for at least 24 days, but as long as practical or until as much as 80% of the aluminum is dissolved. As planned, an aluminum removal process can reduce the aluminum in SB6 from about 84,500 kg to as little as 17,900 kg with a corresponding reduction of total insoluble solids in the batch from 246,000 kg to 131,000 kg. The extent of the reduction may be limited by the time available to maintain Tank 51 at dissolution temperature. The range of dissolution in four weeks based on the known variability in dissolution kinetics can range from 44 to more than 80%. At 44% of the aluminum dissolved, the mass reduction is approximately 1/2 of the mass noted above, i.e., 33,300 kg of aluminum instead of 66,600 kg. Planning to reach 80% of the aluminum dissolved should allow a maximum of 81 days for dissolution and reduce the allowance if test data shows faster kinetics. 47,800 kg of the dissolved

  5. Aluminum as anode for energy storage and conversion: a review

    Science.gov (United States)

    Li, Qingfeng; Bjerrum, Niels J.

    Aluminum has long attracted attention as a potential battery anode because of its high theoretical voltage and specific energy. The protective oxide layer on the aluminum surface is however detrimental to the battery performance, contributing to failure to achieve the reversible potential and causing the delayed activation of the anode. By developing aluminum alloys as anodes and solution additives to electrolytes, a variety of aluminum batteries have been extensively investigated for various applications. From molten salt and other non-aqueous electrolytes, aluminum can be electrodeposited and therefore be suitable for developing rechargable batteries. Considerable efforts have been made to develop secondary aluminum batteries of high power density. In the present paper, these research activities are reviewed, including aqueous electrolyte primary batteries, aluminum-air batteries and molten salt secondary batteries.

  6. Carbon contaminant in the ion processing of aluminum oxide film

    International Nuclear Information System (INIS)

    Chaug, Y.; Roy, N.

    1989-01-01

    Ion processing can induce contamination on the bombarded surface. However, this process is essential for the microelectronics device fabrication. Auger electron spectroscopy has been used to study the simultaneous deposition of carbon impurity during ion bombardment of magnetron rf-sputtering deposited aluminum oxide film. Ion bombardment on aluminum oxide results in a preferential removal of surface oxygen and a formation of a metastable state of aluminum suboxide. Cosputtered implanted carbon contaminant appears to have formed a new state of stoichiometry on the surface of the ion bombarded aluminum oxide and existed as an aluminum carbide. This phase has formed due to the interaction of the implanted carbon and the aluminum suboxide. The Ar + ion sputter etching rate is reduced for the carbon contaminated oxide. The electrical resistance of the aluminum oxide between two gold strips has been measured. It is found that the electrical resistance is also reduced due to the formation of the new stoichiometry on the surface

  7. Aluminum Target Dissolution in Support of the Pu-238 Program

    Energy Technology Data Exchange (ETDEWEB)

    McFarlane, Joanna [ORNL; Benker, Dennis [ORNL; DePaoli, David W [ORNL; Felker, Leslie Kevin [ORNL; Mattus, Catherine H [ORNL

    2014-09-01

    Selection of an aluminum alloy for target cladding affects post-irradiation target dissolution and separations. Recent tests with aluminum alloy 6061 yielded greater than expected precipitation in the caustic dissolution step, forming up to 10 wt.% solids of aluminum hydroxides and aluminosilicates. We present a study to maximize dissolution of aluminum metal alloy, along with silicon, magnesium, and copper impurities, through control of temperature, the rate of reagent addition, and incubation time. Aluminum phase transformations have been identified as a function of time and temperature, using X-ray diffraction. Solutions have been analyzed using wet chemical methods and X-ray fluorescence. These data have been compared with published calculations of aluminum phase diagrams. Temperature logging during the transients has been investigated as a means to generate kinetic and mass transport data on the dissolution process. Approaches are given to enhance the dissolution of aluminum and aluminosilicate phases in caustic solution.

  8. Vapor corrosion of aluminum cladding alloys and aluminum-uranium fuel materials in storage environments

    International Nuclear Information System (INIS)

    Lam, P.; Sindelar, R.L.; Peacock, H.B. Jr.

    1997-04-01

    An experimental investigation of the effects of vapor environments on the corrosion of aluminum spent nuclear fuel (A1 SNF) has been performed. Aluminum cladding alloys and aluminum-uranium fuel alloys have been exposed to environments of air/water vapor/ionizing radiation and characterized for applications to degradation mode analysis for interim dry and repository storage systems. Models have been developed to allow predictions of the corrosion response under conditions of unlimited corrodant species. Threshold levels of water vapor under which corrosion does not occur have been identified through tests under conditions of limited corrodant species. Coupons of aluminum 1100, 5052, and 6061, the US equivalent of cladding alloys used to manufacture foreign research reactor fuels, and several aluminum-uranium alloys (aluminum-10, 18, and 33 wt% uranium) were exposed to various controlled vapor environments in air within the following ranges of conditions: Temperature -- 80 to 200 C; Relative Humidity -- 0 to 100% using atmospheric condensate water and using added nitric acid to simulate radiolysis effects; and Gamma Radiation -- none and 1.8 x 10 6 R/hr. The results of this work are part of the body of information needed for understanding the degradation of the A1 SNF waste form in a direct disposal system in the federal repository. It will provide the basis for data input to the ongoing performance assessment and criticality safety analyses. Additional testing of uranium-aluminum fuel materials at uranium contents typical of high enriched and low enriched fuels is being initiated to provide the data needed for the development of empirical models

  9. First-principles surface interaction studies of aluminum-copper and aluminum-copper-magnesium secondary phases in aluminum alloys

    Science.gov (United States)

    da Silva, Thiago H.; Nelson, Eric B.; Williamson, Izaak; Efaw, Corey M.; Sapper, Erik; Hurley, Michael F.; Li, Lan

    2018-05-01

    First-principles density functional theory-based calculations were performed to study θ-phase Al2Cu, S-phase Al2CuMg surface stability, as well as their interactions with water molecules and chloride (Cl-) ions. These secondary phases are commonly found in aluminum-based alloys and are initiation points for localized corrosion. Density functional theory (DFT)-based simulations provide insight into the origins of localized (pitting) corrosion processes of aluminum-based alloys. For both phases studied, Cl- ions cause atomic distortions on the surface layers. The nature of the distortions could be a factor to weaken the interlayer bonds in the Al2Cu and Al2CuMg secondary phases, facilitating the corrosion process. Electronic structure calculations revealed not only electron charge transfer from Cl- ions to alloy surface but also electron sharing, suggesting ionic and covalent bonding features, respectively. The S-phase Al2CuMg structure has a more active surface than the θ-phase Al2Cu. We also found a higher tendency of formation of new species, such as Al3+, Al(OH)2+, HCl, AlCl2+, Al(OH)Cl+, and Cl2 on the S-phase Al2CuMg surface. Surface chemical reactions and resultant species present contribute to establishment of local surface chemistry that influences the corrosion behavior of aluminum alloys.

  10. Phases in lanthanum-nickel-aluminum alloys

    International Nuclear Information System (INIS)

    Mosley, W.C.

    1992-01-01

    Lanthanum-nickel-aluminum (LANA) alloys will be used to pump, store and separate hydrogen isotopes in the Replacement Tritium Facility (RTF). The aluminum content (y) of the primary LaNi 5 -phase is controlled to produce the desired pressure-temperature behavior for adsorption and desorption of hydrogen. However, secondary phases cause decreased capacity and some may cause undesirable retention of tritium. Twenty-three alloys purchased from Ergenics, Inc. for development of RTF processes have been characterized by scanning electron microscopy (SEM) and by electron microprobe analysis (EMPA) to determine the distributions and compositions of constituent phases. This memorandum reports the results of these characterization studies. Knowledge of the structural characteristics of these alloys is a useful first step in selecting materials for specific process development tests and in interpreting results of those tests. Once this information is coupled with data on hydrogen plateau pressures, retention and capacity, secondary phase limits for RTF alloys can be specified

  11. Etching Behavior of Aluminum Alloy Extrusions

    Science.gov (United States)

    Zhu, Hanliang

    2014-11-01

    The etching treatment is an important process step in influencing the surface quality of anodized aluminum alloy extrusions. The aim of etching is to produce a homogeneously matte surface. However, in the etching process, further surface imperfections can be generated on the extrusion surface due to uneven materials loss from different microstructural components. These surface imperfections formed prior to anodizing can significantly influence the surface quality of the final anodized extrusion products. In this article, various factors that influence the materials loss during alkaline etching of aluminum alloy extrusions are investigated. The influencing variables considered include etching process parameters, Fe-rich particles, Mg-Si precipitates, and extrusion profiles. This study provides a basis for improving the surface quality in industrial extrusion products by optimizing various process parameters.

  12. Aluminum recycling—An integrated, industrywide approach

    Science.gov (United States)

    Das, Subodh K.; Green, John A. S.; Kaufman, J. Gilbert; Emadi, Daryoush; Mahfoud, M.

    2010-02-01

    The aluminum industry is a leading proponent of global sustainability and strongly advocates the use of recycled metal. As the North American primary aluminum industry continues to move offshore to other geographic areas such as Iceland and the Middle East, where energy is more readily available at lower cost, the importance of the secondary (i.e., recycled metal) market in the U.S. will continue to increase. The purpose of this paper is to take an integrated, industry-wide look at the recovery of material from demolished buildings, shredded automobiles, and aging aircraft, as well as from traditional cans and other rigid containers. Attempts will be made to assess how the different alloys used in these separate markets can be recycled in the most energy-efficient manner.

  13. Generation and structural characterization of aluminum cyanoacetylide

    Energy Technology Data Exchange (ETDEWEB)

    Cabezas, Carlos; Peña, Isabel; Alonso, José L., E-mail: alargo@qf.uva.es, E-mail: jlalonso@qf.uva.es [Grupo de Espectroscopia Molecular (GEM), Edificio Quifima, Laboratorios de Espectroscopia y Bioespectroscopia, Unidad Asociada CSIC, Parque Científico Uva, Universidad de Valladolid, Paseo de Belén 5, 47011 Valladolid (Spain); Barrientos, Carmen; Largo, Antonio, E-mail: alargo@qf.uva.es, E-mail: jlalonso@qf.uva.es [Departamento de Química Física y Química Inorgánica, Facultad de Ciencias, Universidad de Valladolid, Campus Miguel Delibes, Paseo de Belén 7, 47011 Valladolid (Spain); Guillemin, Jean-Claude [Institut des Sciences Chimiques de Rennes, École Nationale Supérieure de Chimie de Rennes, CNRS, UMR 6226, 11 Allée de Beaulieu, CS 50837, 35708 Rennes Cedex 7 (France); Cernicharo, José [Group of Molecular Astrophysics, ICMM C/Sor Juana Ines de la Cruz N3 Cantoblanco, 28049 Madrid (Spain)

    2014-09-14

    Combined spectroscopy measurements and theoretical calculations bring to light a first investigation of a metallic cyanoacetylide, AlC{sub 3}N, using laser ablation molecular beam Fourier transform microwave spectroscopy. This molecule was synthesized in a supersonic expansion by the reaction of aluminum vapour with C{sub 3}N, produced from solid aluminum rods and BrCCCN in a newly constructed ablation-heating nozzle device. A set of accurate rotational and {sup 27}Al and {sup 14}N nuclear quadrupole coupling constants have been determined from the analysis of the rotational spectrum and compared with those predicted in a high-level ab initio study, conducting to the assignment of the observed species to linear AlCCCN. We have searched for this species towards the carbon-rich evolved star IRC + 10216 but only an upper limit to its abundance has been obtained.

  14. Cratering Equations for Zinc Orthotitanate Coated Aluminum

    Science.gov (United States)

    Hyde, James; Christiansen, Eric; Liou, Jer-Chyi; Ryan, Shannon

    2009-01-01

    The final STS-125 servicing mission (SM4) to the Hubble Space Telescope (HST) in May of 2009 saw the return of the 2nd Wide Field Planetary Camera (WFPC2) aboard the shuttle Discovery. This hardware had been in service on HST since it was installed during the SM1 mission in December of 1993 yielding one of the longest low Earth orbit exposure times (15.4 years) of any returned space hardware. The WFPC2 is equipped with a 0.8 x 2.2 m radiator for thermal control of the camera electronics (Figure 1). The space facing surface of the 4.1 mm thick aluminum radiator is coated with Z93 zinc orthotitanate thermal control paint with a nominal thickness of 0.1 0.2 mm. Post flight inspections of the radiator panel revealed hundreds of micrometeoroid/orbital debris (MMOD) impact craters ranging in size from less than 300 to nearly 1000 microns in diameter. The Z93 paint exhibited large spall areas around the larger impact sites (Figure 2) and the craters observed in the 6061-T651 aluminum had a different shape than those observed in uncoated aluminum. Typical hypervelocity impact craters in aluminum have raised lips around the impact site. The craters in the HST radiator panel had suppressed crater lips, and in some cases multiple craters were present instead of a single individual crater. Humes and Kinard observed similar behavior after the WFPC1 post flight inspection and assumed the Z93 coating was acting like a bumper in a Whipple shield. Similar paint behavior (spall) was also observed by Bland2 during post flight inspection of the International Space Station (ISS) S-Band Antenna Structural Assembly (SASA) in 2008. The SASA, with similar Z93 coated aluminum, was inspected after nearly 4 years of exposure on the ISS. The multi-crater phenomena could be a function of the density, composition, or impact obliquity angle of the impacting particle. For instance, a micrometeoroid particle consisting of loosely bound grains of material could be responsible for creating the

  15. Aluminum matrix composites reinforced with alumina nanoparticles

    CERN Document Server

    Casati, Riccardo

    2016-01-01

    This book describes the latest efforts to develop aluminum nanocomposites with enhanced damping and mechanical properties and good workability. The nanocomposites exhibited high strength, improved damping behavior and good ductility, making them suitable for use as wires. Since the production of metal matrix nanocomposites by conventional melting processes is considered extremely problematic (because of the poor wettability of the nanoparticles), different powder metallurgy routes were investigated, including high-energy ball milling and unconventional compaction methods. Special attention was paid to the structural characterization at the micro- and nanoscale, as uniform nanoparticle dispersion in metal matrix is of prime importance. The aluminum nanocomposites displayed an ultrafine microstructure reinforced with alumina nanoparticles produced in situ or added ex situ. The physical, mechanical and functional characteristics of the materials produced were evaluated using different mechanical tests and micros...

  16. [Analysis of tartrazine aluminum lake and sunset yellow aluminum lake in foods by capillary zone electrophoresis].

    Science.gov (United States)

    Zhang, Yiding; Chang, Cuilan; Guo, Qilei; Cao, Hong; Bai, Yu; Liu, Huwei

    2014-04-01

    A novel analytical method for tartrazine aluminum lake and sunset yellow aluminum lake using capillary zone electrophoresis (CZE) was studied. The pigments contained in the color lakes were successfully separated from the aluminum matrix in the pre-treatment process, which included the following steps: dissolve the color lakes in 0.1 mol/L H2SO4, adjust the pH of the solution to 5.0, then mix it with the solution of EDTA x 2Na and heat it in a water bath, then use polyamide powder as the stationary phase of solid phase extraction to separate the pigments from the solution, and finally elute the pigments with 0.1 mol/L NaOH. The CZE conditions systematically optimized for tartrazine aluminum lake were: 48.50 cm of a fused silica capillary with 40.00 cm effective length and 50 microm i. d., the temperature controlled at 20.0 degrees C, 29.0 kV applied, HPO4(2-)-PO4(3-) (0.015 mol/L, pH 11.45) solution as running buffer, detection at 263 nm. The conditions for sunset yellow aluminum lake were: the same capillary and temperature, 25.0 kV applied, HPO4(2-)-PO4(3-) (0.025 mol/L, pH 11.45) solution as running buffer, detection at 240 nm. The limits of detection were 0.26 mg/L and 0.27 mg/L, and the linear ranges were 0.53-1.3 x 10(2) mg/L and 0.54-1.4 x 10(2) mg/L for tartrazine aluminum lake and sunset yellow aluminum lake, respectively. The RSDs were 4.3% and 5.7% (run to run, n = 6), 5.6% and 6.0% (day to day, n = 6) for tartrazine aluminum lake and sunset yellow aluminum lake, respectively. Further developments for this method could make it a routinely used method analyzing color lakes in foods.

  17. Ignition of Aluminum Particles and Clouds

    Energy Technology Data Exchange (ETDEWEB)

    Kuhl, A L; Boiko, V M

    2010-04-07

    Here we review experimental data and models of the ignition of aluminum (Al) particles and clouds in explosion fields. The review considers: (i) ignition temperatures measured for single Al particles in torch experiments; (ii) thermal explosion models of the ignition of single Al particles; and (iii) the unsteady ignition Al particles clouds in reflected shock environments. These are used to develop an empirical ignition model appropriate for numerical simulations of Al particle combustion in shock dispersed fuel explosions.

  18. Anodizing And Sealing Aluminum In Nonchromated Solutions

    Science.gov (United States)

    Emmons, John R.; Kallenborn, Kelli J.

    1995-01-01

    Improved process for anodizing and sealing aluminum involves use of 5 volume percent sulfuric acid in water as anodizing solution, and 1.5 to 2.0 volume percent nickel acetate in water as sealing solution. Replaces process in which sulfuric acid used at concentrations of 10 to 20 percent. Improved process yields thinner coats offering resistance to corrosion, fatigue life, and alloy-to-alloy consistency equal to or superior to those of anodized coats produced with chromated solutions.

  19. Preparation and characterization of aluminum stearate

    Directory of Open Access Journals (Sweden)

    Lončar Eva S.

    2003-01-01

    Full Text Available Preparation of aluminum stearate by the precipitation method was examined under various conditions of stearic acid saponification with sodium hydroxide. It was proved that the most favorable ratio of acid/alkali was 1:1.5 and that the obtained soap was very similar to the commercial product. Endothermic effects determined by differential scanning calorimetry and also the other parameters showed that the soaps consisted mono-, di-, tristearates and non-reacted substances, where distearate was the dominant form.

  20. Thermoelectric charge imbalance in superconducting aluminum

    International Nuclear Information System (INIS)

    Heidel, D.F.; Garland, J.C.

    1981-01-01

    The charge imbalance voltage produced in superconducting aluminum by the presence of a temperature gradient and an electric current has been studied over the temperature range 0.5-1.2 K. Measurements were obtained of the magnitude and temperature dependence of the charge imbalance voltage of seven samples, two of which contained magnetic impurities. The data are compared with recent theoretical models of the effect

  1. Testing conformal mapping with kitchen aluminum foil

    OpenAIRE

    Haas, S.; Cooke, D. A.; Crivelli, P.

    2016-01-01

    We report an experimental verification of conformal mapping with kitchen aluminum foil. This experiment can be reproduced in any laboratory by undergraduate students and it is therefore an ideal experiment to introduce the concept of conformal mapping. The original problem was the distribution of the electric potential in a very long plate. The correct theoretical prediction was recently derived by A. Czarnecki (Can. J. Phys. 92, 1297 (2014)).

  2. Ultrasonic maps of porosity in aluminum castings

    International Nuclear Information System (INIS)

    Ghaffari, Bita; Potter, Timothy J.; Mozurkewich, George

    2002-01-01

    The use of cast aluminum in the automotive industry has grown dramatically in recent years, leading to increased need for quantitative characterization of microporosity. As previously reported in the literature, the attenuation of ultrasound can be used to measure the porosity volume fraction and the mean pore size. An immersion ultrasound system has been built utilizing this technique to scan castings with high spatial resolution. Maps of attenuation are shown to locate areas of varying porosity readily and reliably

  3. Internal Heterogeneous Processes in Aluminum Combustion

    Science.gov (United States)

    Dreizin, E. L.

    1999-01-01

    This paper discusses the aluminum particle combustion mechanism which has been expanded by inclusion of gas dissolution processes and ensuing internal phase transformations. This mechanism is proposed based on recent normal and microgravity experiments with particles formed and ignited in a pulsed micro-arc. Recent experimental findings on the three stages observed in Al particle combustion in air and shows the burning particle radiation, trajectory (streak), smoke cloud shapes, and quenched particle interiors are summarized. During stage I, the radiation trace is smooth and the particle flame is spherically symmetric. The temperature measured using a three-color pyrometer is close to 3000 K. Because it exceeds the aluminum boiling point (2730 K), this temperature most likely characterizes the vapor phase flame zone rather than the aluminum surface. The dissolved oxygen content within particles quenched during stage I was below the detection sensitivity (about 1 atomic %) for Wavelength Dispersive Spectroscopy (WDS). After an increase in the radiation intensity (and simultaneous decrease in the measured color temperature from about 3000 to 2800 K) indicative of the transition to stage II combustion, the internal compositions of the quenched particles change. Both oxygen-rich (approx. 10 atomic %) and oxygen-lean (combustion behavior and the evolution of its internal composition, the change from the spherically symmetric to asymmetric flame shape occurring upon the transition from stage I to stage II combustion could not be understood based only on the fact that dissolved oxygen is detected in the particles. The connection between the two phenomena appeared even less significant because in earlier aluminum combustion studies carried in O2/Ar mixtures, flame asymmetry was not observed as opposed to experiments in air or O2/CO mixtures. It has been proposed that the presence of other gases, i.e., hydrogen, or nitrogen causes the change in the combustion regime.

  4. Concept Development of an Aluminum Pedestrian Bridge

    OpenAIRE

    Brekke, Christian Arne Raknes

    2017-01-01

    As part of new initiatives from Norwegian Public Road Administration (NPRA) and Nye Veier AS towards reduced cost of road construction and maintenance, alternative materials for bridges are being considered. For the construction phase, quick installation and utilization of prefabricated units are being requested. For the operational phase, solutions not requiring periodical maintenance are favorized. In total, these new requirements are well suited for the use of aluminum. Especially for pede...

  5. Reshock and release response of aluminum single crystal

    International Nuclear Information System (INIS)

    Huang, H.; Asay, J. R.

    2007-01-01

    Reshock and release experiments were performed on single crystal aluminum along three orientations and on polycrystalline 1050 aluminum with 50 μm grain size at shock stresses of 13 and 21 GPa to investigate the mechanisms for previously observed quasielastic recompression behavior. Particle velocity profiles obtained during reshocking both single crystals and polycrystalline aluminum from initial shock stresses of 13-21 GPa show similar quasielastic recompression behavior. Quasielastic release response is also observed in all single crystals, but the magnitude of the effect is crystal orientation dependent, with [111] and [110] exhibiting more ideal elastic-plastic release for unloading from the shocked state than for the [100] orientation and polycrystalline aluminum. The quasielastic response of 1050 aluminum is intermediate to that of the [100] and [111] orientations. Comparison of the wave profiles obtained for both unloading and reloading of single crystals and polycrystalline 1050 aluminum from shocked states suggests that the observed quasielastic response of polycrystalline aluminum results from the averaging response of single crystals for shock propagation along different orientations, and that the response of 1050 aluminum with large grain boundaries is not significantly different from the results obtained on single crystal aluminum. The yield strength of the single crystals and 1050 aluminum is found to increase with shock stress, which is consistent with previous results [H. Huang and I. R. Asay, J. Appl. Phys. 98, 033524 (2005)

  6. Low Velocity Impact Properties of Aluminum Foam Sandwich Structural Composite

    Directory of Open Access Journals (Sweden)

    ZHAO Jin-hua

    2018-01-01

    Full Text Available Sandwich structural composites were prepared by aluminum foam as core materials with basalt fiber(BF and ultra-high molecular weight polyethylene(UHMWPE fiber composite as faceplate. The effect of factors of different fiber type faceplates, fabric layer design and the thickness of the corematerials on the impact properties and damage mode of aluminum foam sandwich structure was studied. The impact properties were also analyzed to compare with aluminum honeycomb sandwich structure. The results show that BF/aluminum foam sandwich structural composites has bigger impact damage load than UHMWPE/aluminum foam sandwich structure, but less impact displacement and energy absorption. The inter-layer hybrid fabric design of BF and UHMWPE has higher impact load and energy absorption than the overlay hybrid fabric design faceplate sandwich structure. With the increase of the thickness of aluminum foam,the impact load of the sandwich structure decreases, but the energy absorption increases. Aluminum foam sandwich structure has higher impact load than the aluminum honeycomb sandwich structure, but smaller damage energy absorption; the damage mode of aluminum foam core material is mainly the fracture at the impact area, while aluminum honeycomb core has obvious overall compression failure.

  7. Chromic acid anodizing of aluminum foil

    Science.gov (United States)

    Dursch, H.

    1988-01-01

    The success of the Space Station graphite/epoxy truss structure depends on its ability to endure long-term exposure to the LEO environment, primarily the effects of atomic oxygen and the temperture cycling resulting from the 94 minute orbit. This report describes the development and evaluation of chromic acid anodized (CAA) aluminum foil as protective coatings for these composite tubes. Included are: development of solar absorptance and thermal emittance properties required of Al foil and development of CAA parameters to achieve these optical properties; developing techniques to CAA 25 ft lengths of Al foil; developing bonding processes for wrapping the Al foil to graphite/epoxy tubes; and atomic oxygen testing of the CAA Al foil. Two specifications were developed and are included in the report: Chromic Acid Anodizing of Aluminum Foil Process Specification and Bonding of Anodized Aluminum Foil to Graphite/Epoxy Tubes. Results show that CAA Al foil provides and excellent protective and thermal control coating for the Space Station truss structure.

  8. Nitrogen bonding in aluminum oxynitride films

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Paul W., E-mail: pwang@bradley.edu [Department of Physics, Bradley University, 1501 W. Bradley Ave., Peoria, IL 61625 (United States); Hsu, Jin-Cherng [Department of Physics, Fu Jen Catholic University, Hsinchuang, Taipei Hsien 24205, Taiwan (China); Lin, Yung-Hsin; Chen, Huang-Lu [Graduate Institute of Applied Science and Engineering, Fu Jen Catholic University, Hsinchuang, Taipei Hsien 24205, Taiwan (China)

    2010-04-15

    Assignment of oxidation states of N{sub 1s} in XPS spectra of aluminum oxynitride by curve fitting is difficult. The XPS curve fitting was previously discussed in the paper published in J. Non-Cryst. Solids, 224 (1998) 31, in which O{sub 1s} photoelectrons from GeO{sub 2} glass were used to illustrate how to fit the XPS spectra. Three different ways were pointed out to eliminate the ambiguity caused by curve fitting such as comparing the data to data from standard samples, investigating the continuous surface modifications caused by slowly sputtering the surface, and monitoring the continuous surface modifications due to gradual increases in surface species under heating, cooling, or irradiation. Our recent work in aluminum oxynitride films provides another example of how to fit the XPS spectra of N{sub 1s} by three different oxidation states of N{sup +}, N{sup 2+}, and N{sup 3+}, by comparison of the measured data to data from previously published results, and by the gradual changes of spectra as functions of the oxygen contents in the films. Three oxidation states in different nitrogen bonding in the aluminum oxynitride, AlO{sub 2}N, Al{sub 2}O{sub 5}N{sub 2}, and AlO{sub 3}N, were clearly deduced.

  9. Yttrium aluminum garnet coating on glass substrate

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Camila M.A.; Freiria, Gabriela S.; Faria, Emerson H. de; Rocha, Lucas A.; Ciuffi, Katia J.; Nassar, Eduardo J., E-mail: eduardo.nassar@unifran.edu.br

    2016-02-15

    Thin luminescent films have seen great technological advances and are applicable in the production of a variety of materials such as sensors, solar cells, photovoltaic devices, optical magnetic readers, waveguides, lasers, and recorders. Systems that contain yttrium aluminum oxide are important hosts for lanthanide ions and serve as light emission devices. This work deals with the deposition of yttrium aluminum garnet (YAG) film doped with Eu{sup 3+} onto a glass substrate obtained by the sol–gel methodology. Spray pyrolysis furnished the yttrium aluminum oxide powder. Dip-coating at a withdrawal speed of 10 mm min{sup −1} and evaporation led to deposition of different numbers of layers of the YAG:Eu{sup 3+} film onto the glass substrate from a YAG:Eu{sup 3+} powder suspension containing ethanol, water, and tetraethylorthosilicate. Photoluminescence, X-ray diffraction, scanning electron microscopy, and transparency measurements aided film characterization. The emission spectra revealed that the number of layers influenced film properties. - Highlights: • The spray pyrolysis was used to obtain luminescent YAG:Eu{sup 3+}. • The matrix was deposited as transparent films. • The YAG:Eu{sup 3+} was deposited by sol–gel process onto glass substrate.

  10. Yttrium aluminum garnet coating on glass substrate

    International Nuclear Information System (INIS)

    Ferreira, Camila M.A.; Freiria, Gabriela S.; Faria, Emerson H. de; Rocha, Lucas A.; Ciuffi, Katia J.; Nassar, Eduardo J.

    2016-01-01

    Thin luminescent films have seen great technological advances and are applicable in the production of a variety of materials such as sensors, solar cells, photovoltaic devices, optical magnetic readers, waveguides, lasers, and recorders. Systems that contain yttrium aluminum oxide are important hosts for lanthanide ions and serve as light emission devices. This work deals with the deposition of yttrium aluminum garnet (YAG) film doped with Eu 3+ onto a glass substrate obtained by the sol–gel methodology. Spray pyrolysis furnished the yttrium aluminum oxide powder. Dip-coating at a withdrawal speed of 10 mm min −1 and evaporation led to deposition of different numbers of layers of the YAG:Eu 3+ film onto the glass substrate from a YAG:Eu 3+ powder suspension containing ethanol, water, and tetraethylorthosilicate. Photoluminescence, X-ray diffraction, scanning electron microscopy, and transparency measurements aided film characterization. The emission spectra revealed that the number of layers influenced film properties. - Highlights: • The spray pyrolysis was used to obtain luminescent YAG:Eu 3+ . • The matrix was deposited as transparent films. • The YAG:Eu 3+ was deposited by sol–gel process onto glass substrate.

  11. Hydrolysis of aluminum dross material to achieve zero hazardous waste

    International Nuclear Information System (INIS)

    David, E.; Kopac, J.

    2012-01-01

    Highlights: ► The hydrolysis of aluminum dross in tap water generates pure hydrogen. ► Aluminum particles from dross are activated by mechanically milling technique. ► The process is completely greenhouse gases free and is cleanly to environment. ► Hydrolysis process leads to recycling of waste aluminum by hydrogen production. - Abstract: A simple method with high efficiency for generating high pure hydrogen by hydrolysis in tap water of highly activated aluminum dross is established. Aluminum dross is activated by mechanically milling to particles of about 45 μm. This leads to removal of surface layer of the aluminum particles and creation of a fresh chemically active metal surface. In contact with water the hydrolysis reaction takes place and hydrogen is released. In this process a Zero Waste concept is achieved because the other product of reaction is aluminum oxide hydroxide (AlOOH), which is nature-friendly and can be used to make high quality refractory or calcium aluminate cement. For comparison we also used pure aluminum powder and alkaline tap water solution (NaOH, KOH) at a ratio similar to that of aluminum dross content. The rates of hydrogen generated in hydrolysis reaction of pure aluminum and aluminum dross have been found to be similar. As a result of the experimental setup, a hydrogen generator was designed and assembled. Hydrogen volume generated by hydrolysis reaction was measured. The experimental results obtained reveal that aluminum dross could be economically recycled by hydrolysis process with achieving zero hazardous aluminum dross waste and hydrogen generation.

  12. Electrical transport through single-wall carbon nanotube-anodic aluminum oxide-aluminum heterostructures

    International Nuclear Information System (INIS)

    Kukkola, Jarmo; Rautio, Aatto; Sala, Giovanni; Pino, Flavio; Toth, Geza; Leino, Anne-Riikka; Maeklin, Jani; Jantunen, Heli; Uusimaeki, Antti; Kordas, Krisztian; Gracia, Eduardo; Terrones, Mauricio; Shchukarev, Andrey; Mikkola, Jyri-Pekka

    2010-01-01

    Aluminum foils were anodized in sulfuric acid solution to form thick porous anodic aluminum oxide (AAO) films of thickness ∼6 μm. Electrodes of carboxyl-functionalized single-wall carbon nanotube (SWCNT) thin films were inkjet printed on the anodic oxide layer and the electrical characteristics of the as-obtained SWCNT-AAO-Al structures were studied. Nonlinear current-voltage transport and strong temperature dependence of conduction through the structure was measured. The microstructure and chemical composition of the anodic oxide layer was analyzed using transmission and scanning electron microscopy as well as x-ray photoelectron spectroscopy. Schottky emission at the SWCNT-AAO and AAO-Al interfaces allowed by impurity states in the anodic aluminum oxide film together with ionic surface conduction on the pore walls of AAO gives a reasonable explanation for the measured electrical conduction. Calcined AAO is proposed as a dielectric material for SWCNT-field effect transistors.

  13. Utilization of Aluminum Waste with Hydrogen and Heat Generation

    Science.gov (United States)

    Buryakovskaya, O. A.; Meshkov, E. A.; Vlaskin, M. S.; Shkolnokov, E. I.; Zhuk, A. Z.

    2017-10-01

    A concept of energy generation via hydrogen and heat production from aluminum containing wastes is proposed. The hydrogen obtained by oxidation reaction between aluminum waste and aqueous solutions can be supplied to fuel cells and/or infrared heaters for electricity or heat generation in the region of waste recycling. The heat released during the reaction also can be effectively used. The proposed method of aluminum waste recycling may represent a promising and cost-effective solution in cases when waste transportation to recycling plants involves significant financial losses (e.g. remote areas). Experiments with mechanically dispersed aluminum cans demonstrated that the reaction rate in alkaline solution is high enough for practical use of the oxidation process. In theexperiments aluminum oxidation proceeds without any additional aluminum activation.

  14. Low-temperature resistance of cyclically strained aluminum

    International Nuclear Information System (INIS)

    Segal, H.R.; Richard, T.G.

    1977-01-01

    An experimental study of the resistance changes in high-purity, reinforced aluminum due to cyclic straining is presently underway. The purpose of this work is to determine the optimum purity of aluminum to be used as a stabilizing material for superconducting magnets used for energy storage. Since pure aluminum has a low yield strength, it is not capable of supporting the stress levels in an energized magnet. Therefore, it has been bonded to a high-strength material--in this case, 6061 aluminum alloy. This bonding permits pure aluminum to be strained cyclically beyond its elastic limit with recovery of large plastic strains upon release of the load. The resistance change in this composite material is less than that of pure, unreinforced aluminum

  15. Chemical effects in the Corrosion of Aluminum and Aluminum Alloys. A Bibliography

    Science.gov (United States)

    1976-10-01

    tances.II. Effect Of Pomegranate Juice And The Aqueous Extract Of Pomegranate Fruits And Tea leaves On The Corrosion Of Aluminum" The effect of the juices...T7651 tempers to exfoliation and stress- corrosion cracking . 1968-8 D.P. Doyle and H.P. Godard ,a) Tr. Mezhdunar. Kongr. Korroz. Metal, 4, 439-48, (1968...Tapper Brit. Corros. J., 3, 285-87, (1968) "Corrosion Of Aluminum" Summary of the literature of Al corrosion which includes stress- corrosion cracking

  16. Preparation of Aluminum Nanomesh Thin Films from an Anodic Aluminum Oxide Template as Transparent Conductive Electrodes

    Science.gov (United States)

    Li, Yiwen; Chen, Yulong; Qiu, Mingxia; Yu, Hongyu; Zhang, Xinhai; Sun, Xiao Wei; Chen, Rui

    2016-02-01

    We have employed anodic aluminum oxide as a template to prepare ultrathin, transparent, and conducting Al films with a unique nanomesh structure for transparent conductive electrodes. The anodic aluminum oxide template is obtained through direct anodization of a sputtered Al layer on a glass substrate, and subsequent wet etching creates the nanomesh metallic film. The optical and conductive properties are greatly influenced by experimental conditions. By tuning the anodizing time, transparent electrodes with appropriate optical transmittance and sheet resistance have been obtained. The results demonstrate that our proposed strategy can serve as a potential method to fabricate low-cost TCEs to replace conventional indium tin oxide materials.

  17. 49 CFR 178.512 - Standards for steel or aluminum boxes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Standards for steel or aluminum boxes. 178.512... aluminum boxes. (a) The following are identification codes for steel or aluminum boxes: (1) 4A for a steel box; and (2) 4B for an aluminum box. (b) Construction requirements for steel or aluminum boxes are as...

  18. Physical and Electrical Characterization of Polymer Aluminum Capacitors

    Science.gov (United States)

    Liu, David; Sampson, Michael J.

    2010-01-01

    Polymer aluminum capacitors from several manufacturers with various combinations of capacitance, rated voltage, and ESR values were physically examined and electrically characterized. The physical construction analysis of the capacitors revealed three different capacitor structures, i.e., traditional wound, stacked, and laminated. Electrical characterization results of polymer aluminum capacitors are reported for frequency-domain dielectric response at various temperatures, surge breakdown voltage, and other dielectric properties. The structure-property relations in polymer aluminum capacitors are discussed.

  19. A Study on the Anodic Dissolution of Aluminum(II)

    International Nuclear Information System (INIS)

    Nam, C. W.; Park, C. S.; Park, C. S.

    1978-01-01

    In many cases oxide films formed on metals in atmosphere or aqueous solution are chemically inactive, especially it is the case with aluminum. In this study, anodic dissolution of aluminum was done using various electrolyte and cathode, mechanism of which was examined. As a consequence, oxide film on aluminum surface was dissolved together with the dissolution reaction of metal by the anodic current. It was shown that the dissolution reaction due to the contact between electrolyte and metal happened in the same time

  20. Sensitization of Naturally Aged Aluminum 5083 Armor Plate

    Science.gov (United States)

    2015-07-29

    5 - 1 - SENSITIZATION OF NATURALLY AGED ALUMINUM 5083 ARMOR PLATE INTRODUCTION Aluminum -magnesium alloys are important for both ship...boundaries [3,4]. The magnesium-rich phase (normally β-Al3Mg2) is highly anodic with respect to the surrounding aluminum phase, thus is susceptible... alloys , and with varying amounts of debris scattered about the surface consistent with corrosion product, Figure 2b, that often forms over time within

  1. Differential response of plants to aluminum. A review

    OpenAIRE

    Valencia R, Rubén A; Ligarreto M, Gustavo A

    2012-01-01

    Aluminum toxicity is a major limiting factor to the growth and development of plants in acidic soils worldwide, occurring in 40% of arable soils. The root seems to be the object of aluminum toxicity, particularly the apex, producing a rapid inhibition of cell division and elongation of the root. Fortunately, plants differ in their ability to tolerate aluminum and grow in acidic soils. Tolerance mechanisms have commonly been defined in genetic and physiological terms, however, tolerance mechan...

  2. Physical and Electrical Characterization of Aluminum Polymer Capacitors

    Science.gov (United States)

    Liu, David; Sampson, Michael J.

    2010-01-01

    Polymer aluminum capacitors from several manufacturers with various combinations of capacitance, rated voltage, and ESR values were physically examined and electrically characterized. The physical construction analysis of the capacitors revealed three different capacitor structures, i.e., traditional wound, stacked, and laminated. Electrical characterization results of polymer aluminum capacitors are reported for frequency-domain dielectric response at various temperatures, surge breakdown voltage, and other dielectric properties. The structure-property relations in polymer aluminum capacitors are discussed.

  3. Improved Density Functional Tight Binding Potentials for Metalloid Aluminum Clusters

    Science.gov (United States)

    2016-06-01

    unlimited IMPROVED DENSITY-FUNCTIONAL TIGHT BINDING POTENTIALS FOR METALLOID ALUMINUM CLUSTERS by Joon H. Kim June 2016 Thesis Advisor...DATES COVERED Master’s thesis 4. TITLE AND SUBTITLE IMPROVED DENSITY-FUNCTIONAL TIGHT BINDING POTENTIALS FOR METALLOID ALUMINUM CLUSTERS 5. FUNDING...repulsive potentials for use in density-functional tight binding (DFTB) simulations of low-valence aluminum metalloid clusters . These systems are under

  4. Monolithic Approach to Oxide Dispersion Strengthened Aluminum, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Nassau Stern Company is investigating an approach for manufacturing oxide dispersion strengthened (ODS) aluminum in bulk rather than powder form. The approach...

  5. Manufacturing of aluminum composite material using stir casting process

    International Nuclear Information System (INIS)

    Jokhio, M.H.; Panhwar, M.I.; Unar, M.A.

    2011-01-01

    Manufacturing of aluminum alloy based casting composite materials via stir casting is one of the prominent and economical route for development and processing of metal matrix composites materials. Properties of these materials depend upon many processing parameters and selection of matrix and reinforcements. Literature reveals that most of the researchers are using 2, 6 and 7 xxx aluminum matrix reinforced with SiC particles for high strength properties whereas, insufficient information is available on reinforcement of 'AI/sub 2/O/sub 3/' particles in 7 xxx aluminum matrix. The 7 xxx series aluminum matrix usually contains Cu-Zn-Mg; Therefore, the present research was conducted to investigate the effect of elemental metal such as Cu-Zn-Mg in aluminum matrix on mechanical properties of stir casting of aluminum composite materials reinforced with alpha 'AI/sub 2/O/sub 3/' particles using simple foundry melting alloying and casting route. The age hardening treatments were also applied to study the aging response of the aluminum matrix on strength, ductility and hardness. The experimental results indicate that aluminum matrix cast composite can be manufactured via conventional foundry method giving very good responses to the strength and ductility up to 10% 'AI/sub 2/O/sub 3/' particles reinforced in aluminum matrix. (author)

  6. The aluminum chemistry and corrosion in alkaline solutions

    International Nuclear Information System (INIS)

    Zhang Jinsuo; Klasky, Marc; Letellier, Bruce C.

    2009-01-01

    Aluminum-alkaline solution systems are very common in engineering applications including nuclear engineering. Consequently, a thorough knowledge of the chemistry of aluminum and susceptibility to corrosion in alkaline solutions is reviewed. The aluminum corrosion mechanism and corrosion rate are examined based on current experimental data. A review of the phase transitions with aging time and change of environment is also performed. Particular attention is given to effect of organic and inorganic ions. As an example, the effect of boron is examined in detail because of the application in nuclear reactor power systems. Methods on how to reduce the corrosion rate of aluminum in alkaline solutions are also highlighted

  7. Dissolution mechanism of aluminum hydroxides in acid media

    Science.gov (United States)

    Lainer, Yu. A.; Gorichev, I. G.; Tuzhilin, A. S.; Gololobova, E. G.

    2008-08-01

    The effects of the concentration, temperature, and potential at the hydroxide/electrolyte interface on the aluminum hydroxide dissolution in sulfuric, hydrochloric, and perchloric acids are studied. The limiting stage of the aluminum hydroxide dissolution in the acids is found to be the transition of the complexes that form on the aluminum hydroxide surface from the solid phase into the solution. The results of the calculation of the acid-base equilibrium constants at the oxide (hydroxide)/solution interface using the experimental data on the potentiometric titration of Al2O3 and AlOOH suspensions are analyzed. A mechanism is proposed for the dissolution of aluminum hydroxides in acid media.

  8. Improving pitting corrosion resistance of aluminum by anodizing process

    International Nuclear Information System (INIS)

    John, P.; Khan, I.U.

    2013-01-01

    Summary: Anodizing of aluminum was studied in sulphuric/citric/boric acid electrolyte system to improve pitting corrosion resistance. Maximum oxide film thickness was obtained using 5% sulphuric acid, 3% citric acid and 0.5% boric acid electrolyte composition. The corrosion resistance of aluminum sample was determined to find the effectiveness of oxide coating by potentiodynamic polarization test. The surface morphology of aluminum samples was investigated using scanning electron microscope (SEM) before and after corrosion test. It was found that the coated aluminum sample obtained by anodizing in sulphuric/citric/boric acid electrolyte system exhibited better pitting corrosion resistance with no significant difference in surface morphology. (author)

  9. Technological, Economic, and Environmental Optimization of Aluminum Recycling

    Science.gov (United States)

    Ioana, Adrian; Semenescu, Augustin

    2013-08-01

    The four strategic directions (referring to the entire life cycle of aluminum) are as follows: production, primary use, recycling, and reuse. Thus, in this work, the following are analyzed and optimized: reducing greenhouse gas emissions from aluminum production, increasing energy efficiency in aluminum production, maximizing used-product collection, recycling, and reusing. According to the energetic balance at the gaseous environment level, the conductive transfer model is also analyzed through the finished elements method. Several principles of modeling and optimization are presented and analyzed: the principle of analogy, the principle of concepts, and the principle of hierarchization. Based on these principles, an original diagram model is designed together with the corresponding logic diagram. This article also presents and analyzes the main benefits of aluminum recycling and reuse. Recycling and reuse of aluminum have the main advantage that it requires only about 5% of energy consumed to produce it from bauxite. The aluminum recycling and production process causes the emission of pollutants such as dioxides and furans, hydrogen chloride, and particulate matter. To control these emissions, aluminum recyclers are required to comply with the National Emission Standards for Hazardous Air Pollutants for Secondary Aluminum Production. The results of technological, economic, and ecological optimization of aluminum recycling are based on the criteria function's evaluation in the modeling system.

  10. A liquid aluminum corrosion resistance surface on steel substrate

    International Nuclear Information System (INIS)

    Wang Deqing; Shi Ziyuan; Zou Longjiang

    2003-01-01

    The process of hot dipping pure aluminum on a steel substrate followed by oxidation was studied to form a surface layer of aluminum oxide resistant to the corrosion of aluminum melt. The thickness of the pure aluminum layer on the steel substrate is reduced with the increase in temperature and time in initial aluminizing, and the thickness of the aluminum layer does not increase with time at given temperature when identical temperature and complete wetting occur between liquid aluminum and the substrate surface. The thickness of the Fe-Al intermetallic layer on the steel base is increased with increasing bath temperature and time. Based on the experimental data and the mathematics model developed by the study, a maximum exists in the thickness of the Fe-Al intermetallic at certain dipping temperature. X-ray diffraction (XRD) and energy dispersive X-ray (EDX) analysis reveals that the top portion of the steel substrate is composed of a thin layer of α-Al 2 O 3 , followed by a thinner layer of FeAl 3 , and then a much thicker one of Fe 2 Al 5 on the steel base side. In addition, there is a carbon enrichment zone in diffusion front. The aluminum oxide surface formed on the steel substrate is in perfect condition after corrosion test in liquid aluminum at 750 deg. C for 240 h, showing extremely good resistance to aluminum melt corrosion

  11. Joining of parts via magnetic heating of metal aluminum powders

    Science.gov (United States)

    Baker, Ian

    2013-05-21

    A method of joining at least two parts includes steps of dispersing a joining material comprising a multi-phase magnetic metal-aluminum powder at an interface between the at least two parts to be joined and applying an alternating magnetic field (AMF). The AMF has a magnetic field strength and frequency suitable for inducing magnetic hysteresis losses in the metal-aluminum powder and is applied for a period that raises temperature of the metal-aluminum powder to an exothermic transformation temperature. At the exothermic transformation temperature, the metal-aluminum powder melts and resolidifies as a metal aluminide solid having a non-magnetic configuration.

  12. Analysis of Material Flow in Screw Extrusion of Aluminum

    International Nuclear Information System (INIS)

    Haugen, Bjoern; Oernskar, Magnus; Welo, Torgeir; Wideroee, Fredrik

    2010-01-01

    Screw extrusion of aluminum is a new process for production of aluminum profiles. The commercial potential could be large. Little experimental and numerical work has been done with respect to this process.The material flow of hot aluminum in a screw extruder has been analyzed using finite element formulations for the non-Newtonian Navier-Stokes equations. Aluminum material properties are modeled using the Zener-Holloman material model. Effects of stick-slip conditions are investigated with respect to pressure build up and mixing quality of the extrusion process.The numerical results are compared with physical experiments using an experimental screw extruder.

  13. Reactive ion assisted deposition of aluminum oxynitride thin films

    International Nuclear Information System (INIS)

    Hwangbo, C.K.; Lingg, L.J.; Lehan, J.P.; Macleod, H.A.; Suits, F.

    1989-01-01

    Optical properties, stoichiometry, chemical bonding states, and crystal structure of aluminum oxynitride (AlO/sub x/N/sub y/) thin films prepared by reactive ion assisted deposition were investigated. The results show that by controlling the amount of reactive gases the refractive index of aluminum oxynitride films at 550 nm is able to be varied from 1.65 to 1.83 with a very small extinction coefficient. Variations of optical constants and chemical bonding states of aluminum oxynitride films are related to the stoichiometry. From an x-ray photoelectron spectroscopy analysis it is observed that our aluminum oxynitride film is not simply a mixture of aluminum oxide and aluminum nitride but a continuously variable compound. The aluminum oxynitride films are amorphous from an x-ray diffraction analysis. A rugate filter using a step index profile of aluminum oxynitride films was fabricated by nitrogen ion beam bombardment of a growing Al film with backfill oxygen pressure as the sole variation. This filter shows a high resistivity to atmospheric moisture adsorption, suggesting that the packing density of aluminum oxynitride films is close to unity and the energetic ion bombardment densifies the film as well as forming the compound

  14. Secondary Aluminum Production: National Emission Standards for Hazardous Air Pollutants

    Science.gov (United States)

    National emission standards for hazardous air pollutants (NESHAP) for new and existing sources at secondary aluminum production facilities. Includes rule history, summary, federal register citations and implementation information.

  15. Investigation of magnetism in aluminum-doped silicon carbide nanotubes

    Science.gov (United States)

    Behzad, Somayeh; Chegel, Raad

    2013-11-01

    The effect of aluminum doping on the structural, electronic and magnetic properties of (8,0) silicon carbide nanotube (SiCNT) is investigated using spin-polarized density functional theory. It is found from the calculation of the formation energies that aluminum substitution for silicon atom is preferred. Our results show that the magnetization depends on the substitutional site, aluminum substitution at silicon site does not introduce any spin-polarization, whereas the aluminum substitution for carbon atom yields a spin polarized, almost dispersionless π band within the original band gap.

  16. Aluminum nitrate recrystallization and recovery from liquid extraction raffinates

    International Nuclear Information System (INIS)

    Griffith, W.L.; Compere, A.L.; Googin, J.M.; Huxtable, W.P.

    1991-09-01

    The solid sludges resulting form biodenitrification of discarded aluminum nitrate are the largest Y-12 Plant process solid waste. Aluminum nitrate feedstocks also represent a major plant materials cost. The chemical constraints on aluminum nitrate recycle were investigated to determine the feasibility of increasing recycle while maintaining acceptable aluminum nitrate purity. Reported phase behavior of analogous systems, together with bench research, indicated that it would be possible to raise the recycle rate from 35% to between 70 and 90% by successive concentration and recrystallization of the mother liquor. A full scale pilot test successfully confirmed the ability to obtain 70% recycle in existing process equipment

  17. Manufacturing of Aluminum Composite Material Using Stir Casting Process

    Directory of Open Access Journals (Sweden)

    Muhammad Hayat Jokhio

    2011-01-01

    Full Text Available Manufacturing of aluminum alloy based casting composite materials via stir casting is one of the prominent and economical route for development and processing of metal matrix composites materials. Properties of these materials depend upon many processing parameters and selection of matrix and reinforcements. Literature reveals that most of the researchers are using 2, 6 and 7xxx aluminum matrix reinforced with SiC particles for high strength properties whereas, insufficient information is available on reinforcement of \\"Al2O3\\" particles in 7xxx aluminum matrix. The 7xxx series aluminum matrix usually contains Cu-Zn-Mg. Therefore, the present research was conducted to investigate the effect of elemental metal such as Cu-Zn-Mg in aluminum matrix on mechanical properties of stir casting of aluminum composite materials reinforced with alpha \\"Al2O3\\" particles using simple foundry melting alloying and casting route. The age hardening treatments were also applied to study the aging response of the aluminum matrix on strength, ductility and hardness. The experimental results indicate that aluminum matrix cast composite can be manufactured via conventional foundry method giving very good responses to the strength and ductility up to 10% \\"Al2O3\\" particles reinforced in aluminum matrix.

  18. Accelerating Thick Aluminum Liners Using Pulsed Power

    International Nuclear Information System (INIS)

    Kyrala, G.A.; Hammerburg, J.E.; Bowers, D.; Stokes, J.; Morgan, D.V.; Anderson, W.E.; Cochrane, J.C.

    1999-01-01

    The authors have investigated the acceleration of very thick cylindrical aluminum liners using the Pegasus II capacitory bank. These accelerated solid liners will be used to impact other objects at velocities below 1.5 km/sec, allowing one to generate and sustain shocks of a few 100 kilobar for a few microseconds. A cylindrical shell of 1100 series aluminum with an initial inner radius of 23.61 mm, an initial thickness of 3.0 mm, and a height of 20 mm, was accelerated using a current pulse of 7.15 MA peak current and a 7.4 microsecond quarter cycle time. The aluminum shell was imploded within confining copper glide planes with decreasing separation with an inward slope of 8 degrees. At impact with a cylindrical target of diameter 3-cm, the liner was moving at 1.4 km/sec and its thickness increased to 4.5 mm. Radial X-ray radiograms of the liner showed both the liner and the glide plane interface. The curvature of the inner surface of the liner was measured before impact with the 15-mm radius target. The radiograms also showed that the copper glide planes distorted as the liner radius decreased and that some axial stress is induced in the liner. The axial stresses did not affect the inner curvature significantly. Post-shot calculations of the liner behavior indicated that the thickness of the glide plane played a significant role in the distortion of the interface between the liner and the glide plane

  19. Phonon optimized interatomic potential for aluminum

    Directory of Open Access Journals (Sweden)

    Murali Gopal Muraleedharan

    2017-12-01

    Full Text Available We address the problem of generating a phonon optimized interatomic potential (POP for aluminum. The POP methodology, which has already been shown to work for semiconductors such as silicon and germanium, uses an evolutionary strategy based on a genetic algorithm (GA to optimize the free parameters in an empirical interatomic potential (EIP. For aluminum, we used the Vashishta functional form. The training data set was generated ab initio, consisting of forces, energy vs. volume, stresses, and harmonic and cubic force constants obtained from density functional theory (DFT calculations. Existing potentials for aluminum, such as the embedded atom method (EAM and charge-optimized many-body (COMB3 potential, show larger errors when the EIP forces are compared with those predicted by DFT, and thus they are not particularly well suited for reproducing phonon properties. Using a comprehensive Vashishta functional form, which involves short and long-ranged interactions, as well as three-body terms, we were able to better capture interactions that reproduce phonon properties accurately. Furthermore, the Vashishta potential is flexible enough to be extended to Al2O3 and the interface between Al-Al2O3, which is technologically important for combustion of solid Al nano powders. The POP developed here is tested for accuracy by comparing phonon thermal conductivity accumulation plots, density of states, and dispersion relations with DFT results. It is shown to perform well in molecular dynamics (MD simulations as well, where the phonon thermal conductivity is calculated via the Green-Kubo relation. The results are within 10% of the values obtained by solving the Boltzmann transport equation (BTE, employing Fermi’s Golden Rule to predict the phonon-phonon relaxation times.

  20. Oxidation of zirconium-aluminum alloys

    International Nuclear Information System (INIS)

    Cox, B.

    1967-10-01

    Examination of the processes occurring during the oxidation of Zr-1% A1, Zr-3% A1, and Zr-1.5% A1-0.5% Mo alloys has shown that in steam rapid oxidation occurs predominantly around the Zr 3 A1 particles, which at low temperatures appear to be relatively unattacked. The unoxidised particles become incorporated in the oxide, and become fully oxidised as the film thickens. This rapid localised oxidation is preceded by a short period of uniform film growth, during which the oxide film thickness does not exceed ∼200A-o. Thus the high oxidation rates can probably be ascribed to aluminum in solution in the zirconium matrix, although its precise mode of operation has not been determined. Once the solubility limit of aluminum is exceeded, the size, distribution and number of intermetallic particles affects the oxidation rate merely by altering the distribution of regions of metal giving high oxidation rates. The controlling process during the early stages of oxidation is electron transport and not ionic transport. Thus, the aluminum in the oxide film is presumably increasing the ionic conductivity more than the electronic. The oxidation rates in atmospheric pressure steam are very high and their irregular temperature dependence suggests that the oxidation rate will be pressure dependent. This was confirmed, in part, by a comparison with oxidation in moist air. It was found that the rate of development of white oxide around intermetallic particles was considerably reduced by the decrease in the partial pressure of H 2 O; the incubation period was not much different, however. (author)

  1. Phonon optimized interatomic potential for aluminum

    Science.gov (United States)

    Muraleedharan, Murali Gopal; Rohskopf, Andrew; Yang, Vigor; Henry, Asegun

    2017-12-01

    We address the problem of generating a phonon optimized interatomic potential (POP) for aluminum. The POP methodology, which has already been shown to work for semiconductors such as silicon and germanium, uses an evolutionary strategy based on a genetic algorithm (GA) to optimize the free parameters in an empirical interatomic potential (EIP). For aluminum, we used the Vashishta functional form. The training data set was generated ab initio, consisting of forces, energy vs. volume, stresses, and harmonic and cubic force constants obtained from density functional theory (DFT) calculations. Existing potentials for aluminum, such as the embedded atom method (EAM) and charge-optimized many-body (COMB3) potential, show larger errors when the EIP forces are compared with those predicted by DFT, and thus they are not particularly well suited for reproducing phonon properties. Using a comprehensive Vashishta functional form, which involves short and long-ranged interactions, as well as three-body terms, we were able to better capture interactions that reproduce phonon properties accurately. Furthermore, the Vashishta potential is flexible enough to be extended to Al2O3 and the interface between Al-Al2O3, which is technologically important for combustion of solid Al nano powders. The POP developed here is tested for accuracy by comparing phonon thermal conductivity accumulation plots, density of states, and dispersion relations with DFT results. It is shown to perform well in molecular dynamics (MD) simulations as well, where the phonon thermal conductivity is calculated via the Green-Kubo relation. The results are within 10% of the values obtained by solving the Boltzmann transport equation (BTE), employing Fermi's Golden Rule to predict the phonon-phonon relaxation times.

  2. Hydrolysis-precipitation studies of aluminum (III) solutions. I. Titration of acidified aluminum nitrate solutions

    NARCIS (Netherlands)

    Vermeulen, A.C.; Geus, John W.; Stol, R.J.; Bruyn, P.L. de

    Acidified aluminum nitrate solutions were titrated with alkali (NaOH or KOH) over a temperature range of 24°C to 90°C. A homogeneous distribution of added base was achieved by: (i) in situ decomposition of urea (90°C); and (ii) a novel method involving injection through a capillary submerged in the

  3. pH dependent dissolution of sediment aluminum in six Danish lakes treated with aluminum

    DEFF Research Database (Denmark)

    Reitzel, Kasper; Jensen, Henning S.; Egemose, Sara

    2013-01-01

    The possible pH dependent dissolution of aluminum hydroxides (Al(OH)(3)) from lake sediments was studied in six lakes previously treated with Al to bind excess phosphorus (P). Surface sediment was suspended for 2 h in lake water of pH 7.5, 8.5, or 9.5 with resulting stepwise increments in dissolved...

  4. The role of aluminum sensing and signaling in plant aluminum resistance

    Science.gov (United States)

    As researchers have gained a better understanding in recent years into the physiological, molecular and genetic basis of how plants deal with aluminum (Al) toxicity in acid soils prevalent in the tropics and sub-tropics, it has become clear that an important component of these responses is the trigg...

  5. Polarization properties of real aluminum mirrors; I. Influence of the aluminum oxide layer

    NARCIS (Netherlands)

    van Harten, G.; Snik, F.; Keller, C.U.

    2009-01-01

    In polarimetry, it is important to characterize the polarization properties of the instrument itself to disentangle real astrophysical signals from instrumental effects. This article deals with the accurate measurement and modeling of the polarization properties of real aluminum mirrors, as used in

  6. Polyphenol-aluminum complex formation: Implications for aluminum tolerance in plants

    Science.gov (United States)

    Natural polyphenols may play an important role in aluminum detoxification in some plants. We examined the interaction between Al3+ and the purified high molecular weight polyphenols pentagalloyl glucose (940 Da) and oenothein B (1568 Da), and the related compound methyl gallate (184 Da) at pH 4 and ...

  7. Modeling aluminum-lithium alloy welding characteristics

    Science.gov (United States)

    Bernstein, Edward L.

    1996-01-01

    The purpose of this project was to develop a finite element model of the heat-affected zone in the vicinity of a weld line on a plate in order to determine an accurate plastic strain history. The resulting plastic strain increments calculated by the finite element program were then to be used to calculate the measure of damage D. It was hoped to determine the effects of varying welding parameters, such as beam power, efficiency, and weld speed, and the effect of different material properties on the occurrence of microfissuring. The results were to be compared first to the previous analysis of Inconel 718, and then extended to aluminum 2195.

  8. Cleaning of aluminum after machining with coolants

    International Nuclear Information System (INIS)

    Roop, B.

    1992-01-01

    An x-ray photoemission spectroscopic study was undertaken to compare the cleaning of the Advanced Photon Source (APS) aluminum extrusion storage ring vacuum chambers after machining with and without water soluble coolants. While there was significant contamination left by the coolants, the cleaning process was capable of removing the residue. The variation of the surface and near surface composition of samples machined either dry or with coolants was negligible after cleaning. The use of such coolants in the machining process is therefore recommended

  9. Alloyed Aluminum Contacts for Silicon Solar Cells

    International Nuclear Information System (INIS)

    Tin Tin Aye

    2010-12-01

    Aluminium is usually deposited and alloyed at the back of p-p silicon solar cell for making a good ohmic contact and establishing a back electric field which avoids carrier recombination of the back surface. It was the deposition of aluminum on multicrystalline silicon (mc-Si) substrate at various annealing temperature. Physical and elemental analysis was carried out by using scanning electron microscopy (SEM) and X-rays diffraction (XRD). The electrical (I-V) characteristic of the photovoltaic cell was also measured.

  10. Proposal of 99.99%-aluminum/7N01-Aluminum clad beam tube for high energy booster of Superconducting Super Collider

    International Nuclear Information System (INIS)

    Ishimaru, Hajime

    1994-01-01

    Proposal of 99.99% pure aluminum/7N01 aluminum alloy clad beam tube for high energy booster in Superconducting Super Collider is described. This aluminum clad beam tube has many good performances, but a eddy current effect is large in superconducting magnet quench collapse. The quench test result for aluminum clad beam tube is basically no problem against magnet quench collapse. (author)

  11. Der bor en Breivik i os alle

    DEFF Research Database (Denmark)

    Høgsbro, Kjeld

    2011-01-01

    Anders Breivik må være psykopat, tænker man umiddelbart, når billederne af terrorhandlingen i Norge ruller over tv-skærmen. Men årtiers forskning viser, at helt normale mennesker kan ledes til at begå overgreb og mord på linje med Breiviks. Forudsætningen er blot, at en autoritet overbeviser dem om...

  12. 75 FR 51243 - Aluminum Extrusions from the People's Republic of China: Postponement of Preliminary...

    Science.gov (United States)

    2010-08-19

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-967] Aluminum Extrusions from the... Department of Commerce (``the Department'') initiated an antidumping duty investigation on Aluminum... Aluminum Extrusions from the People's Republic of China: Initiation of Antidumping Duty Investigation, 75...

  13. Türkiye’de 2001 Krizi Öncesi ve Sonrası Dönemler İçin Dış Borç Ekonomik Büyüme İlişkisi (1991–2010 External Debt Economıcal Growing Relationship For The Terms Before And After The 2001 Crysis İn Turkey (1991–2010

    Directory of Open Access Journals (Sweden)

    Süleyman ÇELİK

    2013-03-01

    Full Text Available In order to overcome financial restrictions and so achieve ahigher rate of growth, these countries often utilize external loans.External debts, which are initially taken as additional resources, canaccelerate the investments, economic growth and development whenthey are used efficiently. But if the external debts aren’t used efficientlyand the principal and interest payments of the external debts becomehigher than national income increase, it is required to get debts again topay debts and thereby it causes to increase external debt burden anddecrease the country welfare.Most empirical studies indicate a negative correlation betweenforeign debt and economic growth. In this study, the relationshipbetween economic growth and foreign debt is discussed in terms ofTurkish economy. Using time series data over the 1991–2010 period.The stationarity of time series data used in this study was tested by theADF test. Cointegration test which is developed by Johansen was usedin order to investigate long-term relationship between the variableswhich are stabilize at the same level or not. A least squares regressionanalysis and at last in order to obtain effect direction between thevariables Granger analysis are performed. Analysis show that foreigndebts in Turkey habe a negative effect on economical growth. Accordingto these results, domestic resources should finance the requiredinvestments and external resources should be reduced in order toincrease economic growth-in Turkey. Az gelişmiş ve gelişmekte olan ülkeler finansman kısıtlarınıaşarak yüksek büyüme hızlarına ulaşmak için dış borçlanmaya sık sıkbaşvurmaktadırlar. Başlangıçta ek bir kaynak olarak alınan dış borçlaretkin bir şekilde kullanıldıklarında yatırımları, ekonomik büyümeyi vekalkınmayı hızlandırabilmektedir. Fakat alınan dış borcun etkinkullanılmaması ve dış borcun anapara ve faiz ödemelerinin ulusal gelirartışından daha fazla artış g

  14. Modification of Sr on 4004 Aluminum Alloy

    Science.gov (United States)

    Guo, Erjun; Cao, Guojian; Feng, Yicheng; Wang, Liping; Wang, Guojun; Lv, Xinyu

    2013-05-01

    As a brazing foil, 4004 Al alloy has good welding performance. However, the high Si content decreases the plasticity of the alloy. To improve the plasticity of 4004 Al alloy and subsequently improve the productivity of 4004 Al foil or 434 composite foil, 4004 Al alloy was modified by Al-10%Sr master alloy. Modification effects of an additional amount of Sr, modification temperature, and holding time on 4004 aluminum alloy were studied by orthogonal design. The results showed that the greatest impact parameter of 4004 aluminum alloy modification was the additional amount of Sr, followed by holding time and modification temperature. The optimum modification parameters obtained by orthogonal design were as follows: Sr addition of 0.04%, holding time of 60 min, and modification temperature of 760°C. The effect of Sr addition on modification was analyzed in detail based on orthogonal results. With increasing of Sr addition, elongation of 4004 alloy increased at first, and decreased after reaching the maximum value.

  15. Aluminum limiter experiment in ST tokamak

    International Nuclear Information System (INIS)

    Meservey, E.B.; Bretz, N.; Dimock, D.L.; Hinnov, E.

    1976-01-01

    In order to investigate the effects of a light-element limiter on plasma parameters, aluminum rail limiters interchangeable with Mo rails were installed top, bottom, and outside directions in the ST tokamak. The inside limiter remained a fixed Mo rail. Compared with discharges produced immediately before and after with the usual Mo limiters, the ''aluminum'' discharges showed an increase of T/sub e/ (by factors of 1.4-2 near the center) and of energy confinement (by factors of 2 to 3 in el. energy/power input, depending on time of observation). H 2 and He discharges showed practically identical effects. In plasma composition, the Mo concentration dropped significantly, but Fe only slightly if at all; the Al concentration was about 3-5 percent (i.e., large compared to the heavier metals), whereas oxygen, about 4 to 8 percent to start with, dropped to insignificance, probably as a result of Al evaporation. The z/sub eff/ from resistivity increased 20-30 percent although the resistance dropped because of the higher T/sub e/. The improved T/sub e/ and energy confinement are thought to be the result of cumulative effects of more favorable radial current and power input distributions rather than direct energy losses by radiation

  16. The Anisotropy of Replicated Aluminum Foams

    Directory of Open Access Journals (Sweden)

    Eugeny L. Furman

    2014-01-01

    Full Text Available The replication casting process gives the open-cell aluminum foams that can be used in many industrial applications as well as in filtering technology. The essential requirement for filters is the uniformity of filtering degree which is defined by the minimal pore size. However the structure of replication castings is often inhomogeneous and the minimal pore radius is decreasing in the direction of melt infiltration. The objective of this investigation is to study the dynamics of melt impregnation of the porous medium by vacuum suction to identify the possibility of reducing the anisotropy. Theoretical data illustrate the processes at the boundary between melt and gas medium. The experiments were carried out using the replication aluminum samples produced according to commercial technology. It was found that the permeability coefficient varies throughout the height of castings. A method for estimation of pressure on the line of melt movement was proposed. The resistance of NaCl layer and circular vents of the mold causes the inhomogeneity of castings. Finally the ways of minimizing the anisotropy were offered.

  17. Solid Aluminum Borohydrides for Prospective Hydrogen Storage.

    Science.gov (United States)

    Dovgaliuk, Iurii; Safin, Damir A; Tumanov, Nikolay A; Morelle, Fabrice; Moulai, Adel; Černý, Radovan; Łodziana, Zbigniew; Devillers, Michel; Filinchuk, Yaroslav

    2017-12-08

    Metal borohydrides are intensively researched as high-capacity hydrogen storage materials. Aluminum is a cheap, light, and abundant element and Al 3+ can serve as a template for reversible dehydrogenation. However, Al(BH 4 ) 3 , containing 16.9 wt % of hydrogen, has a low boiling point, is explosive on air and has poor storage stability. A new family of mixed-cation borohydrides M[Al(BH 4 ) 4 ], which are all solid under ambient conditions, show diverse thermal decomposition behaviors: Al(BH 4 ) 3 is released for M=Li + or Na + , whereas heavier derivatives evolve hydrogen and diborane. NH 4 [Al(BH 4 ) 4 ], containing both protic and hydridic hydrogen, has the lowest decomposition temperature of 35 °C and yields Al(BH 4 ) 3 ⋅NHBH and hydrogen. The decomposition temperatures, correlated with the cations' ionic potential, show that M[Al(BH 4 ) 4 ] species are in the most practical stability window. This family of solids, with convenient and versatile properties, puts aluminum borohydride chemistry in the mainstream of hydrogen storage research, for example, for the development of reactive hydride composites with increased hydrogen content. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Spray Forming Aluminum - Final Report (Phase II)

    Energy Technology Data Exchange (ETDEWEB)

    D. D. Leon

    1999-07-08

    The U.S. Department of Energy - Office of Industrial Technology (DOE) has an objective to increase energy efficient and enhance competitiveness of American metals industries. To support this objective, ALCOA Inc. entered into a cooperative program to develop spray forming technology for aluminum. This Phase II of the DOE Spray Forming Program would translate bench scale spray forming technology into a cost effective world class process for commercialization. Developments under DOE Cooperative Agreement No. DE-FC07-94ID13238 occurred during two time periods due to budgetary constraints; April 1994 through September 1996 and October 1997 and December 1998. During these periods, ALCOA Inc developed a linear spray forming nozzle and specific support processes capable of scale-up for commercial production of aluminum sheet alloy products. Emphasis was given to alloys 3003 and 6111, both being commercially significant alloys used in the automotive industry. The report reviews research performed in the following areas: Nozzel Development, Fabrication, Deposition, Metal Characterization, Computer Simulation and Economics. With the formation of a Holding Company, all intellectual property developed in Phases I and II of the Project have been documented under separate cover for licensing to domestic producers.

  19. Excited state electron affinity calculations for aluminum

    Science.gov (United States)

    Hussein, Adnan Yousif

    2017-08-01

    Excited states of negative aluminum ion are reviewed, and calculations of electron affinities of the states (3s^23p^2)^1D and (3s3p^3){^5}{S}° relative to the (3s^23p)^2P° and (3s3p^2)^4P respectively of the neutral aluminum atom are reported in the framework of nonrelativistic configuration interaction (CI) method. A priori selected CI (SCI) with truncation energy error (Bunge in J Chem Phys 125:014107, 2006) and CI by parts (Bunge and Carbó-Dorca in J Chem Phys 125:014108, 2006) are used to approximate the valence nonrelativistic energy. Systematic studies of convergence of electron affinity with respect to the CI excitation level are reported. The calculated value of the electron affinity for ^1D state is 78.675(3) meV. Detailed Calculations on the ^5S°c state reveals that is 1216.8166(3) meV below the ^4P state.

  20. Molten aluminum alloy fuel fragmentation experiments

    International Nuclear Information System (INIS)

    Gabor, J.D.; Purviance, R.T.; Cassulo, J.C.; Spencer, B.W.

    1992-01-01

    Experiments were conducted in which molten aluminum alloys were injected into a 1.2 m deep pool of water. The parameters varied were (i) injectant material (8001 aluminum alloy and 12.3 wt% U-87.7 wt% Al), (ii) melt superheat (O to 50 K), (iii) water temperature (313, 343 and 373 K) and (iv) size and geometry of the pour stream (5, 10 and 20 mm diameter circular and 57 mm annular). The pour stream fragmentation was dominated by surface tension with large particles (∼30 mm) being formed from varicose wave breakup of the 10-mm circular pours and from the annular flow off a 57 mm diameter tube. The fragments produced by the 5 mm circular et were smaller (∼ mm), and the 20 mm jet which underwent sinuous wave breakup produced ∼100 mm fragments. The fragments froze to form solid particles in 313 K water, and when the water was ≥343 K, the melt fragments did not freeze during their transit through 1.2 m of water

  1. High strength corrosion-resistant zirconium aluminum alloys

    International Nuclear Information System (INIS)

    Schulson, E.M.; Cameron, D.J.

    1976-01-01

    A zirconium-aluminum alloy is described possessing superior corrosion resistance and mechanical properties. This alloy, preferably 7.5-9.5 wt% aluminum, is cast, worked in the Zr(Al)-Zr 2 Al region, and annealed to a substantially continuous matrix of Zr 3 Al. (E.C.B.)

  2. Selenium Adsorption To Aluminum-Based Water Treatment Residuals

    Science.gov (United States)

    Aluminum-based water treatment residuals (WTR) can adsorb water-and soil-borne P, As(V), As(III), and perchlorate, and may be able to adsorb excess environmental selenium. WTR, clay minerals, and amorphous aluminum hydroxide were shaken for 24 hours in selenate or selenite solut...

  3. Evaluation of microstructure of A356 aluminum alloy casting ...

    Indian Academy of Sciences (India)

    The objective of this investigation was to evaluate the effect of vibrations (during solidification) on the metallurgical properties of A356 aluminum casting. Mechanical vibrations were applied to A356 aluminum alloy through set up. A356 melt has been subjected to mechanical vibration with the frequency range from 0 to 400 ...

  4. Aluminum and iron contents in phosphate treated swamp rice farm ...

    African Journals Online (AJOL)

    In 2006 aluminum and iron contents were determined in phosphate treated swamp rice farm of Mbiabet, Akwa Ibom State. The objectives were to determine the aluminum and iron contents, the effect of drying, phosphate and lime application in an acid sulphate soil grown to rice in Nigeria. The soil samples used were ...

  5. Cadmium plated steel caps seal anodized aluminum fittings

    Science.gov (United States)

    Padden, J.

    1971-01-01

    Cadmium prevents fracturing of hard anodic coating under torquing to system specification requirements, prevents galvanic coupling, and eliminates need for crush washers, which, though commonly used in industry, do not correct leakage problem experienced when anodized aluminum fittings and anodized aluminum cap assemblies are joined.

  6. exploration the extrudability of aluminum matrix composite (lm6/tic)

    African Journals Online (AJOL)

    lanez

    2017-11-24

    Nov 24, 2017 ... Aluminum matrix composites (LM6/TiC) is a mix of excellent properties of aluminum casting alloy (LM6), and particles of (TiC) which make it the first choice in many applications like airplane and marine industries. During this research the extrudability and mechanical specifications of this composite ...

  7. An improved stress corrosion test medium for aluminum alloys

    Science.gov (United States)

    Humphries, T. S.; Coston, J. E.

    1981-01-01

    A laboratory test method that is only mildly corrosive to aluminum and discriminating for use in classifying the stress corrosion cracking resistance of aluminum alloys is presented along with the method used in evaluating the media selected for testing. The proposed medium is easier to prepare and less expensive than substitute ocean water.

  8. Melting, growth, and faceting of lead precipitates in aluminum

    DEFF Research Database (Denmark)

    Gråbæk, L.; Bohr, J.; Andersen, H.H.

    1992-01-01

    Aluminum single crystals cut in the direction were implanted with 2 x 10(20) m-2 Pb+ ions at 75 or 150 keV. The implanted insoluble lead precipitated as epitaxially oriented crystallites in the aluminum matrix. The precipitates were studied by x-ray diffraction at Riso, DESY, and Brookhaven...

  9. A melt refining method for uranium-contaminated aluminum

    International Nuclear Information System (INIS)

    Uda, T.; Iba, H.; Hanawa, K.

    1986-01-01

    Melt refining of uranium-contaminated aluminum which has been difficult to decontaminate because of the high reactivity of aluminum, was experimentally studied. Samples of contaminated aluminum and its alloys were melted after adding various halide fluxes at various melting temperatures and various melting times. Uranium concentration in the resulting ingots was determined. Effective flux compositions were mixtures of chlorides and fluorides, such as LiF, KCl, and BaCl 2 , at a fluoride/chloride mole ratio of 1 to 1.5. The removal of uranium from aluminum (the ''decontamination effect'') increased with decreasing melting temperature, but the time allowed for reaction had little influence. Pure aluminum was difficult to decontaminate from uranium; however, uranium could be removed from alloys containing magnesium. This was because the activity of the aluminum was decreased by formation of the intermetallic compound Al-Mg. With a flux of LiF-KCl-BaCl 2 and a temperature of 800 0 C, uranium added to give an initial concentration of 500 ppm was removed from a commercial alloy of aluminum, A5056, which contains 5% magnesium, to a final concentration of 0.6 ppm, which is near that in the initial aluminum alloy

  10. Method of forming aluminum oxynitride material and bodies formed by such methods

    Science.gov (United States)

    Bakas, Michael P [Ammon, ID; Lillo, Thomas M [Idaho Falls, ID; Chu, Henry S [Idaho Falls, ID

    2010-11-16

    Methods of forming aluminum oxynitride (AlON) materials include sintering green bodies comprising aluminum orthophosphate or another sacrificial material therein. Such green bodies may comprise aluminum, oxygen, and nitrogen in addition to the aluminum orthophosphate. For example, the green bodies may include a mixture of aluminum oxide, aluminum nitride, and aluminum orthophosphate or another sacrificial material. Additional methods of forming aluminum oxynitride (AlON) materials include sintering a green body including a sacrificial material therein, using the sacrificial material to form pores in the green body during sintering, and infiltrating the pores formed in the green body with a liquid infiltrant during sintering. Bodies are formed using such methods.

  11. Functional aluminum alloys for ultra high vacuum use

    International Nuclear Information System (INIS)

    Kato, Yutaka; Tsukamoto, Kenji; Isoyama, Eizo

    1985-01-01

    Ultra high vacuum systems made of aluminum alloys are actively developed. The reasons for using aluminum alloys are low residual radioactivity, light weight, good machinability, good thermal conductivity, non-magnetism. The important function required for ultra high vacuum materials is low outgassing rate, but surface gas on ordinary aluminum is much. Then the research on aluminum surface structure with low outgassing rate has been made and the special extrusion method, that is, extrusion method with the conditions of preventing air from entering inside of pipe and of taking in mixture gas of Ar + O 2 , was developed. 6063 alloy obtained by special extrusion method showed low outgassing rate (2 x 10 -13 Torr. 1/s. cm 2 ) by only 150 deg C, 24 h baking. For the future it will be important to develop aluminum alloys with low dynamic outgassing rate as well as low static outgassing rate. (author)

  12. The crystallization processes in the aluminum particles production technology

    Directory of Open Access Journals (Sweden)

    Arkhipov Vladimir

    2015-01-01

    Full Text Available The physical and mathematical model of the crystallization process of liquid aluminum particles in the spray-jet of the ejection-type atomizer was proposed. The results of mathematical modeling of two-phase flow in the spray-jet and the crystallization process of fluid particles are given. The influence of the particle size, of the flow rate and the stagnation temperature gas in the ranges of industrial technology implemented for the production of powders aluminum of brands ASD, on the crystallization characteristics were investigated. The approximations of the characteristics of the crystallization process depending on the size of the aluminum particles on the basis of two approaches to the mathematical description of the process of crystallization of aluminum particles were obtained. The results allow to optimize the process parameters of ejection-type atomizer to produce aluminum particles with given morphology.

  13. Reuse of Aluminum Dross as an Engineered Product

    Science.gov (United States)

    Dai, Chen; Apelian, Diran

    To prevent the leaching of landfilled aluminum dross waste and save the energy consumed by recovering metallic aluminum from dross, aluminum dross is reused as an engineering product directly rather than "refurbished" ineffectively. The concept is to reduce waste and to reuse. Two kinds of aluminum dross from industrial streams were selected and characterized. We have shown that dross can be applied directly, or accompanied with a simple conditioning process, to manufacture refractory components. Dross particles below 50 mesh are most effective. Mechanical property evaluations revealed the possibility for dross waste to be utilized as filler in concrete, resulting in up to 40% higher flexural strength and 10% higher compressive strength compared to pure cement, as well as cement with sand additions. The potential usage of aluminum dross as a raw material for such engineering applications is presented and discussed.

  14. Superconducting structure with layers of niobium nitride and aluminum nitride

    International Nuclear Information System (INIS)

    Murduck, J.M.; Lepetre, Y.J.; Schuller, I.K.; Ketterson, J.B.

    1989-01-01

    A superconducting structure is formed by depositing alternate layers of aluminum nitride and niobium nitride on a substrate. Deposition methods include dc magnetron reactive sputtering, rf magnetron reactive sputtering, thin-film diffusion, chemical vapor deposition, and ion-beam deposition. Structures have been built with layers of niobium nitride and aluminum nitride having thicknesses in a range of 20 to 350 Angstroms. Best results have been achieved with films of niobium nitride deposited to a thickness of approximately 70 Angstroms and aluminum nitride deposited to a thickness of approximately 20 Angstroms. Such films of niobium nitride separated by a single layer of aluminum nitride are useful in forming Josephson junctions. Structures of 30 or more alternating layers of niobium nitride and aluminum nitride are useful when deposited on fixed substrates or flexible strips to form bulk superconductors for carrying electric current. They are also adaptable as voltage-controlled microwave energy sources. 8 figs

  15. Achieving Carbon Neutrality in the Global Aluminum Industry

    Science.gov (United States)

    Das, Subodh

    2012-02-01

    In the 21st century, sustainability is widely regarded as the new corporate culture, and leading manufacturing companies (Toyota, GE, and Alcoa) and service companies (Google and Federal Express) are striving towards carbon neutrality. The current carbon footprint of the global aluminum industry is estimated at 500 million metric tonnes carbon dioxide equivalent (CO2eq), representing about 1.7% of global emissions from all sources. For the global aluminum industry, carbon neutrality is defined as a state where the total "in-use" CO2eq saved from all products in current use, including incremental process efficiency improvements, recycling, and urban mining activities, equals the CO2eq expended to produce the global output of aluminum. This paper outlines an integrated and quantifiable plan for achieving "carbon neutrality" in the global aluminum industry by advocating five actionable steps: (1) increase use of "green" electrical energy grid by 8%, (2) reduce process energy needs by 16%, (3) deploy 35% of products in "in-use" energy saving applications, (4) divert 6.1 million metric tonnes/year from landfills, and (5) mine 4.5 million metric tonnes/year from aluminum-rich "urban mines." Since it takes 20 times more energy to make aluminum from bauxite ore than to recycle it from scrap, the global aluminum industry could set a reasonable, self-imposed energy/carbon neutrality goal to incrementally increase the supply of recycled aluminum by at least 1.05 metric tonnes for every tonne of incremental production via primary aluminum smelter capacity. Furthermore, the aluminum industry can and should take a global leadership position by actively developing internationally accepted and approved carbon footprint credit protocols.

  16. Synthesis of Aluminum-Aluminum Nitride Nanocomposites by a Gas-Liquid Reaction II. Microstructure and Mechanical Properties

    Science.gov (United States)

    Borgonovo, Cecilia; Makhlouf, Makhlouf M.

    2016-04-01

    In situ fabrication of the reinforcing particles in the metal matrix is an answer to many of the challenges encountered in manufacturing aluminum matrix nanocomposites. In this method, the nanoparticles are formed directly within the melt by means of a chemical reaction between a specially designed aluminum alloy and a gas. In this publication, we describe a process for synthesizing aluminum-aluminum nitride nanocomposites by reacting a nitrogen-containing gas with a molten aluminum-lithium alloy. We quantify the effect of the process parameters on the average particle size and particle distribution, as well as on the tendency of the particles to cluster in the alloy matrix, is quantified. Also in this publication, we present the measured room temperature and elevated temperature tensile properties of the nanocomposite material as well as its measured room temperature impact toughness.

  17. Behaviour of aluminum foam under fire conditions

    Directory of Open Access Journals (Sweden)

    J. Grabian

    2008-07-01

    Full Text Available Taking into account fire-protection requirements it is advantageous for aluminum foam, after melting at a temperature considerably exceeding the melting point, to have a structure of discontinuous suspension of solid inclusions to liquid metal instead of liquid consistency. Continuity of the suspension depends on the solid phase content. The boundary value of the phase determined by J. Śleziona, above which the suspension becomes discontinuous, is provided by the formula (1. Figure 1 presents the relationship graphically. Boundary values of the vs content resulting from the above relationship is too low, taking into account the data obtained from the technology of suspension composites [4]. Therefore, based on the structure assumed for the suspension shown in Figure 2 these authors proposed another way of determining the contents, the value of which is determined by the relationship (3 [5].For purposes of the experimental study presented in the paper two foams have been molten: a commercially available one, made by aluminum foaming with titanium hydride, and a foam manufactured in the Marine Materials Plant of the Maritime University of Szczecin by blowing the AlSi7 +20% SiC composite with argon. Macrophotographs of foam cross-sections are shown in Figure 3. The foams have been molten in the atmosphere of air at a temperature of 750ºC. The products of melting are presented in Figure 4. It appears that molten aluminum foam may have no liquid consistency, being unable to flow, which is a desired property from the point of view of fire-protection. The above feature of the molten foam results from the fact that it may be a discontinuous suspension of solid particles in a liquid metal. The suspended particles may be solid particles of the composite that served for making the foam or oxide membranes formed on extended metal surface of the bubbles included in the foam. The desired foam ability to form a discontinuous suspension after melting may be

  18. Energy analysis of hydrogen and electricity production from aluminum-based processes

    International Nuclear Information System (INIS)

    Wang, Huizhi; Leung, Dennis Y.C.; Leung, Michael K.H.

    2012-01-01

    The aluminum energy conversion processes have been characterized to be carbon-free and sustainable. However, their applications are restrained by aluminum production capacity as aluminum is never found as a free metal on the earth. This study gives an assessment of typical aluminum-based energy processes in terms of overall energy efficiency and cost. Moreover, characteristics associated with different processes are identified. Results in this study indicate the route from which aluminum is produced can be a key factor in determining the efficiency and costs. Besides, the aluminum–air battery provides a more energy-efficient manner for the conversion of energy stored in primary aluminum and recovered aluminum from products compared to aluminum-based hydrogen production, whereas the aluminum-based hydrogen production gives a more energy-efficient way of utilizing energy stored in secondary aluminum or even scrap aluminum.

  19. Aluminum and aluminum/silicon coatings on ferritic steels by CVD-FBR technology

    International Nuclear Information System (INIS)

    Perez, F.J.; Hierro, M.P.; Trilleros, J.A.; Carpintero, M.C.; Sanchez, L.; Bolivar, F.J.

    2006-01-01

    The use of chemical vapor deposition by fluidized bed reactors (CVD-FBR) offers some advantages in comparison to other coating techniques such as pack cementation, because it allows coating deposition at lower temperatures than pack cementation and at atmospheric pressure without affecting the mechanical properties of material due to heat treatments of the bulk during coating process. Aluminum and aluminum/silicon coatings have been obtained on two different ferritics steels (P-91 and P-92). The coatings were analyzed using several techniques like SEM/EDX and XRD. The results indicated that both coatings were form by Fe 2 Al 5 intermetallic compound, and in the co-deposition the Si was incorporated to the Fe 2 Al 5 structure in small amounts

  20. Environmental fatigue in aluminum-lithium alloys

    Science.gov (United States)

    Piascik, Robert S.

    1992-01-01

    Aluminum-lithium alloys exhibit similar environmental fatigue crack growth characteristics compared to conventional 2000 series alloys and are more resistant to environmental fatigue compared to 7000 series alloys. The superior fatigue crack growth behavior of Al-Li alloys 2090, 2091, 8090, and 8091 is due to crack closure caused by tortuous crack path morphology and crack surface corrosion products. At high R and reduced closure, chemical environment effects are pronounced resulting in accelerated near threshold da/dN. The beneficial effects of crack closure are minimized for small cracks resulting in rapid growth rates. Limited data suggest that the 'chemically small crack' effect, observed in other alloy system, is not pronounced in Al-Li alloys. Modeling of environmental fatigue in Al-Li-Cu alloys related accelerated fatigue crack growth in moist air and salt water to hydrogen embrittlement.

  1. Analysis and Nanomold Design for Aluminum Nanoimprinting

    Directory of Open Access Journals (Sweden)

    Te-Hua Fang

    2014-11-01

    Full Text Available The nanoforging process and mechanism of pure aluminum samples is studied using molecular dynamics (MD simulations based on embedded atom method (EAM potential function. The effects of the forging temperature and the forging velocity are evaluated in terms of molecular trajectories, internal energy, and a radial distribution function. The simulation results clearly show that the internal energy of the workpiece exerted on it during the forging process have high energy with decreasing forging temperature ; however, with increasing forging velocity, the internal energy have higher energy. During the forging process, a special atomic structure in (011 and (0 slip planes was observed, and that represents the site of generation of dislocation and growth nucleation. When severe plastic deformation occurs, the density of the workpiece varied. The forged workpiece has similar distributions of atomic density after the loading for various forging temperatures and forging velocities.

  2. The aluminum anode in deep ocean environments

    International Nuclear Information System (INIS)

    Schreiber, C.F.

    1989-01-01

    Results of field and mini-plant studies are presented for A1 + 0.045% Hg + 0.1% Si + 0.45% Zn* and A1 + 0.015% In + 0.1% Si + 3% Zn** anodes in varying depths of natural seawater. Current capacity and potential information are presented. In addition to information on anode current capacity and potential, polarization curves were obtained on both aluminum alloys using potentiostatic techniques at a simulated ocean depth of 1090 ft. (332 m). These data were compared with similarly run experiments at ocean surface pressures. As a basis of comparison, zinc anodes (U.S. Mil-A-18001H) were included as a companion alloy. Information gained on zinc is sufficient to accurately represent the behavior of this alloy. Results conclude that conditions of high pressure (and low temperature) associated with the alloys under test did not alter their galvanic behavior from that noted at the ocean surface

  3. Modeling aluminum-air battery systems

    Science.gov (United States)

    Savinell, R. F.; Willis, M. S.

    The performance of a complete aluminum-air battery system was studied with a flowsheet model built from unit models of each battery system component. A plug flow model for heat transfer was used to estimate the amount of heat transferred from the electrolyte to the air stream. The effect of shunt currents on battery performance was found to be insignificant. Using the flowsheet simulator to analyze a 100 cell battery system now under development demonstrated that load current, aluminate concentration, and electrolyte temperature are dominant variables controlling system performance. System efficiency was found to decrease as both load current and aluminate concentration increases. The flowsheet model illustrates the interdependence of separate units on overall system performance.

  4. Low energy helium implantation of aluminum

    International Nuclear Information System (INIS)

    Wilson, K.L.; Thomas, G.J.

    1976-02-01

    A series of 20 keV He + implantations was conducted on well-annealed MARZ grade aluminum at fluxes of 6 x 10 14 and 6 x 10 13 He + /cm 2 sec. Three distinct, temperature dependent He release mechanisms were found by He re-emission measurements during implantation, and by subsequent SEM and TEM investigations. At 0.08 of the melting temperature (T/sub m/) gas re-emission rose smoothly after a critical dose of 3 x 10 17 He + /cm 2 , with extensive blistering. The intermediate temperature range (approximately 0.3 T/sub m/) was characterized by repeated flake exfoliation and bursts of He after a dose of 3 x 10 17 He + /cm 2 . Rapid He evolution, with hole formation was found above 0.7 T/sub m/. No significant differences in either gas re-emission or surface deformation were found between the two fluxes employed

  5. Diode laser welding of aluminum to steel

    International Nuclear Information System (INIS)

    Santo, Loredana; Quadrini, Fabrizio; Trovalusci, Federica

    2011-01-01

    Laser welding of dissimilar materials was carried out by using a high power diode laser to join aluminum to steel in a butt-joint configuration. During testing, the laser scan rate was changed as well as the laser power: at low values of fluence (i.e. the ratio between laser power and scan rate), poor joining was observed; instead at high values of fluence, an excess in the material melting affected the joint integrity. Between these limiting values, a good aesthetics was obtained; further investigations were carried out by means of tensile tests and SEM analyses. Unfortunately, a brittle behavior was observed for all the joints and a maximum rupture stress about 40 MPa was measured. Apart from the formation of intermeltallic phases, poor mechanical performances also depended on the chosen joining configuration, particularly because of the thickness reduction of the seam in comparison with the base material.

  6. Solidification paths of multicomponent monotectic aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Mirkovic, Djordje; Groebner, Joachim [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Street 42, D-38678 Clausthal-Zellerfeld (Germany); Schmid-Fetzer, Rainer [Clausthal University of Technology, Institute of Metallurgy, Robert-Koch-Street 42, D-38678 Clausthal-Zellerfeld (Germany)], E-mail: schmid-fetzer@tu-clausthal.de

    2008-10-15

    Solidification paths of three ternary monotectic alloy systems, Al-Bi-Zn, Al-Sn-Cu and Al-Bi-Cu, are studied using thermodynamic calculations, both for the pertinent phase diagrams and also for specific details concerning the solidification of selected alloy compositions. The coupled composition variation in two different liquids is quantitatively given. Various ternary monotectic four-phase reactions are encountered during solidification, as opposed to the simple binary monotectic, L' {yields} L'' + solid. These intricacies are reflected in the solidification microstructures, as demonstrated for these three aluminum alloy systems, selected in view of their distinctive features. This examination of solidification paths and microstructure formation may be relevant for advanced solidification processing of multicomponent monotectic alloys.

  7. Abnormal Grain Growth Suppression in Aluminum Alloys

    Science.gov (United States)

    Hales, Stephen J. (Inventor); Claytor, Harold Dale (Inventor); Alexa, Joel A. (Inventor)

    2015-01-01

    The present invention provides a process for suppressing abnormal grain growth in friction stir welded aluminum alloys by inserting an intermediate annealing treatment ("IAT") after the welding step on the article. The IAT may be followed by a solution heat treatment (SHT) on the article under effectively high solution heat treatment conditions. In at least some embodiments, a deformation step is conducted on the article under effective spin-forming deformation conditions or under effective superplastic deformation conditions. The invention further provides a welded article having suppressed abnormal grain growth, prepared by the process above. Preferably the article is characterized with greater than about 90% reduction in area fraction abnormal grain growth in any friction-stir-welded nugget.

  8. Aluminum-catalyzed silicon nanowires: Growth methods, properties, and applications

    Energy Technology Data Exchange (ETDEWEB)

    Hainey, Mel F.; Redwing, Joan M. [Department of Materials Science and Engineering, Materials Research Institute, The Pennsylvania State University, University Park, Pennsylvania 16802 (United States)

    2016-12-15

    Metal-mediated vapor-liquid-solid (VLS) growth is a promising approach for the fabrication of silicon nanowires, although residual metal incorporation into the nanowires during growth can adversely impact electronic properties particularly when metals such as gold and copper are utilized. Aluminum, which acts as a shallow acceptor in silicon, is therefore of significant interest for the growth of p-type silicon nanowires but has presented challenges due to its propensity for oxidation. This paper summarizes the key aspects of aluminum-catalyzed nanowire growth along with wire properties and device results. In the first section, aluminum-catalyzed nanowire growth is discussed with a specific emphasis on methods to mitigate aluminum oxide formation. Next, the influence of growth parameters such as growth temperature, precursor partial pressure, and hydrogen partial pressure on nanowire morphology is discussed, followed by a brief review of the growth of templated and patterned arrays of nanowires. Aluminum incorporation into the nanowires is then discussed in detail, including measurements of the aluminum concentration within wires using atom probe tomography and assessment of electrical properties by four point resistance measurements. Finally, the use of aluminum-catalyzed VLS growth for device fabrication is reviewed including results on single-wire radial p-n junction solar cells and planar solar cells fabricated with nanowire/nanopyramid texturing.

  9. Strengthening of Aluminum Wires Treated with A206/Alumina Nanocomposites.

    Science.gov (United States)

    Florián-Algarín, David; Marrero, Raúl; Li, Xiaochun; Choi, Hongseok; Suárez, Oscar Marcelo

    2018-03-10

    This study sought to characterize aluminum nanocomposite wires that were fabricated through a cold-rolling process, having potential applications in TIG (tungsten inert gas) welding of aluminum. A206 (Al-4.5Cu-0.25Mg) master nanocomposites with 5 wt % γAl₂O₃ nanoparticles were first manufactured through a hybrid process combining semi-solid mixing and ultrasonic processing. A206/1 wt % γAl₂O₃ nanocomposites were fabricated by diluting the prepared master nanocomposites with a monolithic A206 alloy, which was then added to a pure aluminum melt. The fabricated Al-γAl₂O₃ nanocomposite billet was cold-rolled to produce an Al nanocomposite wire with a 1 mm diameter and a transverse area reduction of 96%. Containing different levels of nanocomposites, the fabricated samples were mechanically and electrically characterized. The results demonstrate a significantly higher strength of the aluminum wires with the nanocomposite addition. Further, the addition of alumina nanoparticles affected the wires' electrical conductivity compared with that of pure aluminum and aluminum-copper alloys. The overall properties of the new material demonstrate that these wires could be an appealing alternative for fillers intended for aluminum welding.

  10. Painting rusted steel: The role of aluminum phosphosilicate

    International Nuclear Information System (INIS)

    Roselli, S.N.; Amo, B. del; Carbonari, R.O.; Di Sarli, A.R.; Romagnoli, R.

    2013-01-01

    Highlights: •Aluminum phosphosilicate is an acid pigment which could act as mild phosphating agent. •Aluminum phosphosilicate can phosphatize iron oxides on rusted surfaces. •Aluminum phosphosilicate is compatible with acid binders. •Aluminum phosphosilicate could replace chromate in complete painting schemes. •Aluminum phosphosilicate primers improve paints adhesion on rusted surfaces. -- Abstract: Surface preparation is a key factor for the adequate performance of a paint system. The aim of this investigation is to employ a wash-primer to accomplish the chemical conversion of rusted surface when current cleaning operations are difficult to carry out. The active component of the wash-primer was aluminum phosphosilicate whose electrochemical behavior and the composition of the generated protective layer, both, were studied by electrochemical techniques and scanning electron microscopy (SEM), respectively. Primed rusted steel panels were coated with an alkyd system to perform accelerated tests in the salt spray chamber and electrochemical impedance measurements (EIS). These tests were conducted in parallel with a chromate wash primer and the same alkyd system. Results showed that the wash-primer containing aluminum phosphosilicate could be used satisfactorily to paint rusted steel exhibiting a similar performance to the chromate primer

  11. Application of accelerator mass spectrometry in aluminum metabolism studies

    International Nuclear Information System (INIS)

    Meirav, O.; Vetterli, D.; Johnson, R.R.; Sutton, R.A.L.; Walker, V.R.; Halabe, A.; Fink, D.; Middleton, R.; Klein, J.

    1990-06-01

    The recent recognition that aluminum causes toxicity in uremic patients and may be associated with Alzheimer's disease has stimulated many studies of its biochemical effects. However, such studies were hampered by the lack of a suitable tracer. In a novel experiment, we have applied the new technique of accelerator mass spectrometry to investigate aluminum kinetics in rats, using as a marker the long-lived isotope 26 Al. We present the first aluminum kinetic model for a biological system. The results clearly demonstrate the advantage this technique holds for isotope tracer studies in animals as well as humans. (Author) (24 refs., 3 figs.)

  12. Application of accelerator mass spectrometry in aluminum metabolism studies

    Energy Technology Data Exchange (ETDEWEB)

    Meirav, O; Vetterli, D; Johnson, R R [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics; Sutton, R A.L.; Walker, V R; Halabe, A [British Columbia U.iv., Vancouver, BC (Canada). Dept. of Medicine; Fink, D; Middleton, R; Klein, J [Pennsylvania Univ., Philadelphia, PA (United States). Dept. of Physics

    1990-06-01

    The recent recognition that aluminum causes toxicity in uremic patients and may be associated with Alzheimer`s disease has stimulated many studies of its biochemical effects. However, such studies were hampered by the lack of a suitable tracer. In a novel experiment, we have applied the new technique of accelerator mass spectrometry to investigate aluminum kinetics in rats, using as a marker the long-lived isotope {sup 26}Al. We present the first aluminum kinetic model for a biological system. The results clearly demonstrate the advantage this technique holds for isotope tracer studies in animals as well as humans. (Author) (24 refs., 3 figs.).

  13. New Process for Grain Refinement of Aluminum. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Joseph A. Megy

    2000-09-22

    A new method of grain refining aluminum involving in-situ formation of boride nuclei in molten aluminum just prior to casting has been developed in the subject DOE program over the last thirty months by a team consisting of JDC, Inc., Alcoa Technical Center, GRAS, Inc., Touchstone Labs, and GKS Engineering Services. The Manufacturing process to make boron trichloride for grain refining is much simpler than preparing conventional grain refiners, with attendant environmental, capital, and energy savings. The manufacture of boride grain refining nuclei using the fy-Gem process avoids clusters, salt and oxide inclusions that cause quality problems in aluminum today.

  14. Using Neural Networks to Predict the Hardness of Aluminum Alloys

    Directory of Open Access Journals (Sweden)

    B. Zahran

    2015-02-01

    Full Text Available Aluminum alloys have gained significant industrial importance being involved in many of the light and heavy industries and especially in aerospace engineering. The mechanical properties of aluminum alloys are defined by a number of principal microstructural features. Conventional mathematical models of these properties are sometimes very complex to be analytically calculated. In this paper, a neural network model is used to predict the correlations between the hardness of aluminum alloys in relation to certain alloying elements. A backpropagation neural network is trained using a thorough dataset. The impact of certain elements is documented and an optimum structure is proposed.

  15. 75 FR 1596 - Grant of Authority for Subzone Status, Reynolds Packaging LLC (Aluminum Foil Liner Stock...

    Science.gov (United States)

    2010-01-12

    ... Status, Reynolds Packaging LLC (Aluminum Foil Liner Stock), Louisville, Kentucky Pursuant to its...-purpose subzone at the aluminum foil liner stock manufacturing and distribution facilities of Reynolds... manufacturing and distribution of aluminum foil liner stock and aluminum foil at the facilities of Reynolds...

  16. 77 FR 16987 - National Emission Standards for Hazardous Air Pollutants: Secondary Aluminum Production

    Science.gov (United States)

    2012-03-23

    ... National Emission Standards for Hazardous Air Pollutants: Secondary Aluminum Production AGENCY... for secondary aluminum production (77 FR 8576). The EPA is extending the deadline for written comments... from the Aluminum Association. The Aluminum Association has requested the extension in order to allow...

  17. 75 FR 57441 - Aluminum Extrusions From the People's Republic of China: Alignment of Final Countervailing Duty...

    Science.gov (United States)

    2010-09-21

    ... DEPARTMENT OF COMMERCE International Trade Administration [C-570-968] Aluminum Extrusions From the... countervailing duty investigation of aluminum extrusions from the People's Republic of China (PRC) with the final... antidumping duty investigations on aluminum extrusions from the PRC. See Aluminum Extrusions from the People's...

  18. 75 FR 69403 - Aluminum Extrusions From the People's Republic of China: Notice of Preliminary Determination of...

    Science.gov (United States)

    2010-11-12

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-967] Aluminum Extrusions From the... Commerce (``Department'') preliminarily determines that aluminum extrusions from the People's Republic of... of aluminum extrusions from the PRC filed in proper form by the Aluminum Extrusions Fair Trade...

  19. Crystallization of aluminum hydroxide in the aluminum-air battery: Literature review, crystallizer design and results of integrated system tests

    Science.gov (United States)

    Maimoni, A.

    1988-03-01

    The literature on aluminum trihydroxide crystallization is reviewed and the implications of crystallization on the design and performance of the aluminum-air battery are illustrated. Results of research on hydrargillite crystallization under battery operating conditions at Alcoa Laboratories, Alcan Kingston Laboratories, and Lawrence Livermore National Laboratory are summarized and are applied to the design of an electrolyte management system using lamella settlers for clarification of the electrolyte and product separation. The design principles were validated in a series of experiments that, for the first time in the aluminum-air program, demonstrated continuous operation of an integrated system consisting of cells, crystallizer, and a product-removal system.

  20. Water requirements of the aluminum industry

    Science.gov (United States)

    Conklin, Howard L.

    1956-01-01

    Aluminum is unique among metals in the way it is obtained from its ore. The first step is to produce alumina, a white powder that bears no resemblance to the bauxite from which it is derived or to the metallic aluminum to which it is reduced by electrolytic action in a second step. Each step requires a complete plant facility, and the plants may be adjacent or separated by as much as the width of the North American continent. Field investigations sf every alumina plant and reduction works in the United States were undertaken to determine the industry's water use. Detailed studies were made of process and plant layout so that a water balance could be made for each plant to determine not only the gross water intake but also an approximation of the consumptive use of water. Water requirements of alumina plants range from 0.28 to 1.10 gallons per pound of alumina; the average for the industry is 0.66 gallon. Water requirements of reduction works vary considerably more, ranging from 1.24 to 36.33 gallons per pound of aluminum, and average 14.62 gallons. All alumina plants in the United States derive alumina from bauxite by the Bayer process or by the Combination process, a modification of the Bayer process. Although the chemical process for obtaining alumina from bauxite is essentially the same at all plants, different procedures are employed to cool the sodium aluminate solution before it enters the precipitating tanks and to concentrate it by evaporation of some of the water in the solution. Where this evaporation takes place in a cooling tower, water in the solution is lost to the atmosphere as water vapor and so is used consumptively. In other plants, the quantity of solution in the system is controlled by evaporation in a multiple-effect evaporator where practically all vapor distilled out of the solution is condensed to water that may be reused. The latter method is used in all recently constructed alumina plants, and some older plants are replacing cooling towers

  1. HIGH ALUMINUM HLW GLASSES FOR HANFORD'S WTP

    International Nuclear Information System (INIS)

    Kruger, A.A.; Joseph, I.; Bowman, B.W.; Gan, H.; Kot, W.; Matlack, K.S.; Pegg, I.L

    2009-01-01

    The world's largest radioactive waste vitrification facility is now under construction at the United State Department of Energy's (DOE's) Hanford site. The Hanford Tank Waste Treatment and Immobilization Plant (WTP) is designed to treat nearly 53 million gallons of mixed hazardous and radioactive waste now residing in 177 underground storage tanks. This multi-decade processing campaign will be one of the most complex ever undertaken because of the wide chemical and physical variability of the waste compositions generated during the cold war era that are stored at Hanford. The DOE Office of River Protection (ORP) has initiated a program to improve the long-term operating efficiency of the WTP vitrification plants with the objective of reducing the overall cost of tank waste treatment and disposal and shortening the duration of plant operations. Due to the size, complexity and duration of the WTP mission, the lifecycle operating and waste disposal costs are substantial. As a result, gains in High Level Waste (HLW) and Low Activity Waste (LAW) waste loadings, as well as increases in glass production rate, which can reduce mission duration and glass volumes for disposal, can yield substantial overall cost savings. EnergySolutions and its long-term research partner, the Vitreous State Laboratory (VSL) of the Catholic University of America, have been involved in a multi-year ORP program directed at optimizing various aspects of the HLW and LAW vitrification flow sheets. A number of Hanford HLW streams contain high concentrations of aluminum, which is challenging with respect to both waste loading and processing rate. Therefore, a key focus area of the ORP vitrification process optimization program at EnergySolutions and VSL has been development of HLW glass compositions that can accommodate high Al 2 O 3 concentrations while maintaining high processing rates in the Joule Heated Ceramic Melters (JHCMs) used for waste vitrification at the WTP. This paper, reviews the

  2. Aluminum-rich mesoporous MFI - type zeolite single crystals

    DEFF Research Database (Denmark)

    Kustova, Marina; Kustov, Arkadii; Christensen, Christina Hviid

    2005-01-01

    Zeolitcs are crystalline materials, which are widely used as solid acid catalysts and supports in many industrial processes. Recently, mesoporous MFI-type zeolite single crystals were synthesized by use of carbon particles as a mesopore template and sodium aluminate as the aluminum Source....... With this technique, only zeolites with relatively low Al contents were reported (Si/Al ratio about 100). In this work, the preparation of aluminum-rich mesoporous MFI-type zeolite single crystals (Si/Al similar to 16-50) using aluminum isopropoxide as the aluminum Source is reported for the first time. All samples...... are characterized by X-ray powder diffraction (XRD), scanning electron microscopy (SEM), ammonia temperature programmed desorption (NH3-TPD), and N-2 adsorption measurements. The obtained zeolites combine the high crystallinity and the characteristic micropores of zeolites with an intracrystalline mesopore system...

  3. Investigation of the Precipitation Behavior in Aluminum Based Alloys

    KAUST Repository

    Khushaim, Muna S.

    2015-01-01

    A complete study examining the influence of common industrial heat treatment on the precipitation kinetics and phase transformations of complex aluminum alloy is performed. The qualitative evaluation results of the precipitation

  4. The solidification of aluminum production waste in geopolymer matrix

    Czech Academy of Sciences Publication Activity Database

    Perná, Ivana; Hanzlíček, Tomáš

    2014-01-01

    Roč. 84, DEC 1 (2014), s. 657-662 ISSN 0959-6526 Institutional support: RVO:67985891 Keywords : aluminum waste * solidification * recycling * geopolymer Subject RIV: DM - Solid Waste and Recycling Impact factor: 3.844, year: 2014

  5. PTFE-ALUMINUM films serve as neutral density filters

    Science.gov (United States)

    Burks, H. D.

    1966-01-01

    Polytetrafluoroethylene /PTFE/ films coated with aluminum films act as neutral density filters in the wavelength range 0.3 to 2.1 microns. These filters are effective in the calibration of photometric systems.

  6. Higher Strength, Lighter Weight Aluminum Spacecraft Structures, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This SBIR Phase I program proposes to develop a bulk processing technology for producing ultra fine grain (UFG) aluminum alloy structures. The goal is to demonstrate...

  7. Nanoengineered Superhydrophobic Surfaces of Aluminum with Extremely Low Bacterial Adhesivity

    NARCIS (Netherlands)

    Hizal, Ferdi; Rungraeng, Natthakan; Lee, Junghoon; Jun, Soojin; Busscher, Henk J.; van der Mei, Henny C.; Choi, Chang-Hwan

    2017-01-01

    Bacterial adhesion and biofilm formation on surfaces are troublesome in many industrial processes. Here, nanoporous and nanopillared aluminum surfaces were engineered by anodizing and postetching processes and made hydrophilic (using the inherent oxide layer) or hydrophobic (applying a Teflon

  8. Molten Triazolium Chloride Systems as New Aluminum Battery Electrolytes

    DEFF Research Database (Denmark)

    Vestergaard, B.; Bjerrum, Niels; Petrushina, Irina

    1993-01-01

    -170-degrees-C) depending on melt acidity and anode material. DMTC, being specifically adsorbed and reduced on the tungsten electrode surface, had an inhibiting effect on the aluminum reduction, but this effect was suppressed on the aluminum substrate. An electrochemical process with high current density (tens...... of milliamperes per square centimeter) was observed at 0.344 V on the acidic sodium tetrachloroaluminate background, involving a free triazolium radical mechanism. Molten DMTC-AlCl3 electrolytes are acceptable for battery performance and both the aluminum anode and the triazolium electrolyte can be used as active......The possibility of using molten mixtures of 1,4-dimethyl-1,2,4-triazolium chloride (DMTC) and aluminum chloride (AlCl3) as secondary battery electrolytes was studied, in some cases extended by the copresence of sodium chloride. DMTC-AlCl, mixtures demonstrated high specific conductivity in a wide...

  9. Failure Analysis of Alumina Reinforced Aluminum Microtruss and Tube Composites

    Science.gov (United States)

    Chien, Hsueh Fen (Karen)

    The energy absorption capacity of cellular materials can be dramatically increased by applying a structural coating. This thesis examined the failure mechanisms of alumina reinforced 3003 aluminum alloy microtrusses and tubes. Alumina coatings were produced by hard anodizing and by plasma electrolytic oxidation (PEO). The relatively thin and discontinuous oxide coating at the hinge acted as a localized weak spot which triggered a chain reaction of failure, including oxide fracture, oxide spallation, oxide penetration to the aluminum core and severe local plastic deformation of the core. For the PEO microtrusses, delamination occurred within the oxide coating resulting in a global strut buckling failure mode. A new failure mode for the anodized tubes was observed: (i) axisymmetric folding of the aluminum core, (ii) longitudinal fracture, and (iii) alumina pulverization. Overall, the alumina coating enhanced the buckling resistance of the composites, while the aluminum core supported the oxide during the damage propagation.

  10. Chemical milling solution produces smooth surface finish on aluminum

    Science.gov (United States)

    Lorenzen, H. C.

    1966-01-01

    Elementary sulfur mixed into a solution of caustic soda and salts produces an etchant which will chemically mill end-grain surfaces on aluminum plate. This composition results in the least amount of thickness variation and pitting.

  11. Study of Plasma Electrolytic Oxidation Coatings on Aluminum Composites

    Directory of Open Access Journals (Sweden)

    Leonid Agureev

    2018-06-01

    Full Text Available Coatings, with a thickness of up to 75 µm, were formed by plasma electrolytic oxidation (PEO under the alternating current electrical mode in a silicate-alkaline electrolyte on aluminum composites without additives and alloyed with copper (1–4.5%. The coatings’ structure was analyzed by scanning electron microscopy, X-ray microanalysis, X-ray photoelectron spectroscopy, nuclear backscattering spectrometry, and XRD analysis. The coatings formed for 60 min were characterized by excessive aluminum content and the presence of low-temperature modifications of alumina γ-Al2O3 and η-Al2O3. The coatings formed for 180 min additionally contained high-temperature corundum α-Al2O3, and aluminum inclusions were absent. The electrochemical behavior of coated composites and uncoated ones in 3% NaCl was studied. Alloyage of aluminum composites with copper increased the corrosion current density. Plasma electrolytic oxidation reduced it several times.

  12. Aluminum electroplating on steel from a fused bromide electrolyte

    Energy Technology Data Exchange (ETDEWEB)

    Prabhat K. Tripathy; Laura A. Wurth; Eric J. Dufek; Toni Y. Gutknecht; Natalie J. Gese; Paula Hahn; Steven M. Frank; Guy L. Frederickson; J. Stephen Herring

    2014-08-01

    A quaternary bromide bath (LiBr–KBr–CsBr–AlBr3) was used to electro-coat aluminum on steel substrates. The electrolytewas prepared by the addition of AlBr3 into the eutectic LiBr–KBr–CsBr melt. A smooth, thick, adherent and shiny aluminum coating could be obtained with 80 wt.% AlBr3 in the ternary melt. The SEM photographs of the coated surfaces suggest the formation of thick and dense coatings with good aluminum coverage. Both salt immersion and open circuit potential measurement suggested that the coatings did display a good corrosionresistance behavior. Annealing of the coated surfaces, prior to corrosion tests, suggested the robustness of the metallic aluminum coating in preventing the corrosion of the steel surfaces. Studies also indicated that the quaternary bromide plating bath can potentially provide a better aluminumcoating on both ferrous and non-ferrous metals, including complex surfaces/geometries.

  13. Fluorine in plants in the areas of Yugoslav aluminum factories

    Energy Technology Data Exchange (ETDEWEB)

    Ivos, J.; Ciszek, H.; Rezek, A.; Marjanovic, L.

    1970-01-01

    Distribution of fluorine in the areas around aluminum production facilities was investigated. The plants in areas around the factories did indeed show increased levels of fluorine. Distribution patterns were found to be affected by wind and precipitation patterns.

  14. Super Polishing of Aluminum 6061-T6 Mirrors, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — An innovative 2D super-polishing process for Aluminum 6061-T6 planar mirrors which removes diamond point turning (DPT) grooves and attains rms surface finishes below...

  15. The Alternate Technology Program for Aluminum Research Reactor Spent Fuel

    International Nuclear Information System (INIS)

    Barlow, M.W.

    1998-01-01

    This paper describes the program for disposition of aluminum-based RRSNF, including the requirements for road-ready dry storage and repository disposal and the criteria to be considered in selecting among the alternative technologies

  16. DGT measurement of dissolved aluminum species in waters

    DEFF Research Database (Denmark)

    Panther, Jared G.; Bennett, William W.; Teasdale, Peter R.

    2012-01-01

    Aluminum is acutely toxic, and elevated concentrations of dissolved Al can have detrimental effects on both terrestrial and aquatic ecosystems. Robust analytical methods that can determine environmentally relevant Al fractions accurately and efficiently are required by the environmental monitoring...

  17. Reaction of Aluminum with Water to Produce Hydrogen - 2010 Update

    Energy Technology Data Exchange (ETDEWEB)

    Petrovic, John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Thomas, George [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2011-06-01

    A Study of Issues Related to the Use of Aluminum for On-Board Vehicular Hydrogen Storage The purpose of this White Paper is to describe and evaluate the potential of aluminum-water reactions for the production of hydrogen for on-board hydrogen-powered vehicle applications. Although the concept of reacting aluminum metal with water to produce hydrogen is not new, there have been a number of recent claims that such aluminum-water reactions might be employed to power fuel cell devices for portable applications such as emergency generators and laptop computers, and might even be considered for possible use as the hydrogen source for fuel cell-powered vehicles.

  18. Aluminum tolerance association mapping in triticale

    Directory of Open Access Journals (Sweden)

    Niedziela Agnieszka

    2012-02-01

    Full Text Available Abstract Background Crop production practices and industrialization processes result in increasing acidification of arable soils. At lower pH levels (below 5.0, aluminum (Al remains in a cationic form that is toxic to plants, reducing growth and yield. The effect of aluminum on agronomic performance is particularly important in cereals like wheat, which has promoted the development of programs directed towards selection of tolerant forms. Even in intermediately tolerant cereals (i.e., triticale, the decrease in yield may be significant. In triticale, Al tolerance seems to be influenced by both wheat and rye genomes. However, little is known about the precise chromosomal location of tolerance-related genes, and whether wheat or rye genomes are crucial for the expression of that trait in the hybrid. Results A mapping population consisting of 232 advanced breeding triticale forms was developed and phenotyped for Al tolerance using physiological tests. AFLP, SSR and DArT marker platforms were applied to obtain a sufficiently large set of molecular markers (over 3000. Associations between the markers and the trait were tested using General (GLM and Multiple (MLM Linear Models, as well as the Statistical Machine Learning (SML approach. The chromosomal locations of candidate markers were verified based on known assignments of SSRs and DArTs or by using genetic maps of rye and triticale. Two candidate markers on chromosome 3R and 9, 15 and 11 on chromosomes 4R, 6R and 7R, respectively, were identified. The r2 values were between 0.066 and 0.220 in most cases, indicating a good fit of the data, with better results obtained with the GML than the MLM approach. Several QTLs on rye chromosomes appeared to be involved in the phenotypic expression of the trait, suggesting that rye genome factors are predominantly responsible for Al tolerance in triticale. Conclusions The Diversity Arrays Technology was applied successfully to association mapping studies

  19. Fusion boundary microstructure evolution in aluminum alloys

    Science.gov (United States)

    Kostrivas, Anastasios Dimitrios

    2000-10-01

    A melting technique was developed to simulate the fusion boundary of aluminum alloys using the GleebleRTM thermal simulator. Using a steel sleeve to contain the aluminum, samples were heated to incremental temperatures above the solidus temperature of a number of alloys. In alloy 2195, a 4wt%Cu-1wt%Li alloy, an equiaxed non-dendritic zone (EQZ) could be formed by heating in the temperature range from approximately 630 to 640°C. At temperatures above 640°C, solidification occurred by the normal epitaxial nucleation and growth mechanism. Fusion boundary behavior was also studied in alloys 5454-H34, 6061-T6, and 2219-T8. Additionally, experimental alloy compositions were produced by making bead on plate welds using an alloy 5454-H32 base metal and 5025 or 5087 filler metals. These filler metals contain zirconium and scandium additions, respectively, and were expected to influence nucleation and growth behavior. Both as-welded and welded/heat treated (540°C and 300°C) substrates were tested by melting simulation, resulting in dendritic and EQZ structures depending on composition and substrate condition. Orientation imaging microscopy (OIM(TM)) was employed to study the crystallographic character of the microstructures produced and to verify the mechanism responsible for EQZ formation. OIM(TM) proved that grains within the EQZ have random orientation. In all other cases, where the simulated microstructures were dendritic in nature, it was shown that epitaxy was the dominant mode of nucleation. The lack of any preferred crystallographic orientation relationship in the EQZ supports a theory proposed by Lippold et al that the EQZ is the result of heterogeneous nucleation within the weld unmixed zone. EDS analysis of the 2195 on STEM revealed particles with ternary composition consisted of Zr, Cu and Al and a tetragonal type crystallographic lattice. Microdiffraction line scans on EQZ grains in the alloy 2195 showed very good agreement between the measured Cu

  20. Ecotoxicology of aluminum to fish and wildlife

    Science.gov (United States)

    Sparling, D.W.; Lowe, T.P.; Campbell, P.G.C.; Yokel, Robert A.; Golub, Mari S.

    1997-01-01

    The toxicity of aluminum has been studied extensively in fish, less so in invertebrates, amphibians, and birds, and not at all in reptiles and free-ranging mammals. For aquatic organisms, Al bioavailability and toxicity are intimately related to ambient pH; changes in ambient acidity may affect Al solubility, dissolved Al speciation, and organism sensitivity to Al. At moderate acidity (pH 5.5 to 7.0), fish and invertebrates may be stressed due to Al adsorption onto gill surfaces and subsequent asphyxiation. At pH 4.5 to 5.5, Al can impair ion regulation and augment the toxicity of H+. At lower pH, elevated Al can temporarily ameliorate the toxic effects of acidity by competing for binding sites with H+. Aluminum toxicity in aquatic environments is further affected by the concentration of ligands such as dissolved organic matter, fluoride, or sulfate, and of other cations such as Ca and Mg which compete for cellular binding sites. Although risk of Al toxicity is often based on a model of free-ion (Al3+) activity, recent evidence suggests that factors determining Al toxicity may be more complex. In general, aquatic invertebrates are less sensitive to Al toxicity and acidity than fish; thus acidified, Al-rich waters may actually reduce predation pressure. Fish may be affected by asphyxiation at moderate acidic conditions or electrolyte imbalances at lower pH. In amphibians, embryos and young larvae are typically more sensitive than older larvae. Early breeding amphibians, which lay eggs in ephemeral ponds and streams subject to spring runoff, are most at risk from Al and acidification; those that breed later in the year in lakes or rivers are least vulnerable. Birds and mammals are most likely exposed through dietary ingestion of soil or Al-contaminated foods. Concentrations > 1000 mg.kg-1 in food may be toxic to young birds and mammals. Clinical signs in these animals are consistent with rickets because Al precipitates with P in the gut. Suggestions for additional

  1. Biaxial Testing of 2195 Aluminum Lithium Alloy Using Cruciform Specimens

    Science.gov (United States)

    Johnston, W. M.; Pollock, W. D.; Dawicke, D. S.; Wagner, John A. (Technical Monitor)

    2002-01-01

    A cruciform biaxial test specimen was used to test the effect of biaxial load on the yield of aluminum-lithium alloy 2195. Fifteen cruciform specimens were tested from 2 thicknesses of 2195-T8 plate, 0.45 in. and 1.75 in. These results were compared to the results from uniaxial tensile tests of the same alloy, and cruciform biaxial tests of aluminum alloy 2219-T87.

  2. ON THE REACTIONS IN ILMENITE, ALUMINUM AND GRAPHITE SYSTEM

    Directory of Open Access Journals (Sweden)

    R. Khoshhal

    2016-03-01

    Full Text Available Al2O3/TiC composites are used as cutting tools for machining gray cast iron and steels. The addition of iron improves the toughness of Al2O3/TiC composites. Ilmenite, aluminum and graphite can be used to produce in-situ Al2O3/TiC–Fe composites. However, the formation mechanism and reaction sequences of this system are not clear enough. Therefore, the present research is designed to determine the reactions mechanism of the first step of reactions that may be occurred between raw materials. In this research, pure ilmenite was synthesized to eliminate the effects of impurities available in the natural ilmenite in the system. The milled and pressed samples, prepared from the synthesized ilmenite, aluminum and graphite mixture with a molar ratio of 1:2:1, were heat treated at 720°C for 48h. In addition, two samples one containing ilmenite and aluminum with a molar ratio of 1:2 and ilmenite and graphite with a molar ratio of 1:1 were heat treated at 720°C for 48h. The final products were analyzed with XRD. It was found that at 720°C, aluminum reacts with FeTiO3, forming Fe, TiO2 and Al2O3. Since the aluminum content used in the mixture was more than the stoichiometry for reaction of ilmenite and aluminum, some unreacted aluminum remains. Therefore, the residual aluminum reacts with the reduced Fe to form Fe2Al5.

  3. Preliminary investigation of aluminum combustion in air and steam.

    OpenAIRE

    Hallenbeck, Amos Edward.

    1983-01-01

    Approved for public release; distribution in unlimited. The goal of the experiment is to understand the role of metal-steam combustion in the explosion of underwater shaped cnarges. An apparatus was constructed to investigate combustion of aluminum in stes.m. For background information, aluminum wires (1 mm diameter, 50 mm length) were ignited in air by high current (480 amperes) . Tests in air and steam were photographed using 35 mm color slides and 16 mm movies (4300 fr...

  4. Explosive compaction of aluminum oxide modified by multiwall carbon nanotubes

    Science.gov (United States)

    Buzyurkin, A. E.; Kraus, E. I.; Lukyanov, Ya L.

    2018-04-01

    This paper presents experiments and numerical research on explosive compaction of aluminum oxide powder modified by multiwall carbon nanotubes (MWCNT) and modeling of the stress state behind the shock front at shock loading. The aim of this study was to obtain a durable low-porosity compact sample. The explosive compaction technology is used in this problem because the aluminum oxide is an extremely hard and refractory material. Therefore, its compaction by traditional methods requires special equipment and considerable expenses.

  5. Dynamic Multiaxial Response of a Hot-Pressed Aluminum Nitride

    Science.gov (United States)

    2012-01-05

    Hutchinson, Adv. Appl . Mech. 29 (1992). [34] H. Ming-Yuan, J.W. Hutchinson, Int. J. Solids Struct. 25 (1989) 1053. [35] J. Salem , L. Ghosn, Int. J...Dynamic Multiaxial Response of a Hot- Pressed Aluminum Nitride by Guangli Hu, C. Q. Chen, K. T. Ramesh, and J. W. McCauley ARL-RP-0487...Laboratory Aberdeen Proving Ground, MD 21005-5066 ARL-RP-0487 June 2014 Dynamic Multiaxial Response of a Hot- Pressed Aluminum Nitride

  6. Reactions of aluminum with uranium fluorides and oxyfluorides

    Energy Technology Data Exchange (ETDEWEB)

    Leitnaker, J.M.; Nichols, R.W.; Lankford, B.S. [Martin Marietta Energy Systems, Inc., Oak Ridge, TN (United States)

    1991-12-31

    Every 30 to 40 million operating hours a destructive reaction is observed in one of the {approximately}4000 large compressors that move UF{sub 6} through the gaseous diffusion plants. Despite its infrequency, such a reaction can be costly in terms of equipment and time. Laboratory experiments reveal that the presence of moderate pressures of UF{sub 6} actually cools heated aluminum, although thermodynamic calculations indicate the potential for a 3000-4000{degrees}C temperature rise. Within a narrow and rather low (<100 torr; 1 torr = 133.322 Pa) pressure range, however, the aluminum is seen to react with sufficient heat release to soften an alumina boat. Three things must occur in order for aluminum to react vigorously with either UF{sub 6} or UO{sub 2}F{sub 2}. 1. An initiating source of heat must be provided. In the compressors, this source can be friction, permitted by disruption of the balance of the large rotating part or by creep of the aluminum during a high-temperature treatment. In the absence of this heat source, compressors have operated for 40 years in UF{sub 6} without significant reaction. 2. The film protecting the aluminum must be breached. Melting (of UF{sub 5} at 620 K or aluminum at 930 K) can cause such a breach in laboratory experiments. In contrast, holding Al samples in UF{sub 6} at 870 K for several hours produces only moderate reaction. Rubbing in the cascade can undoubtedly breach the protective film. 3. Reaction products must not build up and smother the reaction. While uranium products tend to dissolve or dissipate in molten aluminum, AIF{sub 3} shows a remarkable tendency to surround and hence protect even molten aluminum. Hence the initial temperature rise must be rapid and sufficient to move reactants into a temperature region in which products are removed from the reaction site.

  7. Recovery of aluminum and other metal values from fly ash

    Science.gov (United States)

    McDowell, W.J.; Seeley, F.G.

    1979-11-01

    The invention relates to a method for improving the acid leachability of aluminum and other metal values found in fly ash which comprises sintering the fly ash, prior to acid leaching, with a calcium sulfate-containing composition at a temperature at which the calcium sulfate is retained in said composition during sintering and for a time sufficient to quantitatively convert the aluminum in said fly ash into an acid-leachable form.

  8. Microstructures and properties of aluminum die casting alloys

    Energy Technology Data Exchange (ETDEWEB)

    M. M. Makhlouf; D. Apelian; L. Wang

    1998-10-01

    This document provides descriptions of the microstructure of different aluminum die casting alloys and to relate the various microstructures to the alloy chemistry. It relates the microstructures of the alloys to their main engineering properties such as ultimate tensile strength, yield strength, elongation, fatigue life, impact resistance, wear resistance, hardness, thermal conductivity and electrical conductivity. Finally, it serves as a reference source for aluminum die casting alloys.

  9. Progress in Nano-Engineered Anodic Aluminum Oxide Membrane Development

    OpenAIRE

    Gerrard Eddy Jai Poinern; Derek Fawcett; Nurshahidah Ali

    2011-01-01

    The anodization of aluminum is an electro-chemical process that changes the surface chemistry of the metal, via oxidation, to produce an anodic oxide layer. During this process a self organized, highly ordered array of cylindrical shaped pores can be produced with controllable pore diameters, periodicity and density distribution. This enables anodic aluminum oxide (AAO) membranes to be used as templates in a variety of nanotechnology applications without the need for expensive lithographical ...

  10. Wafer-Scale Aluminum Nanoplasmonic Resonators with Optimized Metal Deposition

    Science.gov (United States)

    2016-01-04

    Because the plasma frequency of aluminum is at significantly higher energies than that of gold or silver, aluminum holds promise for UV sensing and...plasmonics. Unlike plasmonic devices based on coinage metals, such as gold and silver, which are effectively banned from silicon semiconductor fabrication... hydroxide -based developer. Finally, samples were plasma etched using a 1200 W plasma with a 145 W bias and a 12 mTorr chamber pressure. The flow

  11. CHARACTERIZATION OF NEW TOOL STEEL FOR ALUMINUM EXTRUSION DIES

    OpenAIRE

    José Britti Bacalhau; Fernanda Moreno Rodrigues; Rafael Agnelli Mesquita

    2014-01-01

    Aluminum extrusion dies are an important segment of application on industrial tools steels, which are manufactured in steels based on AISI H13 steel. The main properties of steels applied to extrusion dies are: wear resistance, impact resistance and tempering resistance. The present work discusses the characteristics of a newly developed hot work steel to be used on aluminum extrusion dies. The effects of Cr and Mo contents with respect to tempering resistance and the Al addition ...

  12. Strengthening of Aluminum Wires Treated with A206/Alumina Nanocomposites

    Directory of Open Access Journals (Sweden)

    David Florián-Algarín

    2018-03-01

    Full Text Available This study sought to characterize aluminum nanocomposite wires that were fabricated through a cold-rolling process, having potential applications in TIG (tungsten inert gas welding of aluminum. A206 (Al-4.5Cu-0.25Mg master nanocomposites with 5 wt % γAl2O3 nanoparticles were first manufactured through a hybrid process combining semi-solid mixing and ultrasonic processing. A206/1 wt % γAl2O3 nanocomposites were fabricated by diluting the prepared master nanocomposites with a monolithic A206 alloy, which was then added to a pure aluminum melt. The fabricated Al–γAl2O3 nanocomposite billet was cold-rolled to produce an Al nanocomposite wire with a 1 mm diameter and a transverse area reduction of 96%. Containing different levels of nanocomposites, the fabricated samples were mechanically and electrically characterized. The results demonstrate a significantly higher strength of the aluminum wires with the nanocomposite addition. Further, the addition of alumina nanoparticles affected the wires’ electrical conductivity compared with that of pure aluminum and aluminum–copper alloys. The overall properties of the new material demonstrate that these wires could be an appealing alternative for fillers intended for aluminum welding.

  13. Study on combined polishing process of aspherical aluminum mirrors

    Science.gov (United States)

    Deng, Jinqiu; Peng, Xiaoqiang; Hu, Hao; Ge, Kunpeng

    2017-10-01

    The aluminum mirrors are widely used as important optical components in some vital fields such as astronomical instruments or military installations due to the unique advantages of aluminum alloy. In order to simplify the structure of optical system and improve the performance at the same time, it's a tendency that the optics will be designed to aspherical or other freeform shapes. However, the traditional techniques are falling to have adequate abilities to deal with the increasing demands of aluminum optics. For example, the tool marks leaved on the surface from single point diamond turning (SPDT) has obvious adverse effects to optical system. The deterministic and sub-aperture polishing process has showed the potential to fabricate complex shapes over the few years. But it's still recognized as a problem to polish bare aluminum directly because of its soft surface and active chemical characteristics. Therefore, a combination of magnetorheological finishing (MRF) and small tool polishing (STP) is applied to obtain high performance aluminum optics in this paper. A paraboloid aluminum mirror was polished with this proposed method, and the results showed that the surface texture of the sample is restrained from rms 0.409λ (λ=632.8nm) to rms 0.025λ, and the surface roughness is improved from average Ra 6 7nm to Ra 3 4nm.

  14. The aluminum-air battery for electric vehicles - An update

    Science.gov (United States)

    1980-11-01

    The development of aluminum-air batteries as mechanically rechargeable power sources to be used in electric vehicles is discussed. The chemistry of the aluminum-air battery, which has a potential for providing the range, acceleration and rapid refueling capability of contemporary automobiles and is based on the reaction of aluminum metal with atmospheric oxygen in the presence of an aqueous sodium hydroxide/sodium aluminate electrolyte, is examined, and it is pointed out that the electric vehicle would be practically emissionless. The battery development program at the Lawrence Livermore National Laboratory, which includes evaluations of electrochemical and chemical phenomena, studies of the economics and energy balance of a transportation system based on aluminum, and power cell design and performance analysis, is presented. It is concluded that although difficult problems must be overcome before the technical and economic feasibility of aluminum-air batteries for electric vehicles can be established, projections indicate that the aluminum-air vehicle is potentially competitive with internal combustion vehicles powered by synthetic liquid fuels.

  15. Structural and optical characterization of porous anodic aluminum oxide

    International Nuclear Information System (INIS)

    Galca, Aurelian C.; Kooij, E. Stefan; Wormeester, Herbert; Salm, Cora; Leca, Victor; Rector, Jan H.; Poelsema, Bene

    2003-01-01

    Spectroscopic ellipsometry and scanning electron microscopy (SEM) experiments are employed to characterize porous aluminum oxide obtained by anodization of thin aluminum films. Rutherford backscattering spectra and x-ray diffraction experiments provide information on the composition and the structure of the samples. Results on our thin film samples with a well-defined geometry show that anodization of aluminum is reproducible and results in a porous aluminum oxide network with randomly distributed, but perfectly aligned cylindrical pores perpendicular to the substrate. The ellipsometry spectra are analyzed using an anisotropic optical model, partly based on the original work by Bruggeman. The model adequately describes the optical response of the anodized film in terms of three physically relevant parameters: the film thickness, the cylinder fraction, and the nanoporosity of the aluminum oxide matrix. Values of the first two quantities, obtained from fitting the spectra, are in perfect agreement with SEM results, when the nanoporosity of the aluminum oxide matrix is taken into account. The validity of our optical model was verified over a large range of cylinder fractions, by widening of the pores through chemical etching in phosphoric acid. While the cylinder fraction increases significantly with etch time and etchant concentration, the nanoporosity remains almost unchanged. Additionally, based on a simple model considering a linear etch rate, the concentration dependence of the etch rate was determined

  16. Carrier gas effects on aluminum-catalyzed nanowire growth

    International Nuclear Information System (INIS)

    Ke, Yue; Hainey, Mel Jr; Won, Dongjin; Weng, Xiaojun; Eichfeld, Sarah M; Redwing, Joan M

    2016-01-01

    Aluminum-catalyzed silicon nanowire growth under low-pressure chemical vapor deposition conditions requires higher reactor pressures than gold-catalyzed growth, but the reasons for this difference are not well understood. In this study, the effects of reactor pressure and hydrogen partial pressure on silicon nanowire growth using an aluminum catalyst were studied by growing nanowires in hydrogen and hydrogen/nitrogen carrier gas mixtures at different total reactor pressures. Nanowires grown in the nitrogen/hydrogen mixture have faceted catalyst droplet tips, minimal evidence of aluminum diffusion from the tip down the nanowire sidewalls, and significant vapor–solid deposition of silicon on the sidewalls. In comparison, wires grown in pure hydrogen show less well-defined tips, evidence of aluminum diffusion down the nanowire sidewalls at increasing reactor pressures and reduced vapor–solid deposition of silicon on the sidewalls. The results are explained in terms of a model wherein the hydrogen partial pressure plays a critical role in aluminum-catalyzed nanowire growth by controlling hydrogen termination of the silicon nanowire sidewalls. For a given reactor pressure, increased hydrogen partial pressures increase the extent of hydrogen termination of the sidewalls which suppresses SiH_4 adsorption thereby reducing vapor–solid deposition of silicon but increases the surface diffusion length of aluminum. Conversely, lower hydrogen partial pressures reduce the hydrogen termination and also increase the extent of SiH_4 gas phase decomposition, shifting the nanowire growth window to lower growth temperatures and silane partial pressures. (paper)

  17. Mechanism of Corrosion of Activated Aluminum Particles by Hot Water

    International Nuclear Information System (INIS)

    Razavi-Tousi, S.S.; Szpunar, J.A.

    2014-01-01

    Mechanism of corrosion in aluminum particles by hot water treatment for hydrogen generation is evaluated. The aluminum powder was activated by ball milling for different durations, which modified size and microstructure of the particles. Open circuit potential test was carried out to elucidate different stages of the reaction. Tafel test was used to explain the effect of ball milling and growth of hydroxide layer on corrosion of the particles. Surface, cross section and thickness of the grown hydroxide on the aluminum particles were studied in a scanning electron microscope. The corrosion potential of the aluminum powders depends on microstructure of the aluminum particles, growth of the hydroxide layer and a change in pH because of cathodic reactions. The hydrogen production test showed that a deformed microstructure and smaller particle size accelerates the corrosion rate of aluminum by hot water, the effect of the deformed microstructure being more significant at the beginning of the reaction. Effect of growth of the hydroxide layer on corrosion mechanism is discussed

  18. Drying studies of simulated DOE aluminum plate fuels

    International Nuclear Information System (INIS)

    Lords, R.E.; Windes, W.E.; Crepeau, J.C.; Sidwell, R.W.

    1996-01-01

    Experiments have been conducted to validate the Idaho National Engineering Laboratory (INEL) drying procedures for preparation of corroded aluminum plate fuel for dry storage in an existing vented (and filtered) fuel storage facility. A mixture of hydrated aluminum oxide bound with a clay was used to model the aluminum corrosion product and sediment expected in these Department of Energy (DOE) owned fuel types. Previous studies demonstrated that the current drying procedures are adequate for removal of free water inside the storage canister and for transfer of this fuel to a vented dry storage facility. However, using these same drying procedures, the simulated corrosion product was found to be difficult to dry completely from between the aluminum clad plates of the fuel. Another related set of experiments was designed to ensure that the fuel would not be damaged during the drying process. Aluminum plate fuels are susceptible to pitting damage on the cladding that can result in a portion of UAl x fuel meat being disgorged. This would leave a water-filled void beneath the pit in the cladding. The question was whether bursting would occur when water in the void flashes to steam, causing separation of the cladding from the fuel, and/or possible rupture. Aluminum coupons were fabricated to model damaged fuel plates. These coupons do not rupture or sustain any visible damage during credible drying scenarios

  19. Friction Pull Plug Welding in Aluminum Alloys

    Science.gov (United States)

    Brooke, Shane A.; Bradford, Vann

    2012-01-01

    NASA's Marshall Space Flight Center (MSFC) has recently invested much time and effort into the process development of Friction Pull Plug Welding (FPPW). FPPW, is a welding process similar to Friction Push Plug Welding in that, there is a small rotating part (plug) being spun and simultaneously pulled (forged) into a larger part. These two processes differ, in that push plug welding requires an internal reaction support, while pull plug welding reacts to the load externally. FPPW was originally conceived as a post proof repair technique for the Space Shuttle fs External Tank. FPPW was easily selected as the primary weld process used to close out the termination hole on the Constellation Program's ARES I Upper Stage circumferential Self-Reacting Friction Stir Welds (SR-FSW). The versatility of FPPW allows it to also be used as a repair technique for both SR-FSW and Conventional Friction Stir Welds. To date, all MSFC led development has been concentrated on aluminum alloys (2195, 2219, and 2014). Much work has been done to fully understand and characterize the process's limitations. A heavy emphasis has been spent on plug design, to match the various weldland thicknesses and alloy combinations. This presentation will summarize these development efforts including weld parameter development, process control, parameter sensitivity studies, plug repair techniques, material properties including tensile, fracture and failure analysis.

  20. Solute-vacancy binding in aluminum

    International Nuclear Information System (INIS)

    Wolverton, C.

    2007-01-01

    Previous efforts to understand solute-vacancy binding in aluminum alloys have been hampered by a scarcity of reliable, quantitative experimental measurements. Here, we report a large database of solute-vacancy binding energies determined from first-principles density functional calculations. The calculated binding energies agree well with accurate measurements where available, and provide an accurate predictor of solute-vacancy binding in other systems. We find: (i) some common solutes in commercial Al alloys (e.g., Cu and Mg) possess either very weak (Cu), or even repulsive (Mg), binding energies. Hence, we assert that some previously reported large binding energies for these solutes are erroneous. (ii) Large binding energies are found for Sn, Cd and In, confirming the proposed mechanism for the reduced natural aging in Al-Cu alloys containing microalloying additions of these solutes. (iii) In addition, we predict that similar reduction in natural aging should occur with additions of Si, Ge and Au. (iv) Even larger binding energies are found for other solutes (e.g., Pb, Bi, Sr, Ba), but these solutes possess essentially no solubility in Al. (v) We have explored the physical effects controlling solute-vacancy binding in Al. We find that there is a strong correlation between binding energy and solute size, with larger solute atoms possessing a stronger binding with vacancies. (vi) Most transition-metal 3d solutes do not bind strongly with vacancies, and some are even energetically strongly repelled from vacancies, particularly for the early 3d solutes, Ti and V

  1. Recrystallization resistance in aluminum alloys containing zirconium

    International Nuclear Information System (INIS)

    Ranganathan, K.

    1991-01-01

    Zirconium forms a fine dispersion of the metastable β' (Al 3 Zr) phase that controls recrystallization by retarding the motion of high-angle boundaries. The primary material chosen for this research was aluminum alloy 7150 containing zinc, magnesium, and copper as the major solute elements and zirconium as the dispersoid-forming element. The size, distribution, and the volume fraction of β' was controlled by varying the alloy composition and preheat practices. Preheated ingots were subjected to a specific sequence of hot-rolling operations to evaluate the resistance to recrystallization of the different microstructures. Optical and transmission electron microscopy (TEM) techniques were used to investigate the influence of dispersoid morphology resulting from the thermal treatments and deformation processing on the recrystallization behavior of the alloy. Studies were conducted to determine the influence of the individual solute elements present in 7150 on the precipitation of β' and consequently on the recrystallization behavior of the material. These studies were done on compositional variants of commercial 7150

  2. Production and characterization of cast aluminum sponges

    International Nuclear Information System (INIS)

    Rivarola, M.E; Marmo Lupano, J.M; Malachevsky, M.T

    2004-01-01

    Cellular materials have unique physical features that make them particularly appropriate for applications that require high mechanical resistance and low weight. They can be produced in different ways: by powder metallurgy, by infiltration over plastic foams, adding a releasing agent of gas to a fused metal or simply injecting gas into it. Cellular structures can also be formed by casting onto a pore forming material. This work proposes a method that is basically similar to the last one mentioned but that allows the resulting material's porosity and topology to be controlled. Thus, the mechanical or thermal features of the material that is being manufactured can be predicted and/or designed. First the three dimensional print of a mold is made in a 3D printer, which is the negative of the piece that will be produced. Then a vacuum assisted aluminum cast is made. A preliminary study is presented for the applicability of this method and the mechanical properties of the resulting sponges (CW)

  3. Aluminum oxide film thickness and emittance

    International Nuclear Information System (INIS)

    Thomas, J.K.; Ondrejcin, R.S.

    1991-11-01

    Aluminum reactor components which are not actively cooled could be subjected to high temperatures due to gamma heating after the core coolant level dropped during the ECS phase of a hypothetical LOCA event. Radiative heat transfer is the dominant heat transfer process in this scenario and therefore the emittance of these components is of interest. Of particular interest are the safety rod thimbles and Mark 60B blanket assemblies; for the K Reactor, these components have been exposed to low temperature (< 55 degrees C) moderator for about a year. The average moderator temperature was assumed to be 30 degrees C. The Al oxide film thickness at this temperature, after one year of exposure, is predicted to be 6.4 μm ± 10%; insensitive to exposure time. Dehydration of the film during the gamma heating accident would result in a film thickness of 6.0 μm ± 11%. Total hemispherical emittance is predicted to be 0.69 at 96 degrees C, decreasing to 0.45 at 600 degrees C. Some phenomena which would tend to yield thicker oxide films in the reactor environment relative to those obtained under experimental conditions were neglected and the predicted film thickness values are therefore conservative. The emittance values predicted for a given film thickness are also conservative. The conservativisms inherent in the predicted emittance are particularly relevant for uncertainty analysis of temperatures generated using these values

  4. An update on toxicology of aluminum phosphide

    Directory of Open Access Journals (Sweden)

    Moghadamnia Ali

    2012-09-01

    Full Text Available Abstract Aluminum phosphide (AlP is a cheap solid fumigant and a highly toxic pesticide which is commonly used for grain preservation. In Iran it is known as the “rice tablet”. AlP has currently aroused interest with increasing number of cases in the past four decades due to increased use in agricultural and non-agricultural purposesand also its easy availability in the markets has increased its misuse to commit suicide. Upon contact with moisture in the environment, AlP undergoes a chemical reaction yielding phosphine gas, which is the active pesticidal component. Phosphine inhibits cellular oxygen utilization and can induce lipid peroxidation. It was reported that AlP has a mortality rate more than 50% of intoxication cases. Poisoning with AlP has usually occurred in attempts to suicide. It is a more common case in adults rather than teen agers. In some eastern countries it is a very common agent with rapid action for suicide. Up to date, there is no effective antidote or treatment for its intoxication. Also, some experimental results suggest that magnesium sulfate, N-acetyl cysteine (NAC, glutathione, vitamin C and E, beta-carotenes, coconut oil and melatonin may play an important role in reducing the oxidative outcomes of phosphine. This article reviews the experimental and clinical features of AlP intoxication and tries to suggest a way to encounter its poisoning.

  5. An Update on Toxicology of Aluminum Phosphide

    Directory of Open Access Journals (Sweden)

    Ali Akbar Moghhadamnia

    2012-09-01

    Full Text Available Aluminum phosphide (AlP is a cheap solid fumigant and a highly toxic pesticide which is commonly used for grain preservation. In Iran it is known as the "rice tablet". AlP has currently aroused interest with increasing number of cases in the past four decades due to increased use in agricultural and non-agricultural purposes and also its easy availability in the markets has increased its misuse to commit suicide. Upon contact with moisture in the environment, AlP undergoes a chemical reaction yielding phosphine gas, which is the active pesticidal component. Phosphine inhibits cellular oxygen utilization and can induce lipid peroxidation. It was reported that AlP has a mortality rate more than 50% of intoxication cases. Poisoning with AlP has usually occurred in attempts to suicide. It is a more common case in adults rather than teen agers. In some eastern countries it is a very common agent with rapid action for suicide. Up to date, there is no effective antidote or treatment for its intoxication. Also, some experimental results suggest that magnesium sulfate, N-acetyl cysteine (NAC, glutathione, vitamin C and E, beta-carotenes, coconut oil and melatonin may play an important role in reducing the oxidative outcomes of phosphine. This article reviews the experimental and clinical features of AlP intoxication and tries to suggest a way to encounter its poisoning.

  6. Fluorescent lighting with aluminum nitride phosphors

    Science.gov (United States)

    Cherepy, Nerine J.; Payne, Stephen A.; Seeley, Zachary M.; Srivastava, Alok M.

    2016-05-10

    A fluorescent lamp includes a glass envelope; at least two electrodes connected to the glass envelope; mercury vapor and an inert gas within the glass envelope; and a phosphor within the glass envelope, wherein the phosphor blend includes aluminum nitride. The phosphor may be a wurtzite (hexagonal) crystalline structure Al.sub.(1-x)M.sub.xN phosphor, where M may be drawn from beryllium, magnesium, calcium, strontium, barium, zinc, scandium, yttrium, lanthanum, cerium, praseodymium, europium, gadolinium, terbium, ytterbium, bismuth, manganese, silicon, germanium, tin, boron, or gallium is synthesized to include dopants to control its luminescence under ultraviolet excitation. The disclosed Al.sub.(1-x)M.sub.xN:Mn phosphor provides bright orange-red emission, comparable in efficiency and spectrum to that of the standard orange-red phosphor used in fluorescent lighting, Y.sub.2O.sub.3:Eu. Furthermore, it offers excellent lumen maintenance in a fluorescent lamp, and does not utilize "critical rare earths," minimizing sensitivity to fluctuating market prices for the rare earth elements.

  7. Porous Anodic Aluminum Oxide with Serrated Nanochannels

    Science.gov (United States)

    Li, Dongdong; Zhao, Liang; Lu, Jia G.

    2010-03-01

    Self-assembled nanoporous anodic aluminum oxide (AAO) membrane with straight channels has long been an important tool in synthesizing highly ordered and vertically aligned quasi-1D nanostructures for various applications. Recently shape-selective nanomaterials have been achieved using AAO as a template. It is envisioned that nanowires with multi-branches will significantly increase the active functional sites for applications as sensors, catalysts, chemical cells, etc. Here AAO membranes with serrated nanochannels have been successfully fabricated via a two-step annodization method. The serrated channels with periodic intervals are aligned at an angle of ˜25^circ along the stem channels. The formation of the serrated channels is attributed to the evolution of oxygen gas bubbles and the resulted plastic deformation in oxide membrane. In order to reveal the inside channel structure, Platinum are electrodeposited into the AAO template. The as-synthesized serrated Pt nanowires demonstrate a superior electrocatalytic activity. This is attributed to the enhanced electric field strength around serrated tips as shown in the electric field simulation by COMOSL. Moreover, hierarchical serrated/straight hybrid structures can be constructed using this simple and novel self assembly technique.

  8. Grain refinement of aluminum and its alloys

    International Nuclear Information System (INIS)

    Zaid, A.I.O.

    2001-01-01

    Grain refinement of aluminum and its alloys by the binary Al-Ti and Ternary Al-Ti-B master alloys is reviewed and discussed. The importance of grain refining to the cast industry and the parameters affecting it are presented and discussed. These include parameters related to the cast, parameters related to the grain refining alloy and parameters related to the process. The different mechanisms, suggested in the literature for the process of grain refining are presented and discussed, from which it is found that although the mechanism of refining by the binary Al-Ti is well established the mechanism of grain refining by the ternary Al-Ti-B is still a controversial matter and some research work is still needed in this area. The effect of the addition of other alloying elements in the presence of the grain refiner on the grain refining efficiency is also reviewed and discussed. It is found that some elements e.g. V, Mo, C improves the grain refining efficiency, whereas other elements e.g. Cr, Zr, Ta poisons the grain refinement. Based on the parameters affecting the grain refinement and its mechanism, a criterion for selection of the optimum grain refiner is forwarded and discussed. (author)

  9. Aluminum nitride and nanodiamond thin film microstructures

    Energy Technology Data Exchange (ETDEWEB)

    Knoebber, Fabian; Bludau, Oliver; Roehlig, Claus-Christian; Williams, Oliver; Sah, Ram Ekwal; Kirste, Lutz; Cimalla, Volker; Lebedev, Vadim; Nebel, Christoph; Ambacher, Oliver [Fraunhofer-Institute for Applied Solid State Physics, Freiburg (Germany)

    2010-07-01

    In this work, aluminum nitride (AlN) and nanocrystalline diamond (NCD) thin film microstructures have been developed. Freestanding NCD membranes were coated with a piezoelectrical AlN layer in order to build tunable micro-lens arrays. For the evaluation of the single material quality, AlN and NCD thin films on silicon substrates were fabricated using RF magnetron sputtering and microwave chemical vapor deposition techniques, respectively. The crystal quality of AlN was investigated by X-ray diffraction. The piezoelectric constant d{sub 33} was determined by scanning laser vibrometry. The NCD thin films were optimized with respect to surface roughness, mechanical stability, intrinsic stress and transparency. To determine the mechanical properties of the materials, both, micromechanical resonator and membrane structures were fabricated and measured by magnetomotive resonant frequency spectroscopy and bulging experiments, respectively. Finally, the behavior of AlN/NCD heterostructures was modeled using the finite element method and the first structures were characterized by piezoelectrical measurements.

  10. Enhanced active aluminum content and thermal behaviour of nano-aluminum particles passivated during synthesis using thermal plasma route

    International Nuclear Information System (INIS)

    Mathe, Vikas L.; Varma, Vijay; Raut, Suyog; Nandi, Amiya Kumar; Pant, Arti; Prasanth, Hima; Pandey, R.K.; Bhoraskar, Sudha V.; Das, Asoka K.

    2016-01-01

    Graphical abstract: - Highlights: • Synthesis of nano crystalline Al (nAl) using DC thermal plasma reactor. • In situ passivation of nAl by palmitic acid and air. • Enhanced active aluminum content obtained for palmitic acid passivated nAl. • Palmitic acid passivated nAl are quite stable in humid atmospheres. - Abstract: Here, we report synthesis and in situ passivation of aluminum nanoparticles using thermal plasma reactor. Both air and palmitc acid passivation was carried out during the synthesis in the thermal plasma reactor. The passivated nanoparticles have been characterized for their structural and morphological properties using X-ray diffraction (XRD) and transmission electron microscopy (TEM) techniques. In order to understand nature of passivation vibrational spectroscopic analysis have been carried out. The enhancement in active aluminum content and shelf life for a palmitic acid passivated nano-aluminum particles in comparison to the air passivated samples and commercially available nano Al powder (ALEX) has been observed. Thermo-gravimetric analysis was used to estimate active aluminum content of all the samples under investigation. In addition cerimetric back titration method was also used to estimate AAC and the shelf life of passivated aluminum particles. Structural, microstructural and thermogravomateric analysis of four year aged passivated sample also depicts effectiveness of palmitic acid passivation.

  11. Role of Spirulina in mitigating hemato-toxicity in Swiss albino mice exposed to aluminum and aluminum fluoride.

    Science.gov (United States)

    Sharma, Shweta; Sharma, K P; Sharma, Subhasini

    2016-12-01

    Aluminum is ingested through foods, water, air, and even drugs. Its intake is potentiated further through foods and tea prepared in aluminum utensils and Al salt added in the drinking water for removal of suspended impurities and also fluoride in the affected areas. The ameliorating role of a blue green alga Spirulina is well documented to various pollutants in the animal models. We, therefore, examined its protective role (230 mg/kg body weight) on the hematology of male Swiss albino mice treated with aluminum (sub-acute = 78.4 mg/kg body weight for 7 days, sub-chronic = 7.8 mg/kg body weight for 90 days) and aluminum fluoride (sub-acute = 103 mg/kg body weight, sub-chronic = 21 mg/kg body weight), along with their recovery after 90 days of sub-chronic exposure. This study revealed significant reduction in the values of RBC (5-18 %), Hb (15-17 %), PCV (8-14 %), and platelets (26-36 %), and increase in WBC (54-124 %) in the treated mice, particularly after sub-acute exposure. Aluminum fluoride was comparatively more toxic than aluminum. Further, Spirulina supplement not only alleviated toxicity of test chemicals in Swiss albino mice but also led to their better recovery after withdrawal.

  12. Enhanced active aluminum content and thermal behaviour of nano-aluminum particles passivated during synthesis using thermal plasma route

    Energy Technology Data Exchange (ETDEWEB)

    Mathe, Vikas L., E-mail: vlmathe@physics.unipune.ac.in [Department of Physics, Savitribai Phule Pune University, Pune 411007, Maharashtra (India); Varma, Vijay; Raut, Suyog [Department of Physics, Savitribai Phule Pune University, Pune 411007, Maharashtra (India); Nandi, Amiya Kumar; Pant, Arti; Prasanth, Hima; Pandey, R.K. [High Energy Materials Research Lab, Sutarwadi, Pune 411021, Maharashtra (India); Bhoraskar, Sudha V. [Department of Physics, Savitribai Phule Pune University, Pune 411007, Maharashtra (India); Das, Asoka K. [Utkal University, VaniVihar, Bhubaneswar, Odisha 751004 (India)

    2016-04-15

    Graphical abstract: - Highlights: • Synthesis of nano crystalline Al (nAl) using DC thermal plasma reactor. • In situ passivation of nAl by palmitic acid and air. • Enhanced active aluminum content obtained for palmitic acid passivated nAl. • Palmitic acid passivated nAl are quite stable in humid atmospheres. - Abstract: Here, we report synthesis and in situ passivation of aluminum nanoparticles using thermal plasma reactor. Both air and palmitc acid passivation was carried out during the synthesis in the thermal plasma reactor. The passivated nanoparticles have been characterized for their structural and morphological properties using X-ray diffraction (XRD) and transmission electron microscopy (TEM) techniques. In order to understand nature of passivation vibrational spectroscopic analysis have been carried out. The enhancement in active aluminum content and shelf life for a palmitic acid passivated nano-aluminum particles in comparison to the air passivated samples and commercially available nano Al powder (ALEX) has been observed. Thermo-gravimetric analysis was used to estimate active aluminum content of all the samples under investigation. In addition cerimetric back titration method was also used to estimate AAC and the shelf life of passivated aluminum particles. Structural, microstructural and thermogravomateric analysis of four year aged passivated sample also depicts effectiveness of palmitic acid passivation.

  13. Metallic aluminum in combustion; Metalliskt aluminium i foerbraenningen

    Energy Technology Data Exchange (ETDEWEB)

    Backman, Rainer; Berg, Magnus; Bostroem, Dan; Hirota, Catherine; Oehman, Marcus; Oehrstroem, Anna

    2007-06-15

    Although aluminum is easily oxidized and melts at temperatures lower than those common in combustion, it can pass through the combustion chamber almost unscathed. If one performs calculations of thermodynamic equilibriums, conditions under which this could happen are extreme in comparison to those generally found in a furnace. Metallic aluminum may yet be found in rather large concentrations in fly ashes. There are also indications that metallic aluminum is present in deposits inside the furnaces. The objectives for the present investigation are better understanding of the behavior of the metallic aluminum in the fuel when it passes through an incinerator and to suggest counter/measures that deal with the problems associated with it. The target group is primary incineration plants using fuel that contains aluminum foil, for example municipal waste, industrial refuse or plastic reject from cardboard recycling. Combustion experiments were performed in a bench scale reactor using plastic reject obtained from the Fiskeby Board mill. First the gas velocity at which a fraction of the reject hovers was determined for the different fuel fractions, yielding a measure for their propensity to be carried over by the combustion gases. Second fractions rich in aluminum foils were combusted with time, temperature and gas composition as parameters. The partially combusted samples were analyzed using SEM/EDS. The degree of oxidation was determined using TGA/DTA. Reference material from full scale incinerators was obtained by collecting fly ash samples from five plants and analyzing them using XRD and SEM/EDS. The results show that thin aluminum foils may easily be carried over from the furnace. Furthermore, it was very difficult to fully oxidize the metallic flakes. The oxide layer on the surface prevents further diffusion of oxygen to the molten core of the flake. The contribution of these flakes to the build of deposits in a furnace is confirmed by earlier investigations in pilot

  14. Aluminum bioavailability from basic sodium aluminum phosphate, an approved food additive emulsifying agent, incorporated in cheese.

    Science.gov (United States)

    Yokel, Robert A; Hicks, Clair L; Florence, Rebecca L

    2008-06-01

    Oral aluminum (Al) bioavailability from drinking water has been previously estimated, but there is little information on Al bioavailability from foods. It was suggested that oral Al bioavailability from drinking water is much greater than from foods. The objective was to further test this hypothesis. Oral Al bioavailability was determined in the rat from basic [26Al]-sodium aluminum phosphate (basic SALP) in a process cheese. Consumption of approximately 1g cheese containing 1.5% or 3% basic SALP resulted in oral Al bioavailability (F) of approximately 0.1% and 0.3%, respectively, and time to maximum serum 26Al concentration (Tmax) of 8-9h. These Al bioavailability results were intermediate to previously reported results from drinking water (F approximately 0.3%) and acidic-SALP incorporated into a biscuit (F approximately 0.1%), using the same methods. Considering the similar oral bioavailability of Al from food vs. water, and their contribution to the typical human's daily Al intake ( approximately 95% and 1.5%, respectively), these results suggest food contributes much more Al to systemic circulation, and potential Al body burden, than does drinking water. These results do not support the hypothesis that drinking water provides a disproportionate contribution to total Al absorbed from the gastrointestinal tract.

  15. Fabrication of Aluminum Tubes Filled with Aluminum Alloy Foam by Friction Welding

    Directory of Open Access Journals (Sweden)

    Yoshihiko Hangai

    2015-10-01

    Full Text Available Aluminum foam is usually used as the core of composite materials by combining it with dense materials, such as in Al foam core sandwich panels and Al-foam-filled tubes, owing to its low tensile and bending strengths. In this study, all-Al foam-filled tubes consisting of ADC12 Al-Si-Cu die-cast aluminum alloy foam and a dense A1050 commercially pure Al tube with metal bonding were fabricated by friction welding. First, it was found that the ADC12 precursor was firmly bonded throughout the inner wall of the A1050 tube without a gap between the precursor and the tube by friction welding. No deformation of the tube or foaming of the precursor was observed during the friction welding. Next, it was shown that by heat treatment of an ADC12-precursor-bonded A1050 tube, gases generated by the decomposition of the blowing agent expand the softened ADC12 to produce the ADC12 foam interior of the dense A1050 tube. A holding time during the foaming process of approximately tH = 8.5 min with a holding temperature of 948 K was found to be suitable for obtaining a sound ADC12-foam-filled A1050 tube with sufficient foaming, almost uniform pore structures over the entire specimen, and no deformation or reduction in the thickness of the tube.

  16. Corrosion of aluminum alloys in a reactor disassembly basin

    International Nuclear Information System (INIS)

    Howell, J.P.; Zapp, P.E.; Nelson, D.Z.

    1992-01-01

    This document discusses storage of aluminum clad fuel and target tubes of the Mark 22 assembly takes place in the concrete-lined, light-water-filled, disassembly basins located within each reactor area at the Savannah River Site (SRS). A corrosion test program has been conducted in the K-Reactor disassembly basin to assess the storage performance of the assemblies and other aluminum clad components in the current basin environment. Aluminum clad alloys cut from the ends of actual fuel and target tubes were originally placed in the disassembly water basin in December 1991. After time intervals varying from 45--182 days, the components were removed from the basin, photographed, and evaluated metallographically for corrosion performance. Results indicated that pitting of the 8001 aluminum fuel clad alloy exceeded the 30-mil (0.076 cm) cladding thickness within the 45-day exposure period. Pitting of the 1100 aluminum target clad alloy exceeded the 30-mil (0.076 cm) clad thickness in 107--182 days exposure. The existing basin water chemistry is within limits established during early site operations. Impurities such as Cl - , NO 3 - and SO 4 - are controlled to the parts per million level and basin water conductivity is currently 170--190 μmho/cm. The test program has demonstrated that the basin water is aggressive to the aluminum components at these levels. Other storage basins at SRS and around the US have successfully stored aluminum components for greater than ten years without pitting corrosion. These basins have impurity levels controlled to the parts per billion level (1000X lower) and conductivity less than 1.0 μmho/cm

  17. Evaluation of water chemistry on the pitting susceptibility of aluminum

    International Nuclear Information System (INIS)

    Chandler, G.T.; Sindelar, R.L.; Lam, P.S.

    1997-01-01

    Aluminum-clad spent nuclear fuels are being stored in water in the Receiving Basin for Off-site Fuels (RBOF) and the reactor disassembly (cooling) basins at the Savannah River Site (SRS). Experience shows that fuels stored in water are subject to rapid pitting corrosion if the water quality is poor. Upgrade projects and actions, including those to improve water quality, were recently undertaken to upgrade the disassembly basins for extended storage. A technical strategy was developed for continued basin storage of aluminum-clad fuel assemblies. The strategy includes development and implementation of basin technical standards for water quality to minimize attack due to pitting corrosion over a desired storage period. In the absence of localized corrosion, only slow, general corrosion of the cladding would be expected. A laboratory corrosion program is being performed to provide the bases for technical standards by identifying the region of aggressive water qualities where existing oxide films would tend to break down and pits would initiate and remain active. Initial results from corrosion potential and cyclic polarization testing of aluminum alloys in various water chemistries have shown that low conductivity water (< 50 μS/cm) should not be aggressive to cause self-pitting corrosion. Initial results from tests of 8001 and 5052 aluminum and aluminium-10% uranium alloy indicate that a strong galvanic couple should not exist between the aluminum cladding materials and the aluminum-uranium fuel. Additional laboratory testing will include immersion testing to allow characterization of the growth rate of active pits to benchmark a kinetic model. This model will form the basis for a water quality technical standard and enable prediction of the life of aluminum-clad spent nuclear fuels in basin storage

  18. Thermocurrent dosimetry with high purity aluminum oxide

    International Nuclear Information System (INIS)

    Fullerton, G.D.; Cameron, J.R.; Moran, P.R.

    1976-01-01

    The application of thermocurrent (TC) to ionizing radiation dosimetry was studied. It was shown that TC in alumina (Al 2 O 3 ) has properties that are suited to personnel dosimetry and environmental monitoring. TC dosimeters were made from thin disks of alumina. Aluminum electrodes were evaporated on each side: on one face a high voltage electrode and on the opposite face a measuring electrode encircled by a guard ring. Exposure to ionizing radiation resulted in stored electrons and holes in metastable trapping sites. The signal was read-out by heating the dosimeter with a voltage source and picnometer connected in series between the opposite electrodes. The thermally remobilized charge caused a transient TC. The thermogram, TC versus time or temperature, is similar to a TL glow curve. Either the peak current or the integrated current is a measure of absorbed dose. Six grades of alumina were studied from a total of four commercial suppliers. All six materials displayed radiation induced TC signals. Sapphire of uv-grade quality from the Adolf Meller Co. (AM) had the best dosimetry properties of those investigated. Sources of interference were studied. Thermal fading, residual signal and radiation damage do not limit TC dosimetry. Ultraviolet light can induce a TC response but it is readily excluded with uv-opaque cladding. Improper surface preparation prior to electrode evaporation was shown to cause interference. A spurious TC signal resulted from polarization of surface contaminants. Spurious TC was reduced by improved cleaning prior to electrode application. Polished surfaces resulted in blocking electrodes and caused a sensitivity shift due to radiation induced thermally activated polarization. This was not observed with rough cut surfaces

  19. Hydrogen storage in sodium aluminum hydride.

    Energy Technology Data Exchange (ETDEWEB)

    Ozolins, Vidvuds; Herberg, J.L. (Lawrence Livermore National Laboratories, Livermore, CA); McCarty, Kevin F.; Maxwell, Robert S. (Lawrence Livermore National Laboratories, Livermore, CA); Stumpf, Roland Rudolph; Majzoub, Eric H.

    2005-11-01

    Sodium aluminum hydride, NaAlH{sub 4}, has been studied for use as a hydrogen storage material. The effect of Ti, as a few mol. % dopant in the system to increase kinetics of hydrogen sorption, is studied with respect to changes in lattice structure of the crystal. No Ti substitution is found in the crystal lattice. Electronic structure calculations indicate that the NaAlH{sub 4} and Na{sub 3}AlH{sub 6} structures are complex-ionic hydrides with Na{sup +} cations and AlH{sub 4}{sup -} and AlH{sub 6}{sup 3-} anions, respectively. Compound formation studies indicate the primary Ti-compound formed when doping the material at 33 at. % is TiAl{sub 3} , and likely Ti-Al compounds at lower doping rates. A general study of sorption kinetics of NaAlH{sub 4}, when doped with a variety of Ti-halide compounds, indicates a uniform response with the kinetics similar for all dopants. NMR multiple quantum studies of solution-doped samples indicate solvent interaction with the doped alanate. Raman spectroscopy was used to study the lattice dynamics of NaAlH{sub 4}, and illustrated the molecular ionic nature of the lattice as a separation of vibrational modes between the AlH{sub 4}{sup -} anion-modes and lattice-modes. In-situ Raman measurements indicate a stable AlH{sub 4}{sup -} anion that is stable at the melting temperature of NaAlH{sub 4}, indicating that Ti-dopants must affect the Al-H bond strength.

  20. Thermocurrent dosimetry with high purity aluminum oxide

    Energy Technology Data Exchange (ETDEWEB)

    Fullerton, G.D.; Cameron, J.R.; Moran, P.R.

    1976-01-01

    The application of thermocurrent (TC) to ionizing radiation dosimetry was studied. It was shown that TC in alumina (Al/sub 2/O/sub 3/) has properties that are suited to personnel dosimetry and environmental monitoring. TC dosimeters were made from thin disks of alumina. Aluminum electrodes were evaporated on each side: on one face a high voltage electrode and on the opposite face a measuring electrode encircled by a guard ring. Exposure to ionizing radiation resulted in stored electrons and holes in metastable trapping sites. The signal was read-out by heating the dosimeter with a voltage source and picnometer connected in series between the opposite electrodes. The thermally remobilized charge caused a transient TC. The thermogram, TC versus time or temperature, is similar to a TL glow curve. Either the peak current or the integrated current is a measure of absorbed dose. Six grades of alumina were studied from a total of four commercial suppliers. All six materials displayed radiation induced TC signals. Sapphire of uv-grade quality from the Adolf Meller Co. (AM) had the best dosimetry properties of those investigated. Sources of interference were studied. Thermal fading, residual signal and radiation damage do not limit TC dosimetry. Ultraviolet light can induce a TC response but it is readily excluded with uv-opaque cladding. Improper surface preparation prior to electrode evaporation was shown to cause interference. A spurious TC signal resulted from polarization of surface contaminants. Spurious TC was reduced by improved cleaning prior to electrode application. Polished surfaces resulted in blocking electrodes and caused a sensitivity shift due to radiation induced thermally activated polarization. This was not observed with rough cut surfaces.

  1. CHARACTERIZATION AND ALUMINUM DISSOLUTION DEMONSTRATION WITH A 3 LITER TANK 51H SAMPLE

    International Nuclear Information System (INIS)

    Hay, M; John Pareizs, J; Cj Bannochie, C; Michael Stone, M; Damon Click, D; Daniel McCabe, D

    2008-01-01

    A 3-liter sludge slurry sample was sent to SRNL for demonstration of a low temperature aluminum dissolution process. The sludge was characterized before and after the aluminum dissolution. Post aluminum dissolution sludge settling and the stability of the decanted supernate were also observed. The characterization of the as-received 3-liter sample of Tank 51H sludge slurry shows a typical high aluminum HM sludge. The XRD analysis of the dried solids indicates Boehmite is the predominant crystalline form of aluminum in the sludge solids. However, amorphous phases of aluminum present in the sludge would not be identified using this analytical technique. The low temperature (55 C) aluminum dissolution process was effective at dissolving aluminum from the sludge. Over the three week test, ∼42% of the aluminum was dissolved out of the sludge solids. The process appears to be selective for aluminum with no other metals dissolving to any appreciable extent. At the termination of the three week test, the aluminum concentration in the supernate had not leveled off indicating more aluminum could be dissolved from the sludge with longer contact times or higher temperatures. The slow aluminum dissolution rate in the test may indicate the dissolution of the Boehmite form of aluminum however; insufficient kinetic data exists to confirm this hypothesis. The aluminum dissolution process appears to have minimal impact on the settling rate of the post aluminum dissolution sludge. However, limited settling data were generated during the test to quantify the effects. The sludge settling was complete after approximately twelve days. The supernate decanted from the settled sludge after aluminum dissolution appears stable and did not precipitate aluminum over the course of several months. A mixture of the decanted supernate with Tank 11 simulated supernate was also stable with respect to precipitation

  2. Design and research on discharge performance for aluminum-air battery

    Science.gov (United States)

    Liu, Zu; Zhao, Junhong; Cai, Yanping; Xu, Bin

    2017-01-01

    As a kind of clean energy, the research of aluminum air battery is carried out because aluminum-air battery has advantages of high specific energy, silence and low infrared. Based on the research on operating principle of aluminum-air battery, a novel aluminum-air battery system was designed composed of aluminum-air cell and the circulation system of electrolyte. A system model is established to analyze the polarization curve, the constant current discharge performance and effect of electrolyte concentration on the performance of monomer. The experimental results show that the new energy aluminum-air battery has good discharge performance, which lays a foundation for its application.

  3. Validity of the Aluminum Equivalent Approximation in Space Radiation Shielding

    Science.gov (United States)

    Badavi, Francis F.; Adams, Daniel O.; Wilson, John W.

    2009-01-01

    The origin of the aluminum equivalent shield approximation in space radiation analysis can be traced back to its roots in the early years of the NASA space programs (Mercury, Gemini and Apollo) wherein the primary radiobiological concern was the intense sources of ionizing radiation causing short term effects which was thought to jeopardize the safety of the crew and hence the mission. Herein, it is shown that the aluminum equivalent shield approximation, although reasonably well suited for that time period and to the application for which it was developed, is of questionable usefulness to the radiobiological concerns of routine space operations of the 21 st century which will include long stays onboard the International Space Station (ISS) and perhaps the moon. This is especially true for a risk based protection system, as appears imminent for deep space exploration where the long-term effects of Galactic Cosmic Ray (GCR) exposure is of primary concern. The present analysis demonstrates that sufficiently large errors in the interior particle environment of a spacecraft result from the use of the aluminum equivalent approximation, and such approximations should be avoided in future astronaut risk estimates. In this study, the aluminum equivalent approximation is evaluated as a means for estimating the particle environment within a spacecraft structure induced by the GCR radiation field. For comparison, the two extremes of the GCR environment, the 1977 solar minimum and the 2001 solar maximum, are considered. These environments are coupled to the Langley Research Center (LaRC) deterministic ionized particle transport code High charge (Z) and Energy TRaNsport (HZETRN), which propagates the GCR spectra for elements with charges (Z) in the range I aluminum equivalent approximation for a good polymeric shield material such as genetic polyethylene (PE). The shield thickness is represented by a 25 g/cm spherical shell. Although one could imagine the progression to greater

  4. A Rare but Potentially Fatal Poisoning; Aluminum Phosphide Poisoning

    Directory of Open Access Journals (Sweden)

    Orkun Tolunay

    2017-04-01

    Full Text Available Phosphide, a very toxic gas, is used in our country as aluminium phosphide tablets impregnated in clay. It is widely used since it has a very high diffusion capacity, whereby it can eradicate all living creatures in any form of their life cycle and does not leave any remnants in agricultural products. Aluminum phosphide poisoning is among intoxications for which there are still no true antidotes. Mortality rate varies between 30% and 100%. This paper presents a case of aluminum phosphide poisoning caused by the uncompleted suicide attempt. A 14-year-old girl, who swallowed aluminum phosphate tablets, was brought to the emergency department with the complaints of nausea and vomiting. The patient was treated with gastric lavage and activated charcoal. Since the patient ingested a lethal amount of aluminum phosphide, she was referred to the pediatric intensive care unit. The patient was discharged in stable condition after supportive care and monitoring. Specific antidotes are life-saving in poisonings. However, this case was presented to show how general treatment principles and quick access to health services affect the result of treatment. Also, we aimed to highlight the uncontrolled selling of aluminum phosphate, which results in high mortality rates in case of poisoning.

  5. Passivation and Stabilization of Aluminum Nanoparticles for Energetic Materials

    Directory of Open Access Journals (Sweden)

    Matthew Flannery

    2015-01-01

    Full Text Available In aircraft applications, fuel is used not only as a propellant but also as a coolant and improving both the thermal conductivity and combustion enthalpy of the fuel is beneficial in these applications. These properties can be enhanced by dispersing aluminum nanoparticles into the fuel; however, the nanoparticles require stabilization from agglomeration and passivation from oxidation in order for these benefits to be realized in aircraft applications. To provide this passivation and stabilization, aluminum nanoparticles were encapsulated with a coating by the plasma enhanced chemical vapor deposition (PE-CVD method from toluene precursors. The thermal conductivity, combustion and ignition properties, and stability of the nanoparticles dispersed in RP-2 fuel were subsequently evaluated. In addition, the effect of dispersing aluminum nanoparticles in RP-2 fuel on the erosion rate of fuel nozzles was evaluated. The dispersion of PE-CVD coated aluminum nanoparticles at a concentration of 3.0% by volume exhibited a 17.7% and 0.9% increase in thermal conductivity and volumetric enthalpy of combustion, respectively, compared to the baseline RP-2 fuel. Additionally, particle size analysis (PSA of the PE-CVD coated aluminum nanofuel exhibited retention of particle size over a five-month storage period and erosion testing of a 1 mm stainless steel nozzle exhibited a negligible 1% change in discharge coefficient after 100 hours of testing.

  6. Predictors of Poor Prognosis in Aluminum Phosphide Intoxication

    Directory of Open Access Journals (Sweden)

    Fakhredin Taghaddosi Nejad

    2012-05-01

    Full Text Available Background: Aluminum phosphide as a fumigant is extensively used for wheat preservation from rodents and bugs especially in silos worldwide. There is increasing number of acute intoxication with this potentially lethal compound because of its easy availability. We have tried to locate predictors of poor prognosis in patients with aluminum phosphide intoxication in order to find patients who need more strict medical cares. Methods: All cases of aluminum phosphide intoxication that had been referred to our hospital during April 2008 to March 2010 were studied by their medical dossiers. Pertinent data including vital signs, demographic features, clinical and lab findings, and incidence of any complication were collected and analyzed by the relevant statistical methods. Results: Sixty seven cases of aluminum phosphide intoxication were included in the study. 44.8% of them were male. 97% of cases were suicidal. Mean amount of ingestion was 1.23+/- 0.71 tablets. Mortality rate was 41.8%. ECG abnormality and need for mechanical ventilation had negative relation with outcome. Conclusion: Correlation between some findings and complications with outcome in aluminum phosphide intoxication can be used as guidance for risk assessment and treatment planning in the patients.

  7. Fracture toughness of steel--aluminum deformation welds

    International Nuclear Information System (INIS)

    Albright, C.E.

    1978-11-01

    A study of the fracture toughness (in this case, G/sub Ic/) of steel--aluminum deformation welds using a specially developed double cantilever beam fracture toughness specimen is presented. Welds made at 350 0 C were heat treated at 360, 380, 400, 420, and 440 0 C. An intermetallic reaction product layer of Fe 2 Al 5 is formed at the steel--aluminum interface with increasing heat treating temperature and time by a process of nucleation and growth of discrete particles. A transition in toughness from a higher average G/sub Ic/ value (6097 N/m) to a very low average G/sub Ic/ value (525 N/m) is observed. The decrease in toughness is accompanied by an increase in Fe 2 Al 5 particle diameter from 4 to 8 μm. Failure at the higher toughness values is characterized by ductile rupture through the aluminum. At the lower toughness values, failure occurs between the aluminum and the Fe 2 Al 5 reaction product layer. A void layer forming by a vacancy condensation mechanism in the aluminum adjacent to the Fe 2 Al 5 is shown to cause the embrittlement

  8. Aluminum-Enhanced Underwater Electrical Discharges for Steam Explosion Triggering

    International Nuclear Information System (INIS)

    HOGELAND, STEVE R.; NELSON, LLOYD S.; ROTH, THOMAS CHRISTOPHER

    1999-01-01

    For a number of years, we have been initiating steam explosions of single drops of molten materials with pressure and flow (bubble growth) transients generated by discharging a capacitor bank through gold bridgewires placed underwater. Recent experimental and theoretical advances in the field of steam explosions, however, have made it important to substantially increase these relatively mild transients in water without using high explosives, if possible. To do this with the same capacitor bank, we have discharged similar energies through tiny strips of aluminum foil submerged in water. By replacing the gold wires with the aluminum strips, we were able to add the energy of the aluminum-water combustion to that normally deposited electrically by the bridgewire explosion in water. The chemical enhancement of the explosive characteristics of the discharges was substantial: when the same electrical energies were discharged through the aluminum strips, peak pressures increased as much as 12-fold and maximum bubble volumes as much as 5-fold above those generated with the gold wires. For given weights of aluminum, the magnitudes of both parameters appeared to exceed those produced by the underwater explosion of equivalent weights of high explosives

  9. Bilayer lift-off process for aluminum metallization

    Science.gov (United States)

    Wilson, Thomas E.; Korolev, Konstantin A.; Crow, Nathaniel A.

    2015-01-01

    Recently published reports in the literature for bilayer lift-off processes have described recipes for the patterning of metals that have recommended metal-ion-free developers, which do etch aluminum. We report the first measurement of the dissolution rate of a commercial lift-off resist (LOR) in a sodium-based buffered commercial developer that does not etch aluminum. We describe a reliable lift-off recipe that is safe for multiple process steps in patterning thin (recipe consists of an acid cleaning of the substrate, the bilayer (positive photoresist/LOR) deposition and development, the sputtering of the aluminum film along with a palladium capping layer and finally, the lift-off of the metal film by immersion in the LOR solvent. The insertion into the recipe of postexposure and sequential develop-bake-develop process steps are necessary for an acceptable undercut. Our recipe also eliminates any need for accompanying sonication during lift-off that could lead to delamination of the metal pattern from the substrate. Fine patterns were achieved for both 100-nm-thick granular aluminum/palladium bilayer bolometers and 500-nm-thick aluminum gratings with 6-μm lines and 4-μm spaces.

  10. 40 CFR 63.5749 - How do I calculate the organic HAP content of aluminum wipedown solvents?

    Science.gov (United States)

    2010-07-01

    ... Manufacturing Standards for Aluminum Recreational Boat Surface Coating Operations § 63.5749 How do I calculate... fraction of organic HAP in aluminum wipedown solvent j. m = number of different aluminum surface coatings...

  11. Wear resistance analysis of the aluminum 7075 alloy and the nanostructured aluminum 7075 - silver nanoparticles composites

    Directory of Open Access Journals (Sweden)

    Estrada-Ruiz R.H.

    2016-01-01

    Full Text Available Nanostructured composites of the aluminum 7075 alloy and carbon-coated silver nanoparticles were synthetized by the mechanical milling technique using a high-energy mill SPEX 8000M; the powders generated were compacted, sintered and hot-extruded to produce 1 cm-diameter bars. The composites were then subjected to a wear test using a pin-on-disc device to validate the hypothesis that second phase-ductile nanometric particles homogenously distributed throughout the metalmatrix improve the wear resistance of the material. It was found that silver nanoparticles prevent the wear of the material by acting as an obstacle to dislocations movement during the plastic deformation of the contact surface, as well as a solid lubricant when these are separated from the metal-matrix.

  12. High strength cast aluminum alloy development

    Science.gov (United States)

    Druschitz, Edward A.

    The goal of this research was to understand how chemistry and processing affect the resulting microstructure and mechanical properties of high strength cast aluminum alloys. Two alloy systems were investigated including the Al-Cu-Ag and the Al-Zn-Mg-Cu systems. Processing variables included solidification under pressure (SUP) and heat treatment. This research determined the range in properties that can be achieved in BAC 100(TM) (Al-Cu micro-alloyed with Ag, Mn, Zr, and V) and generated sufficient property data for design purposes. Tensile, stress corrosion cracking, and fatigue testing were performed. CuAl2 and Al-Cu-Fe-Mn intermetallics were identified as the ductility limiting flaws. A solution treatment of 75 hours or longer was needed to dissolve most of the intermetallic CuAl 2. The Al-Cu-Fe-Mn intermetallic was unaffected by heat treatment. These results indicate that faster cooling rates, a reduction in copper concentration and a reduction in iron concentration might increase the ductility of the alloy by decreasing the size and amount of the intermetallics that form during solidification. Six experimental Al-Zn-Mg-Cu series alloys were produced. Zinc concentrations of 8 and 12wt% and Zn/Mg ratios of 1.5 to 5.5 were tested. Copper was held constant at 0.9%. Heat treating of the alloys was optimized for maximum hardness. Al-Zn-Mg-Cu samples were solution treated at 441°C (826°F) for 4 hours before ramping to 460°C (860°F) for 75 hours and then aged at 120°C (248°F) for 75 hours. X-ray diffraction showed that the age hardening precipitates in most of these alloys was the T phase (Mg32Zn 31.9Al17.1). Tensile testing of the alloys showed that the best mechanical properties were obtained in the lowest alloy condition. Chilled Al-8.2Zn-1.4Mg-0.9Cu solidified under pressure resulted in an alloy with a yield strength of 468MPa (68ksi), tensile strength of 525MPa (76ksi) and an elongation of 9%.

  13. Photon energy response of an aluminum oxide TLD environmental dosimeter

    International Nuclear Information System (INIS)

    Olsher, R.H.

    1992-01-01

    Because of aluminum oxide's significant advantage in sensitivity (about a factor of 30) over LiF, minimal fading characteristics and ease of processing, aluminum oxide thermoluminescent dosimeters (TLDS) are being phased in at Los alamos for environmental monitoring of photon radiation. The new environmental dosimeter design consists of a polyethylene holder, about 0. 5 cm thick, loaded with a stack of four aluminum oxide TLD chips, each 1 mm thick and 5 mm in diameter. As part of the initial evaluation of the new design, the photon energy response of the dosimeter was calculated over the range from 10 keV to 1 MeV. Specific goals of the analysis included the determination of individual chip response in the stack, assessment of the response variation due to TLD material (i.e., LiF versus A1 2 O 3 ), and the effect of copper filtration in flattening the response

  14. Fatigue crack propagation in aluminum-lithium alloys

    Science.gov (United States)

    Rao, K. T. V.; Ritchie, R. O.; Piascik, R. S.; Gangloff, R. P.

    1989-01-01

    The principal mechanisms which govern the fatigue crack propagation resistance of aluminum-lithium alloys are investigated, with emphasis on their behavior in controlled gaseous and aqueous environments. Extensive data describe the growth kinetics of fatigue cracks in ingot metallurgy Al-Li alloys 2090, 2091, 8090, and 8091 and in powder metallurgy alloys exposed to moist air. Results are compared with data for traditional aluminum alloys 2024, 2124, 2618, 7075, and 7150. Crack growth is found to be dominated by shielding from tortuous crack paths and resultant asperity wedging. Beneficial shielding is minimized for small cracks, for high stress ratios, and for certain loading spectra. While water vapor and aqueous chloride environments enhance crack propagation, Al-Li-Cu alloys behave similarly to 2000-series aluminum alloys. Cracking in water vapor is controlled by hydrogen embrittlement, with surface films having little influence on cyclic plasticity.

  15. Typical corrosion of alumina refractory in aluminum reflow oven

    International Nuclear Information System (INIS)

    Baldo, Jaoa B.

    2014-01-01

    The refractory linings of furnaces for secondary melting of aluminum, are exposed to intense attack by the molten metal. This occurs, because molten aluminum has a strong reducing power over the refractory oxide components, particularly Fe 2 O 3 , SiO 2 and TiO 2 . In this work, based on X-ray diffraction and scanning electron microscopy, it is presented a post mortem study of the mechanisms that lead to a premature wear of a 80% Al2O3 chemically bonded refractory bricks, used in the metal line of an aluminum re-melting furnace. The SEM analysis demonstrated that the oxides SiO 2 and TiO 2 contained in the refractory were reduced and transformed into their metallic elements causing an intense structural spalling. (author)

  16. Diffusionless bonding of aluminum to type 304 stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Watson, R D

    1963-03-15

    High strength diffusionless bonds can be produced between 1S aluminum and oxidized 304 stainless steel by hot pressing and extrusion bonding. Both the hot pressing and extrusion bonding techniques have been developed to a point where consistently good bonds can be obtained. Although the bonding is performed at elevated temperatures (about 510{sup o}C) a protective atmosphere is not required to produce strong bonds. The aluminum-stainless steel bonded specimens can be used to join aluminum and stainless steel by conventional welding. Welding close to the bond zone does not appear to affect the integrity of the bond. The extrusion bonding technique is covered by Canadian patent 702,438 January 26, 1965 and the hot press bonding technique by Canadian patent application 904,548 June 6, 1964. (author)

  17. Plasma Decontamination of Uranium From the Interior of Aluminum Objects

    International Nuclear Information System (INIS)

    Veilleux, J.M.; Munson, C.; Fitzpatrick, J.; Chamberlin, E.P.; El-Genk, M.S.

    1997-01-01

    RF plasma glow discharges are being investigated for removing and recovering radioactive elements from contaminated objects, especially those contaminated with transuranic (TRU) materials. These plasmas, using nitrogen trifluoride as the working gas, have been successful at removing uranium and plutonium contaminants from test coupons of stainless steel and aluminum surfaces, including small cracks and crevices, and the interior surfaces of relatively hard to reach aluminum pipes. Contaminant removal exceeded 99.9% from simple surfaces and contaminant recovery using cryogenic traps has exceeded 50%. Work continues with the objective of demonstrating that transuranic contaminated waste can be transformed to low level waste (LLW) and to better understand the physics of the interaction between plasma and surface contaminants. This work summarizes the preliminary results from plasma decontamination from the interior of aluminum objects--the nooks and crannies experiments

  18. FSW of Aluminum Tailor Welded Blanks across Machine Platforms

    Energy Technology Data Exchange (ETDEWEB)

    Hovanski, Yuri; Upadhyay, Piyush; Carlson, Blair; Szymanski, Robert; Luzanski, Tom; Marshall, Dustin

    2015-02-16

    Development and characterization of friction stir welded aluminum tailor welded blanks was successfully carried out on three separate machine platforms. Each was a commercially available, gantry style, multi-axis machine designed specifically for friction stir welding. Weld parameters were developed to support high volume production of dissimilar thickness aluminum tailor welded blanks at speeds of 3 m/min and greater. Parameters originally developed on an ultra-high stiffness servo driven machine where first transferred to a high stiffness servo-hydraulic friction stir welding machine, and subsequently transferred to a purpose built machine designed to accommodate thin sheet aluminum welding. The inherent beam stiffness, bearing compliance, and control system for each machine were distinctly unique, which posed specific challenges in transferring welding parameters across machine platforms. This work documents the challenges imposed by successfully transferring weld parameters from machine to machine, produced from different manufacturers and with unique control systems and interfaces.

  19. COMPILATION OF LABORATORY SCALE ALUMINUM WASH AND LEACH REPORT RESULTS

    International Nuclear Information System (INIS)

    Harrington, S.J.

    2011-01-01

    This report compiles and analyzes all known wash and caustic leach laboratory studies. As further data is produced, this report will be updated. Included are aluminum mineralogical analysis results as well as a summation of the wash and leach procedures and results. Of the 177 underground storage tanks at Hanford, information was only available for five individual double-shell tanks, forty-one individual single-shell tanks (e.g. thirty-nine 100 series and two 200 series tanks), and twelve grouped tank wastes. Seven of the individual single-shell tank studies provided data for the percent of aluminum removal as a function of time for various caustic concentrations and leaching temperatures. It was determined that in most cases increased leaching temperature, caustic concentration, and leaching time leads to increased dissolution of leachable aluminum solids.

  20. Assessment of Aluminum FSW Joints Using Ultrasonic Testing

    Directory of Open Access Journals (Sweden)

    Adamus K.

    2017-12-01

    Full Text Available The paper concerns aluminum joints made using friction stir welding. Although in the aerospace industry there is a tendency to replace metal components with composites, aluminum continues to be a valuable material. Its share in the aircraft structures is the biggest among all structural metals. Lots of aluminum components are made of sheets and most of them require joining. Friction stir welding is a relatively new joining technology, particularly with regard to the sheets having a thickness of 1 mm or lower. The paper is dedicated to non-destructive testing of such joints using ultrasonic inspection. It was found that ultrasonic testing allows for distinguishing between joints without material discontinuities, joint with material discontinuities at the advancing side and joint with discontinuities extending through the whole width of the stir zone. During research only horizontally aligned defects were taken into account.

  1. New-Generation Aluminum Composite with Bottom Ash Industrial Waste

    Science.gov (United States)

    Mandal, A. K.; Sinha, O. P.

    2018-06-01

    Industrial waste bottom ash (BA) from a pulverized coal combustion boiler containing hard wear-resistant particles was utilized in this study to form an aluminum composite through a liquid metallurgy route. Composites comprising 5 wt.% and 10 wt.% bottom ash were characterized for their physiochemical, microstructural, mechanical, as well as tribological properties, along with pure aluminum. Scanning electron microscopy (SEM) microstructure revealed uniform distribution of BA particles throughout the matrix of the composite, whereas x-ray diffraction (XRD) analysis confirmed presence of aluminosilicate phase. Addition of 10 wt.% BA improved the Brinell hardness number (BHN) from 13 to 19 and ultimate tensile strength (UTS) from 71 MPa to 87 MPa, whereas ductility was adversely reduced after 5% BA addition. Incorporation of BA particles resulted in reduced dry sliding wear rates examined up to 80 N load compared with aluminum. Hence, such composites having lower cost could be applied as significantly hard, wear-resistant materials in applications in the automotive industry.

  2. Microstructure, Friction and Wear of Aluminum Matrix Composites

    Science.gov (United States)

    Florea, R. M.

    2018-06-01

    MMCs are made by dispersing a reinforcing material into a metal matrix. They are prepared by casting, although several technical challenges exist with casting technology. Achieving a homogeneous distribution of reinforcement within the matrix is one such challenge, and this affects directly on the properties and quality of composite. The aluminum alloy composite materials consist of high strength, high stiffness, more thermal stability, more corrosion and wear resistance, and more fatigue life. Aluminum alloy materials found to be the best alternative with its unique capacity of designing the materials to give required properties. In this work a composite is developed by adding silicon carbide in Aluminum metal matrix by mass ratio 5%, 10% and 15%. Mechanical tests such as hardness test and microstructure test are conducted.

  3. Improvement of the mechanical properties of reinforced aluminum foam samples

    Science.gov (United States)

    Formisano, A.; Barone, A.; Carrino, L.; De Fazio, D.; Langella, A.; Viscusi, A.; Durante, M.

    2018-05-01

    Closed-cell aluminum foam has attracted increasing attention due to its very interesting properties, thanks to which it is expected to be used as both structural and functional material. A research challenge is the improvement of the mechanical properties of foam-based structures adopting a reinforced approach that does not compromise their lightness. Consequently, the aim of this research is the fabrication of enhanced aluminum foam samples without significantly increasing their original weight. In this regard, cylindrical samples with a core of closed-cell aluminum foam and a skin of fabrics and grids of different materials were fabricated in a one step process and were mechanically characterized, in order to investigate their behaviour and to compare their mechanical properties to the ones of the traditional foam.

  4. Room Temperature Anodization of Aluminum at Low Voltage

    International Nuclear Information System (INIS)

    Kamal, A.; Abdel-Karim, R.; El-Raghy, S.; EL-Sherif, R.M.; Wheed, A.

    2013-01-01

    Membranes with nanometer-scale features have many applications, such as in optics, electronics, catalysis, selective molecule separation, filtration and purification, bio sensing, and single-molecule detection. Anodization process was conducted using 15, 20, 30 and 35% by volume phosphoric acid. Results showed that Porous Anodized Aluminum (PAA) with ideal nano pore arrays can be fabricated at room temperature by one-step anodization on high purity aluminum foil at 5 V. Morphology of the PAA was characterized by scanning electron microscopy (SEM). The electrochemical behavior of anodized aluminum was studied in 0.1 M Na 2 SO 4 solutions using electrochemical impedance spectroscopy (EIS). The highest resistance of the porous layer (R p ) was detected for the samples anodized in 20% phosphoric acid

  5. Optical scattering from rough-rolled aluminum surfaces.

    Science.gov (United States)

    Rönnelid, M; Adsten, M; Lindström, T; Nostell, P; Wäckelgård, E

    2001-05-01

    Bidirectional, angular resolved scatterometry was used to evaluate the feasibility of using rolled aluminum as reflectors in solar thermal collectors and solar cells. Two types of rolled aluminum with different surface roughnesses were investigated. The results show that the smoother of the two samples [rms height, (0.20 ? 0.02) mum] can be used as a nonimaging, concentrating reflector with moderate reflection losses compared with those of optically smooth aluminum reflectors. The sample with the rougher surface [rms height, (0.6 ? 0.1) mum] is not suitable as a concentrating element but can be used as planar reflectors. The orientation of the rolling grooves is then of importance for minimizing reflection losses in the system.

  6. New-Generation Aluminum Composite with Bottom Ash Industrial Waste

    Science.gov (United States)

    Mandal, A. K.; Sinha, O. P.

    2018-02-01

    Industrial waste bottom ash (BA) from a pulverized coal combustion boiler containing hard wear-resistant particles was utilized in this study to form an aluminum composite through a liquid metallurgy route. Composites comprising 5 wt.% and 10 wt.% bottom ash were characterized for their physiochemical, microstructural, mechanical, as well as tribological properties, along with pure aluminum. Scanning electron microscopy (SEM) microstructure revealed uniform distribution of BA particles throughout the matrix of the composite, whereas x-ray diffraction (XRD) analysis confirmed presence of aluminosilicate phase. Addition of 10 wt.% BA improved the Brinell hardness number (BHN) from 13 to 19 and ultimate tensile strength (UTS) from 71 MPa to 87 MPa, whereas ductility was adversely reduced after 5% BA addition. Incorporation of BA particles resulted in reduced dry sliding wear rates examined up to 80 N load compared with aluminum. Hence, such composites having lower cost could be applied as significantly hard, wear-resistant materials in applications in the automotive industry.

  7. Exergy analysis of aluminum recovery from municipal solid waste incineration

    DEFF Research Database (Denmark)

    Vyzinkarova, Dana; Allegrini, Elisa; Laner, D.

    Two main challenges, associated with the recovery of aluminum from state-of-the-art municipal solid waste (MSW) incineration plants, are yield as well as quality losses of metallic aluminum due to particle surface oxidation and presence of impurities. Yet, in the framework of life cycle assessment...... (LCA) a direct measure for expressing the quality of primary and secondary resources is missing. In view of a possible solution, exergy has been proposed as a concept to evaluate the quality of resources. In this paper, LCA and exergy analyses for two waste treatment approaches are conducted...... in parallel to each other, with a goal to evaluate the added value of exergy for LCA studies in the resource recovery context. The functional unit is the treatment of 1 ton MSW. Two alternative approaches for recovering aluminum from MSW directed to a waste-to-energy plant are considered. A) MSW is treated...

  8. Comments on process of duplex coatings on aluminum alloys

    Institute of Scientific and Technical Information of China (English)

    Samir H.A.; QIAN Han-cheng(钱翰城); XIA Bo-cai(夏伯才); WU Shi-ming(吴仕明)

    2004-01-01

    Despite the great achievements made in improvement of wear resistance properties of aluminum alloys,their applications in heavy surface load-bearing are limited. Single coating is insufficient to produce the desired combination of surface properties. These problems can be solved through the duplex coatings. The aim of the present study is to overview the research advances on processes of duplex coatings on aluminum alloys combined with micro plasma oxidation process and with other modern processes such as physical vapour deposition and plasma assisted chemical vapour deposition and also to evaluate the performance of micro plasma oxidation coatings in improving the load-bearing, friction and wear resistance properties of aluminum alloys in comparison with other coatings. Wherein, a more detailed presentation of the processes and their performances and disadvantages are given as well.

  9. Extraction of lithium from sea water with metallic aluminum

    International Nuclear Information System (INIS)

    Takeuchi, Takeji

    1980-01-01

    Extraction of lithium from sea water was investigated. It was found that a corrosion product of metallic aluminum immersed in sea water extracts lithium from it selectively. Effects of the temperature and the pH of sea water, and of the initial concentration of lithium in it were examined. On the basis of the analysis of the surface deposit on aluminum, which is a corrosion product of aluminum, the selectivity coefficients were calculated. For the extraction of lithium from natural sea water, the values of K sub(Na)sup(Li), K sub(Mg)sup(Li), K sub(Ca)sup(Li) and K sub(K)sup(Li) were 9.9 x 10 2 , 1.1 x 10, 4.5 x 10 and 4.4 x 10 2 , respectively. (author)

  10. The aluminum smelting process and innovative alternative technologies.

    Science.gov (United States)

    Kvande, Halvor; Drabløs, Per Arne

    2014-05-01

    The industrial aluminum production process is addressed. The purpose is to give a short but comprehensive description of the electrolysis cell technology, the raw materials used, and the health and safety relevance of the process. This article is based on a study of the extensive chemical and medical literature on primary aluminum production. At present, there are two main technological challenges for the process--to reduce energy consumption and to mitigate greenhouse gas emissions. A future step may be carbon dioxide gas capture and sequestration related to the electric power generation from fossil sources. Workers' health and safety have now become an integrated part of the aluminum business. Work-related injuries and illnesses are preventable, and the ultimate goal to eliminate accidents with lost-time injuries may hopefully be approached in the future.

  11. Dehydration of aluminum chloride hexahydrate: a technical assessment

    International Nuclear Information System (INIS)

    Miller, R.L.

    1984-04-01

    Physical and chemical properties of aluminum chloride hexahydrate, ACH, and related compounds are noted as well as the relation of these properties to the problem of dehydration of ACH to form anhydrous aluminum chloride. Several approaches to the dehydration of ACH are discussed and a rationale or each approach is given: solvent extraction, ligand exchange, azeotropic distillation, chemical dehydration, and energy specific direct heating. While the thermodynamics of dehydration are frequently favorable, the rate of reaction and the mechanisms of reaction are more frequently unfavorable. However, each approach requires experimentation to test its effectiveness. The stability of the aluminum-oxygen bond in the hydrate is such that dehydration without decomposition to the oxide will be very difficult

  12. Characterization of 2024-T3: An aerospace aluminum alloy

    International Nuclear Information System (INIS)

    Huda, Zainul; Taib, Nur Iskandar; Zaharinie, Tuan

    2009-01-01

    The 2024-T3 aerospace aluminum alloy, reported in this investigation, was acquired from a local aerospace industry: Royal Malaysian Air Force (RMAF). The heat treatable 2024-T3 aluminum alloy has been characterized by use of modern metallographic and material characterization techniques (e.g. EPMA, SEM). The microstructural characterization of the metallographic specimen involved use of an optical microscope linked with a computerized imaging system using MSQ software. The use of EPMA and electron microprobe elemental maps enabled us to detect three types of inclusions: Al-Cu, Al-Cu-Fe-Mn, and Al-Cu-Fe-Si-Mn enriched regions. In particular, the presence of Al 2 CuMg (S-phase) and the CuAl 2 (θ') phases indicated precipitation strengthening in the aluminum alloy

  13. Characterization of 2024-T3: An aerospace aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    Huda, Zainul [Department of Mechanical Engineering, University of Malaya, Kuala Lumpur (Malaysia)], E-mail: drzainulhuda@hotmail.com; Taib, Nur Iskandar [Department of Geology, University of Malaya, Kuala Lumpur (Malaysia)], E-mail: ntaib@alumni.indiana.edu; Zaharinie, Tuan [Department of Mechanical Engineering, University of Malaya, Kuala Lumpur (Malaysia)], E-mail: rinie_3483@hotmail.com

    2009-02-15

    The 2024-T3 aerospace aluminum alloy, reported in this investigation, was acquired from a local aerospace industry: Royal Malaysian Air Force (RMAF). The heat treatable 2024-T3 aluminum alloy has been characterized by use of modern metallographic and material characterization techniques (e.g. EPMA, SEM). The microstructural characterization of the metallographic specimen involved use of an optical microscope linked with a computerized imaging system using MSQ software. The use of EPMA and electron microprobe elemental maps enabled us to detect three types of inclusions: Al-Cu, Al-Cu-Fe-Mn, and Al-Cu-Fe-Si-Mn enriched regions. In particular, the presence of Al{sub 2}CuMg (S-phase) and the CuAl{sub 2} ({theta}') phases indicated precipitation strengthening in the aluminum alloy.

  14. CHARACTERIZATION OF NEW TOOL STEEL FOR ALUMINUM EXTRUSION DIES

    Directory of Open Access Journals (Sweden)

    José Britti Bacalhau

    2014-06-01

    Full Text Available Aluminum extrusion dies are an important segment of application on industrial tools steels, which are manufactured in steels based on AISI H13 steel. The main properties of steels applied to extrusion dies are: wear resistance, impact resistance and tempering resistance. The present work discusses the characteristics of a newly developed hot work steel to be used on aluminum extrusion dies. The effects of Cr and Mo contents with respect to tempering resistance and the Al addition on the nitriding response have been evaluated. From forged steel bars, Charpy impact test and characterization via EPMA have been conducted. The proposed contents of Cr, Mo, and Al have attributed to the new VEX grade a much better tempering resistance than H13, as well as a deeper and harder nitrided layer. Due to the unique characteristics, this new steel provides an interesting alternative to the aluminum extrusion companies to increase their competitiveness.

  15. Friction stir welding process to repair voids in aluminum alloys

    Science.gov (United States)

    Rosen, Charles D. (Inventor); Litwinski, Edward (Inventor); Valdez, Juan M. (Inventor)

    1999-01-01

    The present invention provides an in-process method to repair voids in an aluminum alloy, particularly a friction stir weld in an aluminum alloy. For repairing a circular void or an in-process exit hole in a weld, the method includes the steps of fabricating filler material of the same composition or compatible with the parent material into a plug form to be fitted into the void, positioning the plug in the void, and friction stir welding over and through the plug. For repairing a longitudinal void (30), the method includes machining the void area to provide a trough (34) that subsumes the void, fabricating filler metal into a strip form (36) to be fitted into the trough, positioning the strip in the trough, and rewelding the void area by traversing a friction stir welding tool longitudinally through the strip. The method is also applicable for repairing welds made by a fusing welding process or voids in aluminum alloy workpieces themselves.

  16. Axenic aerobic biofilms inhibit corrosion of copper and aluminum.

    Science.gov (United States)

    Jayaraman, A; Ornek, D; Duarte, D A; Lee, C C; Mansfeld, F B; Wood, T K

    1999-11-01

    The corrosion behavior of unalloyed copper and aluminum alloy 2024 in modified Baar's medium has been studied with continuous reactors using electrochemical impedance spectroscopy. An axenic aerobic biofilm of either Pseudomonas fragi K or Bacillus brevis 18 was able to lessen corrosion as evidenced by a consistent 20-fold increase in the low-frequency impedance value of copper as well as by a consistent four- to seven-fold increase in the polarization resistance of aluminum 2024 after six days exposure compared to sterile controls. This is the first report of axenic aerobic biofilms inhibiting generalized corrosion of copper and aluminum. Addition of the representative sulfate-reducing bacterium (SRB) Desulfovibrio vulgaris (to simulate consortia corrosion behavior) to either the P. fragi K or B. brevis 18 protective biofilm on copper increased the corrosion to that of the sterile control unless antibiotic (ampicillin) was added to inhibit the growth of SRB in the biofilm.

  17. Evaluation of several corrosion protective coating systems on aluminum

    Science.gov (United States)

    Higgins, R. H.

    1981-01-01

    A study of several protective coating systems for use on aluminum in seawater/seacoast environments was conducted to review the developments made on protective coatings since early in the Space Shuttle program and to perform comparative studies on these coatings to determine their effectiveness for providing corrosion protection during exposure to seawater/seacoast environments. Panels of 2219-T87 aluminum were coated with 21 different systems and exposed to a 5 percent salt spray for 4000 hr. Application properties, adhesion measurements, heat resistance and corrosion protection were evaluated. For comparative studies, the presently specified Bostik epoxy system used on the SRB structures was included. Results of these tests indicate four systems with outstanding performance and four additional systems with protection almost as good. These systems are based on a chromated pretreatment, a chromate epoxy primer, and a polyurethane topcoat. Consideration for one of these systems should be included for those applications where superior corrosion protection for aluminum surfaces is required.

  18. Corrosion of aluminum alloys in simulated dry storage environments

    International Nuclear Information System (INIS)

    Peacock, H.B. Jr.; Sindelar, R.L.; Lam, P.S.

    1996-01-01

    The effect of temperature and relative humidity on the high temperature (up to 150 degrees C) corrosion of aluminum alloys was investigated for dry storage of spent nuclear fuels in a closed or sealed system. A dependency on alloy type, temperature and initial humidity was determined for 1100, 5052 and 6061 aluminum alloys. Results after 4500 hours of environmental testing show that for a closed system, corrosion tends to follow a power law with the rate decreasing with increasing exposure. As corrosion takes place, two phenomena occur: (1) a hydrated layer builds up to resist corrosion, and (2) moisture is depleted from the system and the humidity slowly decreases with time. At a critical level of relative humidity, corrosion reactions stop, and no additional corrosion occurs if the system remains closed. The results form the basis for the development of an acceptance criteria for the dry storage of aluminum clad spent nuclear fuels

  19. Fracture Mechanics Prediction of Fatigue Life of Aluminum Highway Bridges

    DEFF Research Database (Denmark)

    Rom, Søren; Agerskov, Henning

    2015-01-01

    Fracture mechanics prediction of the fatigue life of aluminum highway bridges under random loading is studied. The fatigue life of welded joints has been determined from fracture mechanics analyses and the results obtained have been compared with results from experimental investigations. The fati......Fracture mechanics prediction of the fatigue life of aluminum highway bridges under random loading is studied. The fatigue life of welded joints has been determined from fracture mechanics analyses and the results obtained have been compared with results from experimental investigations...... against fatigue in aluminum bridges, may give results which are unconservative. Furthermore, it was in both investigations found that the validity of the results obtained from Miner's rule will depend on the distribution of the load history in tension and compression....

  20. Diffusionless bonding of aluminum to type 304 stainless steel

    International Nuclear Information System (INIS)

    Watson, R.D.

    1963-03-01

    High strength diffusionless bonds can be produced between 1S aluminum and oxidized 304 stainless steel by hot pressing and extrusion bonding. Both the hot pressing and extrusion bonding techniques have been developed to a point where consistently good bonds can be obtained. Although the bonding is performed at elevated temperatures (about 510 o C) a protective atmosphere is not required to produce strong bonds. The aluminum-stainless steel bonded specimens can be used to join aluminum and stainless steel by conventional welding. Welding close to the bond zone does not appear to affect the integrity of the bond. The extrusion bonding technique is covered by Canadian patent 702,438 January 26, 1965 and the hot press bonding technique by Canadian patent application 904,548 June 6, 1964. (author)

  1. The Aluminum Smelting Process and Innovative Alternative Technologies

    Science.gov (United States)

    Drabløs, Per Arne

    2014-01-01

    Objective: The industrial aluminum production process is addressed. The purpose is to give a short but comprehensive description of the electrolysis cell technology, the raw materials used, and the health and safety relevance of the process. Methods: This article is based on a study of the extensive chemical and medical literature on primary aluminum production. Results: At present, there are two main technological challenges for the process—to reduce energy consumption and to mitigate greenhouse gas emissions. A future step may be carbon dioxide gas capture and sequestration related to the electric power generation from fossil sources. Conclusions: Workers' health and safety have now become an integrated part of the aluminum business. Work-related injuries and illnesses are preventable, and the ultimate goal to eliminate accidents with lost-time injuries may hopefully be approached in the future. PMID:24806723

  2. COMPILATION OF LABORATORY SCALE ALUMINUM WASH AND LEACH REPORT RESULTS

    Energy Technology Data Exchange (ETDEWEB)

    HARRINGTON SJ

    2011-01-06

    This report compiles and analyzes all known wash and caustic leach laboratory studies. As further data is produced, this report will be updated. Included are aluminum mineralogical analysis results as well as a summation of the wash and leach procedures and results. Of the 177 underground storage tanks at Hanford, information was only available for five individual double-shell tanks, forty-one individual single-shell tanks (e.g. thirty-nine 100 series and two 200 series tanks), and twelve grouped tank wastes. Seven of the individual single-shell tank studies provided data for the percent of aluminum removal as a function of time for various caustic concentrations and leaching temperatures. It was determined that in most cases increased leaching temperature, caustic concentration, and leaching time leads to increased dissolution of leachable aluminum solids.

  3. Aluminum chloride restoration of in situ leached uranium ores

    International Nuclear Information System (INIS)

    Grant, D.C.; Burgman, M.A.

    1982-01-01

    During in situ uranium mining using ammonium bicarbonate lixiviant, the ammonium exchanges with cations on the ore's clay. After mining is complete, the ammonium may desorb into post-leach ground water. For the particular ore studied, other chemicals (i.e., uranium and selenium) which are mobilized during the leach process, have also been found in the post-leach ground water. Laboratory column tests, used to simulate the leaching process, have shown that aluminum chloride can rapidly remove ammonium from the ore and thus greatly reduce the subsequent ammonium leakage level into ground water. The aluminum chloride has also been found to reduce the leakage levels of uranium and selenium. In addition, the aluminum chloride treatment produces a rapid improvement in permeability

  4. Dietary intake of aluminum in a Spanish population (Canary Islands).

    Science.gov (United States)

    González-Weller, Dailos; Gutiérrez, Angel José; Rubio, Carmen; Revert, Consuelo; Hardisson, Arturo

    2010-10-13

    The aim of this study was to analyze the aluminum content in foods and beverages most commonly consumed by the Canary Island population to determine the dietary intake of this metal throughout the Canary Islands as a whole and in each of the seven islands (Gran Canaria, Lanzarote, Fuerteventura, Tenerife, La Palma, La Gomera, and El Hierro). Four hundred and forty samples were analyzed by ICP-OES. Estimated total intake of aluminum for the Canary population was 10.171 mg/day, slightly higher than the provisional tolerable weekly intake (PTWI; 10 mg/day for a person weighing 70 kg). Aluminum intake by age and sex of the Canary Island population was also determined and compared values from other populations, both national and international.

  5. Al/sub 2/S/sub 3/ preparation and use in electrolysis process for aluminum production

    Science.gov (United States)

    Hsu, C.C.; Loutfy, R.O.; Yao, N.P.

    A continuous process for producing aluminum sulfide and for electrolyzing the aluminum sulfide to form metallic aluminum in which the aluminum sulfide is produced from aluminum oxide and COS or CS/sub 2/ in the presence of a chloride melt which also serves as the electrolysis bath. Circulation between the reactor and electrolysis cell is carried out to maintain the desired concentration of aluminum sulfide in the bath.

  6. Acoustic emission from a solidifying aluminum-lithium alloy

    Science.gov (United States)

    Henkel, D. P.; Wood, J. D.

    1992-01-01

    Physical phenomena associated with the solidification of an AA2090 Al-Li alloy have been characterized by AE methods. Repeatable patterns of AE activity as a function of solidification time are recorded and explained for ultrahigh-purity (UHP) aluminum and an Al-4.7 wt pct Cu binary alloy, in addition to the AA2090 Al-Li alloy, by the complementary utilization of thermal, AE, and metallographic methods. One result shows that the solidification of UHP aluminum produces one discrete period of high AE activity as the last 10 percent of solid forms.

  7. High current density aluminum stabilized conductor concepts for space applications

    International Nuclear Information System (INIS)

    Huang, X.; Eyssa, Y.M.; Hilal, M.A.

    1989-01-01

    Lightweight conductors are needed for space magnets to achieve values of E/M (energy stored per unit mass) comparable to the or higher than advanced batteries. High purity aluminum stabilized NbTi composite conductors cooled by 1.8 K helium can provide a winding current density up to 15 kA/cm/sup 2/ at fields up to 10 tesla. The conductors are edge cooled with enough surface area to provide recovery following a normalizing disturbance. The conductors are designed so that current diffusion time in the high purity aluminum is smaller than thermal diffusion time in helium. Conductor design, stability and current diffusion are considered in detail

  8. Silicon diffusion in aluminum for rear passivated solar cells

    International Nuclear Information System (INIS)

    Urrejola, Elias; Peter, Kristian; Plagwitz, Heiko; Schubert, Gunnar

    2011-01-01

    We show that the lateral spread of silicon in a screen-printed aluminum layer increases by (1.50±0.06) μm/ deg. C, when increasing the peak firing temperature within an industrially applicable range. In this way, the maximum spread limit of diffused silicon in aluminum is predictable and does not depend on the contact area size but on the firing temperature. Therefore, the geometry of the rear side pattern can influence not only series resistance losses within the solar cell but the process of contact formation itself. In addition, too fast cooling lead to Kirkendall void formations instead of an eutectic layer.

  9. The corrosion protection of 2219-T87 aluminum by anodizing

    Science.gov (United States)

    Danford, M. D.

    1991-01-01

    Various types of anodizing coatings were studied for 2219-T87 aluminum. These include both type II and type III anodized coats which were water sealed and a newly developed and proprietary Magnaplate HCR (TM) coat. Results indicate that type II anodizing is not much superior to type II anodizing as far as corrosion protection for 2219-T87 aluminum is concerned. Magnaplate HCR (TM) coatings should provide superior corrosion protection over an extended period of time using a coating thickness of 51 microns (2.0 mils).

  10. Fabrication of high quality ordered porous anodic aluminum oxide templates

    International Nuclear Information System (INIS)

    Liu Kai; Du Kai; Chen Jing; Zhou Lan; Zhang Lin; Fang Yu

    2010-01-01

    The preparation of porous anodic aluminum oxide (AAO) templates has been studied with oxalic acid as electrolyte. The morphology of the as-prepared templates has been characterized by field-emission scanning electron microscope (FE-SEM). The pores distributed orderly and uniformly with the diameter ranging from 40 nm to 70 nm. The experimental results indicate that electrolyte concentration, oxidation voltage, oxidation temperature and oxidation time affect the structure of AAO templates. Ordered porous AAO templates can be derived without annealing and finishing. X-ray diffraction (XRD) analysis indicates that the aluminum oxide film is mainly composed of amorphous Al 2 O 3 . (authors)

  11. Effects of the Addictives on Etching Characteristics of Aluminum Foil

    Energy Technology Data Exchange (ETDEWEB)

    Kim, S.K.; Jang, J.M.; Chi, C.S. [Kookmin University, Seoul (Korea); Shin, D.C. [Sungnam Polytechnic, Sungnam (Korea); Lee, J.H.; Oh, H.J. [Hanseo University, Seosan (Korea)

    2001-01-01

    The effects of additives in the HCI etching solution on etching behaviors of aluminium foil as dielectric film for electrolytic capacitors were investigated. The etch pits formed in 1M hydrochloric acid containing ethylene glycol as an additive contain more fine and homogeneous etch tunnels compared to thoese in 1 M hydrochloric acid only, which led to the increase in the effective internal surface area of aluminum foil. After anodizing of aluminum foil etched in etching solutions, the LCR meter results have shown that the capacitance of dielectric film etched in hydrochloric acid with ethylene glycol was increased remarkably compared to that etched in hydrochloric acid only. (author). 21 refs., 10 figs.

  12. Interfacial reaction effects on erosion of aluminum matrix composites

    International Nuclear Information System (INIS)

    Tu, J.P.; Hiroshima Univ., Higashi-Hiroshima; Matsumura, M.

    1999-01-01

    Alumina borate (A 18 B 4 O 33 ) whisker reinforced aluminum composites have attracted interest because of their high specific strength, high modulus and low cost. An obvious feature of the microstructure in A 18 B 4 O 33 /Al composite is that an interfacial reaction exists between the whisker and the aluminum alloy. In order to discuss the influence of interface interaction between the whisker and matrix on the erosion resistance of composites, two reaction treatments are conducted. From the results of the treated composites, it can be obtained about the erosion characteristics of the composite materials under steady-state conditions

  13. TANK 12 SLUDGE CHARACTERIZATION AND ALUMINUM DISSOLUTION DEMONSTRATION

    International Nuclear Information System (INIS)

    Reboul, S.; Hay, Michael; Zeigler, Kristine; Stone, Michael

    2009-01-01

    A 3-L sludge slurry sample from Tank 12 was characterized and then processed through an aluminum dissolution demonstration. The dominant constituent of the sludge was found to be aluminum in the form of boehmite. The iron content was minor, about one-tenth that of the aluminum. The salt content of the supernatant was relatively high, with a sodium concentration of ∼7 M. Due to these characteristics, the yield stress and plastic viscosity of the unprocessed slurry were relatively high (19 Pa and 27 cP), and the settling rate of the sludge was relatively low (∼20% settling over a two and a half week period). Prior to performing aluminum dissolution, plutonium and gadolinium were added to the slurry to simulate receipt of plutonium waste from H-Canyon. Aluminum dissolution was performed over a 26 day period at a temperature of 65 C. Approximately 60% of the insoluble aluminum dissolved during the demonstration, with the rate of dissolution slowing significantly by the end of the demonstration period. In contrast, approximately 20% of the plutonium and less than 1% of the gadolinium partitioned to the liquid phase. However, about a third of the liquid phase plutonium became solubilized prior to the dissolution period, when the H-Canyon plutonium/gadolinium simulant was added to the Tank 12 slurry. Quantification of iron dissolution was less clear, but appeared to be on the order of 1% based on the majority of data (a minor portion of the data suggested iron dissolution could be as high as 10%). The yield stress of the post-dissolution slurry (2.5 Pa) was an order of magnitude lower than the initial slurry, due most likely to the reduced insoluble solids content caused by aluminum dissolution. In contrast, the plastic viscosity remained unchanged (27 cP). The settling rate of the post-dissolution slurry was higher than the initial slurry, but still relatively low compared to settling of typical high iron content/low salt content sludges. Approximately 40% of the

  14. Plasma diagnostics during magnetron sputtering of aluminum doped zinc oxide

    DEFF Research Database (Denmark)

    Stamate, Eugen; Crovetto, Andrea; Sanna, Simone

    2016-01-01

    Plasma parameters during magnetron sputtering of aluminum-doped zinc oxide are investigated with optical emission spectroscopy, electrostatic probes and mass spectrometry with the aim of understanding the role of negative ions of oxygen during the film growth and improving the uniformity of the f......Plasma parameters during magnetron sputtering of aluminum-doped zinc oxide are investigated with optical emission spectroscopy, electrostatic probes and mass spectrometry with the aim of understanding the role of negative ions of oxygen during the film growth and improving the uniformity...

  15. A model for recovery kinetics of aluminum after large strain

    DEFF Research Database (Denmark)

    Yu, Tianbo; Hansen, Niels

    2012-01-01

    A model is suggested to analyze recovery kinetics of heavily deformed aluminum. The model is based on the hardness of isothermal annealed samples before recrystallization takes place, and it can be extrapolated to longer annealing times to factor out the recrystallization component of the hardness...... for conditions where recovery and recrystallization overlap. The model is applied to the isothermal recovery at temperatures between 140 and 220°C of commercial purity aluminum deformed to true strain 5.5. EBSD measurements have been carried out to detect the onset of discontinuous recrystallization. Furthermore...

  16. Fatigue in Aluminum Highway Bridges under Random Loading

    DEFF Research Database (Denmark)

    Rom, Søren; Agerskov, Henning

    2014-01-01

    Fatigue damage accumulation in aluminum highway bridges under random loading is studied. The fatigue life of welded joints has been determined both experimentally and from a fracture mechanics analysis. In the experimental part of the investigation, fatigue test series on welded plate test...... is normally used in the design against fatigue in aluminum bridges, may give results which are unconservative. The validity of the results obtained from Miner’s rule will depend on the distribution of the load history in tension and compression....

  17. Initial Stages of Recrystallization in Aluminum of Commercial Purity

    DEFF Research Database (Denmark)

    Hansen, Niels; Bay, Bent

    1979-01-01

    In commercial aluminum with a purity of 99.4 pct, the formation and growth of recrystallization nuclei were studied by techniques such asin-situ annealing in a high voltage electron microscope, transmission electron microscopy and light microscopy. Sample parameters were the initial grain size (370...... by the FeAl3 particles present in the commercial aluminum as impurities. The nucleation temperatures determined by high voltage electron microscopy and transmission electron microscopy decrease markedly when the initial grain size is decreased both after 50 and 90 pct cold rolling; a less pronounced...

  18. Study of nanodispersed aluminum and iron alcosols by photoacoustic spectroscopy

    Science.gov (United States)

    An, Vladimir; de Izarra, Charles; Saveliev, Gennady

    2011-06-01

    Nanodispersed aluminum and iron alcosols were prepared by ultrasonic dispersion of nanodispersed aluminum and iron powders in absolute ethanol. The photoacoustic signal (PAS) produced in modulated CO2 laser irradiation (1.026 and 1.096 kHz) of alcosols depends on the nature and method of nanoparticle fabrication and does not depend on their concentration in ethanol (within 1-5 g/l). Chemical interaction between metal nanoparticles and ethanol activated by laser irradiation or/and ultrasound is considered as the cause of the PAS.

  19. The importance of fragment size distribution on underwater aluminum ignition

    International Nuclear Information System (INIS)

    Navarro-Valenti, S.; Georgevich, V.; Taleyarkhan, R.P.; Kim, S.H.

    1993-01-01

    In the study of postulated severe accidents for uranium-aluminum-fueled research reactors, it is necessary to consider the possibility and consequences of fuel/coolant interactions. In the event of a severe accident, where the fuel melts and comes into contact with the coolant, an explosion of considerable violence may occur due to the very fast heat transfer rates involved in the process; this is referred to as thermal interaction. However, when a chemical reaction between the molten aluminum and water occurs simultaneously, its contribution to the energetics of the explosion will produce a much more damaging explosion, referred to as an ignition-type interaction

  20. Stress corrosion in high-strength aluminum alloys

    Science.gov (United States)

    Dorward, R. C.; Hasse, K. R.

    1980-01-01

    Report describes results of stress-corrosion tests on aluminum alloys 7075, 7475, 7050, and 7049. Tests compare performance of original stress-corrosion-resistant (SCR) aluminum, 7075, with newer, higher-strength SCR alloys. Alloys 7050 and 7049 are found superior in short-transverse cross-corrosion resistance to older 7075 alloy; all alloys are subject to self-loading effect caused by wedging of corrosion products in cracks. Effect causes cracks to continue to grow, even at very-low externally applied loads.

  1. Friction Joint Between Basalt-Reinforced Composite and Aluminum

    DEFF Research Database (Denmark)

    Costache, Andrei; Glejbøl, Kristian; Sivebæk, Ion Marius

    2015-01-01

    The purpose of this study was to anchor basalt-reinforced polymers in an aluminum grip using dry friction. Dry friction clamping is considered the optimal solution for post-mounting of load-bearing terminations on composite structures. A new test method is presented for characterizing the frictio......The purpose of this study was to anchor basalt-reinforced polymers in an aluminum grip using dry friction. Dry friction clamping is considered the optimal solution for post-mounting of load-bearing terminations on composite structures. A new test method is presented for characterizing...

  2. Aluminum uptake from natural waters by a radiation-grafted membrane

    Energy Technology Data Exchange (ETDEWEB)

    Bazante-Yamaguishi, Renata; Moura, Eduardo; Manzoli, Jose E.; Geraldo, Aurea B.C., E-mail: ageraldo@ipen.br, E-mail: ryamaguishi@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Styrene grafted, chemically modified polymeric membranes were used to carry off aluminum of drinking water from wells located at Billings dam region. The membranes comprised polymeric substrates of PVC (polyvinylchloride) and PP (polypropylene), which were mutually grafted with gamma radiation. The chemical modification included three basic reaction paths: Friedel-Crafts acylation, 2-methylanisole coupling and a final oxidation; this modification enables aluminum selectivity on the membrane. This chemical process inserts a salicylated derivative bonded onto the aromatic ring of styrene; such molecular arrangement is responsible for complexation of aluminum ions. The aluminum sorption capacity of these membranes was evaluated firstly from an aluminum control solution, where parameters like the ideal pH value for aluminum sorption and the interfering species were studied and correlated to know the best conditions for aluminum uptake. Later, the membranes were used for aluminum remediation of natural waters (real-life samples). The applicability results and limits are then discussed. (author)

  3. Aluminum uptake from natural waters by a radiation-grafted membrane

    International Nuclear Information System (INIS)

    Bazante-Yamaguishi, Renata; Moura, Eduardo; Manzoli, Jose E.; Geraldo, Aurea B.C.

    2013-01-01

    Styrene grafted, chemically modified polymeric membranes were used to carry off aluminum of drinking water from wells located at Billings dam region. The membranes comprised polymeric substrates of PVC (polyvinylchloride) and PP (polypropylene), which were mutually grafted with gamma radiation. The chemical modification included three basic reaction paths: Friedel-Crafts acylation, 2-methylanisole coupling and a final oxidation; this modification enables aluminum selectivity on the membrane. This chemical process inserts a salicylated derivative bonded onto the aromatic ring of styrene; such molecular arrangement is responsible for complexation of aluminum ions. The aluminum sorption capacity of these membranes was evaluated firstly from an aluminum control solution, where parameters like the ideal pH value for aluminum sorption and the interfering species were studied and correlated to know the best conditions for aluminum uptake. Later, the membranes were used for aluminum remediation of natural waters (real-life samples). The applicability results and limits are then discussed. (author)

  4. Aluminum and stainless steel tubes joined by simple ring and welding process

    Science.gov (United States)

    Townhill, A.

    1967-01-01

    Duranel ring is used to join aluminum and stainless steel tubing. Duranel is a bimetal made up of roll-bonded aluminum and stainless steel. This method of joining the tubing requires only two welding operations.

  5. Growth and Breakdown of Surface Films and Localized Corrosion of Aluminum in Concentrated Chloride Media

    National Research Council Canada - National Science Library

    Lee, Jiajing

    1994-01-01

    ...) and mechanical stress for aluminum and titanium alloys in aggressive corrosion environments. This report presents results of some very preliminary experiments on aluminum alloys and titanium during anodic dissolution in chloride media...

  6. Evaluation of Corrosion of Aluminum Based Reactor Fuel Cladding Materials During Dry Storage

    International Nuclear Information System (INIS)

    Peacock, H.B. Jr.

    1999-01-01

    This report provides an evaluation of the corrosion behavior of aluminum cladding alloys and aluminum-uranium alloys at conditions relevant to dry storage. The details of the corrosion program are described and the results to date are discussed

  7. Remote plasma-enhanced metalorganic chemical vapor deposition of aluminum oxide thin films

    NARCIS (Netherlands)

    Volintiru, I.; Creatore, M.; Hemmen, van J.L.; Sanden, van de M.C.M.

    2008-01-01

    Aluminum oxide films were deposited using remote plasma-enhanced metalorganic chemical vapor deposition from oxygen/trimethylaluminum mixtures. Initial studies by in situ spectroscopic ellipsometry demonstrated that the aluminum oxide films deposited at temperatures

  8. The Identification of Aluminum in Human Brain Tissue Using Lumogallion and Fluorescence Microscopy

    Science.gov (United States)

    Mirza, Ambreen; King, Andrew; Troakes, Claire; Exley, Christopher

    2016-01-01

    Aluminum in human brain tissue is implicated in the etiologies of neurodegenerative diseases including Alzheimer’s disease. While methods for the accurate and precise measurement of aluminum in human brain tissue are widely acknowledged, the same cannot be said for the visualization of aluminum. Herein we have used transversely-heated graphite furnace atomic absorption spectrometry to measure aluminum in the brain of a donor with Alzheimer’s disease, and we have developed and validated fluorescence microscopy and the fluor lumogallion to show the presence of aluminum in the same tissue. Aluminum is observed as characteristic orange fluorescence that is neither reproduced by other metals nor explained by autofluorescence. This new and relatively simple method to visualize aluminum in human brain tissue should enable more rigorous testing of the aluminum hypothesis of Alzheimer’s disease (and other neurological conditions) in the future. PMID:27472886

  9. 40 CFR 440.20 - Applicability; description of the aluminum ore subcategory.

    Science.gov (United States)

    2010-07-01

    ... subpart B are applicable to discharges from facilities engaged in the mining of bauxite as an aluminum ore. ... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS ORE MINING AND DRESSING POINT SOURCE CATEGORY Aluminum Ore...

  10. Charge-density-shear-moduli relationships in aluminum-lithium alloys.

    Science.gov (United States)

    Eberhart, M

    2001-11-12

    Using the first principles full-potential linear-augmented-Slater-type orbital technique, the energies and charge densities of aluminum and aluminum-lithium supercells have been computed. The experimentally observed increase in aluminum's shear moduli upon alloying with lithium is argued to be the result of predictable changes to aluminum's total charge density, suggesting that simple rules may allow the alloy designer to predict the effects of dilute substitutional elements on alloy elastic response.

  11. 75 FR 22109 - Aluminum Extrusions from the People's Republic of China: Initiation of Antidumping Duty...

    Science.gov (United States)

    2010-04-27

    ... Aluminium, Ltd., a producer of aluminum extrusions, for the 2008 2009 fiscal year. See Volume II of the..., produced by an extrusion process, made from aluminum alloys having metallic elements corresponding to the alloy series designations published by The Aluminum Association commencing with the numbers 1, 3, and 6...

  12. Mercury-free dissolution of aluminum-clad fuel in nitric acid

    Science.gov (United States)

    Christian, Jerry D.; Anderson, Philip A.

    1994-01-01

    A mercury-free dissolution process for aluminum involves placing the aluminum in a dissolver vessel in contact with nitric acid-fluoboric acid mixture at an elevated temperature. By maintaining a continuous flow of the acid mixture through the dissolver vessel, an effluent containing aluminum nitrate, nitric acid, fluoboric acid and other dissolved components are removed.

  13. 40 CFR 464.10 - Applicability; description of the aluminum casting subcategory.

    Science.gov (United States)

    2010-07-01

    ... aluminum casting subcategory. 464.10 Section 464.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS METAL MOLDING AND CASTING POINT SOURCE CATEGORY Aluminum Casting Subcategory § 464.10 Applicability; description of the aluminum casting subcategory. The...

  14. Guangdong Aluminum to Raise RMB 3 billion for New Production Base in Guizhou

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    <正>On July 7, a loan signing ceremony was held between the Guangdong Aluminum Group, China Construction Bank, Hua Xia Bank and Guangzhou Bank Consortium. It is reported that these banks will provide Guangdong Aluminum Group with RMB 30 billion for an alu-minum oxide and supporting bauxite mining project in Guizhou.

  15. Preparation of nano-aluminum and studies on thermo-reaction properties

    International Nuclear Information System (INIS)

    Wei Sheng; Wang Chaoyang; Huang Yong; Wu Weidong; Tang Yongjian; Wei Jianjun

    2002-01-01

    The author presents the fabrication of nano-aluminum powders by evaporation-condensation method. The thermo gravimetric-differential scanning calorimetry technique is used to characterize the thermo-reaction properties between nano-aluminum powders and N 2 or Ar. The experiment results confirm the different thermo-reaction properties between block- and nano-aluminum

  16. The effect of surface modification on initial ice formation on aluminum surfaces

    DEFF Research Database (Denmark)

    Rahimi, Maral; Afshari, Alireza; Fojan, Peter

    2015-01-01

    material of heat exchanger fins is aluminum, this paper focuses on the effect of aluminum wettability on the initial stages of ice formation. The ice growth was studied on bare as well as hydrophilically and hydrophobically modified surfaces of aluminum (8011A) sheets, commonly used in heat exchangers...

  17. 49 CFR 178.506 - Standards for metal drums other than steel or aluminum.

    Science.gov (United States)

    2010-10-01

    ... aluminum. 178.506 Section 178.506 Transportation Other Regulations Relating to Transportation PIPELINE AND... drums other than steel or aluminum. (a) The following are the identification codes for metal drums other than steel or aluminum: (1) 1N1 for a non-removable head metal drum; and (2) 1N2 for a removable head...

  18. 21 CFR 73.3110a - Chromium-cobalt-aluminum oxide.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Chromium-cobalt-aluminum oxide. 73.3110a Section... LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Medical Devices § 73.3110a Chromium-cobalt-aluminum oxide. (a) Identity. The color additive chromium-cobalt-aluminum oxide (Pigment Blue 36) (CAS Reg. No...

  19. 76 FR 30650 - Aluminum Extrusions from the People's Republic of China: Antidumping Duty Order

    Science.gov (United States)

    2011-05-26

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-967] Aluminum Extrusions from the...''), the Department is issuing an antidumping duty order on aluminum extrusions from the People's Republic... of material injury by reason of imports of certain aluminum extrusions from the PRC, and its negative...

  20. 40 CFR 180.415 - Aluminum tris (O-ethylphosphonate); tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Aluminum tris (O-ethylphosphonate... Tolerances § 180.415 Aluminum tris (O-ethylphosphonate); tolerances for residues. (a) General. Tolerances are established for residues of the fungicide aluminum tris(O-ethylphosphonate) in or on the following food...