Jason-1 and Jason-2 POD Using GPS
Melachroinos, Stavros; Lemoine, Frank G.; Zelensky, Nikita P.; Rowlands, David D.; Luthcke, Scott B.; Beckley, Brian D.
2012-01-01
The Jason-2 satellite, launched in June 2008, is the latest follow-on to the successful Jason-1 altimetry satellite mission launched in December 7, 2001. Both, Jason-2 and Jason-1 are equipped with a GPS dual-frequency receiver, a laser retroreflector array, and a DORIS receiver for precise orbit determination (POD). A series of dynamic and reduced-dynamic Jason-2 orbits computed at NASA GSFC, based on GPS-only data and the std0905 standards, have been completed till cy74through cycle 74 using the IGS05 framework. These orbits, now publicly available, have been shown to agree radially at 1 cm RMS with the GSFC std0905 SLR/DORIS orbits and in comparison with orbits produced by JPL, ESA and CNES. In this paper, we describe the implementation of the IGS08 and repro1 framework for the Jason-2 and Jason-1 GPS POD processing with the NASA GSFC GEODYN software. . In our updated GPS POD, ambiguity fixing and updated time variable and static gravity fields. We also evaluate the implementation of non-tidal and degree-1 loading displacement as forward modeling to the tracking stations. Reduced-dynamic versus dynamic orbit differences are used to characterize the remaining force model errors and TRF instability. In particular, we assess their consistency radially and the stability of the altimeter satellite reference frame in the North/South direction as a proxy to assess the consistency of the reference frame.
First Jason-1 and OSTM/Jason-2 Tandem Global View
2009-01-01
This is the first global map of ocean surface topography produced with data from the new interleaved tandem mission of the Jason-1 and Ocean Surface Topography Mission (OSTM)/Jason-2 satellites. In January 2009, Jason-1 was maneuvered into orbit on the opposite side of Earth from its successor, OSTM/Jason-2 satellite. It takes 10 days for the satellites to cover the globe and return to any one place over the ocean. So, in this new tandem configuration, Jason-1 flies over the same region of the ocean that OSTM/Jason-2 flew over five days earlier. Its ground tracks fall mid-way between those of Jason-2, which are about 315 kilometers (195 miles) apart at the equator. Working together, the two spacecraft measure the surface topography of the ocean twice as often as would be possible with one satellite, and over a 10-day period, they return twice the amount of detailed measurements. Combining data from the two satellites makes it possible to map smaller, more rapidly changing features than one satellite could alone. This image shows sea-level anomaly data from the first 14 days of the interleaved orbit of Jason-1 and OSTM/Jason-2, the period beginning on Feb. 20, 2009. An anomaly is a departure from a value averaged over a long period of time. Red and yellow are regions where sea levels are higher than normal. Purple and dark blue show where sea levels are lower. A higher-than-normal sea surface is usually a sign of warm waters below, while lower sea levels indicate cooler than normal temperatures. The small-sized patches of highs and lows are ocean eddies, the storms of ocean weather that carry most of the energy of ocean circulation. These are not well observed with only one satellite. Jason-1 is a joint mission of NASA and the French space agency, CNES. The U.S. portion of the Jason-1 mission is managed by JPL for NASA's Science Mission Directorate, Washington, D.C. OSTM/Jason 2 is an international endeavor with responsibility for satellite development and launch
National Oceanic and Atmospheric Administration, Department of Commerce — OSTM/JASON-2 and Jason-3 (scheduled for launch in 2015) are follow-on missions continuing the TOPEX/Poseidon and Jason-1 missions, and are designed to ensure...
National Aeronautics and Space Administration — OSTM/Jason-2's primary payload includes five instruments similar to those aboard Jason-1, along with three experimental instruments. Its main instrument is an...
Generating precise and homogeneous orbits for Jason-1 and Jason-2
Flohrer, Claudia; Otten, Michiel; Springer, Tim; Dow, John M.
Driven by the GMES (Global Monitoring for Environment and Security) and GGOS (Global Geodetic Observing System) initiatives the user community has a strong demand for high-quality altimetry products. In order to derive such high-quality altimetry products, precise orbits for the altimetry satellites are needed. Satellite altimetry missions meanwhile span over three decades, in which our understanding of the Earth has increased significantly. As also the models used for precise orbit determination (POD) have improved, the satellite orbits of the altimetry satellites are not available in an uniform reference system. Homogeneously determined orbits referring to the same global reference system are, however, needed to improve our understanding of the Earth system. With the launch of the TOPEX/Poseidon (T/P) mission in 1992 a still ongoing time series of high-altimetry measurements of ocean topography started. In 2001 the altimetry mission Jason-1 took over and in 2009 the follow-on program Jason-2/OSTM started. All three satellites follow the same ground-track by flying in the same orbit, thus ensuring a continuous time-series of centimetre-level ocean topography observations. Therefore a reprocessing of the orbit determination for these altimetry satellites would be highly beneficial for altimetry applications. The Navigation Support Office at ESA/ESOC has enhanced the GNSS processing capabilities of its NAPEOS software. Thus it is now in the unique position to do orbit determination by combining different types of data, and by using one single software system for different satellite types, including the most recent improvements in orbit and observation modelling and IERS conventions. Our presentation focuses on the re-processing efforts carried out by ESA/ESOC for the gener-ation of precise and homogeneous orbits referring to the same reference frame for the altimetry satellites Jason-1 and Jason-2. At the same time ESOC carried out a re-processing of the com
Nuclear Physics studies at ELI-NP
International Nuclear Information System (INIS)
Stevenson, P.D.; Goddard, P.M.; Rios, A.
2015-01-01
The mission of the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) facility is to use extreme electromagnetic fields for nuclear physics research. At ELI-NP, high-power lasers together with a very brilliant γ-ray beam are the main research tools. Their targeted operational parameters are described. The emerging experimental program of the facility in the field of nuclear physics is reported and the main directions of the research envisioned are presented. The experimental instrumentation, which will operate at ELI-NP for the realization of the research program, is discussed. The expected impact of ELI-NP on the future advance of the field is summarized
Bush, Jason
2008-01-01
Korruptsioonist Venemaal Samara piirkonnas, ettevõtte-vaenulikest ülevõtmiskatsetest ja riigiametnike osast selles, Venemaa presidendi algatusest korruptsiooni väljajuurimisel. Vt. samas Jason Bush. BP rasked ajad Venemaal
Towards experiments at the new ELI-NP facility
Directory of Open Access Journals (Sweden)
Balabanski D. L.
2014-01-01
Full Text Available The Extreme Light Infrastructure (ELI Pan-European initiative represents a major step forward in quest for extreme electromagnetic fields. The Extreme Light Infrastructure – Nuclear Physics (ELI-NP laboratory is one of the three pillars of the ELI project, that aims to use such extreme electromagnetic fields for nuclear physics and quantum electrodynamics research. At ELI-NP two ten petawatt high-power laser systems together with a very brilliant narrow-width γ beam are the main research tools. Here the current status of the project and the experimental program related to nuclear research, which is under preparation at ELI-NP, are presented.
Elis Regina e a música televisual brasileira
Directory of Open Access Journals (Sweden)
Alexandre Rocha da Silva
2008-11-01
Full Text Available Este artigo discute o modo pelo qual a televisão brasileira construiu Elis Regina como ator televisivo. Parte da idéia proposta por Augusto de Campos e Caetano Veloso de que Elis foi a primeira cantora efetivamente produzida pela televisão brasileira para investigar semioticamente o que aqui se denomina mundo televisivo. Este estudo aborda, ainda, as articulações entre gêneros, subgêneros e formatos como níveis que tecem as malhas do propriamente televisivo. Palavras-chave: mundos televisivos; audiovisualidades; imagem-música; semiótica; Elis Regina Abstract Elis Regina and Brazilian televised music - This paper discusses how Brazilian television built singer Elis Regina into a television actress. Starting from the idea proposed by Augusto de Campos and Caetano Veloso that Elis was the first singer effectively produced by Brazilian television, this paper makes a semiotic investigation into what is known as the world of television. This study also discusses the articulations between genres, subgenres and formats as levels that weave the mesh of television itself. Keywords: world of television; audiovisualities; image-music; semiotics; Elis Regina
National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the gridded 5-day mean sea surface height anomaly (SSHA) and Ku Band significant wave height (SWH-KU) observed from Jason-1 and OSTM/Jason-2...
2007-01-01
We were deeply saddened to hear of the death of our former colleague and friend, Elie Menant, at Collonge-Bellerive, on 17 August, in his 80th year. Formerly of the French National Geographic Institute, for which he had conducted many geodesic surveys throughout France, Elie came to CERN in 1962, joining the team of surveyors led by Jean Gervaise in AR Division. Elie was involved in the PS, ISR, SPS and LEP projects and made a substantial contribution to the development of the group’s alignment techniques. Among the highlights of a richly creative career, we particularly recall his essential contributions to the implementation of the first computer software for the adjustment of major geodesic networks, to new computer-assisted calculation techniques, to the design of the alignment method for the ISR ring and the associated beam transfer lines, as well as his work on the site studies for the 300 GeV project. Last, but not least, his instinct for large-dimension metrolog...
Building Multi-Agent Systems Using Jason
DEFF Research Database (Denmark)
Boss, Niklas Skamriis; Jensen, Andreas Schmidt; Villadsen, Jørgen
2010-01-01
We provide a detailed description of the Jason-DTU system, including the used methodology, tools as well as team strategy. We also discuss the experience gathered in the contest. In spring 2009 the course “Artificial Intelligence and Multi- Agent Systems” was held for the first time...... on the Technical University of Denmark (DTU). A part of this course was a short introduction to the multi-agent framework Jason, which is an interpreter for AgentSpeak, an agent-oriented programming language. As the final project in this course a solution to the Multi-Agent Programming Contest from 2007, the Gold...
Improving Multi-Agent Systems Using Jason
DEFF Research Database (Denmark)
Vester, Steen; Boss, Niklas Skamriis; Jensen, Andreas Schmidt
2011-01-01
We describe the approach used to develop the multi-agent system of herders that competed as the Jason-DTU team at the Multi-Agent Programming Contest 2010. We also participated in 2009 with a system developed in the agentoriented programming language Jason which is an extension of AgentSpeak. We ...... used the implementation from 2009 as a foundation and therefore much of the work done this year was on improving that implementation. We present a description which includes design and analysis of the system as well as the main features of our agent team strategy. In addition we discuss...
Anidulafungin (Eli Lilly & Co).
Hawser, S
1999-12-01
The pentyloxyterphenyl side chain derivative of echinocandin B, anidulafungin, is a 1,3-alpha-glucan synthesis inhibitor undergoing phase II clinical trials by Versicor and Eli Lilly, in various formulations, for the potential treatment of fungal and protozoal infections. Eli Lilly has retained options to the oral formulation of the compound, but development, clinical registration and marketing rights were licensed to Versicor in June 1999. The primary target of this compound is Candida, but Eli Lilly also intends to develop the drug for Aspergillus infections. No activity has been shown against Cryptococcus. The oral activity of anidulafungin is compromised by a low bioavailability, a decreased absorption when taken with food, and gastrointestinal side effects at higher doses. The development of a phosphorylated prodrug, LY-307853, which is converted in the body to anidulafungin by tissue and serum phosphatases, was discontinued in favor of an oral formulation, which uses anidulafungin directly. In February 1999, Deutsche Bank predicted sales of $100 million in 2001, rising to $300 million in 2003.
The Galapagos Jason Curriculum.
National Science Teachers Association, Arlington, VA.
The JASON Curriculum Project materials are designed to prepare teachers and students for an exploration around the Galapagos Islands via satellite transmission of live images and sound. This curriculum package contains five units, 25 lesson plans, and over 50 activities, along with teacher background material, student worksheets and readings, a…
Wheeler, Glen D
2003-02-01
Eli Lilly & Co is developing the protein kinase C (PKC)-b inhibitor ruboxistaurin, the lead compound from a series of 14-membered macrocycles, for the potential treatment of diabetic retinopathy, diabetic peripheral neuropathy and macular edema.
National Aeronautics and Space Administration — Jason 1 is an oceanography mission to monitor global ocean circulation, study the ties between the oceans and atmosphere, improve global climate forecasts and...
ELi institutsioonide ja juhtimise reform / Ivar Raig
Raig, Ivar, 1953-
2003-01-01
Kuna Eestist võib 2004. aasta mais saada EL-i liige, siis on vaja kujundada seisukoht, milline EL-i institutsioonide ja juhtimise reform oleks kõige vastuvõetavam Eesti kui erilise majanduspoliitikaga väikeriigi huvidest lähtuvalt. Märkused valitsuse sellekohaste seisukohtade suhtes ja ettepanekud nende muutmiseks või täiendamiseks
Decommissioning the Jason Argonaut research reactor at a world heritage site
Energy Technology Data Exchange (ETDEWEB)
Lockwood, R.J.S.; Beeley, P.A. [HMS Sultan, Gosport, Hampshire (United Kingdom)
2001-07-01
The Jason low power Argonaut type, water and graphite moderated reactor was located in King William Building, which is a Grade 1 listed building within the Royal Naval College, Greenwich, London. The College itself is a Scheduled Ancient Monument with World Heritage Site status and is situated about a mile from the Greenwich Dome. The decision to decommission Jason to International Atomic Energy Agency Stage 3 status (unrestricted site use) was taken in 1996. All physical decommissioning work was completed by October 1999, site radiological clearance was obtained in November 1999, the site license was withdrawn and the site was handed over for future unrestricted use on 9 December 1999. The Jason decommissioning project was safely completed to time, cost and quality by the Millennium [2] without any adverse effects on World Heritage aspects of the site. In this paper details are provided about the Jason fuel removal phase and an outline of the other phases of the project.
The Ocean Surface Topography Sentinel-6/Jason-CS Mission
Giulicchi, L.; Cullen, R.; Donlon, C.; Vuilleumier@esa int, P.
2016-12-01
The Sentinel-6/Jason-CS mission consists of two identical satellites flying in sequence and designed to provide operational measurements of sea surface height significant wave high and wind speed to support operational oceanography and climate monitoring. The mission will be the latest in a series of ocean surface topography missions that will span nearly three decades. They follow the altimeters on- board TOPEX/Poseidon through to Jason-3 (launched in January 2016). Jason-CS will continue to fulfil objectives of the reference series whilst introducing a major enhancement in capability providing the operational and science oceanographic community with the state of the art in terms of spacecraft, measurement instrumentation design thus securing optimal operational and science data return. As a secondary objective the mission will also include Radio Occultation user services. Each satellite will be launched sequentially into the Jason orbit (up to 66 latitude) respectively in 2020 and 2025. The principle payload instrument is a high precision Ku/C band radar altimeter with retrieval of geophysical parameters (surface elevation, wind speed and SWH) from the altimeter data require supporting measurements: a DORIS receiver for Precise Orbit Determination; The Climate Quality Advanced Microwave Radiometer (AMR-C) for high stability path delay correction. Orbit tracking data are also provided by GPS & LRA. An additional GPS receiver will be dedicated to radio-occultation measurements. The programme is a part of the European Community Copernicus initiative, whose objective is to support Europe's goals regarding sustainable development and global governance of the environment by providing timely and quality data, information, services and knowledge. The Sentinel-6/Jason-CS in particular is a cooperative mission with contributions from NASA, NOAA, EUMETSAT, ESA, CNES and the European Union.
Aquatic assessment of the Ely Copper Mine Superfund site, Vershire, Vermont
Seal, Robert R.; Kiah, Richard G.; Piatak, Nadine M.; Besser, John M.; Coles, James F.; Hammarstrom, Jane M.; Argue, Denise M.; Levitan, Denise M.; Deacon, Jeffrey R.; Ingersoll, Christopher G.
2010-01-01
The Ely Mine, which operated from 1821 to 1905, and its area of downstream impact constitute the Ely Copper Mine Superfund site. The site was placed on the National Priorities List in 2001. The mine comprises underground workings, foundations from historical structures, several waste-rock piles, roast beds associated with the smelting operation, and slag piles resulting from the smelting. The mine site is drained by Ely Brook, which includes several tributaries, one of which drains a series of six ponds. Ely Brook empties into Schoolhouse Brook, which flows 3.3 kilometers and joins the Ompompanoosuc River.
Ocean Surface Topography Mission (OSTM) /Jason-3 Data Collection, 2015- (NCEI Accession 0118278)
National Oceanic and Atmospheric Administration, Department of Commerce — OSTM/JASON-3 is a follow-on mission continuing the TOPEX/Poseidon and Jason-1/2, and is designed to ensure continuity of high quality measurements for ocean science...
Review of Painting by Numbers by Jason Makansi
Directory of Open Access Journals (Sweden)
Thomas Pfaff
2018-01-01
Full Text Available Makansi, Jason. Painting By Numbers: How to Sharpen Your BS Detector and Smoke Out the "Experts." (Tucson, AZ: Layla Dog Press, 2016. 196 pp. ISBN 978-0-9984259-0-0. In Painting by Numbers Jason Makansi adds another book to the quantitative literacy bookshelf, with a book focusing on models. The book offers twelve commandments to aid the reader in assess quantitative models. The second section of the book offers examples to apply the models. Increasing quantitative literacy is crucial and generally, the more books the better. Unfortunately, this book is too superficial, often misses key ideas, and can easily lead a person to climate denialism. This book may do more harm than good.
Leonard A. Jason: Award for Distinguished Professional Contributions to Applied Research.
2015-11-01
The Award for Distinguished Professional Contributions to Applied Research is given to a psychologist whose research has led to important discoveries or developments in the field of applied psychology. To be eligible, this research should have led to innovative applications in an area of psychological practice, including but not limited to assessment, consultation, instruction, or intervention (either direct or indirect). The 2015 recipient is Leonard A. Jason. Jason "is among the most prolific community psychology researchers whose work has had measurable and significant real-world impact. His work is characterized by a continuing desire to apply knowledge to major social problems. His research is methodologically sound and creative, collaborative, and participatory, thereby increasing stakeholders' support for proposed changes." Jason's award citation, biography, and a selected bibliography are presented here. (c) 2015 APA, all rights reserved).
de Jonge, E.
2002-01-01
Drotrecogin alfa (Xigris, recombinant activated protein C) is an anticoagulant developed and launched by Eli Lilly & Co for the treatment of sepsis [333781], [339372], [430133], [436271]. The FDA and the EMEA accepted the brand name Xigris for drotrecogin alfa in June 2001. This trade name had been
Eflucimibe. Pierre Fabre/Eli Lilly.
Burnett, John R
2003-03-01
Eflucimibe is an acyl coenzyme A:cholesterol acyltransferase inhibitor under development by Pierre Fabre SA and Eli Lilly & Co for the potential treatment of hypercholesterolemia and atherosclerosis. Phase II clinical trials commenced during 2002.
National Oceanic and Atmospheric Administration, Department of Commerce — OSTM/JASON-2 is a follow-on mission continuing the TOPEX/Poseidon and Jason-1, and is designed to ensure continuity of high quality measurements for ocean science...
Status of Precise Orbit Determination for Jason-2 Using GPS
Melachroinos, S.; Lemoine, F. G.; Zelensky, N. P.; Rowlands, D. D.; Pavlis, D. E.
2011-01-01
The JASON-2 satellite, launched in June 2008, is the latest follow-on to the successful TOPEX/Poseidon (T/P) and JASON-I altimetry missions. JASON-2 is equipped with a TRSR Blackjack GPS dual-frequency receiver, a laser retroreflector array, and a DORIS receiver for precise orbit determination (POD). The most recent time series of orbits computed at NASA GSFC, based on SLR/DORIS data have been completed using both ITRF2005 and ITRF2008. These orbits have been shown to agree radially at 1 cm RMS for dynamic vs SLRlDORIS reduced-dynamic orbits and in comparison with orbits produced by other analysis centers (Lemoine et al., 2010; Zelensky et al., 2010; Cerri et al., 2010). We have recently upgraded the GEODYN software to implement model improvements for GPS processing. We describe the implementation of IGS standards to the Jason2 GEODYN GPS processing, and other dynamical and measurement model improvements. Our GPS-only JASON-2 orbit accuracy is assessed using a number of tests including analysis of independent SLR and altimeter crossover residuals, orbit overlap differences, and direct comparison to orbits generated at GSFC using SLR and DORIS tracking, and to orbits generated externally at other centers. Tests based on SLR and the altimeter crossover residuals provide the best performance indicator for independent validation of the NASAlGSFC GPS-only reduced dynamic orbits. For the ITRF2005 and ITRF2008 implementation of our GPS-only obits we are using the IGS05 and IGS08 standards. Reduced dynamic versus dynamic orbit differences are used to characterize the remaining force model error and TRF instability. We evaluate the GPS vs SLR & DORIS orbits produced using the GEODYN software and assess in particular their consistency radially and the stability of the altimeter satellite reference frame in the Z direction for both ITRF2005 and ITRF2008 as a proxy to assess the consistency of the reference frame for altimeter satellite POD.
Directory of Open Access Journals (Sweden)
Nurul Hazrina Idris
2017-06-01
Full Text Available This paper presents the Coastal Altimetry Waveform Retracking Expert System (CAWRES, a novel method to optimise the Jason satellite altimetric sea levels from multiple retracking solutions. CAWRES’ aim is to achieve the highest possible accuracy of coastal sea levels, thus bringing measurement of radar altimetry data closer to the coast. The principles of CAWRES are twofold. The first is to reprocess altimeter waveforms using the optimal retracker, which is sought based on the analysis from a fuzzy expert system. The second is to minimise the relative offset in the retrieved sea levels caused by switching from one retracker to another using a neural network. The innovative system is validated against geoid height and tide gauges in the Great Barrier Reef, Australia for Jason-1 and Jason-2 satellite missions. The regional investigations have demonstrated that the CAWRES can effectively enhance the quality of 20 Hz sea level data and recover up to 16% more data than the standard MLE4 retracker over the tested region. Comparison against tide gauge indicates that the CAWRES sea levels are more reliable than those of Sensor Geophysical Data Records (SGDR products, because the former has a higher (≥0.77 temporal correlation and smaller (≤19 cm root mean square errors. The results demonstrate that the CAWRES can be applied to coastal regions elsewhere as well as other satellite altimeter missions.
The JASON reactor at the Royal Naval College: Silver Jubilee 6th November 1987
International Nuclear Information System (INIS)
Lakey, J.R.A.; Roust, C.B.
1988-01-01
The 10 kW Research and Training Reactor Jason has been used at the Royal Naval College for 25 years in support of the Naval Nuclear Submarine Propulsion Programme. The principal features of Jason, relevant to its training role are given, along with the specifications of Jason, instrumentation, maintenance and operational experience. The educational role of the reactor is described with respect to the Nuclear Reactor Course, Nuclear Advanced Course, and the Nuclear Radiation Protection Course. Future developments in operator training, advantages of the low power reactor, quality control of education and training, and research and development, are also discussed. (U.K.)
DEFF Research Database (Denmark)
Jensen, Andreas Schmidt; Villadsen, Jørgen
2015-01-01
When information is shared between agents of unknown reliability, it is possible that their belief bases become inconsistent. In such cases, the belief base must be revised to restore consistency, so that the agent is able to reason. In some cases the inconsistent information may be due to use of...... of incorrect plans. We extend work by Alechina et al. to revise belief bases in which plans can be dynamically added and removed. We present an implementation of the algorithm in the AgentSpeak implementation Jason....
Proposed Operational Base Site, Steptoe Valley, Ely Area, Nevada.
1980-03-31
1629, respectively (White Pine Chamber of Commerce , WPCC, 1980). The city of Ely is incorporated; the suburb of East Ely is not. For purposes of this...Site SAF Security Alert Facility WPCC White Pine Chamber of Commerce WPPP White Pine Power Project IL__ _ FN-TR-35 38 BIBLIOGRAPHY Cardinalli, J., 1979...Nevada Forecasts for the Future--Agriculture, State Engineer’s Office, Carson City, Nevada. *1 White Pine Chamber of Commerce , 1980, Oral
London ja Pariis katsuvad jõudu EL-i eelarve kallal / Krister Paris
Paris, Krister, 1977-
2005-01-01
Kõige suuremad vaidlused EL-i eelarvega seoses käivad Suurbritannia tagasimakse ja põllumajandustoetuste üle. Suurbritannia välisministri Jack Straw nimetas EL-i eelarvet nii raiskavaks kui ka ebaõiglaseks vaesemate riikide suhtes
National Oceanic and Atmospheric Administration, Department of Commerce — OSTM/JASON-2 is a follow-on mission continuing the TOPEX/Poseidon and Jason-1, and is designed to ensure continuity of high quality measurements for ocean science...
Kes kaitseb maatootjate õigusi ELis? / Alvar Timmi
Timmi, Alvar
1999-01-01
Ülevaade ELi valitsusvälisest organisatsioonist COPA-COGECA, mis ühendab põllumajandustootjaid ja toodangu töötlejaid eesmärgiga mõjutada valitsusasutusi põllumajandust puudutava seadusandluse kujundamisel
Energy Technology Data Exchange (ETDEWEB)
Filipescu, D.; Balabanski, D.L.; Constantin, P.; Gales, S.; Tesileanu, O.; Ur, C.A.; Ursu, I.; Zamfir, N.V. [Horia Hulubei National Institute for R and D in Physics and Nuclear Engineering (IFIN-HH), Extreme Light Infrastructure - Nuclear Physics (ELI-NP), Bucharest-Magurele (Romania); Anzalone, A.; La Cognata, M.; Spitaleri, C. [INFN-LNS, Catania (Italy); Belyshev, S.S. [Lomonosov Moscow State University, Physics Faculty, Moscow (Russian Federation); Camera, F. [Departement of Physics, University of Milano, Milano (Italy); INFN section of Milano, Milano (Italy); Csige, L.; Krasznahorkay, A. [Hungarian Academy of Sciences (MTA Atomki), Institute of Nuclear Research, Post Office Box 51, Debrecen (Hungary); Cuong, P.V. [Vietnam Academy of Science and Technology, Centre of Nuclear Physics, Institute of Physics, Hanoi (Viet Nam); Cwiok, M.; Dominik, W.; Mazzocchi, C. [University of Warsaw, Warszawa (Poland); Derya, V.; Zilges, A. [University of Cologne, Institute for Nuclear Physics, Cologne (Germany); Gai, M. [University of Connecticut, LNS at Avery Point, Connecticut, Groton (United States); Gheorghe, I. [Horia Hulubei National Institute for R and D in Physics and Nuclear Engineering (IFIN-HH), Extreme Light Infrastructure - Nuclear Physics (ELI-NP), Bucharest-Magurele (Romania); University of Bucharest, Nuclear Physics Department, Post Office Box MG-11, Bucharest-Magurele (Romania); Ishkhanov, B.S. [Lomonosov Moscow State University, Physics Faculty, Moscow (Russian Federation); Lomonosov Moscow State University, Skobeltsyn Institute of Nuclear Physics, Moscow (Russian Federation); Kuznetsov, A.A.; Orlin, V.N.; Stopani, K.A.; Varlamov, V.V. [Lomonosov Moscow State University, Skobeltsyn Institute of Nuclear Physics, Moscow (Russian Federation); Pietralla, N. [Technische Universitat Darmstadt, Institut fur Kernphysik, Darmstadt (Germany); Sin, M. [University of Bucharest, Nuclear Physics Department, Post Office Box MG-11, Bucharest-Magurele (Romania); Utsunomiya, H. [Konan University, Department of Physics, Kobe (Japan); University of Tokyo, Center for Nuclear Study, Saitama (Japan); Weller, H.R. [Triangle Universities Nuclear Laboratory, North Carolina, Durham (United States); Duke University, Department of Physics, North Carolina, Durham (United States)
2015-12-15
The perspectives for photonuclear experiments at the new Extreme Light Infrastructure - Nuclear Physics (ELI-NP) facility are discussed in view of the need to accumulate novel and more precise nuclear data. The parameters of the ELI-NP gamma beam system are presented. The emerging experimental program, which will be realized at ELI-NP, is presented. Examples of day-one experiments with the nuclear resonance fluorescence technique, photonuclear reaction measurements, photofission experiments and studies of nuclear collective excitation modes and competition between various decay channels are discussed. The advantages which ELI-NP provides for all these experiments compared to the existing facilities are discussed. (orig.)
The MEDEA/JASON remotely operated vehicle system
Ballard, Robert D.
1993-08-01
The remotely operated vehicle (ROV) system MEDEA/JASON has been under development for the last decade. Adter a number of engineering test cruises, including the discovery of the R.M.S. Titanic and the German Battleship Bismarck, this ROV system is now being implemented in oceanographic investigations. This paper explains its development history and its unique ability to carry out a broad range of scientific research.
Ekspert : ELi ühine välisminister tähendaks ka ühtsemat idapoliitikat / Erkki Bahovski
Bahovski, Erkki, 1970-
2004-01-01
Euroopa Poliitikauuringute Keskuse teadlase Michael Emersoni sõnul aitaks plaan anda EL-i ühise välisministri portfell senisele välispoliitika koordineerijale Javier Solanale tasakaalustada EL-i liikmesriikide ja eri institutsioonide huve. EL-i idasuunaline tegevus peaks tema sõnul olema julgem
Implementation status of the extreme light infrastructure - nuclear physics (ELI-NP) project
Energy Technology Data Exchange (ETDEWEB)
Gales, S., E-mail: sydney.gales@eli-np.ro; Zamfir, N. V., E-mail: sydney.gales@eli-np.ro [ELI-NP, Horia Hulubei National Institute for Physics and Nuclear Engineering, 30 Reactorului Street, RO-077125 Bucharest-Magurele (Romania)
2015-02-24
The Project Extreme Light Infrastructure (ELI) is part of the European Strategic Forum for Research Infrastructures (ESFRI) Roadmap. ELI will be built as a network of three complementary pillars at the frontier of laser technologies. The ELI-NP pillar (NP for Nuclear Physics) is under construction near Bucharest (Romania) and will develop a scientific program using two 10 PW lasers and a Compton back-scattering high-brilliance and intense gamma beam, a marriage of laser and accelerator technology at the frontier of knowledge. In the present paper, the technical description of the facility, the present status of the project as well as the science, applications and future perspectives will be discussed.
Directory of Open Access Journals (Sweden)
Tassanee Lerksuthirat
Full Text Available Pythium insidiosum is a unique oomycete that can infect humans and animals. Patients with a P. insidiosum infection (pythiosis have high rates of morbidity and mortality. The pathogen resists conventional antifungal drugs. Information on the biology and pathogenesis of P. insidiosum is limited. Many pathogens secrete proteins, known as effectors, which can affect the host response and promote the infection process. Elicitins are secretory proteins and are found only in the oomycetes, primarily in Phytophthora and Pythium species. In plant-pathogenic oomycetes, elicitins function as pathogen-associated molecular pattern molecules, sterol carriers, and plant defense stimulators. Recently, we reported a number of elicitin-encoding genes from the P. insidiosum transcriptome. The function of elicitins during human infections is unknown. One of the P. insidiosum elicitin-encoding genes, ELI025, is highly expressed and up-regulated at body temperature. This study aims to characterize the biochemical, immunological, and genetic properties of the elicitin protein, ELI025. A 12.4-kDa recombinant ELI025 protein (rELI025 was expressed in Escherichia coli. Rabbit anti-rELI025 antibodies reacted strongly with the native ELI025 in P. insidiosum's culture medium. The detected ELI025 had two isoforms: glycosylated and non-glycosylated. ELI025 was not immunoreactive with sera from pythiosis patients. The region near the transcriptional start site of ELI025 contained conserved oomycete core promoter elements. In conclusion, ELI025 is a small, abundant, secreted glycoprotein that evades host antibody responses. ELI025 is a promising candidate for development of diagnostic and therapeutic targets for pythiosis.
Giannoukakis, Nick
2003-04-01
Amylin Pharmaceuticals Inc and Eli Lilly & Co are co-developing exenatide (AC-2993; synthetic exendin-4), a 39-amino acid, glucagon-like peptide-1 agonist derived from the venom of the Gila monster lizard (Heloderma suspectum) as a potential injectable treatment for type 2 diabetes. The first phase III trial (exenatide as a monotherapy) was initiated in December 2001. In January 2002 the second phase III trial, of exenatide in conjunction with sulfonylureas, was initiated and in March 2002, Amylin initiated the third phase III trial, of exenatide in combination with metformin and sulfonylureas.
Ocean Surface Topography Mission (OSTM) /Jason-2: Telemetry (NODC Accession 0044986)
National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the data descriptions for the OSTM/Jason-2 Telemetry data, which is served through the NOAA/NESDIS Comprehensive Large Array-data Stewardship...
Highlights from e-EPS: New milestone for ELI Beamlines facility
Jorge Rivero González, e-EPS News
2013-01-01
e-EPS News is a monthly addition to the CERN Bulletin line-up, showcasing articles from e-EPS – the European Physical Society newsletter – as part of a collaboration between the two publications. On 16 September 2013, the Extreme Light Infrastructure (ELI) Beamlines facility awarded a contract worth approximately €34.5m to Lawrence Livermore National Security LLC (LLNS, California, USA) to develop and deliver a state-of-the-art laser system that will be at the heart of the ELI Beamlines user facility. Located in the village of Dolní Břežany, Czech Republic, the ELI Beamlines facility aims to pioneer work in a number of research fields using ultra-high intensity lasers. The facility will host a cutting-edge research laser, around 100 times more powerful than any other laser in operation today. In particular, it will focus on providing users with ultra-short energetic particle beams (10 GeV) and radiation beams (up to a few MeV), produced by...
Poola saab tülis Venemaaga kogu EL-i oma selja taha / Krister Paris
Paris, Krister, 1977-
2006-01-01
EL-i eesistujamaa Soome lubas Poolale lisada Venemaa kehtestatud impordikeelu Poola lihatoodetele EL-i ja Venemaa läbirääkimiste ametlikku päevakorda. Impordikeelu kiiret lõpetamist toetavad Prantsusmaa ja Leedu. Lisa: Poola püüdlused "vastuvõetamatud"
Marks & Spencer loob ELis maksupretsedenti / Sirje Rank
Rank, Sirje, 1966-
2005-01-01
Ilmunud ka: Delovõje Vedomosti 13. apr. lk. 6. Briti rõivakett Marks & Spencer kaebas, et Briti maksuseadused, mis ei lubanud emafirma Suurbritannias maksustavast tulust maha kanda Saksamaal, Prantsusmaal ja Belgias asunud tütarfirmade suuri kahjumeid üheksakümnendate aastate lõpus, on vastuolus EL-i ühisturu seadustega
Holland piiraks sisserännet EL-i / Ahto Lobjakas
Lobjakas, Ahto, 1970-
2004-01-01
Hollandi justiitsministri Piet Hein Donneri sõnul otsib EL-i praegune eesistujamaa Holland lahendusi, mis aitaksid põgenikke ja potentsiaalseid asüülitaotlejaid paremini kaitsta nende asukohariikide läheduses
Ocean Surface Topography Mission (OSTM) /Jason-2: Orbital Information (NODC Accession 0044985)
National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the descriptions for the OSTM/Jason-2 orbital information, which is served through the NOAA/NESDIS Comprehensive Large Array-data Stewardship...
Ocean Surface Topography Mission (OSTM) /Jason-2: Auxiliary Files (NODC Accession 0044983)
National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the data descriptions for the OSTM/Jason-2 Auxiliary data files, which is served through the NOAA/NESDIS Comprehensive Large Array-data...
Ocean Surface Topography Mission (OSTM) /Jason-2: Ancillary Files (NODC Accession 0044982)
National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the data descriptions for the OSTM/Jason-2 Ancillary data files, which is served through the NOAA/NESDIS Comprehensive Large Array-data...
ELIMED: MEDICAL APPLICATION AT ELI-BEAMLINES. STATUS OF THE COLLABORATION AND FIRST RESULTS
Directory of Open Access Journals (Sweden)
Francesco Schillaci
2014-08-01
Full Text Available ELI-Beamlines is one of the four pillars of the ELI (Extreme Light Infrastructure pan-European project. It will be an ultrahigh-intensity, high repetition-rate, femtosecond laser facility whose main goal is to generate and apply high-brightness X-ray sources and accelerated charged particles. In particular, medical applications are treated by the ELIMED task force, which has been launched by collaboration between ELI and INFN researchers. ELIMED aims to demonstrate the clinical applicability of laser accelerated ions. In this article, the state of the ELIMED project and the first scientific results are reported. The design and realisation of a preliminary beam handling system and of an advanced spectrometer for diagnostics of high energy (multi-MeV laser-accelerated ion beams will also be briefly presented.
Eli Fischer-Jørgensen, Eugeniu Coseriu et Louis Hjelmslev
DEFF Research Database (Denmark)
Jensen, Viggo Bank
2015-01-01
Based on a correspondence between Eugenio Coseriu (1921-2002) and Eli Fischer-Jørgensen (1911-2010), the article discusses the importance of Louis Hjelmslev (1899-1965) for the development of the theory of Coseriu. In a letter dated 1955, Fischer-Jørgensen agrees with Coseriu in his criticism of ...... to be a slight change in Coseriu’s view on content substance. This way, the article aims to show that Fischer-Jørgensen played an important role as a critical mediator between Hjelmslev and Coseriu.......Based on a correspondence between Eugenio Coseriu (1921-2002) and Eli Fischer-Jørgensen (1911-2010), the article discusses the importance of Louis Hjelmslev (1899-1965) for the development of the theory of Coseriu. In a letter dated 1955, Fischer-Jørgensen agrees with Coseriu in his criticism...
Subatomic and frontier physics with ELI Beamlines. Reality and dreams
International Nuclear Information System (INIS)
Drska, L.
2010-01-01
Complete text of publication follows. This contribution attempts to review some results of thinking about prospects for meaningful and procreative research by exploitation the potential of the unique laser technology to be available within the future ELI Beamlines Facility - an ultrashort-pulse, multi-petawatt, multi-beam, high-repetition-rate system. The presentation may be (hopefully) regarded as a specific contribution with the emphasis on two concrete areas to general ELI reports. Two sets of potential studies will be discussed: (1) Realistic experiments. (2) 'Dream' research. The first set (maybe realizable in the first phase of the laboratory work) includes the following topics: (1) Laser-driven electronuclear processes. (2) Unconventional / NLTE fusion reactions. (3) Laser positron / antimatter physics. Most detailed analysis will be presented for the subject. Some concrete themes planned for this part of the talk are: Challenges for laser positronium physics. Nuclear excitation in positron annihilation. Positrons and the laboratory astrophysics. Schemes of some experiments exploiting the ELI Beamlines possibilities will be displayed. The second ('dream') set to be outlined (under consideration as potential one for the second phase) should initiate a brainstorming discussion in these areas: (1) High-Z ion physics studies. (2) Exploring of high-gamma systems. (3) Search for hypothetic particles. Again, the highest attention will be paid to the topic. Key themes in this part: The search for hidden-sector lightweights. Challenges and opportunities in photon regeneration experiments. Potential of ELI Beamlines for the research in this area? The final section of the contribution will include some comments on technical issues related to the proposed research themes: (1) Novel targets and particle traps. (2) Diagnostics challenges and solutions. (3) Simulation / Evaluation problems. Some new approaches will be considered. Acknowledgements. This research has been
Implementation and Setup of a System Dedicated Logbook based on ELisA
Van Tonder, Raynette
2016-01-01
ELisA is a web tool used by the ATLAS community as a daily logbook facility in order to record and share information concerning the experiment's operation and deployment. A few subsystems, notably the FTK subsystem, of the ATLAS experiment would like to setup a logbook based on the ELisA logbook for their own private usage. This new logbook would be completely separated from the main ATLAS logbook and will only be accessed from the general public network. In this project the implementation and setup of the ELisA based logbook will be discussed as well as various modifications that were made to the new logbook. These modifications were specified by the FTK users in order to make the logbook relevant to the FTK subsystem. Once the logbook was functioning as expected and the users were satisfied with the modifications, the FTK logbook was installed on a FTK dedicated machine where it is currently being used by members of the FTK group.
Ocean Surface Topography Mission (OSTM) /Jason-3: Telemetry, 2015- (NODC Accession 0122599)
National Oceanic and Atmospheric Administration, Department of Commerce — Jason-3 is the fourth mission in U.S.-European series of satellite missions that measure the height of the ocean surface. Scheduled to launch in 2015, the mission...
Evaluation of Ocean Tide Models Used for Jason-2 Altimetry Corrections
DEFF Research Database (Denmark)
Fok, H.S.; Baki Iz, H.; Shum, C. K.
2010-01-01
It has been more than a decade since the last comprehensive accuracy assessment of global ocean tide models. Here, we conduct an evaluation of the barotropic ocean tide corrections, which were computed using FES2004 and GOT00.2, and other models on the Jason-2 altimetry Geophysical Data Record (G...
The Ocean Surface Topography SENTINEL-6/JASON-CS Mission
Cullen, R.
2015-12-01
The Sentinel-6/Jason-CS mission will consist of 2 spacecraft and will be the latest in a series of ocean surface topography missions that will span nearly three decades. They follow the altimeters on- board TOPEX/Poseidon through to Jason-3 (expected March 2015). Jason-CS will continue to fulfil objectives of the reference series whilst introducing a major enhancement in capability providing the operational and science oceanographic community with the state of the art in terms of platform, measurement instrumentation design thus securing optimal operational and science data return. The programme is a part of the EC Copernicus initiative, whose objective is to support Europe's goals regarding sustainable development and global governance of the environment by providing timely and quality data, information, services and knowledge. The programme brings together: ESA for development, procurement & early orbit activities; EUMETSAT for mission management, ground segment, flight ops, contributing funding of the 1st satellite and participation in funding for the 2nd satellite; NASA for the US payload and launcher procurement in addition to funding US science opportunities; EC for funding the operations and participation in funding (with EUMETSAT) for the 2nd satellite; NOAA are expected to provide US ground stations & operations services; CNES for mission expertise and provision of the POD service. The consortium plan to procure 2 satellites with the 1st planned for launch readiness in the 1st half of 2020 with the 2nd satellite 5 years later. The first major commitment to funding was given by the ESA member states that approved the programme in June 2014 and in addition the European Commission funding is also fully secure. The design is based on a platform derived from CryoSat-2 adjusted to the specific requirements of the higher orbit. The principle payload instrument is a high precision Ku/C band radar altimeter with retrieval of geophysical parameters (surface
The Ocean Surface Topography JASON-CS/SENTINEL-6 Mission
Cullen, R.; Francis, R.
2014-12-01
The Jason-CS/Sentinel-6 programme will consist of 2 spacecraft and will be the latest in a series of ocean surface topography missions that will span nearly three decades. They follow the altimeters on-board TOPEX/Poseidon through to Jason-3 (expected March 2015). Jason-CS will continue to fulfil objectives of the reference series whilst introducing a major enhancement in capability providing the operational and science oceanographic community with the state of the art in terms of platform, measurement instrumentation design thus securing optimal operational and science data return. The programme is a part of the EC Copernicus initiative, whose objective is to support Europe's goals regarding sustainable development and global governance of the environment by providing timely and quality data, information, services and knowledge. The programme brings together: ESA for development, procurement & early orbit activities; EUMETSAT for mission management, ground segment, flight ops, contributing funding of the 1st satellite and participation in funding for the 2nd satellite; NOAA for US payload instruments, launcher, ground stations & operations; NASA for developing the US payload, launcher procurement and funding US science; EU for funding the operations and participation in funding (with EUMETSAT) for the 2nd satellite; CNES for mission expertise and provision of POD. The consortium plan to procure 2 satellites with the 1st planned for launch readiness in the 1st half of 2020 with the 2nd satellite 5 years later. The first major commitment to funding was given by the ESA member states that approved the programme in June 2014 and in addition the European Union funding is also secure. The design will be based on a platform derived from CryoSat-2 but adjusted to the specific requirements of the higher orbit. The principle payload instrument is a high precision Ku/C band radar altimeter with retrieval of geophysical parameters (surface elevation, wind speed and SWH) from
ELIMED, MEDical and multidisciplinary applications at ELI-Beamlines
International Nuclear Information System (INIS)
Schillaci, F; Anzalone, A; Cirrone, G A P; Cuttone, G; Musumarra, A; Pisciotta, P; Romano, F; Romano, F P; Carpinelli, M; Cutroneo, M; De Martinis, C; Giove, D; Korn, G; Maggiore, M; Margarone, D; Manti, L; Perozziello, F M; Petrovic, I; Ristic-Fira, A; Renis, M
2014-01-01
ELI-Beamlines is one of the pillars of the pan-European project ELI (Extreme Light Infrastructure). It will be an ultra high-intensity, high repetition-rate, femtosecond laser facility whose main goal is generation and applications of high-brightness X-ray sources and accelerated charged particles in different fields. Particular care will be devoted to the potential applicability of laser-driven ion beams for medical treatments of tumors. Indeed, such kind of beams show very interesting peculiarities and, moreover, laser-driven based accelerators can really represent a competitive alternative to conventional machines since they are expected to be more compact in size and less expensive. The ELIMED project was launched thanks to a collaboration established between FZU-ASCR (ELI-Beamlines) and INFN-LNS researchers. Several European institutes have already shown a great interest in the project aiming to explore the possibility to use laser-driven ion (mostly proton) beams for several applications with a particular regard for medical ones. To reach the project goal several tasks need to be fulfilled, starting from the optimization of laser-target interaction to dosimetric studies at the irradiation point at the end of a proper designed transport beam-line. Researchers from LNS have already developed and successfully tested a high-dispersive power Thomson Parabola Spectrometer, which is the first prototype of a more performing device to be used within the ELIMED project. Also a Magnetic Selection System able to produce a small pencil beam out of a wide energy distribution of ions produced in laser-target interaction has been realized and some preliminary work for its testing and characterization is in progress. In this contribution the status of the project will be reported together with a short description of the of the features of device recently developed.
Barrett, J F
2001-08-01
Oritavancin (LY-333328), a lead glycopeptide from a series targeted at vancomycin-resistant bacteria, especially enterococci, is under development by Eli Lilly for the potential treatment of bacterial infections. It entered phase III trials in the US in January 2001 [396223] and the company expects to submit an NDA by 2003 [396478]. Oritavancin has been reported to have activity comparable to that of vancomycin and teicoplanin (Aventis Pharma AG), but retains activity against glycopeptide-resistant bacterial strains [407519]. The bactericidal activity of oritavancin suggests that it may prove useful as a single agent therapy in the treatment of antibiotic-resistant enterococci. Although its mechanism of action is unclear, dimerization of the glycosyl portion stabilizing D-Ala-D-Ala binding has been suggested [337644].
Ocean Surface Topography Mission (OSTM) /Jason-3: Auxiliary Files, 2015- (NODC Accession 0122597)
National Oceanic and Atmospheric Administration, Department of Commerce — Jason-3 is the fourth mission in U.S.-European series of satellite missions that measure the height of the ocean surface. Scheduled to launch in 2015, the mission...
National Oceanic and Atmospheric Administration, Department of Commerce — Jason-3 is the fourth mission in U.S.-European series of satellite missions that measure the height of the ocean surface. Scheduled to launch in 2015, the mission...
Ocean Surface Topography Mission (OSTM) /Jason-3: Ancillary Files, 2015- (NCEI Accession 0122596)
National Oceanic and Atmospheric Administration, Department of Commerce — Jason-3 is the fourth mission in U.S.-European series of satellite missions that measure the height of the ocean surface. Scheduled to launch in 2015, the mission...
Sverdrup, Bjørn Otto
1994-01-01
"INSTITUTIONALISING CO-OPERATION. A STUDY OF THE ELYSÉE TREATY AND FRANCO-GERMAN CO-OPERATION 1963-93" In 1963, France and Germany completed 'The Franco-German Treaty on Organization and Principles of Co-operation', the so-called Elysée Treaty. The Elysée Treaty, and its protocols, are in this study viewed as a political institution, hence the Elysée Treaty will be referred to as the Franco-German institution. This study seeks to answer the question of how the Franco-German institution has...
78 FR 33426 - Eli Lilly and Co.; Withdrawal of Approval of a New Drug Application for ORAFLEX
2013-06-04
...] Eli Lilly and Co.; Withdrawal of Approval of a New Drug Application for ORAFLEX AGENCY: Food and Drug... new drug application (NDA) for ORAFLEX (benoxaprofen) Tablets, held by Eli Lilly and Co. (Lilly), Lilly Corporate Center, Indianapolis, IN 46285. Lilly has voluntarily requested that approval of this...
Status of the development of a HPGe-BGO pair spectrometer for ELI-NP
Energy Technology Data Exchange (ETDEWEB)
Homm, Ilja; Ignatov, Alexander; Ilieva, Stoyanka; Kroell, Thorsten [Technische Universitaet Darmstadt, Darmstadt (Germany)
2016-07-01
At the moment, the new European research facility called ELI-NP (The Extreme Light Infrastructure - Nuclear Physics) is being built in Bucharest-Magurele, Romania. It is one of three parts of the ELI project and offers applications for the investigation of questions concerning nuclear physics. The 8 HPGe (High-Purity Germanium) CLOVER detectors of ELIADE (ELI-NP Array of DEtectors) with four crystals each and high resolution are important components for the gamma spectroscopic study of photonuclear reactions. These detectors are surrounded by standard anti-Compton shields (AC shield). We investigate the possibility to operate for two of the ELIADE CLOVERS an advanced version of an AC shield as escape γ-rays pair spectrometers to extend the high-resolution spectroscopy to photon energies of several MeV where the pair production process dominates. The main tasks in this work are to develop and test such an AC shield: a pair spectrometer with BGO and CsI(Tl) crystals with APD (avalanche photodiode) or SPM (silicon photomultiplier) readout. The results of prototype testing are reported.
DEFF Research Database (Denmark)
Mertikas, S. P.; Daskalakis, A.; Tziavos, I. N.
2012-01-01
This work outlines how changes in steep bathymetry (from 200 m to 3500 m depth over a distance of 10 km) are reflected on the determined sea surface anomalies at the Gavdos site used for satellite altimeter calibration. After almost 4 years of Jason-2 calibration activities, it has been observed......, but others are related to under-sampling of the Earth's gravity field due to the resolution of the geoid model. New reference surfaces for calibration have thus emerged. Finally, new updated values for the Jason-2 altimeter bias have been determined as 191.81 ± 2.80 mm with the geoid model and as 181.51 ± 2...
EL-i eriesindaja usub lahendusse Transnistrias / Kalman Mizsei ; interv. Erkki Bahovski
Mizsei, Kalman
2007-01-01
Euroopa Liidu eriesindaja Moldovas ütleb, et Moldova liigub aeglaselt EL-i standardite poole ja Eesti on toetanud Moldovat ning koos Ukrainaga leitakse lahendus Transnistria probleemile. Vt. samas: Marianne Mikko. Moldova rikastub
Taani tahab meid ELi kutsuda / Mariann Fischer Boel ; interv. Marianne Mikko
Fischer Boel, Mariann
2002-01-01
Taani põllumajandusminister Mariann Fischer Boel vastab küsimustele Eesti soovitud piimakvoodi, EL-i tulevaste liikmesriikide otsetoetuste, Taanis maa ostmise, Eesti üliliberaalse majanduse ja sotsiaalse heaolu ühendamise võimaluse kohta
Status of the ELIMED multidisciplinary and medical beam-line at ELI-Beamlines
International Nuclear Information System (INIS)
Romano, F; Cirrone, G A P; Cuttone, G; Schillaci, F; Scuderi, V; Amico, A; Candiano, G; Larosa, G; Leanza, R; Manna, R; Marchese, V; Milluzzo, G; Petringa, G; Pipek, J; Giordanengo, S; Guarachi, L F; Marchetto, F; Sacchi, R; Korn, G; Margarone, D
2017-01-01
Nowadays, one of the biggest challenges consists in using high intensity laser-target interaction to generate high-energy ions for medical purposes, eventually replacing the old paradigm of acceleration characterized by huge and complex machines. In order to investigate the feasibility of using laser-driven ion beams for multidisciplinary application, a dedicated beam transport line will be installed at the ELI-Beamlines facility in Prague (CZ), as a part of the User-oriented ELIMAIA beam-line dedicated to ion acceleration and their potential applications. The beam-line section dedicated to transport and dosimetric endpoints is called ELIMED (ELI-Beamlines MEDical and multidisciplinary applications) and will be developed by the INFN-LNS. (paper)
Directory of Open Access Journals (Sweden)
S. Weber
2017-07-01
Full Text Available ELI-Beamlines (ELI-BL, one of the three pillars of the Extreme Light Infrastructure endeavour, will be in a unique position to perform research in high-energy-density-physics (HEDP, plasma physics and ultra-high intensity (UHI (>1022W/cm2 laser–plasma interaction. Recently the need for HED laboratory physics was identified and the P3 (plasma physics platform installation under construction in ELI-BL will be an answer. The ELI-BL 10 PW laser makes possible fundamental research topics from high-field physics to new extreme states of matter such as radiation-dominated ones, high-pressure quantum ones, warm dense matter (WDM and ultra-relativistic plasmas. HEDP is of fundamental importance for research in the field of laboratory astrophysics and inertial confinement fusion (ICF. Reaching such extreme states of matter now and in the future will depend on the use of plasma optics for amplifying and focusing laser pulses. This article will present the relevant technological infrastructure being built in ELI-BL for HEDP and UHI, and gives a brief overview of some research under way in the field of UHI, laboratory astrophysics, ICF, WDM, and plasma optics.
Recensão a: Migrating Music, editado por Jason Toynbee and Byron Dueck (2011)
Vanspauwen, Bart
2014-01-01
UID/EAT/00472/2013 SFRH/BD/92040/2012 Jason Toynbee and Byron Dueck (eds): Migrating Music. London and New York, Routledge, 2011. 256 pp. ISBN 978-0-415-59448-6 Reseña de Bart Paul Vanspauwen (INET-MD, Universidade Nova de Lisboa) publishersversion published
Exploring high-intensity QED at ELI
Energy Technology Data Exchange (ETDEWEB)
Heinzl, T. [Plymouth Univ., School of Mathematics and Statistics, Drake Circus, PL4 8AA (United Kingdom); Ilderton, A. [School of Mathematics, Hamilton Building, Trinity College, Dublin (Ireland)
2009-11-15
We give a non-technical overview of quantum electrodynamics (QED) effects arising in the presence of ultra-strong electromagnetic fields highlighting the new prospects provided by a realisation of the ELI laser facility. Vacuum polarization is a genuine QED process describing the probability amplitude of a propagating photon fluctuating into a virtual electron-positron pair. It has measurable effects such as the Lamb shift and charge screening at short distances. Nonlinear Compton scattering that consists of processes of the type: e + ngamma{sub L} -> e' + gamma (where n counting the number of laser photons involved) is an intensity dependent effect that is accessible to experimental observation
Kütusehinnad Eestis ja ELis : 2004 ja edaspidi / Hede-Kerstin Luik
Luik, Hede-Kerstin
2003-01-01
Autor arutleb lähiajal ja kaugemas perspektiivis kütuse hinda mõjutavate võimalike tegurite üle, sh. Euroopa Komisjoni plaani üle ühtlustada mootorsõidukite kütuste aktsiisimäärad EL-i liikmesriikides. Eesti valitsuse aktsiisipoliitika kujundamisest
Gija Kantšeli kui kontrastide guru / Igor Garšnek
Garšnek, Igor, 1958-
2010-01-01
Gruusia nüüdishelilooja Gija Kantšeli 75. sünnipäeva tähistamisest Eestis - EMTA kammersaalis 11. novembril toimunud avalikust kohtumisest ja vestlusringist ning 12, novembril toimunud autoriõhtust Estonia kontserdisaalis, kus esines ERSO Andres MUstoneni dirigeerimisel
The good gift: a comparison of the Eli Lilly presentation copies of Aequanimitas.
Kimbrough, R C
1995-08-01
The Eli Lilly Pharmaceutical Company of Indianapolis, Indiana distributed some 150,000 copies of the third edition of Sir William Osler's Aequanimitas to graduating medical students between 1932 and 1953. Bibliophiles have considered these volumes identical. However, there were at least seven different printings in English and one in Spanish and one in Portuguese. The size of the book and type of paper changed over the years. The title page, spine information, and printing information also changed. A congratulatory letter from Eli Lilly and Company was placed in the front of each book. These letters have many differences. Thus, the volumes are not identical and the recognition of these differences opens a new field for research and collecting.
DEFF Research Database (Denmark)
Mertikas, Stelios; Tziavos, Ilias; Galanakis, Demitris
This work presents and compares the latest altimeter calibration results for the Sentinel-3, Jason series, as well as the SARAL/AltiKa and the Chinese HY-2 missions, conducted at the Gavdos/Crete calibration/validation facilities. At first, the Jason altimeter calibration values will be given for...
Radiation protection of a proton beamline at ELI-Beamlines
Czech Academy of Sciences Publication Activity Database
Bechet, Sabrina; Versaci, Roberto; Rollet, S.; Olšovcová, Veronika; Fajstavr, Antonín; Žáková, Martina; Margarone, Daniele
2016-01-01
Roč. 11, č. 12 (2016), 1-5, č. článku C12019. ISSN 1748-0221 R&D Projects: GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : models * simulations * wake-field acceleration Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.220, year: 2016
78 FR 21849 - Television Broadcasting Services; Ely, NV to Middletown Township, NJ
2013-04-12
... FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 [MB Docket No. 13-72; RM-11694, DA 13-448] Television Broadcasting Services; Ely, NV to Middletown Township, NJ AGENCY: Federal Communications... CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video Division...
Nuclear Astrophysics at ELI-NP: the ELISSA prototype tested at Laboratori Nazionali del Sud
Guardo, Giovanni Luca; Anzalone, Antonello; Balabanski, Dimiter; Chesnevskaya, Svetlana; Crucillá, Walter; Filipescu, Dan; Gulino, Marisa; La Cognata, Marco; Lattuada, Dario; Matei, Catalin; Pizzone, Rosario Gianluca; Rapisarda, Giuseppe; Romano, Stefano; Spitaleri, Claudio; Taffara, Alessandra; Tumino, Aurora; Xu, Yi
2018-01-01
The Extreme Light Infrastructure-Nuclear Physics (ELI-NP) facility, under construction in Magurele near Bucharest in Romania, will provide high-intensity and high-resolution gamma ray beams that can be used to address hotly debated problems in nuclear astrophysics, such as the accurate measurements of the cross sections of the 24Mg(γ,α)20Ne reaction, that is fundamental to determine the effective rate of 28Si destruction right before the core collapse and the subsequent supernova explosion. For this purpose, a silicon strip detector array (named ELISSA, acronym for Extreme Light Infrastructure Silicon Strip Array) will be realized in a common effort by ELI-NP and Laboratori Nazionali del Sud (INFN-LNS), in order to measure excitation functions and angular distributions over a wide energy and angular range. A prototype of ELISSA was built and tested at INFN-LNS in Catania (Italy) with the support of ELI-NP. In this occasion, we have carried out experiments with alpha sources and with a 11 MeV 7Li beam. Thanks to our approach, the first results of those tests show up a very good energy resolution (better than 1%) and very good position resolution, of the order of 1 mm. Moreover, a threshold of 150 keV can be easily achieved with no cooling.
Qualification of Ti6Al4V ELI Alloy Produced by Laser Powder Bed Fusion for Biomedical Applications
Yadroitsev, I.; Krakhmalev, P.; Yadroitsava, I.; Du Plessis, A.
2018-03-01
Rectangular Ti6Al4V extralow interstitials (ELI) samples were manufactured by laser powder bed fusion (LPBF) in vertical and horizontal orientations relative to the build platform and subjected to various heat treatments. Detailed analyses of porosity, microstructure, residual stress, tensile properties, fatigue, and fracture surfaces were performed based on x-ray micro-computed tomography, scanning electron microscopy, and x-ray diffraction methods. The types of fracture and the tensile fracture mechanisms of the LPBF Ti6Al4V ELI alloy were also studied. Detailed analysis of the microstructure and the corresponding mechanical properties were compared against standard specifications for conventional Ti6Al4V alloy for use in surgical implant applications. Conclusions regarding the mechanical properties and heat treatment of LPBF Ti6Al4V ELI for biomedical applications are made.
Overview on the target fabrication facilities at ELI-NP and ongoing strategies
Gheorghiu, C. C.; Leca, V.; Popa, D.; Cernaianu, M. O.; Stutman, D.
2016-10-01
Along with the development of petawatt class laser systems, the interaction between high power lasers and matter flourished an extensive research, with high-interest applications like: laser nuclear physics, proton radiography or cancer therapy. The new ELI-NP (Extreme Light Infrastructure - Nuclear Physics) petawatt laser facility, with 10PW and ~ 1023W/cm2 beam intensity, is one of the innovative projects that will provide novel research of fundamental processes during light-matter interaction. As part of the ELI-NP facility, Targets Laboratory will provide the means for in-house manufacturing and characterization of the required targets (mainly solid ones) for the experiments, in addition to the research activity carried out in order to develop novel target designs with improved performances. A description of the Targets Laboratory with the main pieces of equipment and their specifications are presented. Moreover, in view of the latest progress in the target design, one of the proposed strategies for the forthcoming experiments at ELI-NP is also described, namely: ultra-thin patterned foil of diamond-like carbon (DLC) coated with a carbon-based ultra-low density layer. The carbon foam which behaves as a near-critical density plasma, will allow the controlled-shaping of the laser pulse before the main interaction with the solid foil. Particular emphasis will be directed towards the target's design optimization, by simulation tests and tuning the key-properties (thickness/length, spacing, density foam, depth, periodicity etc.) which are expected to have a crucial effect on the laser-matter interaction process.
Performance studies of X3 silicon detectors for the future ELISSA array at ELI-NP
Chesnevskaya, S.; Balabanski, D. L.; Choudhury, D.; Constantin, P.; Filipescu, D. M.; Ghita, D. G.; Guardo, G. L.; Lattuada, D.; Matei, C.; Rotaru, A.; State, A.
2018-05-01
ELISSA is an array of silicon strip detectors under construction at the ELI-NP facility for measurements of photodissociation reactions using high-brilliance, quasi monoenergetic gamma beams. The detection system consists of 35 single-sided position-sensitive X3 detectors arranged in a cylindrical configuration and eight QQQ3 detectors as end-caps. A batch of forty X3 detectors have been tested at ELI-NP. The energy and position resolution, ballistic deficit, leakage currents, and depletion voltage were measured and analyzed. Measurements of the energy resolution were carried out using two read-out electronic chains, one based on multichannel preamplifiers and another based on multiplexers.
Anti Moppel : logistikafirmadel ei tasu ELi karta / Anti Moppel ; interv. Rivo Sarapik
Moppel, Antti, 1968-
2003-01-01
Ilmunud ka: Delovõje Vedomosti : Avtomobili i transport 15. okt. lk. 10-11. Majandus- ja kommunikatsiooniministeeriumi osakonnajuhataja Anti Moppel vastab küsimustele, mis puudutavad logistikafirmade ootusi EL-ist, Eesti transpordituru arengut, transpordifirmade valmisolekut Eesti liitumiseks EL-iga, ministeeriumi pakutavat infot EL-i kohta
Characterization of X3 Silicon Detectors for the ELISSA Array at ELI-NP
Chesnevskaya, S.; Balabanski, D. L.; Choudhury, D.; Cognata, M. La; Constantin, P.; Filipescu, D. M.; Ghita, D. G.; Guardo, G. L.; Lattuada, D.; Matei, C.; Rotaru, A.; Spitaleri, C.; State, A.; Xu, Y.
2018-01-01
Position-sensitive silicon strip detectors represent one of the best solutions for the detection of charged particles as they provide good energy and position resolution over a large range of energies. A silicon array coupled with the gamma beams at the ELI-NP facility would allow measuring photodissociation reactions of interest for Big Bang Nucleosynthesis and on heavy nuclei intervening in the p-process. Forty X3 detectors for our ELISSA (ELI-NP Silicon Strip Detectors Array) project have been recently purchased and tested. We investigated several specifications, such as leakage currents, depletion voltage, and detector stability under vacuum. The energy and position resolution, and ballistic deficit were measured and analyzed. This paper presents the main results of our extensive testing. The measured energy resolution for the X3 detectors is better than results published for similar arrays (ANASEN or ORRUBA).
On the potential of laser driven isotope generation at ELI-NP for positron emission tomography
Cucoanes, A. S.; Balabanski, D. L.; Canova, F.; Cuong, P.; Negoita, F.; Puicea, F.; Tanaka, K. A.
2017-05-01
The huge progress made in the laser driven ion acceleration had open the possibility of using ions generated in high power laser interactions with solid targets for the production of medical isotopes. Indeed, lasers could provide several key features with respect to the traditional method where the target activation is produced by particle beams delivered by cyclotrons. The price and the dimensions of high power lasers are on a descendant slope and the quality of the produced ion beams is continuously increasing. However, in order to compete with cyclotrons, the average proton current intensity has to be increased for example by increasing the frequency of the laser pulses. In our contribution, we review the general ideas of the laser-based radioisotope production and we present our analysis on the potential of the medical isotope generation at ELI-NP with a focus on 18F. We use estimations of the proton beam parameters and a code implemented in Geant4 for computing the yield of the main production channel taking into account the experimental conditions available soon at ELI-NP. The obtained results are compatible with previous studies and will be verified by experiments foreseen at the future ELI-NP facility, under construction now in Magurele, Romania.
Preti, Antonio
2002-02-01
Eli Lilly is developing tomoxetine, a norepinephrine reuptake inhibitor, for the potential treatment of attention deficit hyperactivity disorder (ADHD) and depression. As of May 2000, tomoxetine was undergoing phase III trials in the US [368128]. An NDA was filed with the FDA in October 2001, with a launch expected in the second half of 2002 [426786]. Tomoxetine was first investigated by Lilly in the 1980s as a potential treatment for depressive illness. The compound was selected from a series of potent inhibitors of norepinephrine reuptake, and reached large-scale phase II clinical trials for depression in 1990. Development for this indication appeared to stop at that time, despite some evidence that tomoxetine wasfairly effective [273943]. In 1996, Lilly apparently restarted preclinical development of tomoxetine as a potential therapyfor ADHD, and submitted EP-00721777 claiming tomoxetine's utility for this disorder in July of that year [273956]. In June 2001, ABN AMRO predicted sales of $121 million in 2002, rising to $4,064 million in 2012 [422762]. In October 2001, analysts at Salomon Smith Barney predicted that the product would make sales of $24 million in 2002, rising to $305 million in 2005 [427501].
Simulation of photofission experiments at the ELI-NP facility
International Nuclear Information System (INIS)
Constantin, P.; Balabanski, D.L.; Cuong, P.V.
2016-01-01
An extensive experimental program for the study of photofission will take place at the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) facility, where different actinide targets will be exposed to a brilliant gamma beam to produce fission fragments. We report on the implementation within the Geant4 simulation toolkit of the photofission process, of related background processes, and of extended ionic charge parameterization. These developments are used to evaluate the production rates of photofission fragments and their release efficiency from the actinide targets.
Simulation of photofission experiments at the ELI-NP facility
Energy Technology Data Exchange (ETDEWEB)
Constantin, P., E-mail: paul.constantin@eli-np.ro [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Balabanski, D.L. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Cuong, P.V. [Centre of Nuclear Physics, Institute of Physics, Vietnam Academy of Science and Technology, Hanoi (Viet Nam)
2016-04-01
An extensive experimental program for the study of photofission will take place at the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) facility, where different actinide targets will be exposed to a brilliant gamma beam to produce fission fragments. We report on the implementation within the Geant4 simulation toolkit of the photofission process, of related background processes, and of extended ionic charge parameterization. These developments are used to evaluate the production rates of photofission fragments and their release efficiency from the actinide targets.
Eesti välisminister jätab ELis ainsana Rice'iga kohtumata / Toomas Sildam
Sildam, Toomas, 1961-
2005-01-01
Seoses Rein Langi ametisse astumisega 22. veebr., ei jõua ta EL-i välisministrite kohtumisele USA välisministri Condoleezza Rice'iga ega NATO Nõukogu istungile. Lisa: Kaks nädalat välisministrita
Patients' satisfaction evaluation with the health center of elis province.
Karavida, Angeliki; Stamouli, Maria-Aggeliki; Balis, Charalampos
2014-01-01
Patient satisfaction related to the provided health services is a key indicator of the quality of the health sector. The SERVQUAL model was employed as a way of measuring the level of patient satisfaction with the services of the Health Center of Elis Province. Although certain aspects such as "Assurance" and "Empathy" meet the users' needs, improvements like a detailed medical record and an overhaul of the equipment need to be introduced.
Nuclear Physics Research at ELI-NP
Zamfir, N. V.
2018-05-01
The new research facility Extreme Light Infrastructure - Nuclear Physics (ELI-NP) is under construction in Romania, on the Magurele Physics campus. Valued more than 300 Meuros the center will be operational in 2019. The research center will use a high brilliance Gamma Beam and a High-power Laser beam, with unprecedented characteristics worldwide, to investigate the interaction of very intense radiation with matter with specific focus on nuclear phenomena and their applications. The energetic particle beams and radiation produced by the 2x10 PW laser beam interacting with matter will be studied. The precisely tunable energy and excellent bandwidth of the gamma-ray beam will allow for new experimental approaches regarding nuclear astrophysics, nuclear resonance fluorescence, and applications. The experimental equipment is presented, together with the main directions of the research envisioned with special emphasizes on nuclear physics studies.
Beckley, B. D.; Lemoine, F. G.; Zelensky, N. P.; Yang, X.; Holmes, S.; Ray, R. D.; Mitchum, G. T.; Desai, S.; Brown, S.; Haines, B.
2011-01-01
Recent developments in Precise Orbit Determinations (POD) due to in particular to revisions to the terrestrial reference frame realization and the time variable gravity (TVG) continues to provide improvements to the accuracy and stability of the PO directly affecting mean sea level (MSL) estimates. Long-term credible MSL estimates require the development and continued maintenance of a stable reference frame, along with vigilant monitoring of the performance of the independent tracking systems used to calculate the orbits for altimeter spacecrafts. The stringent MSL accuracy requirements of a few tenths of an mm/yr are particularly essential for mass budget closure analysis over the relative short time period of Jason-l &2, GRACE, and Argo coincident measurements. In an effort to adhere to cross mission consistency, we have generated a full time series of experimental orbits (GSFC stdlllO) for TOPEX/Poseidon (TP), Jason-I, and OSTM based on an improved terrestrial reference frame (TRF) realization (ITRF2008), revised static (GGM03s), and time variable gravity field (Eigen6s). In this presentation we assess the impact of the revised precision orbits on inter-mission bias estimates, and resultant global and regional MSL trends. Tide gauge verification results are shown to assess the current stability of the Jason-2 sea surface height time series that suggests a possible discontinuity initiated in early 2010. Although the Jason-2 time series is relatively short (approximately 3 years), a thorough review of the entire suite of geophysical and environmental range corrections is warranted and is underway to maintain the fidelity of the record.
The impact of using jason-1 and cryosat-2 geodetic mission altimetry for gravity field modeling
DEFF Research Database (Denmark)
Andersen, Ole Baltazar; Jain, Maulik; Knudsen, Per
2016-01-01
Since the release of the Danish Technical University DTU10 global marine gravity field in 2010, the amount of geodetic mission altimetry data has nearly tripled. The Cryosat-2 satellite have provided data along its 369 day near repeat since 2010 and as of May 2012 the Jason-1 satellite has been o...
Extending the ELisA Logbook to use MySQL
Osman Jama Ali, Yosuf
2017-01-01
ELisA (Electronic Logbook for the Information Storage of ATLAS Experiments at LHC) is a web tool that is used within the ATLAS community to keep track of the daily experiments and deployments within ATLAS. It is implemented using the Spring framework and consists of a web interface, a REST API and a set of client libraries. This Report summarises the process taken in replacing the Oracle database that is used with MySQL, as well as the incorporation of Docker as a deployment strategy in order to make the logbook more portable.
National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the descriptions for the OSTM/Jason-2 Near Real-Time Altimetry Validation System Quality Reports, which are served through the NOAA/NESDIS...
Xu, Yi; Luo, Wen; Balabanski, Dimiter; Goriely, Stephane; Matei, Catalin; Tesileanu, Ovidiu
2017-09-01
The astrophysical p-process is an important way of nucleosynthesis to produce the stable and proton-rich nuclei beyond Fe which can not be reached by the s- and r-processes. In the present study, the astrophysical reaction rates of (γ,n), (γ,p), and (γ,α) reactions are computed within the modern reaction code TALYS for about 3000 stable and proton-rich nuclei with 12 Infrastructure-Nuclear Physics (ELI-NP) facility is being developed, which will provide the great opportunity to experimentally study the photonuclear reactions in p-process. Simulations of the experimental setup for the measurements of the photonuclear reactions 96Ru(γ,p) and 96Ru(γ,α) are performed. It is shown that the experiments of photonuclear reactions in p-process based on ELI-NP are quite promising.
A gamma beam profile imager for ELI-NP Gamma Beam System
Cardarelli, P.; Paternò, G.; Di Domenico, G.; Consoli, E.; Marziani, M.; Andreotti, M.; Evangelisti, F.; Squerzanti, S.; Gambaccini, M.; Albergo, S.; Cappello, G.; Tricomi, A.; Veltri, M.; Adriani, O.; Borgheresi, R.; Graziani, G.; Passaleva, G.; Serban, A.; Starodubtsev, O.; Variola, A.; Palumbo, L.
2018-06-01
The Gamma Beam System of ELI-Nuclear Physics is a high brilliance monochromatic gamma source based on the inverse Compton interaction between an intense high power laser and a bright electron beam with tunable energy. The source, currently being assembled in Magurele (Romania), is designed to provide a beam with tunable average energy ranging from 0.2 to 19.5 MeV, rms energy bandwidth down to 0.5% and flux of about 108 photons/s. The system includes a set of detectors for the diagnostic and complete characterization of the gamma beam. To evaluate the spatial distribution of the beam a gamma beam profile imager is required. For this purpose, a detector based on a scintillator target coupled to a CCD camera was designed and a prototype was tested at INFN-Ferrara laboratories. A set of analytical calculations and Monte Carlo simulations were carried out to optimize the imager design and evaluate the performance expected with ELI-NP gamma beam. In this work the design of the imager is described in detail, as well as the simulation tools used and the results obtained. The simulation parameters were tuned and cross-checked with the experimental measurements carried out on the assembled prototype using the beam from an x-ray tube.
National Oceanic and Atmospheric Administration, Department of Commerce — Jason-3 is the fourth mission in U.S.-European series of satellite missions that measure the height of the ocean surface. Scheduled to launch in 2015, the mission...
National Oceanic and Atmospheric Administration, Department of Commerce — Jason-3 is the fourth mission in U.S.-European series of satellite missions that measure the height of the ocean surface. Scheduled to launch in 2015, the mission...
Suhtumine tšetšeeni põgenikesse erineb EL-is seinast seina / Ahto Lobjakas
Lobjakas, Ahto, 1970-
2006-01-01
Euroopa Komisjoni kriitika EL-i varjupaigapoliitika varieeruvuse kohta: näiteks Austrias rahuldati 84% tšetšeenide varjupaigataotlustest, Saksamaal aga 23%. Rakendus direktiiv, millega määratletakse ühised miinimumstandardid nimetatud taotluste üle otsustamisel, tähtajaks on direktiivi rakendanud vaid kuus riiki
Effect of Annealing Temperature on the Ballistic Limit Velocity of Ti-6A1-4V ELI
National Research Council Canada - National Science Library
Burkins, M
1997-01-01
.... Army Research Laboratory (ARL) and the RMI Titanium Company (RMI) performed a joint research program to evaluate the effect of annealing temperature on Ti-6A1-4V alloy, extra-low interstitial (ELI...
Laser-driven acceleration at ELI Beamlines - radioprotection aspects
International Nuclear Information System (INIS)
Olsovcova, V.; Fasso, A; Versaci, R.
2014-01-01
The international research centre ELI Beamlines, which is under construction in the village of Dolni Brezany near Prague, will exploit high power lasers of PW class to generate and accelerate beams of charged particles (up to tens of GeVs in energy). The beams will be used for both fundamental and applied research by experts from various scientific fields, including biology, medicine, plasma physics but also dosimetry and radiation protection. As laboratories operating lasers do not belong among the traditional 'radiation workplaces', there are no suitable specialized recommendations or standards available. Therefore, it is necessary to newly implement the existing general recommendations. Further, the generated mixed fields possess unique properties due to their production methods. As a result, the routinely used detection methods are not reliable or fail completely. (authors)
Directory of Open Access Journals (Sweden)
Ya-fei Ren
2017-01-01
Full Text Available Thermo hydrogen treatment (THT of titanium is a process in which hydrogen is used as a temporary alloying element in titanium alloys. It is an attractive approach for controlling the microstructure and thereby improving the final mechanical properties. In the present study, the microstructure of the original (non-hydrogenated sample has only α phase and the grains is coarse with an average size of ~ 650 μm. While the grain size of thermo hydrogen treated Ti-5Al-2.5Sn ELI alloy became finer and the mechanical properties were improved significantly. When the hydrogen content of the hydrogenated Ti-5Al-2.5Sn ELI alloy is 0.321wt.%, β phase and δ titanium hydride appear. Also the average grain size decreases to 450 μm. When the hydrogen content is 0.515wt.%, the grain size decreases to 220 μm. The mechanical properties were tested after dehydrogenation, and the mechanical properties improved significantly compared to the unhydrogenated specimens. The tensile strength of the Ti-5Al-2.5Sn ELI alloy improved by 17.7% when the hydrogen content increased to 0.920wt.%, at the same time the percentage reduction of area (Z increased by 33% and the impact toughness increased by 37%.
Nuclear Reactions Studies in Laser-Plasmas at the forthcoming ELI-NP facilities
Lanzalone, G.; Muoio, A.; Altana, C.; Frassetto, M.; Malferrari, L.; Mascali, D.; Odorici, F.; Tudisco, S.; Gizzi, L. A.; Labate, L.; Puglia, S. M. R.; Trifirò, A.
2018-05-01
This work aim to prepare a program of studies on nuclear physics and astrophysics, which will be conducted at the new ELI-NP Laser facility, which actually is under construction in Bucharest, Romania. For the arguments treated, such activity has required also a multidisciplinary approach and knowledge in the fields of nuclear physics, astrophysics, laser and plasma physics join with also some competences on solid state physics related to the radiation detection. A part of this work has concerned to the experimental test, which have been performed in several laboratories and in order to study and increase the level of knowledge on the different parts of the project. In particular have been performed studies on the laser matter interaction at the ILIL laboratory of Pisa Italy and at the LENS laboratory in Catania, where (by using different experimental set-ups) has been investigated some key points concerning the production of the plasma stream. Test has been performed on several target configurations in terms of: composition, structure and size. All the work has been devoted to optimize the conditions of target in order to have the best performance on the production yields and on energies distribution of the inner plasma ions. A parallel activity has been performed in order to study the two main detectors, which will constitute the full detections system, which will be installed at the ELI-NP facility.
Measuring GAMMA 10 end-loss ions with an ELIS [end-loss-ion spectrometers] from TMX-U
International Nuclear Information System (INIS)
Foote, J.H.
1987-01-01
The author spent the period from March 22 to July 10, 1987, at the GAMMA 10 tandem-mirror experiment at the University of Tsukuba in Tsukuba, Japan. The purpose of this extended trip was to install on GAMMA 10 one of the end-loss-ion spectrometers (ELIS) used on TMX-U (Tandem Mirror Experiment-Upgrade) at LLNL and to make plasma measurements there with this diagnostic instrument. This report discusses the considerable planning and preparations that preceded the trip, the actual experience with the ELIS equipment at GAMMA 10, data and results obtained while the author was there, GAMMA 10 experimental procedures, the scientific and technical support during the stay, and some final comments and suggestions concerning an international exchange such as this one. The data acquired on GAMMA 10 while there, along with earlier data, present an encouraging picture of a plasma in a thermal-barrier mode in a tandem-mirror, magnetic-fusion machine. 6 refs
Shielding and activation studies for the ELI-beamlines project
International Nuclear Information System (INIS)
Fasso, Alberto; Korn, Georg; Versaci, Roberto; Ferrari, Anna
2015-01-01
ELI-beamlines is one of the four pillars of the Extreme Light Infrastructure, a European ESFRI Project, for the next generation of high-energy and high-intensity lasers. It aims at the development of high-brightness sources of X-rays and the acceleration of proton, electron, and ion beams, to be used both for pure research and practical applications. Aiming at a proper radiation protection assessment, for both shielding and activation, extensive FLUKA simulations have been performed, taking into account the laser high repetition rates. The present work, which is the continuation of the calculations presented at SATIF-10, is the first one based on the design of the facility being constructed and on the updated experimental set-up. (authors)
Allocation universelle et transferts "ELIE" : De la divergence à la compatibilité ?
Claude Gamel
2008-01-01
Van Parijs (1995) and Kolm (2005) étudient les fondements éthico-philosophiques de la fiscalité et de la redistribution des revenus à travers les projets apparemment proches d'allocation universelle et de transferts ELIE (1). En fait, les deux propositions divergent en raison de modalités plus ou moins crédibles de financement et du traitement très dissemblable des « excentriques productifs » qui choisissent de ne pas travailler (2). Les deux projets restent néanmoins compatibles : du point d...
Radiation field characterization and shielding studies for the ELI Beamlines facility
Czech Academy of Sciences Publication Activity Database
Ferrari, A.; Amato, E.; Margarone, Daniele; Cowan, T.; Korn, Georg
2013-01-01
Roč. 272, May (2013), s. 138-144 ISSN 0169-4332 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0087; GA ČR(CZ) GAP205/11/1165 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087; AVČR(CZ) M100101210 Institutional support: RVO:68378271 Keywords : particle acceleration from laser-matter interaction * shielding * Monte Carlo * radiation protection Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.538, year: 2013
Beckley, Brian D.; Ray, Richard D.; Lemoine, Frank G.; Zelensky, N. P.; Holmes, S. A.; Desal, Shailen D.; Brown, Shannon; Mitchum, G. T.; Jacob, Samuel; Luthcke, Scott B.
2010-01-01
The science value of satellite altimeter observations has grown dramatically over time as enabling models and technologies have increased the value of data acquired on both past and present missions. With the prospect of an observational time series extending into several decades from TOPEX/Poseidon through Jason-1 and the Ocean Surface Topography Mission (OSTM), and further in time with a future set of operational altimeters, researchers are pushing the bounds of current technology and modeling capability in order to monitor global sea level rate at an accuracy of a few tenths of a mm/yr. The measurement of mean sea-level change from satellite altimetry requires an extreme stability of the altimeter measurement system since the signal being measured is at the level of a few mm/yr. This means that the orbit and reference frame within which the altimeter measurements are situated, and the associated altimeter corrections, must be stable and accurate enough to permit a robust MSL estimate. Foremost, orbit quality and consistency are critical to satellite altimeter measurement accuracy. The orbit defines the altimeter reference frame, and orbit error directly affects the altimeter measurement. Orbit error remains a major component in the error budget of all past and present altimeter missions. For example, inconsistencies in the International Terrestrial Reference Frame (ITRF) used to produce the precision orbits at different times cause systematic inconsistencies to appear in the multimission time-frame between TOPEX and Jason-1, and can affect the intermission calibration of these data. In an effort to adhere to cross mission consistency, we have generated the full time series of orbits for TOPEX/Poseidon (TP), Jason-1, and OSTM based on recent improvements in the satellite force models, reference systems, and modeling strategies. The recent release of the entire revised Jason-1 Geophysical Data Records, and recalibration of the microwave radiometer correction also
Gómez-Saldivar, Georgina; Fernandez, Anita; Hirano, Yasuhiro; Mauro, Michael; Lai, Allison; Ayuso, Cristina; Haraguchi, Tokuko; Hiraoka, Yasushi; Piano, Fabio; Askjaer, Peter
2016-06-01
Nucleoporins are the constituents of nuclear pore complexes (NPCs) and are essential regulators of nucleocytoplasmic transport, gene expression and genome stability. The nucleoporin MEL-28/ELYS plays a critical role in post-mitotic NPC reassembly through recruitment of the NUP107-160 subcomplex, and is required for correct segregation of mitotic chromosomes. Here we present a systematic functional and structural analysis of MEL-28 in C. elegans early development and human ELYS in cultured cells. We have identified functional domains responsible for nuclear envelope and kinetochore localization, chromatin binding, mitotic spindle matrix association and chromosome segregation. Surprisingly, we found that perturbations to MEL-28's conserved AT-hook domain do not affect MEL-28 localization although they disrupt MEL-28 function and delay cell cycle progression in a DNA damage checkpoint-dependent manner. Our analyses also uncover a novel meiotic role of MEL-28. Together, these results show that MEL-28 has conserved structural domains that are essential for its fundamental roles in NPC assembly and chromosome segregation.
Strong field physics and QED experiments with ELI-NP 2×10PW laser beams
Energy Technology Data Exchange (ETDEWEB)
Turcu, I. C. E., E-mail: Edmond.Turcu@eli-np.ro; Balascuta, S., E-mail: Edmond.Turcu@eli-np.ro; Negoita, F., E-mail: Edmond.Turcu@eli-np.ro [National Institute for Physics and Nuclear Engineering, ELI-NP, Str. Reactorului, nr. 30, P.O.Box MG-6, Bucharest-Magurele (Romania); Jaroszynski, D.; McKenna, P. [University of Strathclyde, Scottish Universities Physics Alliance (SUPA), Glasgow G4 0NG, Scotland (United Kingdom)
2015-02-24
The ELI-NP facility will focus a 10 PW pulsed laser beam at intensities of ∼10{sup 23} W/cm{sup 2} for the first time, enabling investigation of the new physical phenomena at the interfaces of plasma, nuclear and particle physics. The electric field in the laser focus has a maximum value of ∼10{sup 15} V/m at such laser intensities. In the ELI-NP Experimental Area E6, we propose the study of Radiation Reaction, Strong Field Quantum Electrodynamics (QED) effects and resulting production of Ultra-bright Sources of Gamma-rays which could be used for nuclear activation. Two powerful, synchronized 10 PW laser beams will be focused in the E6 Interaction Chamber on either gas or solid targets. One 10 PW beam is the Pump-beam and the other is the Probe-beam. The focused Pump beam accelerates the electrons to relativistic energies. The accelerated electron bunches interact with the very high electro-magnetic field of the focused Probe beam. The layout of the experimental area E6 will be presented with several options for the experimental configurations.
Eli Hecksher as a Portrait Maker
Directory of Open Access Journals (Sweden)
Benny Carlson
2017-04-01
Full Text Available Eli Heckscher was not only author of extensive investigations into economic history. He was also skillful in depicting phenomena in small format in encyclopædias, journals and newspapers. This article presents Heckscher as portrait maker of economic scholars. In these portraits—what he emphasized, what he praised, what he criticized—one can discern the stance of the portrait maker himself. Overall, his portraits are permeated by admiration of sharp theoretical analyses and massive economic historical investigations. He admires the founding fathers of political economy, Adam Smith and David Ricardo, stresses continuity in the development of economic thought, praises humble innovators like David Davidson, Knut Wicksell and Alfred Marshall and denounces (what he perceives as pretentious innovators like Gustav Cassel and John Maynard Keynes. He is critical towards economists who attempt to break out of the classical and neoclassical tradition, especially representatives of the German historical school, and what he judges to be a new type of mercantilism, represented by Bertil Ohlin and Keynes. At the same time he appreciates voluminous and solid investigations into economic history, even if performed without theoretical beacons, by scholars like William Cunningham, William Ashley, John Clapham, Marc Bloch, Richard Ehrenberg and Werner Sombart.
de Jonge, E
2002-04-01
Drotrecogin alfa (Xigris, recombinant activated protein C) is an anticoagulant developed and launched by Eli Lilly & Co for the treatment of sepsis [333781], [339372], [430133], [436271]. The FDA and the EMEA accepted the brand name Xigris for drotrecogin alfa in June 2001. This trade name had been proposed by Lilly in place of the previous brand name, Zovant, which was deemed unacceptable by the EMEA due to concerns that the name could be confused with hospital-based drugs [412512]. Filings for sepsis were made in the US, EU and Australia in February 2001 [398514], [447870] and in March 2001, the US FDA assigned drotrecogin alfa Priority Review status [403435]. The FDA extended the action date from July 27 to October 27, 2001 for completion of its review of the biologics license application (BLA) for drotrecogin alfa to assess further supplementary data submitted by Lilly [412512]. At the October 16, 2001 meeting (postponed from September 12), the FDA Advisory Committee on Anti-Infective Drugs split 10 to 10 over whether to recommend approval [425873], [425940]. In late October 2001, Lilly received an approvable letter from the FDA for the treatment of severe sepsis. Approval was contingent upon successful negotiation of labeling, agreement on post-approval clinical trials, and successful completion of manufacturing inspections [427301]. In November 2001, the FDA approved drotrecogin alfa for the reduction of mortality in adult patients with severe sepsis who have a high risk of death [430133]; the product was launched onto the US market days later [436271]. Following the FDA committee's split decision in October 2001, Credit Suisse First Boston, which expected mid-2002 approval but with restrictive labeling, revised its predictions from $1.265 billion in 2004 sharply downwards to $543 million [425929].
Energy Technology Data Exchange (ETDEWEB)
Fridley, David; Lin, Jiang; Denver, Andrea; Biermayer, Peter; Dillavou, Tyler
2005-07-20
This report examines critical differences among energy-efficient labeling programs for CFLs in Brazil, China, the United States, and the seven members of the international Efficient Lighting Initiative (ELI) in terms of technical specifications and test procedures, and review issues related to international harmonization of these standards.
One-Centimeter Orbits in Near-Real Time: The GPS Experience on OSTM/JASON-2
Haines, Bruce; Armatys, Michael; Bar-Sever, Yoaz; Bertiger, Willy; Desai, Shailen; Dorsey, Angela; Lane, Christopher; Weiss, Jan
2010-01-01
The advances in Precise Orbit Determination (POD) over the past three decades have been driven in large measure by the increasing demands of satellite altimetry missions. Since the launch of Seasat in 1978, both tracking-system technologies and orbit modeling capabilities have evolved considerably. The latest in a series of precise (TOPEX-class) altimeter missions is the Ocean Surface Topography Mission (OSTM, also Jason-2). GPS-based orbit solutions for this mission are accurate to 1-cm (radial RMS) within 3-5 hrs of real time. These GPS-based orbit products provide the basis for a near-real time sea-surface height product that supports increasingly diverse applications of operational oceanography and climate forecasting.
Radiation field characterization and shielding studies for the ELI Beamlines facility
Energy Technology Data Exchange (ETDEWEB)
Ferrari, A., E-mail: a.ferrari@hzdr.de [Institute of Radiation Physics, Helmholtz-Zentrum Dresden-Rossendorf, PF 510119, 01314 Dresden (Germany); Amato, E. [Department of Radiological Sciences, Messina University (Italy); Margarone, D. [ELI Beamlines Project, Institute of Physics of the ASCR, Na Slovance 2, 18221 Prague (Czech Republic); PALS Centre, Za Slovankou, 18200 Prague (Czech Republic); Cowan, T. [Institute of Radiation Physics, Helmholtz-Zentrum Dresden-Rossendorf, PF 510119, 01314 Dresden (Germany); Korn, G. [ELI Beamlines Project, Institute of Physics of the ASCR, Na Slovance 2, 18221 Prague (Czech Republic)
2013-05-01
The ELI (Extreme Light Infrastructure) Beamlines facility in the Czech Republic, which is planned to complete the installation in 2015, is one of the four pillars of the ELI European project. Several laser beamlines with ultrahigh intensities and ultrashort pulses are foreseen, offering versatile radiation sources in an unprecedented energy range: laser-driven particle beams are expected to range between 1 and 50 GeV for electrons and from 100 MeV up to 3 GeV for protons. The number of particles delivered per laser shot is estimated to be 10{sup 9}–10{sup 10} for the electron beams and 10{sup 10}–10{sup 12} for the proton beams. The high energy and current values of the produced particles, together with the potentiality to operate at 10 Hz laser repetition rate, require an accurate study of the primary and secondary radiation fields to optimize appropriate shielding solutions: this is a key issue to minimize prompt and residual doses in order to protect the personnel, reduce the radiation damage of electronic devices and avoid strong limitations in the operational time. A general shielding study for the 10 PW (0.016 Hz) and 2 PW (10 Hz) laser beamlines is presented here. Starting from analytical calculations, as well as from dedicated simulations, the main electron and proton fields produced in the laser-matter interaction have been described and used to characterize the “source terms” in full simulations with the Monte Carlo code FLUKA. The secondary radiation fields have been then analyzed to assess a proper shielding. The results of this study and the proposed solutions for the beam dumps of the high energy beamlines, together with a cross-check analysis performed with the Monte Carlo code GEANT4, are presented.
The Electronic Logbook for the Information Storage of ATLAS Experiment at LHC (ELisA)
International Nuclear Information System (INIS)
Corso Radu, A; Lehmann Miotto, G; Magnoni, L
2012-01-01
A large experiment like ATLAS at LHC (CERN), with over three thousand members and a shift crew of 15 people running the experiment 24/7, needs an easy and reliable tool to gather all the information concerning the experiment development, installation, deployment and exploitation over its lifetime. With the increasing number of users and the accumulation of stored information since the experiment start-up, the electronic logbook actually in use, ATLOG, started to show its limitations in terms of speed and usability. Its monolithic architecture makes the maintenance and implementation of new functionality a hard-to-almost-impossible process. A new tool ELisA has been developed to replace the existing ATLOG. It is based on modern web technologies: the Spring framework using a Model-View-Controller architecture was chosen, thus helping building flexible and easy to maintain applications. The new tool implements all features of the old electronic logbook with increased performance and better graphics: it uses the same database back-end for portability reasons. In addition, several new requirements have been accommodated which could not be implemented in ATLOG. This paper describes the architecture, implementation and performance of ELisA, with particular emphasis on the choices that allowed having a scalable and very fast system and on the aspects that could be re-used in different contexts to build a similar application.
Tramontana, A.; Anzalone, A.; Candiano, G.; Carpinelli, M.; Cirrone, G. A. P.; Cuttone, G.; Korn, G.; Licciardello, T.; Maggiore, M.; Manti, L.; Margarone, D.; Musumarra, A.; Perozziello, F.; Pisciotta, P.; Raffaele, L.; Romano, F.; Romano, F. P.; Stancampiano, C.; Schillaci, F.; Scuderi, V.; Torrisi, L.; Tudisco, S.
2014-04-01
Laser accelerated proton beams represent nowadays an attractive alternative to the conventional ones and they have been proposed in different research fields. In particular, the interest has been focused in the possibility of replacing conventional accelerating machines with laser-based accelerators in order to develop a new concept of hadrontherapy facilities, which could result more compact and less expensive. With this background the ELIMED (ELIMED: ELI-Beamlines MEDical applications) research project has been launched by LNS-INFN researchers (Laboratori Nazionali del Sud-Istituto Nazionale di Fisica Nucleare, Catania, IT) and ASCR-FZU researchers (Academy of Sciences of the Czech Republic-Fyzikální ústar, Prague, Cz), within the pan-European ELI-Beamlines facility framework. Its main purposes are the demonstration of future applications in hadrontherapy of optically accelerated protons and the realization of a laser-accelerated ion transport beamline for multidisciplinary applications. Several challenges, starting from laser-target interaction and beam transport development, up to dosimetric and radiobiological issues, need to be overcome in order to reach the final goals. The design and the realization of a preliminary beam handling and dosimetric system and of an advanced spectrometer for high energy (multi-MeV) laser-accelerated ion beams will be shortly presented in this work.
Belling the cat: Eli F. Heckscher on the gold standard as a discipline device
Fregert, Klas
2013-01-01
Unlike Knut Wicksell, Eli Heckscher did not believe the time had arrived for “managed money” to replace the gold standard after World War I. The war had shown that only a gold standard could bind the central bank to a time-consistent policy with reasonable price stability. Heckscher likened the problem of reinstating the gold standard to “Belling the cat” in Aesop’s fable. When the international gold standard crumbled in the Great Depression, he supported the Swedish price stabilization regim...
Elie Cartan and pan-geometry of multispatial hyperspace
International Nuclear Information System (INIS)
Czajko, Jakub
2004-01-01
Elie Cartan has proved that highest dimensionality of any simple geometric space is three and that an exterior differentiation of a 3D+ geometric object gives bivector, which may correspond to some two 2D surfaces as if the 3D+ geometric object comprised two 3D objects. Since one cannot increase the dimensionality of a 3D space even though more than four independently varying physical magnitudes do exist, then an expansion of dimensionality requires a multispatial hyperspace that contains many simple geometric 3D spaces. Presence of such a hyperspace prompts for an entirely new concept of vectors with an isometric operation of vector multiplication of traditional vectors (3-tuples). This new operation on 3-vectors implies presence of a 3D mass-based linear vector space and consequently thus a 9D geometric hyperspace for classical mechanics alone. Also an outline of entirely new, synthetic approach to physics and mathematics is introduced. This synthetic approach can be used to design a computer-aided knowledge extracting system, which could generate entirely new scientific knowledge
Relato literario, relato periodístico: el caso Elián González
Lic. María Inés Loyola; Lic. Miriam Eugenia Villa
2000-01-01
Nos proponemos estudiar las relaciones entre relato literario y relato periodístico a partir del caso del niño balsero cubano, Elián González, que estuvo retenido en Estados Unidos durante siete meses. En este análisis, el principal objetivo es describir las diferencias y similitudes respecto a la construcción discursiva de la historia narrada, sus personajes y escenarios. La finalidad de la comparación es demostrar cómo los relatos "no ficcionales" que los medios imponen como verdaderos y ac...
Damisih, Jujur, I. Nyoman; Sah, Joni; Agustanhakri, Prajitno, Djoko Hadi
2018-05-01
Ti 6Al-4V ELI (Extra Low Interstitial)alloy containing 6wt% of aluminum, 4wt% of vanadium with controlled level of iron and oxygen is one of most popular alloy employed in biomedical applications as implant material. Heat treatment process for titanium alloys becomes important and could be performed by some of different ways in order to develop microstructure as well as its properties. The objective of this paper is to study the effects of solution treatment temperature on microstructure and mechanical properties of as-cast Ti-6Al-4V ELI especially microhardness value. The alloy was melted by single arc melting furnace with a water-cooled copper crucible hearth under argon atmosphere and then casted. It was heat treated through solution treatment at 3 (three) different temperaturesi.e. 850°C, 950°C and 1050°C in an argon gas atmosphere for around 30 minutes. After solution treatment, samples were water quenched and then aged at temperature of 500°C for 4 hours. To investigate its microstructure, the alloy was investigated under optical microscope and scanning electron microscope (SEM). It was observed Widmanstätten microstructure consisting of mixture α and β phase with basket-weave pattern. The Vickers microhardness test was performed and the results exhibited the optimum value was obtained at temperature of 950°C of solution treatment. From the observation, it revealed that the heat treatment has substantial effect on microstructural properties where microhardness increased due to formation of α' martensite structure. It was showed also that solution treatment followed by aging could improve mechanical properties especially microhardness value of Ti-6Al-4V ELI alloy. These results were suggesting the optimized conditions of heat treatment to obtain the best microstructure properties and microhardness value.
Czech Academy of Sciences Publication Activity Database
Ďurák, Michal; Velpula, Praveen K.; Kramer, Daniel; Cupal, Josef; Medřík, Tomáš; Hřebíček, Jan; Golasowski, Jiří; Peceli, Davorin; Kozlová, Michaela; Rus, Bedřich
2017-01-01
Roč. 56, č. 1 (2017), s. 1-6, č. článku 011024. ISSN 0091-3286 R&D Projects: GA MŠk LQ1606; GA MŠk LM2015065; GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091; GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 Laser Sys(XE) CZ.1.07/2.3.00/20.0091; ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : Peta-watt class laser s * ultrafast laser s * behavior at different vacuum levels * cleaning treatment Subject RIV: BH - Optics, Masers, Laser s OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.082, year: 2016
Czech Academy of Sciences Publication Activity Database
Amato, E.; Italiano, A.; Margarone, Daniele; Pagano, B.; Baldari, S.; Korn, Georg
2016-01-01
Roč. 11, Apr (2016), 1-7, č. článku C04007. ISSN 1748-0221 R&D Projects: GA MŠk EF15_008/0000162; GA MŠk LQ1606; GA ČR(CZ) GA15-02964S Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : accelerator applications * radiotherapy concepts Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.220, year: 2016
Karakavakta anaçlık yöntemiyle sırık çeliği üretim tekniğinin belirlenmesi
Directory of Open Access Journals (Sweden)
Dr. Selda AKGÜL
2016-12-01
Full Text Available Bu çalışmada, kavak dikim materyali üretiminde, en pratik ve ekonomik metot olarak tespit edilen, anaçlık usulü ile “KOCABEY”, “GAZİ” ve “GEYVE” karakavak klonlarında, ağaçlandırmalarda kullanılmak üzere, bir ve iki yaşlı sırık çeliği standart üretim metodu tespit edilmeye çalışılmıştır. Bir ve iki yaşlı sırık çeliği üretiminde, aralık-mesafenin ve anaçtaki sürgün sayısının etkili olup olmadığını belirlemek amacıyla, rastlantı bloklarında bölünmüş parseller deneme deseni kullanılarak Ankara-Behiçbey Orman Fidanlığında denemeler tesis edilmiştir. Çalışmadan elde edilen sonuçlara göre, bir yaşlı sırık çeliği üretiminde, denenen geniş aralık-mesafe grubu (1,6x0,4 m, üretilen miktar açısından daha iyi sonuç vermiştir. Anaçta bırakılacak sürgün adedi sayısının ise önemli olmadığı görülmüştür. İki yaşlı sırık çeliği üretiminde ise; her üç klonda da, denenen işlemlerin etkisinin çok fazla olmadığı kanaatine ulaşılmıştır.
The Energy Selection System for the laser-accelerated proton beams at ELI-Beamlines
Czech Academy of Sciences Publication Activity Database
Tramontana, A.; Candiano, G.; Carpinelli, M.; Cirrone, G.A.P.; Cuttone, G.; Bijan Jia, S.; Korn, Georg; Licciardello, T.; Maggiore, Mario; Manti, L.; Margarone, Daniele; Pisciotta, P.; Romano, F.; Stancampiano, C.; Schillaci, Francesco; Scuderi, Valentina
2014-01-01
Roč. 9, May (2014), s. 1-11 ISSN 1748-0221 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279; GA MŠk EE.2.3.20.0087 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; LaserZdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; OP VK 2 LaserGen(XE) CZ.1.07/2.3.00/20.0087 Institutional support: RVO:68378271 Keywords : instrumentation for hadron therapy * wake-field acceleration (laser-driven, electron-driven) * plasma diagnostics * charged-particle spectroscopy Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.399, year: 2014
Design of the gas cell for the IGISOL facility at ELI-NP
Energy Technology Data Exchange (ETDEWEB)
Constantin, P., E-mail: paul.constantin@eli-np.ro [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Balabanski, D.L. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Anh, L.T. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Graduate University of Science and Technology, Vietnam Academy of Science and Technology, Hanoi (Viet Nam); Cuong, P.V. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania); Centre of Nuclear Physics, Institute of Physics, Vietnam Academy of Science and Technology, Hanoi (Viet Nam); Mei, B. [Extreme Light Infrastructure – Nuclear Physics, “Horia Hulubei” National Institute for Physics and Nuclear Engineering, Str. Reactorului 30, 077125 Bucharest Magurele (Romania)
2017-04-15
One of the experimental programs that will be carried out at the Extreme Light Infrastructure – Nuclear Physics (ELI-NP) facility is the production of exotic neutron-rich ion beams in an IGISOL facility via photofission in a stack of actinide targets placed at the center of a cell filled with He gas. Simulations with the Geant4 toolkit were done for the optimization of the target configuration that maximizes the rate of released photofission fragments. The cell geometry is established based on the stopping properties of these fragments. Studies, based on simulations with Geant4 and SIMION 8.1, of the space charge effect and its induced electric field in the gas cell are presented. Estimates of the extraction time and efficiency of the photofission fragments are derived.
Status of ELI-ALPS implementation (Conference Presentation)
Osvay, Karoly; Charalambidis, Dimitris; Antici, Patrizio; Dombi, Péter; Fulop, Lajos J.; Lepine, Franck; Mészáros, Gergo; Sansone, Giuseppe; Varju, Katalin G.
2017-05-01
The major research equipment of the Attosecond Light Pulse Source of the Extreme Light Infrastructure (ELI-ALPS) are driven by laser pulses of few cycle duration operating in the 100 W average power regime. The peak power and the repetition rate span from 1 TW at 100 kHz up to PW at 10 Hz. The systems are designed for stable and reliable operation, yet to deliver pulses with unique parameters, especially with unmatched fluxes and extreme bandwidths. This exceptional performance will enable the generation of secondary sources with exceptional characteristics, including light sources ranging from the THz to the X-ray spectral ranges, and particle sources. The experimental activities in the building complex to be inaugurated early 2017 will start with the installation of the two 100 kHz repetition rate, CEP stabilized lasers in May 2017. The MIR laser produces 0.15mJ, shorter than 4-optical-cylce pulses tunable between 2.5-3.9 µm. The first stage of the HR laser will provide pulses around 1 µm with 1 mJ energy and pulse duration less than 6.2 fs. The systems will be optically synchronized to each other with a temporal jitter below 1 fs. Along with the installation of the lasers, we will also start the assembly of the high harmonic beamlines and the THz laboratory, as well as nanoplasmonic experiments. The XUV bursts of light with attosecond duration are expected to be generated by the end of 2017.
Xu, Y.; Goriely, S.; Balabanski, D. L.; Chesnevskaya, S.; Guardo, G. L.; La Cognata, M.; Lan, H. Y.; Lattuada, D.; Luo, W.; Matei, C.
2018-05-01
The astrophysical p-process is an important way of nucleosynthesis to produce the stable and proton-rich nuclei beyond Fe which can not be reached by the s- and r-processes. In the present study, the impact of nuclear ingredients, especially the nuclear potential, level density and strength function, to the astrophysical re-action rates of (p,γ), (α,γ), (γ,p), and (γ,α) reactions are systematically studied. The calculations are performed basad on the modern reaction code TALYS for about 3000 stable and proton-rich nuclei with 12≤Z≤110. In particular, both of the Wood-Saxon potential and the microscopic folding potential are taken into account. It is found that both the capture and photonuclear reaction rates are very sensitive to the nuclear potential, thus the better determination of nuclear potential would be important to reduce the uncertainties of reaction rates. Meanwhile, the Extreme Light Infrastructure-Nuclear Physics (ELI-NP) facility is being developed, which will provide the great opportunity to experimentally study the photonuclear reactions in p-process. Simulations of the experimental setup for the measurements of the photonuclear reactions 96Ru(γ,p) and 96Ru(γ,α) are performed. It is shown that the experiments of photonuclear reactions in p-process based on ELI-NP are quite promising.
Brasseur, Pierre; Candille, Guillem; Bouttier, Pierre-Antoine; Brankart, Jean-Michel; Verron, Jacques
2015-04-01
The objective of this study is to explicitly simulate and quantify the uncertainty related to sea-level anomalies diagnosed from eddy-resolving ocean circulation models, in order to develop advanced methods suitable for addressing along-track altimetric data assimilation into such models. This work is carried out jointly with the MyOcean and SANGOMA (Stochastic Assimilation for the Next Generation Ocean Model Applications) consortium, funded by EU under the GMES umbrella over the 2012-2015 period. In this framework, a realistic circulation model of the North Atlantic ocean at 1/4° resolution (NATL025 configuration) has been adapted to include effects of unresolved scales on the dynamics. This is achieved by introducing stochastic perturbations of the equation of state to represent the associated model uncertainty. Assimilation experiments are designed using altimetric data from past and on-going missions (Jason-2 and Saral/AltiKA experiments, and Cryosat-2 for fully independent altimetric validation) to better control the Gulf Stream circulation, especially the frontal regions which are predominantly affected by the non-resolved dynamical scales. An ensemble based on such stochastic perturbations is then produced and evaluated -through the probabilistic criteria: the reliability and the resolution- using the model equivalent of along-track altimetric observations. These three elements (stochastic parameterization, ensemble simulation and 4D observation operator) are used together to perform optimal 4D analysis of along-track altimetry over 10-day assimilation windows. In this presentation, the results show that the free ensemble -before starting the assimilation process- well reproduces the climatological variability over the Gulf Stream area: the system is then pretty reliable but no informative (null probabilistic resolution). Updating the free ensemble with altimetric data leads to a better reliability and to an improvement of the information (resolution
Dorina ARANGHEL; Doina STANCIU; Chivuta-Ramona BADITA; Ana STOCHIOIU; Ion TUDOR
2018-01-01
The individual andenvironmental passive monitoring program of the Extreme Light Infrastructure -Nuclear Physics (ELI-NP) will use a combination of Optically StimulatedLuminescence (OSL) and Solid State Nuclear Track Detector – (SSNTD) detectors.The OSL dosimeters are dedicated for X-rays/gamma radiation monitoring and willcontain BeO detectors which provide the personal dose equivalent and theambient dose equivalent or the directional dose equivalent according to SR EN62387-1:2012. The SSNTDs...
Study about the entrepreneurs´ or social iInnovators´ competencies case study of the EAN ELI Prize
Directory of Open Access Journals (Sweden)
Omar Alonso Patiño Castro
2017-02-01
Full Text Available Social innovation and entrepreneurship have become managerial alternatives, even if they are used for profit or non-profit purposes. This article aims at identifying the competencies of the social innovator and entrepreneur focusing on the basic concept of those who consider that they belong to those categories. The information used in this project was collected by the ELI Prize participants organized and held at Universidad EAN in 2013 and 2014.
Pemetrexed disodium (Eli Lilly).
Norman, P
2001-11-01
Pemetrexed, a thymidylate synthase (TS) and transferase inhibitor, is in phase III trials with Eli Lilly as a potential treatment for several common solid tumors, including non-small cell lung cancer (NSCLC) and mesothelioma [321789], [410731]. Studies on pemetrexed have concluded that not only is the compound a TS inhibitor but also a potent inhibitor of human dihydrofolate reductase (DHFR). The results suggest that pemetrexed acts upon multiple intracellular targets and that the antitumor effect may be derived from its simultaneous inhibition of multiple folate-requiring enzymes [203662]: this compound has been designated as a multitargeted antifolate (MTA) [386680]. The drug also causes concentration- and time-dependent apoptosis [284380]. Other studies in which the 4-oxo group of the pyrimidine ring portion of pemetrexed was replaced with a hydrogen atom, demonstrated that the resulting analogs were potent DHFR inhibitors with very little activity against the enzymes glycinamide ribonucleotide formyltransferase (GARFT) and TS [310674]. In phase II European studies in 64 patients with advanced breast cancer, encouraging responses were seen in anthracycline-failure (23%) and anthracycline-refractory (19%) patients. Responses were observed in 28% of patients who had been previously treated with a taxane [326097]. Data from a phase II trial of pemetrexed (500 mg/m2 once every 21 days as a 10 min i.v. infusion) as a salvage therapy in advanced breast cancer showed that supplementation of the treatment regime with folic acid (FA) and vitamin B12 reduced its already manageable and tolerable toxicities [408821], [409650]. At doses of 500 mg/m2, the drug was also safely administered to 35 patients with impaired renal function [409953]. Phase I and II trials have shown that the main side effects include neutropenia, thrombocytopenia, mucositis, nausea and vomiting [203666], [272241]. Princeton University holds the patent rights to this drug under EP-00432677. In June
The development of molecularly targeted anticancer therapies: an Eli Lilly and Company perspective.
Perry, William L; Weitzman, Aaron
2005-03-01
The ability to identify activated pathways that drive the growth and progression of cancer and to develop specific and potent inhibitors of key proteins in these pathways promises to dramatically change the treatment of cancer: A patient's cancer could be characterized at the molecular level and the information used to select the best treatment options. The development of successful therapies not only requires extensive target validation, but also new approaches to evaluating drug efficacy in animal models and in the clinic compared to the development of traditional cytotoxic agents. This article highlights Eli Lilly and Company's approach to developing targeted therapies, from target identification and validation through evaluation in the clinic. A selection of drugs in the Lilly Oncology pipeline is also discussed.
Strategická hra v multi-agentním prostředí Jason
Vais, Roman
2015-01-01
Práce se zabývá umělou inteligencí využívanou v~oblasti počítačových her, zejména pak tzv. strategií v~reálném čase, a implementuje rozšíření pro jednu z~těchto her. Analyzuje možnosti využití přístupu multi-agentních systémů právě pro účely umělé inteligence v~počítačových hrách. Zabývá se konceptem swarm inteligece (inteligence roje), jako vhodné, ale nevyužívané, varianty umělé inteligence nejen pro strategické hry. Mimo jiné se tato práce pokouší o~volbu vhodné reprezentace vjemů jednotli...
Directory of Open Access Journals (Sweden)
Xu Y.
2018-01-01
Full Text Available The astrophysical p-process is an important way of nucleosynthesis to produce the stable and proton-rich nuclei beyond Fe which can not be reached by the s- and r-processes. In the present study, the impact of nuclear ingredients, especially the nuclear potential, level density and strength function, to the astrophysical re-action rates of (p,γ, (α,γ, (γ,p, and (γ,α reactions are systematically studied. The calculations are performed basad on the modern reaction code TALYS for about 3000 stable and proton-rich nuclei with 12≤Z≤110. In particular, both of the Wood-Saxon potential and the microscopic folding potential are taken into account. It is found that both the capture and photonuclear reaction rates are very sensitive to the nuclear potential, thus the better determination of nuclear potential would be important to reduce the uncertainties of reaction rates. Meanwhile, the Extreme Light Infrastructure-Nuclear Physics (ELI-NP facility is being developed, which will provide the great opportunity to experimentally study the photonuclear reactions in p-process. Simulations of the experimental setup for the measurements of the photonuclear reactions 96Ru(γ,p and 96Ru(γ,α are performed. It is shown that the experiments of photonuclear reactions in p-process based on ELI-NP are quite promising.
Arabsahebi, Reza; Voosoghi, Behzad; Tourian, Mohammad J.
2018-05-01
Tropospheric correction is one of the most important corrections in satellite altimetry measurements. Tropospheric wet and dry path delays have strong dependence on temperature, pressure and humidity. Tropospheric layer has particularly high variability over coastal regions due to humidity, wind and temperature gradients. Depending on the extent of water body and wind conditions over an inland water, Wet Tropospheric Correction (WTC) is within the ranges from a few centimeters to tens of centimeters. Therefore, an extra care is needed to estimate tropospheric corrections on the altimetric measurements over inland waters. This study assesses the role of tropospheric correction on the altimetric measurements over the Urmia Lake in Iran. For this purpose, four types of tropospheric corrections have been used: (i) microwave radiometer (MWR) observations, (ii) tropospheric corrections computed from meteorological models, (iii) GPS observations and (iv) synoptic station data. They have been applied to Jason-2 track no. 133 and SARAL/AltiKa track no. 741 and 356 corresponding to 117-153 and the 23-34 cycles, respectively. In addition, the corresponding measurements of PISTACH and PEACHI, include new retracking method and an innovative wet tropospheric correction, have also been used. Our results show that GPS observation leads to the most accurate tropospheric correction. The results obtained from the PISTACH and PEACHI projects confirm those obtained with the standard SGDR, i.e., the role of GPS in improving the tropospheric corrections. It is inferred that the MWR data from Jason-2 mission is appropriate for the tropospheric corrections, however the SARAL/AltiKa one is not proper because Jason-2 possesses an enhanced WTC near the coast. Furthermore, virtual stations are defined for assessment of the results in terms of time series of Water Level Height (WLH). The results show that GPS tropospheric corrections lead to the most accurate WLH estimation for the selected
Oittinen, Hannu, 1959-
2013-01-01
Arvustus: Tapio, J. Suljetut vaunut, eli, Kadonnutta aikaa etsimässä. Porvoo : J. Kostiainen, 2012 ; Kostiainen, Jukka. Kinnises tõllas, ehk, Kadunud aega otsimas / tõlkinud Ants Paikre. Tartu : Atlex, 2013 ; Vaaskivi, Tatu. Maarjamaa / tõlkinud Ants Paikre. Tallinn : Kultuurileht, 2013. (Loomingu raamatukogu)
The visual impact of Taff Ely wind farm - a case study using GIS
International Nuclear Information System (INIS)
Kidner, D.B.
1997-01-01
This paper describes a project being undertaken to validate the performance of a Geographical Information System (GIS) being developed to predict, quantify and qualify the visual impact of proposed wind farm developments. In order to determine the optimal choice of terrain data model, elevation and topographic data sets, and visibility algorithms, a validation study for the Taff Ely Wind Farm has been commissioned. The issues involved in calculating and presenting visual impact are discussed, whilst a methodology for verifying the results is also described. Existing methods for presenting for visual impact of wind farms are limited and susceptible to error, whilst the interpretation of the results can often do more harm than good. The use of GIS to visualise the probable impacts is illustrated to add meaning to the results of a wind farm visibility study. (author)
Development of a Graphical Tool to integrate the Prometheus AEOlus methodology and Jason Platform
Directory of Open Access Journals (Sweden)
Rafhael CUNHA
2017-07-01
Full Text Available Software Engineering (SE is an area that intends to build high-quality software in a systematic way. However, traditional software engineering techniques and methods do not support the demand for developing Multiagent Systems (MAS. Therefore a new subarea has been studied, called Agent Oriented Software Engineering (AOSE. The AOSE area proposes solutions to issues related to the development of agent oriented systems. There is still no standardization in this subarea, resulting in several methodologies. Another issue of this subarea is that there are very few tools that are able to automatically generate code. In this work we propose a tool to support the Prometheus AEOlus Methodology because it provides modelling artifacts to all MAS dimensions: agents, environment, interaction, and organization. The tool supports all Prometheus AEOlus artifacts and can automatically generated code to the agent and interaction dimensions in the AgentSpeak Language, which is the language used in the Jason Platform. We have done some validations with the proposed tool and a case study is presented.
ELiXIR—Solid-State Luminaire With Enhanced Light Extraction by Internal Reflection
Allen, Steven C.; Steckl, Andrew J.
2007-06-01
A phosphor-converted light-emitting diode (pcLED) luminaire featuring enhanced light extraction by internal reflection (ELiXIR) with efficacy of 60 lm/W producing 18 lumens of yellowish green light at 100 mA is presented. The luminaire consists of a commercial blue high power LED, a polymer hemispherical shell lens with interior phosphor coating, and planar aluminized reflector. High extraction efficiency of the phosphor-converted light is achieved by separating the phosphor from the LED and using internal reflection to steer the light away from lossy reflectors and the LED package and out of the device. At 10 and 500 mA, the luminaire produces 2.1 and 66 lumens with efficacies of 80 and 37 lm/W, respectively. Technological improvements over existing commercial LEDs, such as more efficient pcLED packages or, alternatively, higher efficiency green or yellow for color mixing, will be essential to achieving 150 200 lm/W solid-state lighting. Advances in both areas are demonstrated.
Tertiary particle physics with ELI: from challenge to chance (Conference Presentation)
Drska, Ladislav
2017-05-01
. Concrete application study: muon tomography. (22) Antilepton gravity studies [14]: Possibility of antimattter gravity research using positronium and muonium [15] [16]. Lepton / antilepton gravity studiesactive with relativistic particle beams [17]. First-phase practical application : positron production for filling (commertial) particle traps, development base for multiple microtrap systems. (23) Hidden world searching [18] : Potential laser-based production / detection of selected dark mattter particles - axions, hidden photons [19] [20]. Search for hidden particles in nuclear decay processes [21]. Potential application output: intense positronium source. Conclusion: The extensive feasibility study confirms the potential of ELI to contribute to the solution of Grand Challenge Problems of physics. Laser-produced tertiary particles will play important role in this effort. : References [1] L.Drska et al.: Physics of Extreme Systems. Course ATHENS CTU18, Prague 12 - 19 Nov., 2016. http://vega.fjfi.cvut.cz/docs/athens2016/ [2] L.Drska : Lepton Diagnostics and Antimatter Physics. In: SPIE Optics+Optoelectronics, Prague, April 13 - 16, 2015 . [3] H. Chen et al.: Scaling the Yield of Laser-Driven Electron-Positron Jets to Laboratory Astrophysics Applications. Rep. LLNL-JRNL-665381, Dec. 11, 2014. [4] E Liang et al.: High e+ / e- Ratio Dense Pair Creation with 1022 W.cm-2 Laser Irradiating Solid Targets. Scientific Reports, Sept. 14, 2015. www.nature.com/scientificreports [5] G. Sarri et al.: Spectral and Spatial Characterization of Laser-driven Positron Beams. Plasma Phys. Control. Fusion 59 (2017) 014015. [6] B. Schoch: A Method to Produce Intense Positron Beams via Electro Pair Production on Electrons. arXiv:1607.03847v1 [physics.acc-ph] [7] I. Pomerantz: Laser Generation of Neutrons: Science and Applications. In: ELI-NP Summer School, Magurele, Sept. 21 - 25, 2015. http://www.eli-np.ro/2015-summer-school/presentations/23.09/Pomerantz_Eli-NP-Summer-school-2015.pdf [8] V
Straight talk with... Ricardo Dolmetsch. Interview by Elie Dolgin.
Dolmetsch, Ricardo
2013-11-01
Neuroscience, in recent years, has started to look like a graveyard for drug development, with many large pharmaceutical companies either eliminating their brain disorder programs or cutting back heavily on such research. Novartis seemed to have made exactly this kind of drastic change two years ago when the company announced plans to shutter its neuroscience operations at its global headquarters in Basel, Switzerland. But the company made it known then that its intention was to ultimately set up a new neuroscience division at the company's US base in Cambridge, Massachusetts. The US site was initially picked to take advantage of the local academic strength in the field of psychiatric genetics. Now, it seems that Novartis is also looking to add stem cell technologies to the mix with the appointment in August of Ricardo Dolmetsch as the company's global head of neurosciences-the first new hire for the company's reincarnated division. As a professor at California's Stanford University School of Medicine for the past ten years, Dolmetsch made his name using induced pluripotent stem (iPS) cells to study a rare form of autism known as Timothy syndrome. Elie Dolgin met with Dolmetsch at the Novartis Institutes for BioMedical Research in the Technology Square area of Cambridge to discuss how he plans to succeed where so many others have failed.
La voz en la tribuna (El verbo apasionado de Jorge Eliécer Gaitán
Directory of Open Access Journals (Sweden)
Carlos José Reyes
2009-05-01
Full Text Available El uso de la voz humana comoun medio de comunicación einducción frente a la comunidad,se ha desarrollado desde las primerascivilizaciones. Sócrates creóen Grecia la primera escuela deoratoria. En Colombia, uno de lospolíticos y oradores públicos quemás utilizó la oratoria, con su vozvibrante y emotiva, fue el caudilloliberal Jorge Eliécer Gaitán, quienencontró las palabras, los acentos,giros y expresiones adecuadaspara comunicarse con ampliossectores populares. La fuerza desu movimiento lo hubiera llevadoa la presidencia, de no ser por suasesinato, el 9 de abril de 1948.Palabras clave: oratoria, pueblo, a lacarga, mamola, reconquista.
MAAGs (Medical Audit Advisory Groups): the Eli Lilly National Clinical Audit Centre.
Baker, R; Fraser, R
1993-01-01
Outlines the framework for promoting audit in general practice, created as one part of the health service reforms. Medical Audit Advisory Groups (MAAGs) were set up in each district with the aim of participation in audit of all general practitioners by April 1992. The activities undertaken have included those recommended by the Department of Health; the most significant of these being the appointment of lay facilitators who are able to assist general practitioners and primary care teams co-operate over efforts to improve the quality of care, and may offer one means of introducing some of the methods of total quality management into general practice. Discusses the problems which remain: audit is not yet sufficiently systematic, interface audit with secondary care is at a very early stage, the ways to involve managers and patients in audit remain to be clarified, and there is little evidence of the consequences of audit in terms of improved care. The Eli Lilly National Clinical Audit Centre has been set up within the Department of General Practice, University of Leicester, in order to address these issues.
Ďurák, Michal; Velpula, Praveen Kumar; Kramer, Daniel; Cupal, Josef; Medřík, Tomáš; Hřebíček, Jan; Golasowski, Jiří; Peceli, Davorin; Kozlová, Michaela; Rus, Bedřich
2017-01-01
Increasing the laser-induced damage resistance of optical components is one of the major challenges in the development of Peta-watt (PW) class laser systems. The extreme light infrastructure (ELI) beamlines project will provide ultrafast laser systems with peak powers up to 10 PW available every minute and PW class beams at 10 Hz complemented by a 5-TW, 1-kHz beamline. Sustainable performance of PW class laser systems relies on the durability of the employed optical components. As part of an effort to evaluate the damage resistance of components utilized in ELI beamlines systems, damage thresholds of several optical multilayer dielectric coatings were measured with different laser parameters and in different environments. Three coatings were tested with 10 Hz and 1 kHz pulse repetition rates, and the effect of a cleaning treatment on their damage resistance was examined. To explore the damage threshold behavior at different vacuum levels, one coating was subject to tests at various residual gas pressures. No change of damage threshold in a high vacuum with respect to ambient pressure was recorded. The effect of the cleaning treatment was found to be inconsistent, suggesting that development of the optimal cleaning treatment for a given coating requires consideration of its specific properties.
Czech Academy of Sciences Publication Activity Database
Amato, E.; Italiano, A.; Margarone, Daniele; Pagano, B.; Baldari, S.; Korn, Georg
2016-01-01
Roč. 811, Mar (2016), s. 1-5 ISSN 0168-9002 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : plasma laser * proton acceleration * positron emission tomography * microfluidics Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 1.362, year: 2016
User oriented end-station on VUV pump-probe magneto-optical ellipsometry at ELI beamlines
Espinoza, Shirly; Neuber, Gerd; Brooks, Christopher D.; Besner, Bastian; Hashemi, Maryam; Rübhausen, Michael; Andreasson, Jakob
2017-11-01
A state of the art ellipsometer for user operations is being implemented at ELI Beamlines in Prague, Czech Republic. It combines three of the most promising and exotic forms of ellipsometry: VUV, pump-probe and magneto-optical ellipsometry. This new ellipsometer covers a spectral operational range from the NIR up to the VUV, with high through-put between 1 and 40 eV. The ellipsometer also allows measurements of magneto-optical spectra with a 1 kHz switchable magnetic field of up to 1.5 T across the sample combining ellipsometry and Kerr spectroscopy measurements in an unprecedented spectral range. This form of generalized ellipsometry enables users to address diagonal and off-diagonal components of the dielectric tensor within one measurement. Pump-probe measurements enable users to study the dynamic behaviour of the dielectric tensor in order to resolve the time-domain phenomena in the femto to 100 ns range.
Stambler, I S
2015-01-01
The years 2015-2016 mark a double anniversary--the 170th anniversary of birth and the 100th anni- versary of death--of one of the greatest Russian scientists, a person that may be considered a founding figure of modern immunology, aging and longevity science--Elie Metchnikoff (May 15, 1845-July 15, 1916). At this time of the rapid aging of the world population and the rapid development of technologies that may ameliorate degenerative aging processes, Metchnikoff's pioneering contribution to the search for anti-aging and healthspan-extending means needs to be recalled and honored.
The Electronic Logbook for the Information Storage of ATLAS Experiment at LHC (ELisA)
Corso-Radu, A; The ATLAS collaboration; Magnoni, L
2012-01-01
A large experiment like ATLAS at LHC (CERN), with over three thousand members and a shift crew of 15 people running the experiment 24/7, needs an easy and reliable tool to gather all the information concerning the experiment development, installation, deployment and exploitation over its lifetime. With the increasing number of users and the accumulation of stored information since the experiment start-up, the electronic logbook actually in use, ATLOG, started to show its limitations in terms of speed and usability. Its monolithic architecture makes the maintenance and implementation of new functionality a hard-to-almost-impossible process. A new tool ELisA has been developed to replace the existing ATLOG. It is based on modern web technologies: the Spring framework using a Model-View-Controller architecture was chosen, thus helping building flexible and easy to maintain applications. The new tool implements all features of the old electronic logbook with increased performance and better graphics: it uses the ...
Validatin of miniaturised tensile testing on DMLS TI6AL4V (ELI specimens
Directory of Open Access Journals (Sweden)
Van Zyl, Ian
2016-11-01
Full Text Available Direct metal laser sintering (DMLS is a relatively new technology that is developing rapidly. Since DMLS material is created by melting/solidifying tracks and layers from powder, even building geometry can influence the mechanical properties. To certify a material, the testing specimens must be designed and manufactured according to the appropriate standards. Miniaturised tensile DMLS samples could be a good alternative for express quality control, and could reduce the cost of DMLS-specific testing. In this study, as-built and stress-relieved miniaturised tensile DMLS Ti6Al4V (ELI specimens with different surface qualities were investigated. The fracture surfaces and mechanical properties of the mini-tensile specimens were analysed and compared with standard full-sized specimens also manufactured by DMLS. The obtained data showed the applicability of mini-tensile tests for the express analysis of DMLS objects if a correction factor is applied for the calculation of the load-bearing cross-section of the specimen.
Cyclic deformation and fatigue data for Ti–6Al–4V ELI under variable amplitude loading
Directory of Open Access Journals (Sweden)
Patricio E. Carrion
2017-08-01
Full Text Available This article presents the strain-based experimental data for Ti–6Al–4V ELI under non-constant amplitude cyclic loading. Uniaxial strain-controlled fatigue experiments were conducted under three different loading conditions, including two-level block loading (i.e. high-low and low-high, periodic overload, and variable amplitude loading. Tests were performed under fully-reversed, and mean strain/stress conditions. For each test conducted, two sets of data were collected; the cyclic stress–strain response (i.e. hysteresis loops in log10 increments, and the peak and valley values of stress and strain for each cycle. Residual fatigue lives are reported for tests with two-level block loading, while for periodic overload and variable amplitude experiments, fatigue lives are reported in terms of number of blocks to failure.
Nababan, Bisman; Hakim, Muhammad R.; Panjaitan, James P.
2018-05-01
Indonesian waters containing many small islands and shallow waters leads to a less accurate of sea surface height (SSH) estimation from satellite altimetry. Little efforts are also given for the validation of SSH estimation from the satellite in Indonesian waters. The purpose of this research was to identify and retrack waveforms of Jason-2 altimeter satellite data in southern Java island waters and Java Sea using several retrackers and performed improvement percentage analyses for new SSH estimation. The study used data of the Sensor Geophysical Data Record type D (SGDR-D) of Jason-2 satellite altimeter of the year 2010 in the southern Java island waters and 2012-2014 in Java Sea. Waveform retracking analyses were conducted using several retrackers (Offset Center of Gravity, Ice, Threshold, and Improved Threshold) and examined using a world reference undulation geoid of EGM08 and Oceanic retracker. Result showed that shape and pattern of waveforms were varied in all passes, seasons, and locations specifically along the coastal regions. In general, non-Brownish and complex waveforms were identified along coastal region specifically within the distance of 0-10 km from the shoreline. In contrary, generally Brownish waveforms were found in offshore. However, Brownish waveform can also be found within coastal region and non-Brownish waveforms within offshore region. The results were also showed that the four retrackers produced a better SSH estimation in coastal region. However, there was no dominant retracker to improve the accuracy of the SSH estimate.
Tensile properties and microstructure of direct metal laser-sintered TI6AL4V (ELI alloy
Directory of Open Access Journals (Sweden)
Moletsane, M. G.
2016-11-01
Full Text Available Direct metal laser sintering (DMLS is an additive manufacturing technology used to melt metal powder by high laser power to produce customised parts, light-weight structures, or other complex objects. During DMLS, powder is melted and solidified track-by-track and layer-by-layer; thus, building direction can influence the mechanical properties of DMLS parts. The mechanical properties and microstructure of material produced by DMLS can depend on the powder properties, process parameters, scanning strategy, and building geometry. In this study, the microstructure, tensile properties, and porosity of DMLS Ti6Al4V (ELI horizontal samples were analysed. Defect analysis by CT scans in pre-strained samples was used to detect the crack formation mechanism during tensile testing of as-built and heat-treated samples. The mechanical properties of the samples before and after stress relieving are discussed.
HOS cell adhesion on Ti6Al4V ELI texturized by CO2 laser
Sandoval-Amador, A.; Bayona–Alvarez, Y. M.; Carreño Garcia, H.; Escobar-Rivero, P.; Y Peña-Ballesteros, D.
2017-12-01
In this work, the response of HOS cells on Ti6Al4V ELI textured surfaces by a CO2 laser was evaluated. The test surfaces were; smooth Ti6Al4V, used as the control, and four textured surfaces with linear geometry. These four surfaces had different separation distances between textured lines, D1 (1000 microns), D2 (750 microns), D3 (500 microns) and D4 (250 microns). Toxicity of textured surfaces was assessed by MTT and the cellular adhesion test was performed using HOS ATCC CRL 1543 line cells. This test was done after 5 days of culture in a RPMI 1640 medium supplemented with 10% fetal bovine serum and 1% antibiotics. The results showed that the linear textures present 23% toxicity after 30 days of incubation, nevertheless, the adhesion tests results are inconclusive in such conditions and therefore the effect of the line separation on the cell adhesion cannot be determined.
Gonçalves, Rodrigo; Santana, Grazielle; Catarino, João; Matos, Eduardo
2017-01-01
O estudo visa investigar se empresas certificadas como socialmente responsáveis possuem práticas de elisão fiscais diferenciadas quando comparadas às empresas não certificadas. A amostra tem como base 158 observações de empresas brasileiras entre 2010 e 2014, composta por empresas certificadas pelo índice de sustentabilidade empresarial da BM and FBovespa e grupo de controle de empresas não certificadas. No caso de Portugal, obteve-se um total de 17 observações (2010-2014) de empresas certifi...
International Nuclear Information System (INIS)
Soucek, D.J.; Currie, R.J.; Cherry, D.S.; Latimer, H.A.
1998-01-01
The Ely Creek watershed in Lee County, Virginia, contains an abundance of abandoned mined land (AML) seeps that contaminate the majority of the creek and its confluence into Big Stone Creek. Contaminated sediments had high concentrations of iron (∼10,000 mg/kg), aluminum (∼1,500 mg/kg), magnesium (∼400 mg/kg) and manganese (∼150 mg/kg). Copper and zinc generally ranged from 3 to 20 mg/kg. Benthic macroinvertebrates surveys at six of 20 sites sampled in the watershed yielded no macroinvertebrates, while eight others had total abundances of 1 to 9 organisms. Four reference sites contained ≥100 organisms and at least 14 different taxa. Laboratory, 10-day survival/impairment sediments tests with Daphnia magna did not support the field data. Mortality of 92 to 100% for D. magna occurred in samples collected from six cities. Daphnid reproduction was more sensitive than laboratory test organism survivorship; however, neither daphnid survivorship nor reproduction were good predictors of taxa richness. Laboratory test concerns included the use of a reference diluent water rather than site specific diluent water
Eli Lilly and Company's bioethics framework for human biomedical research.
Van Campen, Luann E; Therasse, Donald G; Klopfenstein, Mitchell; Levine, Robert J
2015-11-01
Current ethics and good clinical practice guidelines address various aspects of pharmaceutical research and development, but do not comprehensively address the bioethical responsibilities of sponsors. To fill this void, in 2010 Eli Lilly and Company developed and implemented a Bioethics Framework for Human Biomedical Research to guide ethical decisions. (See our companion article that describes how the framework was developed and implemented and provides a critique of its usefulness and limitations.) This paper presents the actual framework that serves as a company resource for employee education and bioethics deliberations. The framework consists of four basic ethical principles and 13 essential elements for ethical human biomedical research and resides within the context of our company's mission, vision and values. For each component of the framework, we provide a high-level overview followed by a detailed description with cross-references to relevant well regarded guidance documents. The principles and guidance described should be familiar to those acquainted with research ethics. Therefore the novelty of the framework lies not in the foundational concepts presented as much as the attempt to specify and compile a sponsor's bioethical responsibilities to multiple stakeholders into one resource. When such a framework is employed, it can serve as a bioethical foundation to inform decisions and actions throughout clinical planning, trial design, study implementation and closeout, as well as to inform company positions on bioethical issues. The framework is, therefore, a useful tool for translating ethical aspirations into action - to help ensure pharmaceutical human biomedical research is conducted in a manner that aligns with consensus ethics principles, as well as a sponsor's core values.
Czech Academy of Sciences Publication Activity Database
Weber, Stefan A.; Bechet, Sabrina; Borneis, S.; Brabec, Lukáš; Bučka, Martin; Chacon-Golcher, Edwin; Ciappina, Marcelo F.; De Marco, Massimo; Fajstavr, Antonín; Falk, Kateřina; Garcia, E.-R.; Grosz, Jakub; Gu, Yanjun; Hernandez Martin, Juan C.; Holec, M.; Janečka, Pavel; Jantač, Martin; Jirka, Martin; Kadlecová, Hedvika; Khikhlukha, Danila; Klimo, Ondřej; Korn, Georg; Kramer, Daniel; Batheja, Deepak Kumar; Laštovička, Tomáš; Lutoslawski, P.; Morejon, L.; Olšovcová, Veronika; Rajdl, Marek; Renner, Oldřich; Rus, Bedřich; Singh, Sushil K.; Šmíd, Michal; Sokol, Martin; Versaci, Roberto; Vrána, Roman; Vranic, M.; Vyskočil, Jiří; Wolf, Adam; Yu, Q.
2017-01-01
Roč. 2, č. 4 (2017), s. 149-176 E-ISSN 2468-080X R&D Projects: GA MŠk LQ1606; GA MŠk LM2015065; GA MŠk EF15_008/0000162; GA MŠk EF15_003/0000449 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162; OP VVV - HiFi(XE) CZ.02.1.01/0.0/0.0/15_003/0000449 Institutional support: RVO:68378271 Keywords : high-energy-density- physics * ultra-high-intensity * warm dense matter * laboratory astrophysics * high repetition rate lasers * plasma optics * inertial confinement fusion Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics )
Bor, M V; Jacobsen, I-L Søtang; Gram, J B; Sidelmann, J J
2018-01-01
Background Phadia/EliA fluorescence enzyme immunoassays are widely used automated assays for anticardiolipin (aCL) and anti-β2-glycoprotein I (aβ2GPI) antibodies. To date, cut-off values for these assays have not been evaluated systematically and the evidence behind manufacturer's recommended cut-off values is not clear. Objective To determine Phadia/EliA cut-off values for antiphospholipid antibodies (aPL) according to the procedures suggested by guidelines. Methods A total of 266 blood donors (135 females and 131 males) were included. The pre-handling and analysis of the samples were performed according to the International Society on Thrombosis and Hemostasis (ISTH) guideline for solid phase aPL assays. Cut-off values and corresponding 90% confidence intervals (CI) for each antibody were established and outliers were handled according to the Clinical and Laboratory Standards Institute (CLSI) guideline for reference intervals. Samples from 377 consecutive patients, referred to our thrombophilia center with evidence of thrombosis or pregnancy morbidity were included for aPL testing. Results The in-house 99th (97.5th) percentile cut-off values were 11 (8.7), 12 (6.9) 8.5 (5.0) AU/mL for aβ2GPI IgG, IgM and IgA, and 21 (13) GPL-U/mL and 41 (25) MPL-U/mL for aCL IgG and IgM, respectively. The prevalence of positive results (%) defined by these cut-off values in patients with evidence of thrombosis or pregnancy morbidity was 9.5 (12.2), 1.6 (2.9), and 7.0 (9.9), and 0.8 (3.8) for aβ2GPI IgG, IgM, and aCL IgG and IgM respectively. The use of in-house 99th percentile cut-off values compared to the manufacturer suggested cut-off values resulted in 1 and 39 fewer samples for aβ2GPI and aCL to be classified as positive for aPL, respectively. Conclusions We present Phadia/EliA cut-off values with 90% CI for aPL determined systematically according to the ISTH and CLSI guidelines. These values are different from values previously determined, suggesting variation of a
International Nuclear Information System (INIS)
Beeley, P.A.; Lockwood, R.J.S.; Hoult, D.; Major, R.
2001-01-01
In 1996 the UK Government announced that the Royal Naval College, Greenwich would pass to non-defence use by the millennium. As a consequence of this decision, the decommissioning of the JASON 10 kW Argonaut research reactor and the relocation of the Department of Nuclear Science and Technology (DNST) were approved by the Ministry of Defence. The decommissioning of the reactor commenced in November 1997 while DNST remained operational until October 1998. The DNST was responsible for education and training in support of the UK Naval Nuclear Propulsion Programme and operated academic laboratories for atomic and nuclear physics, health physics, instrument calibration and radiochemistry. Therefore, besides the nuclear reactor, open and sealed sources (alpha, beta and gamma), intense x-ray (sealed tube) and gamma-ray ( 60 CO and 137 Cs) sources and small 241 Am/Be neutron sources had been used in the Department for over 35 years. Decommissioning of all facilities was therefore a relatively complex task and the management of waste streams was challenging. All facilities were successfully decommissioned for unrestricted site release by December 1999 and this paper will describe the methodology used for preparation, storage, characterisation and disposal of all waste streams. The most significant waste management task during this decommissioning programme was that associated with the JASON reactor. It should be noted that the JASON reactor fuel was not designated as nuclear waste, the fuel removal and storage were covered under separate contracts and therefore no high level waste was generated. With respect to other waste streams, a combination of Monte Carlo modelling and selective sampling and analysis of the reactor materials was used to estimate the quantities of waste as follows: LLW - 76 tonnes packed in 4 half height ISO containers; LLW - 6 Tonnes packed in 200litre drums in 1 full height ISO container; ILW - 60 kg packed in approved shielded containers; FRW -121
Herzberg, D L
2001-01-01
This paper examines the social thought of University of Wisconsin professors Richard T. Ely, John R. Commons, and Edward A. Ross during World War I. Like many of their fellow scholars, these three were actively involved in the pro-war effort. Although their support for the war was strongly conditioned by personal and occupational considerations, the impact of their wartime service was not restricted to those realms. Their social thought, which they impressed into service explaining and justifying the war, was itself altered in subtle and sometimes surprising ways by the forceful positions they took on the political, economic, and racial significance of the conflict. Copyright 2001 John Wiley & Sons, Inc.
Elie Luzac and L’homme plus que machine (1748: The Dialogic Voice of an Enlightenment Printer
Directory of Open Access Journals (Sweden)
Lieve Jooken
2018-01-01
Full Text Available Early into his career as one of the most successful printerpublishers of the Dutch Republic, Elie Luzac (1721-1796 played a pivotal role in disseminating the materialist ideas of La Mettrie’s Homme machine (1747. This paper focuses on the dialogic voice (Bakhtine in a publication by Luzac himself, which oscillates between asserting and refuting La Mettrie’s views. Descended from Huguenot refugees, Luzac condemns what he publishes and publishes what he condemns. This discursive ambiguity emerges in Luzac’s L’homme plus que machine (1748, a work which cites La Mettrie’s theses in order to contest them. Building on the succès de scandale of the English version of L’homme machine (Man a Machine, 1749, the English translation of L’homme plus que machine, Man more than a Machine, appeared in 1752. The present contribution examines how the translator’s Voice, which is defined as an enarrative voice, effaces the concealed claims of the original text and replaces them with a discourse whose explicit anti-materialist tenor contrasts with the vehement rhetoric of Man a Machine.
Bridging the Gap between ABM and MAS: A Disaster-Rescue Simulation Using Jason and NetLogo
Directory of Open Access Journals (Sweden)
Wulfrano Arturo Luna-Ramirez
2018-04-01
Full Text Available An agent is an autonomous computer system situated in an environment to fulfill a design objective. Multi-Agent Systems aim to solve problems in a flexible and robust way by assembling sets of agents interacting in cooperative or competitive ways for the sake of possibly common objectives. Multi-Agent Systems have been applied to several domains ranging from many industrial sectors, e-commerce, health and even entertainment. Agent-Based Modeling, a sort of Multi-Agent Systems, is a technique used to study complex systems in a wide range of domains. A natural or social system can be represented, modeled and explained through a simulation based on agents and interactions. Such a simulation can comprise a variety of agent architectures like reactive and cognitive agents. Despite cognitive agents being highly relevant to simulate social systems due their capability of modelling aspects of human behaviour ranging from individuals to crowds, they still have not been applied extensively. A challenging and socially relevant domain are the Disaster-Rescue simulations that can benefit from using cognitive agents to develop a realistic simulation. In this paper, a Multi-Agent System applied to the Disaster-Rescue domain involving cognitive agents based on the Belief–Desire–Intention architecture is presented. The system aims to bridge the gap in combining Agent-Based Modelling and Multi-Agent Systems approaches by integrating two major platforms in the field of Agent-Based Modeling and Belief-Desire Intention multi-agent systems, namely, NetLogo and Jason.
Zhao, Zhuang; Chen, Jing; Tan, Hua; Lin, Xin; Huang, Weidong
2017-07-01
In this paper, laser additive manufacturing (LAM) technology with powder feeding has been employed to fabricate 50%LAMed specimens (i.e. the volume fraction of the laser deposited zone was set to 50%). With aid of the 3D-DIC technique, the tensile deformation behavior of 50%LAMed Ti64ELI titanium alloy was investigated. The 50%LAMed specimen exhibits a significant characteristic of strength mismatch due to the heterogeneous microstructure. The tensile fracture of 50%LAMed specimen occurs in WSZ (wrought substrate zone), but the tensile strength is slightly higher and the plastic elongation is significantly lower than that of the wrought specimen. The 3D-DIC results shows that the 50%LAMed specimen exhibits a characteristic of dramatic plastic strain heterogeneity and the maximal strain is invariably concentrated in WSZ. The ABAQUS simulation indicates that, the LDZ (laser deposited zone) can constrain the plastic deformation of the WSZ and biaxial stresses develop at the interface after yielding.
Cullen, R.; Wingham, D.; Francis, R.; Parrinello, T.
2011-12-01
With CryoSat-2 soon to enter its second year of post commissioning operations there is now sufficient experience and evidence showing improvements of the SIRAL's (Synthetic interferometric radar altimeter) SAR and SARIn modes over conventional pulse-width limited altimeters for both the targeted marine/land ice fields but also for non mission relevant surfaces such as the ocean, for example. In the process of understanding the CryoSat data some side effects of the end-to-end platform measurement and ground retrieval system have been identified and whilst those key to mission success are understood and are being handled others, remain open and pave the way to longer term fine-tuning. Of interest to the session will be a summary of the manditory changes made during 2011 to all the modes of CryoSat-2 science processing with a view to longer term algorithm improvements that could benefit the planned mid-to-late nominal operations re-processing. Since some of the science processor improvements have direct implication to the SAR mode processing of Sentinel-3 and Jason-CS science then these will also be highlighted. Finally a summary of the CryoSat-2 in-orbit platform and payload performances and their stability will also be provided. Expectations of the longer term uses of CryoSat's primary sensor (SIRAL) and its successors will be discussed.
High and low energy gamma beam dump designs for the gamma beam delivery system at ELI-NP
International Nuclear Information System (INIS)
Yasin, Zafar; Matei, Catalin; Ur, Calin A.; Mitu, Iani-Octavian; Udup, Emil; Petcu, Cristian
2016-01-01
The Extreme Light Infrastructure - Nuclear Physics (ELI-NP) is under construction in Magurele, Bucharest, Romania. The facility will use two 10 PW lasers and a high intensity, narrow bandwidth gamma beam for stand-alone and combined laser-gamma experiments. The accurate estimation of particle doses and their restriction within the limits for both personel and general public is very important in the design phase of any nuclear facility. In the present work, Monte Carlo simulations are performed using FLUKA and MCNPX to design 19.4 and 4 MeV gamma beam dumps along with shielding of experimental areas. Dose rate contour plots from both FLUKA and MCNPX along with numerical values of doses in experimental area E8 of the facility are performed. The calculated doses are within the permissible limits. Furthermore, a reasonable agreement between both codes enhances our confidence in using one or both of them for future calculations in beam dump designs, radiation shielding, radioactive inventory, and other calculations releated to radiation protection. Residual dose rates and residual activity calculations are also performed for high-energy beam dump and their effect is negligible in comparison to contributions from prompt radiation.
High and low energy gamma beam dump designs for the gamma beam delivery system at ELI-NP
Energy Technology Data Exchange (ETDEWEB)
Yasin, Zafar, E-mail: zafar.yasin@eli-np.ro; Matei, Catalin; Ur, Calin A.; Mitu, Iani-Octavian; Udup, Emil; Petcu, Cristian [Extreme Light Infrastructure - Nuclear Physics / Horia Hulubei National Institute for R& D in Physics and Nuclear Engineering, Bucharest-Magurele (Romania)
2016-03-25
The Extreme Light Infrastructure - Nuclear Physics (ELI-NP) is under construction in Magurele, Bucharest, Romania. The facility will use two 10 PW lasers and a high intensity, narrow bandwidth gamma beam for stand-alone and combined laser-gamma experiments. The accurate estimation of particle doses and their restriction within the limits for both personel and general public is very important in the design phase of any nuclear facility. In the present work, Monte Carlo simulations are performed using FLUKA and MCNPX to design 19.4 and 4 MeV gamma beam dumps along with shielding of experimental areas. Dose rate contour plots from both FLUKA and MCNPX along with numerical values of doses in experimental area E8 of the facility are performed. The calculated doses are within the permissible limits. Furthermore, a reasonable agreement between both codes enhances our confidence in using one or both of them for future calculations in beam dump designs, radiation shielding, radioactive inventory, and other calculations releated to radiation protection. Residual dose rates and residual activity calculations are also performed for high-energy beam dump and their effect is negligible in comparison to contributions from prompt radiation.
International Nuclear Information System (INIS)
Bhatia, A.K.; Temkin, A.; Silver, A.; Sullivan, E.C.
1978-01-01
The method of polarized orbitals is modified to treat low-energy scattering of electrons from highly polarizable systems, specifically alkali-metal atoms. The modification is carried out in the particular context of the e-Li system, but the procedure is general; it consists of modifying the polarized orbital, so that when used in the otherwise orthodox form of the method, it gives (i) the correct electron affinity of the negative ion (in this case Li - ), (ii) the proper (i.e., Levinson-Swan) number of nodes of the associated zero-energy scattering orbital, and (iii) the correct polarizability. A procedure is devised whereby the scattering length can be calculated from the (known) electron affinity without solving the bound-state equation. Using this procedure we adduce a 1 S scattering length of 8.69a 0 . (The 3 S scattering length is -9.22a 0 .) The above modifications can also be carried out in the (lesser) exchange adiabatic approximation. However, they lead to qualitatively incorrect 3 S phase shifts. The modified polarized-orbital phase shifts are qualitatively similar to close-coupling and elaborate variational calculations. Quantitative differences from the latter calculations, however, remain; they are manifested most noticeably in the very-low-energy total and differential spin-flip cross sections
International Nuclear Information System (INIS)
1980-01-01
An airborne combined radiometric and magnetic survey was performed for the Department of Energy (DOE) over the area covered by the Ely and Lund 1:250,000 National Topographic Map Series (NTMS quadrangle maps). The survey was part of DOE's National Uranium Resource Evaluation (NURE) Aerial Radiometric Reconnaissance program. Data were collected by a helicopter equipped with a gamma-ray spectrometer having a large crystal volume, and a high sensitivity proton precession magnetometer. The radiometric system was calibrated at the Walker Field Calibration pads and the Lake Mead Dynamic Test range. Data quality was ensured during the survey by daily test flights and equipment checks. Radiometric data were corrected for live time, aircraft and equipment background, cosmic background, atmospheric radon, Compton scatter, and altitude dependence. The corrected data were statistically evaluated, plotted, and contoured to produce anomaly maps based on the radiometric response of individual geological units. The maps were interpreted and an anomaly interpretation map produced. Volume I contains a description of the systems used in the survey, a discussion of the calibration of the systems, the data processing procedures, the data display format, the interpretation rationale, and interpretation methodology. Volume II contains the data displays for a quadrangle and the interpretation results
Formation of Ca/P ceramic coatings by Plasma Electrolytic Oxidation (PEO) on Ti6Al4V ELI alloy
Rodriguez-Jaimes, Y.; Naranjo, D. I.; Blanco, S.; García-Vergara, S. J.
2017-12-01
The formation of PEO ceramic coatings on Ti6Al4V ELI alloy was investigated using a phosphate/calcium containing electrolyte at 300 and 400V at 310K for different times. The Plasma Electrolytic Oxidation (PEO) coated specimens were then heat treated at 873 and 1073K for 2 hours. Scanning electron microscopy, Energy Dispersive X-Ray Spectroscopy (EDS) and X-ray diffraction analysis were used to study the composition and the morphology of the ceramic coatings. The corrosion behaviour of the coatings was studied by Electrochemical Impedance Spectroscopy (EIS) in Simulated Body Fluid (SBF). The PEO-treated specimens primarily revealed a porous structure with thickness between 4 and 12μm, according to the voltage and process time used. The coatings are mainly composed of hydroxyapatite; however, as the voltage and anodizing time increase, the Ca/P ratio decreases. Generally, the corrosion resistance of the alloy was improved by the PEO-treated coatings, although the specimens treated at 1073K showed the presence of cracks that reduced the protective effect of the coatings.
Italiano, Antonio; Amato, Ernesto; Minutoli, Fabio; Margarone, Daniele; Baldari, Sergio
2016-01-01
The development of innovative production pathways for high-Z positron emitters is of great interest to enlarge the applicability of PET diagnostics, especially in view of the continuous development of new radiopharmaceuticals. We evaluated the theoretical yields of 64Cu, 86Y, 89Zr, 73Se, 77Br and 124I PET isotopes, plus the 68Ge isotope, parent of the 68Ga positron emitter, in the hypothesis of production through laser-accelerated proton sources expected at the ELI-Beamlines facility. By mean...
La presencia de una ausencia: Jorge Eliécer Gaitán y las desventuras del populismo en Colombia
Directory of Open Access Journals (Sweden)
Malik Tahar Chaouch
2009-01-01
Full Text Available Este texto realiza el retrato del líder político más importante de la primera parte del siglo XX en Colombia, el liberal Jorge Eliécer Gaitán, asesinado el 9 de abril de 1948, cuando la Presidencia de la República parecía estar a su alcance. Desde entonces, su fantasma acosó a una Colombia donde la violencia estalló y se mantuvo durante toda la segunda parte del siglo XX, con breves interrupciones. En este contexto, su trayectoria y pensamiento no dejaron de ser objetos de controversias y debates apasionados. El esfuerzo de clarifi cación conduce a reconocer la filiación populista del político colombiano. Es así como, a pesar de la ausencia de una experiencia populista duradera, el populismo tuvo un impacto central en la historia contemporánea del país andino. Las consecuencias de la presencia de esa ausencia son materia a reflexión sobre el resurgir de los populismos y el estancamiento democrático en la América latina contemporánea.
Analysis of surface roughness and cutting force during turning of Ti6Al4V ELI in dry environment
Directory of Open Access Journals (Sweden)
V. G. Sargade
2016-04-01
Full Text Available This paper investigates the effect of cutting parameters on the surface roughness and cutting force of titanium alloy Ti-6Al-4V ELI when turning using PVD TiAlN coated tool in dry environment. Taguchi L9 orthogonal array design of experiment was used for the turning experiment 2 factors and 3 levels. Turning parameters studied were cutting speed (50, 65, 80 m/min, feed rate (0.08, 0.15, 0.2 mm/rev and depth of cut 0.5 mm constant. Linear and second order model of the surface roughness and cutting force has been developed in terms of cutting speed and feed. The results show that the feed rate was the most impact factor controlling the cutting force and surface roughness produced. MINITAB 17software was used to develop a linear and second order model of surface roughness and cutting force. Optimum condition was at 66.97 m/min of cutting speed, 0.08 mm/rev of feed rate. Surface roughness 0.57μm and cutting force 54.02 N were obtained at the optimum condition. A good agreement between the experimental and predicted surface roughness and cutting force were observed.
DEFF Research Database (Denmark)
Kornum, Birgitte Rahbek; Burgdorf, Kristoffer Sølvsten; Holm, Anja
2017-01-01
Narcolepsy type 1, a neurological sleep disorder strongly associated with Human Leukocyte Antigen (HLA-)DQB1*06:02, is caused by the loss of hypothalamic neurons producing the wake-promoting neuropeptide hypocretin (hcrt, also known as orexin). This loss is believed to be caused by an autoimmune...... reaction. To test whether hcrt itself could be a possible target in the autoimmune attack, CD4(+) T-cell reactivity towards six different 15-mer peptides from prepro-hypocretin with high predicted affinity to the DQA1*01:02/DQB1*06:02 MHC class II dimer was tested using EliSpot in a cohort of 22 narcolepsy...
Directory of Open Access Journals (Sweden)
Rodrigo de Souza Gonçalves
2016-07-01
Full Text Available Esta pesquisa analisa se as empresas abertas brasileiras que receberam subvenções governamentais apresentaram maior nível de elisão fiscal (tax avoidance e se geraram mais riqueza para a sociedade no ano de 2014, quando comparadas a empresas que não receberam tais subvenções. O estudo é de natureza quantitativa. Foram analisados os indicadores de elisão fiscal (Effective Tax Rate – ETR, segundo Hanlon e Heitzman (2010, de geração de riqueza (Quociente entre o Valor Adicionado bruto e o Faturamento – QVAF e de distribuição de riqueza (Índice de Distribuição do Valor Adicionado – IDVA. A amostra contempla 64 empresas listadas na BM&FBOVESPA, divididas em dois grupos de 32, comparadas em relação ao seu porte e setor de atuação. Como resultado verificou-se que as empresas recebedoras de subvenções governamentais apresentaram um maior nível de elisão em relação aos tributos sobre o lucro e agregaram menos valor aos seus bens e serviços produzidos e comercializados. Contudo, tais empresas geraram um maior valor adicionado total, apresentando uma maior distribuição relativa de riqueza para pagamento de tributos (32,44% e de pessoal (25,05%, justificando assim os incentivos fiscais no ano estudado. This research examines whether the listed Brazilian companies that received government grants got higher tax avoidance and have generated more wealth for the society in 2014, when compared to companies that did not receive such grants. The study is quantitative in nature and it considers indicators of tax avoidance (Effective Tax Rate - ETR according to Hanlon and Heitzman (2010, of wealth generation (Quotient between the Gross Value Added and billing -QVAF and of wealth distribution (Value Added Distribution Index - IDVA. The sample includes 64 companies listed on the BM & FBOVESPA, divided into two groups of 32 companies each, compared in relation to their size and activity sector. As a result, it was found out that the
Zhang, Shengjun; Li, Jiancheng; Jin, Taoyong; Che, Defu
2018-04-01
Marine gravity anomaly derived from satellite altimetry can be computed using either sea surface height or sea surface slope measurements. Here we consider the slope method and evaluate the errors in the slope of the corrections supplied with the Jason-1 geodetic mission data. The slope corrections are divided into three groups based on whether they are small, comparable, or large with respect to the 1 microradian error in the current sea surface slope models. (1) The small and thus negligible corrections include dry tropospheric correction, inverted barometer correction, solid earth tide and geocentric pole tide. (2) The moderately important corrections include wet tropospheric correction, dual-frequency ionospheric correction and sea state bias. The radiometer measurements are more preferred than model values in the geophysical data records for constraining wet tropospheric effect owing to the highly variable water-vapor structure in atmosphere. The items of dual-frequency ionospheric correction and sea state bias should better not be directly added to range observations for obtaining sea surface slopes since their inherent errors may cause abnormal sea surface slopes and along-track smoothing with uniform distribution weight in certain width is an effective strategy for avoiding introducing extra noises. The slopes calculated from radiometer wet tropospheric corrections, and along-track smoothed dual-frequency ionospheric corrections, sea state bias are generally within ±0.5 microradians and no larger than 1 microradians. (3) Ocean tide has the largest influence on obtaining sea surface slopes while most of ocean tide slopes distribute within ±3 microradians. Larger ocean tide slopes mostly occur over marginal and island-surrounding seas, and extra tidal models with better precision or with extending process (e.g. Got-e) are strongly recommended for updating corrections in geophysical data records.
Esposito, A.; Frasciello, O.; Pelliccioni, M.
2017-09-01
ELI-NP will be a new international research infrastructure facility for laser-based Nuclear Physics to be built in Magurele, south west of Bucharest, Romania. For the machine to operate as an intense γ rays' source based on Compton back-scattering, electron beams are employed, undergoing a two stage acceleration to 320 MeV and 740 MeV (and, with an eventual energy upgrade, also to 840 MeV) beam energies. In order to assess the radiation safety issues, concerning the effectiveness of the dumps in absorbing the primary electron beams, the generated prompt radiation field and the residual dose rates coming from the activation of constituent materials, as well as the shielding of the adjacent environments against both prompt and residual radiation fields, an extensive design study by means of Monte Carlo simulations with FLUKA code was performed, for both low energy 320 MeV and high energy 720 MeV (840 MeV) beam dumps. For the low energy dump we discuss also the rational of the choice to place it in the building basement, instead of installing it in one of the shielding wall at the machine level, as it was originally conceived. Ambient dose equivalent rate constraints, according to the Rumenian law in force in radiation protection matter were 0.1 /iSv/h everywhere outside the shielding walls and 1.4 μiSv/h outside the high energy dump area. The dumps' placements and layouts are shown to be fully compliant with the dose constraints and environmental impact.
Kaubavahetus on olnud eurooplaste kasuks / Lembo Tanning
Tanning, Lembo
1999-01-01
USA ja EL-i vahelised väliskaubandussuhted. Tabelid: EL-i eksport USA-sse ja import USA-st; suurimad EL-i USA-sse eksportijad ja suurimad EL-i USA-st importijad; EL-i riikide väliskaubanduse suhtarvud SKP-st, USA osatähtsus kaubanduspartnerina Euroopa riikidele
Directory of Open Access Journals (Sweden)
Simeone JC
2017-12-01
Full Text Available Jason C Simeone,1 Jay P Bae,2 Byron J Hoogwerf,3 Qian Li,1 Axel Haupt,3 Ayad K Ali,4 Marilyn K Boardman,3 Beth L Nordstrom1 1Real-world Evidence, Evidera, Waltham, MA, USA; 2Global Patient Outcomes and Real World Evidence, Eli Lilly and Company, Indianapolis, IN, USA; 3Lily Diabetes, Eli Lilly and Company, Indianapolis, IN, USA; 4Global Patient Safety, Eli Lilly and Company, Indianapolis, IN, USA Purpose: To identify the characteristics and initial disease severity of patients with nonalcoholic fatty liver disease (NAFLD and assess incidence and risk factors for disease progression in a retrospective study.Methods: Patients ≥18 years of age without alcoholism or other liver diseases (eg, hepatitis B/C were selected from Geisinger Health System electronic medical record data from 2004 to 2015. Initial disease stage was stratified into uncomplicated NAFLD, advanced fibrosis, cirrhosis, hepatocellular carcinoma (HCC, and liver transplant using clinical biomarkers, diagnosis, and procedure codes. Disease progression was defined as stage progression or death and analyzed via Kaplan–Meier plots and multistate models.Results: In the NAFLD cohort (N=18,754, 61.5% were women, 39.0% had type 2 diabetes mellitus (T2DM, and the mean body mass index was 38.2±10.2 kg/m2. At index, 69.9% had uncomplicated NAFLD, 11.7% had advanced fibrosis, and 17.8% had cirrhosis. Of 18,718 patients assessed for progression, 17.3% progressed (11.0% had stage progression, 6.3% died without evidence of stage progression during follow-up (median=842 days. Among subgroups, 12.3% of those without diabetes mellitus progressed vs 24.7% of those with T2DM. One-year mortality increased from 0.5% in uncomplicated NAFLD to 22.7% in HCC. After liver transplant, mortality decreased to 5.6% per year.Conclusions: In 2.3 years of follow-up, approximately 17% of patients progressed or died without evidence of stage progression. T2DM was associated with approximately twice the risk of
Directory of Open Access Journals (Sweden)
Aura Teresa Palacios-Pérez
2010-09-01
Full Text Available Objective: To determine the sensitivity and specificity of five available scales to the qualification of the Tonal Audiometry for the detection of occupationally induced hearing loss. Methods: A descriptive cross-sectional study was conducted. The study population was 92 adult workers. Participants underwent the application of the different formats of registration of the results and qualification of the tonal audiometry. Participants received a hearing evaluation by clinical audiometry. Sixty four cases met the inclusion criteria and were selected for the final analysis.Once the tonal audiometry was complete, evaluation of occupationally induced hearing loss was done by using the ELI, salt, modified LARSEN, KLOCKHOFF and NIOSH classification scales. Results were compared to FREQUENCIAL analysis. Results: The LARSEN scale was noted to detect more cases of occupationally induced hearing loss. The LARSEN modified, represented detection in 54.69% of cases for right ear and 56.25% of cases for left ear. On the other hand, noted the direct relationship of hearing loss with regard to the age. No direct correlation to time of noise exposure was found.. Conclusions: The rating scale that presented greater sensitivity was the LARSEN modified. It was represented by 93.1% and a specificity of 100%.
Elie Kedourie a kapitoly britské politiky na Blízkém východě
Directory of Open Access Journals (Sweden)
Kristýna Kynclová
2012-04-01
Full Text Available Western influence on the Middle East is a theme that deservedly attracts attention of many scientists from various fields of study. Many theories with regard to the modern political history of the region have been produced and discussed. One of the authors that came out with an influential concept was Edward Said. In his critique of Orientalism (Orientalism, 1978, Said focuses on Western conceptions of the Middle East and its outcomes. The book became worldwide famous for its direct assault on Western society and its imperial politics. An influential attitude is taken by another prominent scientist, Bernard Lewis, who represents an opposition to Said´s opinion. This survey is geared towards presenting the work of Baghdad-born British historian Elie Kedourie, who maintains with regard to given topic very interesting position as well. In the course of his career Kedourie mainly focused on modern Middle Eastern history, with a consideration to British political influence in the region. Kedourie tried to analyse factors which brought Ottoman Empire to decline and Middle Eastern region to general long-lasting crisis. In his writings Kedourie questioned the matter of suitability of Ottoman reforms based on European examples. He also occupied himself in detail with the issue of McMahon-Husayn correspondence and its interpretations, as well as with the Sykes-Picot agreement. He polemised with official viewpoints of British establishment and, usually with criticism, he assessed measures of British foreign politics. His revolutionary interpretations are believed to have changed the scientific approach of the view on modern history of the Middle Eastern countries.
Directory of Open Access Journals (Sweden)
Esposito A.
2017-01-01
Full Text Available ELI-NP will be a new international research infrastructure facility for laser-based Nuclear Physics to be built in Magurele, south west of Bucharest, Romania. For the machine to operate as an intense γ rays’ source based on Compton back-scattering, electron beams are employed, undergoing a two stage acceleration to 320 MeV and 740 MeV (and, with an eventual energy upgrade, also to 840 MeV beam energies. In order to assess the radiation safety issues, concerning the effectiveness of the dumps in absorbing the primary electron beams, the generated prompt radiation field and the residual dose rates coming from the activation of constituent materials, as well as the shielding of the adjacent environments against both prompt and residual radiation fields, an extensive design study by means of Monte Carlo simulations with FLUKA code was performed, for both low energy 320 MeV and high energy 720 MeV (840 MeV beam dumps. For the low energy dump we discuss also the rational of the choice to place it in the building basement, instead of installing it in one of the shielding wall at the machine level, as it was originally conceived. Ambient dose equivalent rate constraints, according to the Rumenian law in force in radiation protection matter were 0.1 /iSv/h everywhere outside the shielding walls and 1.4 μiSv/h outside the high energy dump area. The dumps’ placements and layouts are shown to be fully compliant with the dose constraints and environmental impact.
Czech Academy of Sciences Publication Activity Database
Italiano, A.; Amato, E.; Minutoli, F.; Margarone, Daniele; Baldari, S.
2016-01-01
Roč. 94, č. 2 (2016), 2-10, č. článku A2. ISSN 0365-0359 R&D Projects: GA MŠk EF15_008/0000162; GA ČR(CZ) GA15-02964S; GA MŠk LQ1606 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : PET diagnostics * accelerator applications * radionuclides Subject RIV: BL - Plasma and Gas Discharge Physics
Lu, Jun; Hu, Xiumei; Meng, Yutong; Zhao, Hongying; Cao, Qing; Jin, Mulan
2018-01-01
The aims of this study were to evaluate the associations between peritoneal elastic lamina invasion (ELI) and the clinicopathological prognostic factors of colon cancer, to evaluate the feasibility of ELI with use of an elastic stain to help diagnose serosal invasion of colon cancer in routine practice, so as to help us to provide a more accurate estimate for prognosis and stage of patients and a marker for postoperative treatment. 254 cases with colon cancer were included in the study. According to the presence of elastic lamina (EL) and elastic lamina invasion (ELI), all cases were divided into four groups: pT3 EL negative (pT3 EL (-)), pT3 ELI positive (pT3 ELI (+)), pT3 ELI negative (pT3 ELI (-)) and pT4a. Statistical analysis was used to analyze the relationship between elastic lamina invasion and other established adverse histologic features. The EL and ELI positive rates were 81.5% and 42.1% respectively. There were significant differences in mph node metastasis, venous invasion and tumor buds between pT3 ELI (-) and pT3 ELI (+), pT3 ELI (-) and pT4a. There was no significant difference in same factors between pT3 ELI (+) and pT4a. In pT3 stage, there were significant differences in lymph node metastasis, perineural invasion and tumor buds between EL (-) and ELI (+). There were no significant differences in same factors between EL (-) and ELI (-). EL was detected less frequently in right-sided tumors compared with left-sided tumors. ELI might be the prognostic factors of colon cancer with II stage and might be the marker of postoperative adjuvant chemotherapy. Patients with pT3 ELI (+) might have similar prognosis to patients with pT4a. For patients with pT3 colon cancer, EL(-) might have similar prognosis as ELI (-) and might take the same therapy. In addition, the right half colon EL positive rate was lower than the left colon. Elastic staining might be a useful tool to help determine the invasive depth and stage of colon cancer.
Nii, nagu oli, seal, kus oli / Heili Sibrits
Sibrits, Heili, 1977-
2010-01-01
Arvustus: Goodwin, Jason. Janitšaride puu : [romaan] / inglise keelest tõlkinud Juhan Habicht. Tallinn : Varrak, 2006 ; Goodwin, Jason. Maokivi : [kriminaalromaan] / inglise keelest tõlkinud Juhan Habicht. Tallinn : Varrak, 2008 ; Goodwin, Jason. Bellini kaart / inglise keelest tõlkinud Juhan Habicht. Tallinn : Varrak, 2010
International Nuclear Information System (INIS)
Gusri, A. I.; Che Hassan, C. H.; Jaharah, A. G.
2011-01-01
The performance of Chemical Vapor Deposition (CVD) carbide insert with ISO designation of CCMT 12 04 04 LF, when turning titanium alloys was investigated. There were four layers of coating materials for this insert i.e.TiN-Al2O3-TiCN-TiN. The insert performance was evaluated based on the insert's edge resistant towards the machining parameters used at high cutting speed range of machining Ti-6Al-4V ELI. Detailed study on the wear mechanism at the cutting edge of CVD carbide tools was carried out at cutting speed of 55-95 m/min, feed rate of 0.15-0.35 mm/rev and depth of cut of 0.10-0.20 mm. Wear mechanisms such as abrasive and adhesive were observed on the flank face. Crater wear due to diffusion was also observed on the rake race. The abrasive wear occurred more at nose radius and the fracture on tool were found at the feed rate of 0.35 mm/rev and the depth of cut of 0.20 mm. The adhesion wear takes place after the removal of the coating or coating delaminating. Therefore, adhesion or welding of titanium alloy onto the flank and rake faces demonstrates a strong bond at the workpiece-tool interface.
Energy Technology Data Exchange (ETDEWEB)
Amato, Ernesto [Section of Radiological Sciences, Department of Biomedical and Dental Sciences and of Morphologic and Functional Imaging, University of Messina (Italy); Italiano, Antonio, E-mail: italianoa@unime.it [Istituto Nazionale di Fisica Nucleare, Gruppo Collegato di Messina (Italy); Margarone, Daniele [Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, 182 21 Prague (Czech Republic); Pagano, Benedetta [Nuclear Medicine Unit, University Hospital “G. Martino”, Messina (Italy); Baldari, Sergio [Section of Radiological Sciences, Department of Biomedical and Dental Sciences and of Morphologic and Functional Imaging, University of Messina (Italy); Nuclear Medicine Unit, University Hospital “G. Martino”, Messina (Italy); Korn, Georg [Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, 182 21 Prague (Czech Republic)
2016-03-01
The development of novel compact PET radionuclide production systems is of great interest to promote the diffusion of PET diagnostics, especially in view of the continuous development of microfluidics labeling approaches. We studied the feasibility to produce clinically-relevant amounts of PET isotopes by means of laser-accelerated proton sources such that expected at the ELI-Beamlines facility. {sup 18}F, {sup 11}C, {sup 13}N and {sup 15}O production yields were calculated through the TALYS software, by taking into account the broad proton spectra expected. With the hypothesized proton fluencies, clinically-relevant amounts of radionuclides can be obtained, suitable to prepare single doses of {sup 18}F-, {sup 11}C- and {sup 13}N-labeled radiopharmaceuticals exploiting fast and efficient microfluidic labeling systems.
International Nuclear Information System (INIS)
Amato, Ernesto; Italiano, Antonio; Margarone, Daniele; Pagano, Benedetta; Baldari, Sergio; Korn, Georg
2016-01-01
The development of novel compact PET radionuclide production systems is of great interest to promote the diffusion of PET diagnostics, especially in view of the continuous development of microfluidics labeling approaches. We studied the feasibility to produce clinically-relevant amounts of PET isotopes by means of laser-accelerated proton sources such that expected at the ELI-Beamlines facility. "1"8F, "1"1C, "1"3N and "1"5O production yields were calculated through the TALYS software, by taking into account the broad proton spectra expected. With the hypothesized proton fluencies, clinically-relevant amounts of radionuclides can be obtained, suitable to prepare single doses of "1"8F-, "1"1C- and "1"3N-labeled radiopharmaceuticals exploiting fast and efficient microfluidic labeling systems.
Kui raha on vaja, lendab ideoloogia prügikasti / Villu Zirnask
Zirnask, Villu, 1966-
2009-01-01
KPMG 2009. aasta maailma maksuülevaatest. Eesti käibemaksumäär on peaaegu võrdne EL-i keskmisega, kaudsete maksude suhtelt SKT-sse on Eesti samuti EL-i keskmisel tasemel. EL-i keskmisest kõrgem on Eestis aktsiisimaks. EL-is rakendatavatest pisimaksudest. Tabelid, diagrammid, graafikud
The Invisible Student: Understanding Social Identity Construction within Performing Ensembles
Hourigan, Ryan M.
2009-01-01
This article was taken from a qualitative case study about Jason, a child who suffered from traumatic brain injury syndrome. This research focused on interactions among Jason, his classmates, his band director, his parents, and his school district. Jason encountered many challenges as a child with special needs in band. The purpose of this article…
Scott, James Wesley
2009-01-01
Kaitse ja koostöö agendade põrkumisest ELi territooriumi piiritlemisel ELi ja naaberriikide piiriüleste kodanikeühenduste näitel. ELi ja Ukraina vahelistest suhetest Euroopa naabruspoliitika kontekstis
Directory of Open Access Journals (Sweden)
Tetsuhiko Maeda
2016-01-01
Full Text Available We propose control methods of a photovoltaic (PV-water electrolyzer (ELY system that generates hydrogen by controlling the number of ELY cells. The advantage of this direct coupling between PV and ELY is that the power loss of DC/DC converter is avoided. In this study, a total of 15 ELY cells are used. In the previous researches, the electrolyzer temperature was constantly controlled with a thermostat. Actually, the electrolyzer temperature is decided by the balance of the electrolysis loss and the heat loss to the outside. Here, the method to control the number of ELY cells was investigated. Maximum Power Point Tracking efficiency of more than 96% was achieved without ELY temperature control. Furthermore we construct a numerical model taking into account of ELY temperature. Using this model, we performed a numerical simulation of 1-year. Experimental data and the simulation results shows the validity of the proposed control method.
Euroopa Liidu mahelogo pole kuigi tuntud / ülevaate koostas Merit Mikk
2015-01-01
2010. a muutus ELi mahelogo kasutamine mahetoodetel kohustuslikuks. Euroopa Komisjon lootis sellega elavdada ELi maheturgu. Mitmete uuringute põhjal on aga selgunud, et tarbijad ELi mahemärki siiski eriti ei tunne
Directory of Open Access Journals (Sweden)
Antonio Italiano
2016-05-01
Full Text Available The development of innovative production pathways for high-Z positron emitters is of great interest to enlarge the applicability of PET diagnostics, especially in view of the continuous development of new radiopharmaceuticals. We evaluated the theoretical yields of 64Cu, 86Y, 89Zr, 73Se, 77Br and 124I PET isotopes, plus the 68Ge isotope, parent of the 68Ga positron emitter, in the hypothesis of production through laser-accelerated proton sources expected at the ELI-Beamlines facility. By means of the TALYS software we simulated the nuclear reactions leading to the above radionuclides, hypothesizing three possible scenarios of broad proton spectra, with maximum energies of about 9, 40 and 100 MeV. The production yields of the studied radionuclides, within the expected fluences, appear to be suitable for pre-clinical applications.
Sabato, L.; Arpaia, P.; Cianchi, A.; Liccardo, A.; Mostacci, A.; Palumbo, L.; Variola, A.
2018-02-01
In high-brightness LINear ACcelerators (LINACs), electron bunch length can be measured indirectly by a radio frequency deflector (RFD). In this paper, the accuracy loss arising from non-negligible correlations between particle longitudinal positions and the transverse plane (in particular the vertical one) at RFD entrance is analytically assessed. Theoretical predictions are compared with simulation results, obtained by means of ELEctron Generation ANd Tracking (ELEGANT) code, in the case study of the gamma beam system (GBS) at the extreme light infrastructure—nuclear physics (ELI-NP). In particular, the relative error affecting the bunch length measurement, for bunches characterized by both energy chirp and fixed correlation coefficients between longitudinal particle positions and the vertical plane, is reported. Moreover, the relative error versus the correlation coefficients is shown for fixed RFD phase 0 rad and π rad. The relationship between relative error and correlations factors can help the decision of using the bunch length measurement technique with one or two vertical spot size measurements in order to cancel the correlations contribution. In the case of the GBS electron LINAC, the misalignment of one of the quadrupoles before the RFD between -2 mm and 2 mm leads to a relative error less than 5%. The misalignment of the first C-band accelerating section between -2 mm and 2 mm could lead to a relative error up to 10%.
We're doing all right, but what about you?
2003-01-01
Vaatamata sellele, et EL-i kandidaatriigid, võrreldes praeguste liikmesriikidega on vaesed, hakkavad nad samuti tasuma liikmemaksu EL-iga liitumisel 2004. aasta mais ning seeläbi andma ise abi teistele riikidele. Diagramm: SKP 15 EL-i liikmesriigis ja 8 EL-i kandidaatriigis aastal 2002.
Euroopa Liidu välisinvesteeringud / Lembo Tanning
Tanning, Lembo
2001-01-01
Ilmunud ka: Buhgalterskije Novosti, nr. 6, 2001, lk. 42-47. Euroopa Liidu ühisturu kujunemisest ja välisinvesteerigute liikumisest. Tabel ja diagrammdi: EL-i välismaised otseinvesteeringud; EL-i liikmesriikide välismaale tehtud otseinvesteeringute pingerida; EL-i investeeringute suhe SKT-sse 1995-2000
Kriitikat pälvinud EL nõus langetama põllumajandustolle / Krister Paris
Paris, Krister, 1977-
2005-01-01
EL-i kaubandusvolinik Peter Mandelson pakkus EL-i kaubanduspartneritele, et EL kärbib tariife keskmiselt 46% võrra. Prantsusmaa on EL-i põllumajandustollide vähendamise vastu. USA tahab, et EL vähendaks oma tariife 55-90%. Lisa: WTO nõuab EL-ilt suhkrureformi
National Aeronautics and Space Administration — This product contains along track gridded Sea Surface Height Anomalies (SSHA) from TOPEX/Poseidon, Jason-1 and OSTM/Jason-2 (depending on time period), with biases...
2011-03-23
... Act of 1930, as amended, 19 U.S.C. 1337, on behalf of Eli Lilly and Company of Indianapolis, Indiana. Eli Lilly filed letters supplementing the complaint on February 9 and 16, 2011. The Commission requested additional information on March 2, 1011. Eli Lilly responded with additional information...
Quintana, Oscar A.; Tong, Weidong
2017-12-01
We investigated the selective laser melting (SLM) process for development of Ti-6Al-4 V solid material with oxygen content corresponding to the extra low interstitial (ELI) and non-ELI conditions. The microstructure, chemistry, and tensile properties of samples in as-built and hot isostatically pressed (HIPed) condition were evaluated for both material types, while fatigue performance was evaluated by rotating bending fatigue tests on both smooth and notched SLM ELI and non-ELI Ti-6Al-4 V samples in HIPed condition.
OW AVISO Sea-Surface Height & Niiler Climatology
National Oceanic and Atmospheric Administration, Department of Commerce — The dataset contains satellite-derived sea-surface height measurements collected by means of the TOPEX/Poseidon/ERS, JASON-1/Envisat, and Jason-2/Envisat satellite...
Euroopa Liidu palkadest / Lembo Tanning
Tanning, Lembo
2001-01-01
Euroopa Liidu elustandardi analüüs palkade põhjal. Tabelid: EL-i maade keskmine tunnipalk majandusharude järgi eurodes; EL-i madalapalgaliste üldine tase ja nende liigitus põhjuste järgi %-des; EL-i madalapalgaliste osakaalu jagunemine ja selle tõenäosus; Saksamaa Liitvabariigi palgad 1996-2000
Vähem arenenud piirkonnad Euroopas / Lembo Tanning
Tanning, Lembo
1999-01-01
Missugused on majanduslikud erinevused EL-i riikide ja piirkondade vahel ning erinevus Eestiga. Kas EL-is on regionaalse arenguga probleeme, kas seal on majanduslikult mahajäänud piirkondi. Tabelid: ELi riikide SKP jooksvates hindades ostujõu pariteedi järgi; suuremad SKP-d ühe inimese kohta regiooni järgi, kui EL=100%
Eesti vajab kiiresti euroabi vastuvõtmise kava / Rupinder Singh
Singh, Rupinder
2003-01-01
Autor leiab, et EL-i liikmelisus annab võimaluse püsivaks ja õiglaseks majanduskasvu koefitsiendiks, kuid vaid juhul, kui potentsiaalsed võimalused ära kasutatakse. Ta rõhutab tugeva poliitilise juhtimise ja strateegilise planeerimise vajalikkust valmistamaks ette infrastruktuuri EL-i rahade kasutamiseks. Samas pole Baltimaades tema hinnangul hetkel isegi piisavalt inimesi EL-i finantsvoogude suure potentsiaaliga tegelemiseks.
Reality check for rosy view of convergence / Kathryn Tully
Tully, Kathryn
2002-01-01
Ülevaade EL-i kandidaatriikide aktsiaturgude arengust ja EL-iga liitumise edasilükkumisest tulenevatest ohtudest välisinvesteeringutele. Lisa. Tabelid ja skeem: kandidaatriikide EL-i ja Euroopa Rahaliiduga liitumise tõenäosus %-des jaanuar 2004-2007; kandidaatriikide poolt välisvaluutas välja antud võlakirjad jaanuar-august 2002; võimalikud takistused EL-i laienemise ajakavale
The Impact of Temporal Geopotential Variations on GPS
Melachroinos, Stavros; Lemoine, Frank G.; Zelensky, Nikita P.; Beckley, Brian D.; Chinn, Douglas S.; Nicholas, Joseph B.; McCarthy, John J.; Pennington, Teresa; Luthcke, Scott B.
2012-01-01
Lemoine et al. (2006) and Lemoine et al. (2010) showed that applying more detailed models of time-variable gravity (TVG) improved the quality of the altimeter satellite orbits (e.g. TOPEX/Poseidon, Jason-1, Jason-2). This modeling include application of atmospheric gravity derived from 6-hrly pressure fields obtained from the ECMWF and annual gravity variations to degree & order 20x20 in spherical harmonics derived from GRACE data. This approach allowed the development of a consistent geophysical model for application to altimeter satellite orbit determination from 1993 to 2011. In addition, we have also evaluated the impact of TVG modeling on the POD of Jason-1 and Jason-2 by application of a weekly degree & order four gravity coefficient time series developed using data from ten SLR & DORIS-tracked satellites from 1993 to 2011 (Lemoine et al., 2011).
Kornum, Birgitte Rahbek; Burgdorf, Kristoffer Sølvsten; Holm, Anja; Ullum, Henrik; Jennum, Poul; Knudsen, Stine
2017-08-15
Narcolepsy type 1, a neurological sleep disorder strongly associated with Human Leukocyte Antigen (HLA-)DQB1*06:02, is caused by the loss of hypothalamic neurons producing the wake-promoting neuropeptide hypocretin (hcrt, also known as orexin). This loss is believed to be caused by an autoimmune reaction. To test whether hcrt itself could be a possible target in the autoimmune attack, CD4 + T-cell reactivity towards six different 15-mer peptides from prepro-hypocretin with high predicted affinity to the DQA1*01:02/DQB1*06:02 MHC class II dimer was tested using EliSpot in a cohort of 22 narcolepsy patients with low CSF hcrt levels, and 23 DQB1*06:02 positive healthy controls. Our ELISpot assay had a detection limit of 1:10,000 cells. We present data showing that autoreactive CD4 + T-cells targeting epitopes from the hcrt precursor in the context of MHC-DQA1*01:02/DQB1*06:02 are either not present or present in a frequency is <1:10,000 among peripheral CD4 + T-cells from narcolepsy type 1 patients. Copyright © 2017 Elsevier B.V. All rights reserved.
Euroopa Liit valmistab ette uutmoodi Venemaa-poliitikat / Ahto Lobjakas
Lobjakas, Ahto, 1970-
2006-01-01
EL-i järgmine eesistujariik Saksamaa pakub täielikku paradigma muutust EL-i ja Venemaa suhetes, autori sõnul asenduks senine rõhk "ühistel väärtustel" huvide kaine kalkulatsiooniga. Autor esitab oma seisukoha, kuidas peaks toimima Eesti: probleemid Venemaaga on vaja viia miinimumini ning EL-is tuleb toetada ühiseid valikuid vetoõiguse ja erahuvide vastu
Saniotis, Arthur; Henneberg, Maciej; Sawalma, Abdul-Rahman
2018-01-01
Recent neuroscientific research demonstrates that the human brain is becoming altered by technological devices. Improvements in biotechnologies and computer based technologies are now increasing the likelihood for the development of brain augmentation devices in the next 20 years. We have developed the idea of an "Endomyccorhizae like interface" (ELI) nanocognitive device as a new kind of future neuroprosthetic which aims to facilitate neuronal network properties in individuals with neurodegenerative disorders. The design of our ELI may overcome the problems of invasive neuroprosthetics, post-operative inflammation, and infection and neuroprosthetic degradation. The method in which our ELI is connected and integrated to neuronal networks is based on a mechanism similar to endomyccorhizae which is the oldest and most widespread form of plant symbiosis. We propose that the principle of Endomyccorhizae could be relevant for developing a crossing point between the ELI and neuronal networks. Similar to endomyccorhizae the ELI will be designed to form webs, each of which connects multiple neurons together. The ELI will function to sense action potentials and deliver it to the neurons it connects to. This is expected to compensate for neuronal loss in some neurodegenerative disorders, such as Alzheimer's disease and Parkinson's disease.
Integrating Non-Tidal Sea Level data from altimetry and tide gauges for coastal sea level prediction
DEFF Research Database (Denmark)
Cheng, Yongcun; Andersen, Ole Baltazar; Knudsen, Per
2012-01-01
The main objective of this paper is to integrate Non-Tidal Sea Level (NSL) from the joint TOPEX, Jason-1 and Jason-2 satellite altimetry with tide gauge data at the west and north coast of the United Kingdom for coastal sea level prediction. The temporal correlation coefficient between altimetric...... NSLs and tide gauge data reaches a maximum higher than 90% for each gauge. The results show that the multivariate regression approach can efficiently integrate the two types of data in the coastal waters of the area. The Multivariate Regression Model is established by integrating the along-track NSL...... from the joint TOPEX/Jason-1/Jason-2 altimeters with that from eleven tide gauges. The model results give a maximum hindcast skill of 0.95, which means maximum 95% of NSL variance can be explained by the model. The minimum Root Mean Square Error (RMSe) between altimetric observations and model...
Javier Solana: Euroopa peab tugevdama oma sõjalist võimsust / Javier Solana ; interv. Urmet Kook
Solana, Javier
2005-01-01
Euroopa Liidu ühtse välispoliitika juht Euroopa Liitu ohustavatest teguritest, USA-Euroopa suhetest, NATO ning EL-i dubleerivast sõjalisest tegevusest, Prantsusmaa ja Hollandi Euroopa Liidu põhiseaduse referendumite hääletamise mõjust EL-i välis- ning julgeolekupoliitikale, Iraagi küsimusest, Ukraina ja Türgi võimalikust liitumisest Euroopa Liiduga, Eesti EL-i sõjalises tegevuses osalemise vajadusest
Javier Solana: Euroopa peab tugevdama oma sõjalist võimsust / intervjueerinud Urmet Kook
Solana, Javier, 1942-
2008-01-01
Euroopa Liidu ühtse välispoliitika juht Euroopa Liitu ohustavatest teguritest, USA-Euroopa suhetest, NATO ning EL-i dubleerivast sõjalisest tegevusest, Prantsusmaa ja Hollandi Euroopa Liidu põhiseaduse referendumite hääletamise mõjust EL-i välis- ning julgeolekupoliitikale, Iraagi küsimusest, Ukraina ja Türgi võimalikust liitumisest Euroopa Liiduga, Eesti EL-i sõjalises tegevuses osalemise vajadusest
Ozdener, Fatih; Ozdemir, Vural
2003-09-01
Lilly is developing fasidotril, a diester prodrug of the active metabolite fasidotrilat, for the potential treatment of hypertension and congestive heart failure (CHF). Phase II trials to investigate the potential of fasidotril for the treatment of hypertension and CHF had commenced by the late 1990s, and were ongoing in July 2003 in the US and Europe.
Anttila, Sami; Leinonen, Esa
2002-08-01
Duloxetine is a serotonin (5-HT) and norepinephrine (NE) uptake inhibitor in pre-registration for depression. In vivo studies demonstrate that duloxetine inhibits 5-HT and NE transporters and this may induce an antidepressant effect [159168]. In humans, duloxetine has a low affinity for most 5-HT subtypes and for muscarinic, histamine H1, alpha1-adrenergic, alpha2-adrenergic and dopamine D2 receptors [444103]. Thus, it is not surprising that the meta-analysis of four recent clinical studies suggests duloxetine is a potent and well-tolerated antidepressant [429723]. By December 2001, Lilly had filed an NDA for depression. The launch of duloxetine is planned for the second half of 2002 [434250], [436220]. In April 2002, filing for stress urinary incontinence was anticipated for later in 2002 [456894]. Analysts at Banc of America predicted in April 2002, that the drug will be launched in the first quarter of 2003. The company projects US $400 million in revenue in 2003 and anticipates duloxetine to reach peak sales of over US $1 billion [450920]. Analysts at Morgan Stanley, projected US $25 million in sales in the fourth quarter 2002, rising to US $900 million in 2006 [450937]. At the same time, Credit Suisse First Boston anticipated launch for late 2002, with US $220 million in duloxetine revenues in 2003 and US $457 million in 2004 [450936].
Impact of energy loss index on left ventricular mass regression after aortic valve replacement.
Koyama, Terumasa; Okura, Hiroyuki; Kume, Teruyoshi; Fukuhara, Kenzo; Imai, Koichiro; Hayashida, Akihiro; Neishi, Yoji; Kawamoto, Takahiro; Tanemoto, Kazuo; Yoshida, Kiyoshi
2014-01-01
Recently, the energy loss index (ELI) has been proposed as a new functional index to assess the severity of aortic stenosis (AS). The aim of this study was to investigate the impact of the ELI on left ventricular mass (LVM) regression in patients after aortic valve replacement (AVR) with mechanical valves. A total of 30 patients with severe AS who underwent AVR with mechanical valves was studied. Echocardiography was performed to measure the LVM before AVR (pre-LVM) (n = 30) and repeated 12 months later (post-LVM) (n = 19). The ELI was calculated as [effective orifice area (EOA) × aortic cross sectional area]/(aortic cross sectional area - EOA) divided by the body surface area. The LVM regression rate (%) was calculated as 100 × (post-LVM - pre-LVM)/(pre-LVM). A cardiac event was defined as a composite of cardiac death and heart failure requiring hospitalization. LVM regressed significantly (245.1 ± 84.3 to 173.4 ± 62.6 g, P regression rate negatively correlated with the ELI (R = -0.67, P regression rates (area under the curve = 0.825; P = 0.030). Patients with ELI regression after AVR with mechanical valves. Whether the ELI is a stronger predictor of clinical events than EOAI is still unclear, and further large-scale study is necessary to elucidate the clinical impact of the ELI in patients with AVR.
Euroopa Parlamendist ei saa kunagi tõeliste eurooplaste esinduskogu / Jeroen Bult
Bult, Jeroen
2004-01-01
EL-i liikmesriikide inimeste suhtumisest Euroopa Parlamendi valimistesse ja parlamendi funktsioonide muutmise vajadusest. Vt. samas: Euroopa tähistab valimiste veerandsajandit. Lisa: EL-i liikmesriigid
Trotz Richtlinie weiterhin intergouvernmental / Joachim Lippott
Lippott, Joachim
2017-01-01
ELi kodanike konsulaarkaitsest kolmandates riikides rahvusvahelise, Euroopa Liidu ja siseriikliku õiguse aspektist; ELi toimimise lepingu artikli 23, diplomaatiliste suhete ja konsulaarsuhete Viini konventsiooni tõlgendamisest
Euroopa Liidu teadus ja tehnoloogia / Lembo Tanning
Tanning, Lembo
2001-01-01
Ilmunud ka: Buhgalterskije Novosti, nr. 7, 2001, lk. 42-47. Euroopa Liidu teaduse ja tehnoloogia areng ja hetkeseis. Tabelid ja diagrammid: töötajate arv EL-i kõrgtehnoloogia majandusharudes ja teadusintensiivses teeninduses; EL-i regioonide uurimis-arengutöödele tehtud kulutused ning patentide arv; EL-i regioonide kõrgtehnoloogia edetabel 1997; uurimis- ja arendustöödele tehtud riiklikud kulutused SKP-st 1998; teaduse ja tehnoloogia inimressursid 1999
Directory of Open Access Journals (Sweden)
Arthur Saniotis
2018-03-01
Full Text Available Recent neuroscientific research demonstrates that the human brain is becoming altered by technological devices. Improvements in biotechnologies and computer based technologies are now increasing the likelihood for the development of brain augmentation devices in the next 20 years. We have developed the idea of an “Endomyccorhizae like interface” (ELI nanocognitive device as a new kind of future neuroprosthetic which aims to facilitate neuronal network properties in individuals with neurodegenerative disorders. The design of our ELI may overcome the problems of invasive neuroprosthetics, post-operative inflammation, and infection and neuroprosthetic degradation. The method in which our ELI is connected and integrated to neuronal networks is based on a mechanism similar to endomyccorhizae which is the oldest and most widespread form of plant symbiosis. We propose that the principle of Endomyccorhizae could be relevant for developing a crossing point between the ELI and neuronal networks. Similar to endomyccorhizae the ELI will be designed to form webs, each of which connects multiple neurons together. The ELI will function to sense action potentials and deliver it to the neurons it connects to. This is expected to compensate for neuronal loss in some neurodegenerative disorders, such as Alzheimer's disease and Parkinson's disease.
2011-05-27
..., including on-site leased workers from Accurate Quality Inspection, Grand Rapids, Michigan. The workers produce door inserts for the automotive industry and seat backs for the automotive and furniture... From Accurate Quality Inspection, Imperial Design and Gill Staffing, Grand Rapids, Michigan; Amended...
Kesk-Euroopa on Euroopa Liidu tähtis kaubanduspartner / Lembo Tanning
Tanning, Lembo
1999-01-01
Kaubandusest Euroopa riikide ja Euroopa Liidu liikmesriikide vahel. Joonised: Kesk-Euroopa maade ekspordi ja -impordipartnerid, ELi eksport-import, ELi riikide väliskaubandus Kesk- ja Ida-Euroopa riikidega
EU funds-related Baltic controversies in Brussels / Rokas M. Tracevskis
Tracevskis, Rokas M.
2011-01-01
10.–13. okt. toimus Brüsselis Euroopa Liidu regionaalpoliitika iga-aastane foorum – Avatud Uste Päevad, kus räägiti ühtekuuluvuspoliitika teemadel. 6. oktoobril saatsid Baltimaade ja Ungari peaministrid EL-i juhtidele kirja, milles ütlevad, et nad ei ole EL-i ühtekuuluvuspoliitika rahastamisega seotud ettepanekutega nõus. Baltimaade põllumehed avaldasid Brüsselis meelt ja nõudsid võrdseid konkurentsitingimusi ning toetusi kõikidele EL-i riikidele
Euroopa Liidu ja Moskva suhted vajaks muudatusi / Jaanus Piirsalu
Piirsalu, Jaanus, 1973-
2007-01-01
Brüsselis asuva EL-i ja Venemaa keskuse direktori Fraser Cameroni hinnangul peaksid EL-i liikmesriigid andma Brüsselile Moskvaga suhtlemiseks rohkem võimu. Tema väitel avaldavad tugevat vastuseisu Venemaa ja EL-i poliitiliste suhete arendamisele Baltimaad ja Poola. Liikmesriikide kahepoolsed suhted Venemaaga sõltuvad parajasti võimul olevast juhtkonnast. Balti riigid olevat Venemaa suhtes liiga kriitilised, nimeliselt mainis F. Cameron Eesti presidendi Toomas Hendrik Ilvese avaldusi. Vt. samas : Paralleel Eestiga
Real Science, Real Learning: Bridging the Gap Between Scientists, Educators and Students
Lewis, Y.
2006-05-01
Today as never before, America needs its citizens to be literate in science and technology. Not only must we only inspire a new generation of scientists and engineers and technologists, we must foster a society capable of meeting complex, 21st-century challenges. Unfortunately, the need for creative, flexible thinkers is growing at a time when our young students are lagging in science interest and performance. Over the past 17 years, the JASON Project has worked to link real science and scientists to the classroom. This link provide viable pipeline to creating the next generation scientists and researchers. Ultimately, JASON's mission is to improve the way science is taught by enabling students to learn directly from leading scientists. Through partnerships with agencies such as NOAA and NASA, JASON creates multimedia classroom products based on current scientific research. Broadcasts of science expeditions, hosted by leading researchers, are coupled with classroom materials that include interactive computer-based simulations, video- on-demand, inquiry-based experiments and activities, and print materials for students and teachers. A "gated" Web site hosts online resources and provides a secure platform to network with scientists and other classrooms in a nationwide community of learners. Each curriculum is organized around a specific theme for a comprehensive learning experience. It may be taught as a complete package, or individual components can be selected to teach specific, standards-based concepts. Such thematic units include: Disappearing Wetlands, Mysteries of Earth and Mars, and Monster Storms. All JASON curriculum units are grounded in "inquiry-based learning." The highly interactive curriculum will enable students to access current, real-world scientific research and employ the scientific method through reflection, investigation, identification of problems, sharing of data, and forming and testing hypotheses. JASON specializes in effectively applying
Jump-starting Europe to surpass America
2003-01-01
EL-i kahepäevasel tippkohtumisel Brüsselis tegid Euroopa riikide liidrid avalduse majanduse hoogustamisest ja toetasid Euroopa Komisjoni ettepanekut suurendada EL-i investeeringuid transporti, energeetikasse ja teadusesse
USA ja EL vähendavad kaubandustõkkeid / Kertu Ruus
Ruus, Kertu, 1977-
2005-01-01
Tippkohtumisel Washingtonis arutasid Euroopa Komisjoni president Jose Manuel Barroso ja USA president George W. Bush, kuidas EL-i ja USA majandussuhteid vabamaks muuta. Diagramm: EL-i kaubavahetus USA-ga
Nashihh negrazhdan hotjat sdelat jevropeitsami / Valentin Zvegintsev
Zvegintsev, Valentin
2004-01-01
Brüsselis toimunud konverentsil "Venekeelne elanikkond laienenud EL-is" tõstatus küsimus partei loomise kohta venekeelse elanikkonna huvide kaitsmiseks EL-is. Eesti delegatsioon tutvustas partei programmi
Rauno Pukonen : Meie toodangut armastatakse, meid endid mitte / Rauno Pukonen ; interv. Svea Talving
Pukonen, Rauno
2004-01-01
Farmaatsiafirmast Eli Lilly, ravimifirmade madalast mainest. Eli Lilly filiaali juhi sõnul ei lase väike turg ja tagasihoidlik kompensatsioon võimalikku ravimivalikut Eestisse tuua. Lisa: Fakte ettevõttest
Schneider, Jens-Peter
2015-01-01
1. septembril 2014 avaldas Euroopa Liidu haldusõiguse uurimisvõrgustik (ReNEUAL) ELi halduskorra näidiseeskirjad mis aitavad ELi institutsioonidel toimida ausalt, läbipaistvalt, tõhusalt ja avatult
2013-04-23
... limited liability company, individually, with Stephen L. LaFrance, Jr., Little Rock, Arkansas, as the sole... Properties, LLC, a Missouri limited liability company, with Stephen L. LaFrance, Jr., Jason P. LaFrance, and... limited liability company, with Stephen L. LaFrance, Jr. and Jason P. LaFrance as managers, the Stephen L...
Euroopa Liit hakkab võitlema antisemitismiga / Margo Pajuste
Pajuste, Margo
2004-01-01
EL-i konverentsil, kus osalesid Euroopa Komisjon, Euroopa Juudikongress ja Euroopa Rabide Kongress, kutsus Romano Prodi EL-i riikide valitsusi üles kiitma heaks komisjoni ettepanekut võtta vastu rassismi- ja ksenofoobiaseadus
Euroopa Liit läks Kosovo tunnustamise osas lõhki / Ahto Lobjakas
Lobjakas, Ahto, 1970-
2008-01-01
Euroopa Liidu välisministrite kohtumisel ei saavutatud üksmeelt Kosovo tunnustamises. EL-i avalduse kohaselt langetab iga EL-i liikmesriik suhete loomise otsuse ise. Lisa: Kosovo jäetakse ukse taha
2012-05-30
..., Division of Eli Lilly & Co. DATES: This rule is effective May 30, 2012. FOR FURTHER INFORMATION CONTACT... this table to Elanco Animal Health, Division of Eli Lilly & Co., Lilly Corporate Center, Indianapolis...
Eesti peab ütlema "jah!" / Ken-Marti Vaher, Urmas Reinsalu
Vaher, Ken-Marti, 1974-
2003-01-01
Justiitsminister Ken-Marti Vaher ja parlamendiliige Urmas Reinsalu analüüsivad EL-i põhiseaduslikku korda ja esitavad seisukohad, mida Eesti peab ütlema valitsustevahelisel konverentsil EL-i föderaliseerumise vastu
Eurosaadikud ootavad CIA lendude uurimist / Triin Oppi
Oppi, Triin
2007-01-01
Euroopa Parlament mõistis hukka EL-i 14 liikmesriigi koostöö USA Luure Keskagentuuriga. Ebaseaduslike kinnipidamisasutuste probleemist EL-i liikmesriikide territooriumil. Kuubal Guantanamos asuva USA sõjaväelaagri sulgemise nõudest
Online Journalism in Africa: Trends, Practices and Emerging
DEFF Research Database (Denmark)
Ngomba, Teke Jacob
2017-01-01
Review of: Online Journalism in Africa: Trends, Practices and Emerging Cultures' Hayes M. Mabweazara, Okoth Fred Mudhai, and Jason Whittaker (Eds) London and New York: Routledge, 2014.......Review of: Online Journalism in Africa: Trends, Practices and Emerging Cultures' Hayes M. Mabweazara, Okoth Fred Mudhai, and Jason Whittaker (Eds) London and New York: Routledge, 2014....
Perfluorattujen alkyyliaineiden (PFAS) aiheuttamat ympäristöriskit Suomessa
Korkki, Kati
2006-01-01
Perfluoratut alkyyliaineet (PFAS) ovat laaja ryhmä kemikaaleja, joita on käytetty 1950-luvulta saakka teollisuudessa ja kuluttajatuotteissa. 1990-luvun lopulla tuli ilmi, että osa PFAS-aineista on levinnyt ympäristöön ja eliöihin maailmanlaajuisesti. Eniten esillä ollut PFAS-aine, PFOS eli perfluoro-oktaanisulfonaatti, on pysyvä, biokertyvä ja toksinen. Myös pitkäketjuiset perfluorokarboksyylihapot, kuten PFOA eli perfluoro-oktaanihappo, ovat pysyviä ja biokertyviä. Tutkielman tavoitteena oli...
Climate-change-driven accelerated sea-level rise detected in the altimeter era.
Nerem, R S; Beckley, B D; Fasullo, J T; Hamlington, B D; Masters, D; Mitchum, G T
2018-02-27
Using a 25-y time series of precision satellite altimeter data from TOPEX/Poseidon, Jason-1, Jason-2, and Jason-3, we estimate the climate-change-driven acceleration of global mean sea level over the last 25 y to be 0.084 ± 0.025 mm/y 2 Coupled with the average climate-change-driven rate of sea level rise over these same 25 y of 2.9 mm/y, simple extrapolation of the quadratic implies global mean sea level could rise 65 ± 12 cm by 2100 compared with 2005, roughly in agreement with the Intergovernmental Panel on Climate Change (IPCC) 5th Assessment Report (AR5) model projections. Copyright © 2018 the Author(s). Published by PNAS.
Free movement or benefit tourism: the unreasonable burden of Brey / Herwig Verschueren
Verschueren, Herwig
2014-01-01
ELi direktiivist 2004/38, mis käsitleb ELi kodanike ja nende pereliikmete õigust liikuda ja elada vabalt liikmesriikide territooriumil. Määrusest 883/2004 sotsiaalkindlustussüsteemide kooskõlastamise kohta. Euroopa Kohtu praktikast
Euroliit vaidleb Birma diktatuuri üle / Karin Dean
Dean, Karin
2004-01-01
EL-i ja Aasia riikide diplomaatilisest vaidlusest, kas lubada EL-i ja Kagu-Aasia tippkohtumisele diktatuuririiki Birmat. Kagu-Aasia maade ühenduse ASEAN seisukohtadest. Vt. samas: Birma uue põhiseaduse arutelu põlu all
EU commissioner says Gazprom won't be exception to trade rules
2007-01-01
EL-i konkurentsivolinik Neelie Kroes hoiatas, et Gazprom võib loovutada oma osakud Baltimaade energiaettevõtetes ja Läänemere gaasijuhtmes, kui EL-i liikmesriigid võtavad vastu uue strateegilise energiaplaani, mis edendab konkurentsi
Chmielewski, Lukasz; Brinkman, Richard; Hoepman, J.H.; Bos, Bert
2008-01-01
Nowadays business applications closely collaborate with other business applications by sharing one or more services. Unfortunately, opening your business application to the outside world also sacrifices security. There is quite a number of standards that aims at protecting these services. However,
Olulised on kokkulepped Euroopa vaesema ja rikkama osa vahel / Viktor Sartakov ; interv. Tiia Truu
Sartakov, Viktor, 1947-
2002-01-01
Eestimaa Tootjate Keskliidu juhatuse esimees Viktor Sartakov osalemisest Kopenhaagenis EL-i Põllumajandusorganisatsioonide Komitee (COPA) ja Põllumajandusühistute Peakomitee (COGECA) toimkondade töös, EL-i liikmesmaade suhtumisest kandidaatriikidesse, EL-iga liitumise kasust, ohtudest
Giles Merritt: Euroopa Liit vedas inimesi alt / Giles Merritt ; interv. Liisa Past
Merritt, Giles
2009-01-01
Mõttekoja Friends of Europe peasekretär eelseisvatest Euroopa Parlamendi valimistest, Tšehhist EL-i eesistujamaana, Euroopa Komisjoni vähesest aktiivsusest üleilmse majanduskriisi mõju vähendamisel, protektsionismist, EL-i Venemaa-poliitikast
Directory of Open Access Journals (Sweden)
İskender Özkul
2013-01-01
Full Text Available Bu çalışmada sıcak iş takım çeliklerinden Dievar derece çeliği üzerinde çeşitli matkaplar ile delik delme esnasında meydana gelen eksenel kuvvetler, kesme momentleri, yüzey pürüzlülükleri, ölçü tamlığı ve dairesellikten sapma değerleri araştırılmıştır. Deneyler dik işleme tezgâhında soğutma sıvısı ile Ø16 mm çaplarında kaplamasız karbür matkap ve kendinden raybalı TiAlN kaplamalı matkap kullanılarak yapılmıştır. Deneylerde ilerleme hızı 0,16 mm/dev, kesme hızı ise 36, 40, 44, 48 m/dak hızları kullanılmıştır. Çıkan sonuçlar doğrusal regresyon metodu ile modellenmiş ve polinom regresyon eğrisi eşitliği anlamlılık değerleri mukayese edilmiştir. Aynı zamanda varyans analizi yapılarak kesme hızı ve matkap tipinin eksenel ilerleme kuvveti, kesme momenti, yüzey pürüzlülüğü ölçü tamlığı ve dairesellikten sapma değeri sonuçları üzerine etkileri incelenmiştir.
Pooled eurooplased annavad euroliidule skeptilise hinnangu / Kaivo Kopli
Kopli, Kaivo
2006-01-01
Ligi 25 000 inimest hõlmanud Eurobaromeetri uuringu "Euroopa tulevik" kohaselt arvab vaid 39%, et EL liigub õiges suunas, vaid 29% lätlastest peab EL-i kuulumist heaks. Lisa: Eestlased: EL-i suund on õige
Viimase hetke kokkulepe päästis WTO tippkohtumise / Heiki Suurkask
Suurkask, Heiki, 1972-
2005-01-01
Kuigi EL-i eelarvekõnelustel Brüsselis jäeti ühine põllumajanduspoliitika puutumata, sunnib WTO tippkohtumisel Hongkongis saavutatud lepe 2013. aastast alates EL-i põllumajanduse toetamist revideerima. Lisa: Politsei vahistas 900 meeleavaldajat
Ettevõtja saab raha ka otse Brüsselist / Silva Männik
Männik, Silva, 1974-
2004-01-01
Lisaks mitmetele Eesti asutustele, mis alates sellest aastast EL-i struktuurifondide kaudu raha jagama hakkavad, on ettevõtjatel võimalik taotleda erinevate programmide kaudu raha ka otse EL-i eelarvest. Lisa: Otse saab raha taotleda mitmest programmist
NCBI nr-aa BLAST: CBRC-ACAR-01-0089 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0089 ref|YP_459771.1| hypothetical protein ELI_14410 [Erythrobacter litoral...is HTCC2594] gb|ABC64974.1| hypothetical protein ELI_14410 [Erythrobacter litoralis HTCC2594] YP_459771.1 4.4 24% ...
NCBI nr-aa BLAST: CBRC-CPOR-01-1878 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CPOR-01-1878 ref|YP_459668.1| hypothetical protein ELI_13895 [Erythrobacter litoral...is HTCC2594] gb|ABC64871.1| hypothetical protein ELI_13895 [Erythrobacter litoralis HTCC2594] YP_459668.1 4.8 29% ...
Ainult 1%-meestest ei ole erektsioonihäire ravitav
2004-01-01
Erektsioonihäirete põhjustest, seotud haigustest ja ravimeetoditest rääkisid ravimifirma Eli Lilly korraldatud loengupäeval uroloog Margus Punab, kardioloog Arvo Rosenthal, psühhiaater Imre Rammul ja Eli Lilly turundusjuht Katrin Lätt
Plaiss, Adam
In present-day debates regarding telecommunication policy, one frequently hears the terms natural monopoly and public utility. This article investigates the origins of these ideas, finding that Richard T. Ely-a celebrated American economist of the late nineteenth century-embedded in the term "natural monopoly" a narrative of technological determinism. By arguing that certain services had monopolizing tendencies hardwired into them, Ely argued for their regulation. Ely's theory of natural monopoly formed the basis of Wisconsin's 1907 public utilities law, which served as a model for many other states' regulatory policies. The modern notion of public utility thus carries with it the technological determinism of Ely's natural monopoly idea. By tracing the lineage of these two terms, this article recaptures the influence that activists and progressive politicians exercised over the formation of large technological systems during the Second Industrial Revolution.
Silvio Berlusconi kosib Juhan Partsi pimedast peast / Kaarel Tarand
Tarand, Kaarel, 1966-
2003-01-01
EL-i eesistujamaa Itaalia ei esitanud tähtajaks kompromissettepanekuid EL-i uue põhiseaduse kohta, mis seab keerulisse olukorda Itaalia peaministriga kohtuva Eesti peaministri Juhan Partsi. Euroopas kritiseeritakse Itaalia kui eesistujamaa tegevust. Lisa: Eesti viis olulist nõudmist
Euroliidu laienemine suunab logistikafirmad koostööle / Rivo Sarapik
Sarapik, Rivo, 1981-
2004-01-01
Ilmunud ka: Delovõje Vedomosti 28. juuli lk. 15. Autor refereerib logistikaajakirjas Logistics Business Magazine ilmunud artiklit, milles analüütikud ja firmajuhid prognoosivad EL-i laienemisega kaasnevaid võimalikke arenguid logistikavaldkonnas. Lisa: Muutused logistikas seoses ELi laienemisega
Zdorovje - nash ressurss / Anna Litvinjuk
Litvinjuk, Anna
2005-01-01
Ülemaailmse Tervishoiuorganisatsiooni (WHO) andmetel on keskmine eluiga Eestis tunduvalt lühem kui teistes EL-i riikides. Samuti on Eesti elanike tervis võrreldes teiste EL-i riikide elanike tervisega tunduvalt halvem. WHO toetusel toimunud tervisefoorumist Eestis. Diagramm
Europarlament ihkab enam tähelepanu / Inga Höglund
Höglund, Inga
2010-01-01
Euroopa Parlament korraldas EL-i institutsioonide ja meedia seminari, et leida lahendust probleemile, kuidas suurendada inimeste ja meedia huvi EL-i, Euroopa Parlamendi tegemiste vastu. Parlamendi liikmete Morten Løkkegaardi, Thijs Bermani arvamusi ja ettepanekuid. Parlamendi presidendi Jerzy Buzeki seisukoht
John Kjaer : Nõukogude Liitu ja euroliitu seob vaid sõna "liit" / John Kjaer ; interv. Tuuli Koch
Kjaer, John
2003-01-01
Euroopa Komisjoni delegatsiooni juht Eestis John Kjaer vastab küsimustele, mis puudutavad Edgar Savisaare kõnet Keskerakonna kongressil, kus ta võrdles NSV Liitu Euroopa Liiduga; peamisi erinevusi EL-i ja totalitaarriigi vahel, otsuste langetamise põhimõtteid EL-is
Rebenev Euroopa / Petra Pinzler
Pinzler, Petra
2005-01-01
Ajalehe Die Zeit korrespondendi sõnul ei ole EL-i kodanikud mitte kunagi varem olnud EL-i suhtes nii tõrjuvad kui praegu, hävitavalt mõjub ühise identiteedi puudumine, paljudele ei meeldi suund, mille Euroopa on võtnud
78 FR 44432 - New Animal Drugs; Change of Sponsor; Fentanyl; Iron Injection
2013-07-24
... for an NADA from Nexcyon Pharmaceuticals, Inc. to Elanco Animal Health, A Division of Eli Lilly & Co..., NADA 141-337 for RECUVYRA (fentanyl) Transdermal Solution to Elanco Animal Health, A Division of Eli Lilly & Co., Lilly Corporate Center, [[Page 44433
Organ, James
2017-01-01
Avalikkuse põhimõttest, läbipaistvusest ja kodanike võimalusest ELi välissuhete poliitika kujundamisel osaleda ELi ja Ameerika Ühendriikide vahelise Atlandi-ülese kaubandus- ja investeerimispartnerluse (TTIP) läbirääkimisprotsessi näitel
The SITE Program funded a field demonstration to evaluate the Eco Logic Gas-Phase Chemical Reduction Process developed by ELI Eco Logic International Inc. (ELI), Ontario, Canada. The Demonstration took place at the Middleground Landfill in Bay City, Michigan using landfill wa...
JeS - dengi k dengam / Algirdas Brazauskas ; interv. Ilja Nikiforov
Brazauskas, Algirdas, 1932-2010
2005-01-01
Leedu peaministri sõnul ei ole nüüd, kui EL-is hakati valmistuma uueks finantsperioodiks, tunda euroliidu humanitaarseid ideid aidata alliansi riike sõltuvalt nende arengutasemest, ei ole tunda eelkõige EL-i vanade riikide tähelepanu ega solidaarsusidee realiseerumist
Prantsusmaa on kõigest üks riik, leiavad eurosotsid / Priit Simson
Simson Priit, 1977-
2005-01-01
Euroopa Parlamendi sotsialistide juht Martin Schultz on seisukohal, et EL-i põhiseadusleping ei ole Prantsusmaal toimunud referendumi tõttu läbikukkunud, ning soovitab ära oodata leppe heakskiitmise teistes EL-i riikides. Euroopa Parlamendi sotsialistide väljasõiduistungist Tallinnas
The Baltics - the fastest developing region of the European Union / Lembo Tanning
Tanning, Lembo
2005-01-01
Baltimaad kui kiiremini areneva majandusega riigid EL-is. Eesti, Läti, Leedu majandusnäitajate analüüs. Tabelid, graafikud, diagrammid sisemajanduse kogutoodangu, töötuse, tööhõive, palkade ja hindade kohta Baltimaades ning teistes EL-i riikides
Euroopa Liidu ja tema kandidaatriikide majanduse areng / Lembo Tanning
Tanning, Lembo
2000-01-01
Diagrammid ja tabelid: SKP aastane juurdekasv 1983-2001 USA-s ja EL-is; EUR-11 ja EL-15 kvartaalne SKP juurdekasv; EL-i kandidaatriikide SKP juurdekasv 1995-1999; kandidaatriikide SKP osakaal; SKP inimese kohta 1999.a.; SKP kvartaalne juurdekasv %-des 1999 ja 2000
Euroopa liidu kandiaatriikide võtmearvude võrdlev analüüs / Lembo Tanning
Tanning, Lembo
2000-01-01
Euroopa Liidu kandidaatriikide majandusnäitajad: SKP; tööstuse ja ehituse, teeninduse, põllumajanduse osakaal kogu lisandväärtusest, ELi osakaal koguimpordist ja -ekspordist; ELi otseinvesteeringute seis 1997.a. lõpus. Ilmunud ka: Buhgalterskije Novosti n. 2 lk. 38-43
The Great War and German Memory
DEFF Research Database (Denmark)
Leese, Peter
2012-01-01
Review essay on Jason Crouthamel, The Great War and German Memory. Society, Politics and Psychological Trauma, 1914-18 (2009) and Anton Kaes, Shell Shock Cinema: Weimar Culture and the Wounds of War (2009)......Review essay on Jason Crouthamel, The Great War and German Memory. Society, Politics and Psychological Trauma, 1914-18 (2009) and Anton Kaes, Shell Shock Cinema: Weimar Culture and the Wounds of War (2009)...
2016-03-01
Oaks, CA: Sage, 2001), 2. 30 Donaldson, “The Contingency Theory of Organizational Design,” 22. 18 theory emphasizes the necessity of fit,31 but it...ORGANIZATIONAL FIT: APPLYING CONFIGURATION THEORY TO THE SNOHOMISH COUNTY (WA) EMERGENCY OPERATIONS CENTER by Jason M. Biermann March 2016...CONFIGURATION THEORY TO THE SNOHOMISH COUNTY (WA) EMERGENCY OPERATIONS CENTER 5. FUNDING NUMBERS 6. AUTHOR(S) Jason M. Biermann 7. PERFORMING
Pilc, Andrzej
2003-01-01
Lilly is developing LY-354740, the lead compound in a series of derivatives of the metabotropic glutamate receptor group II agonist L-CCG-1, for the potential treatment of anxiety [212536], [276941], [276942].
Pitsikas, N
2000-09-01
Lilly is developing duloxetine, a 5-HT and norepinephrine uptake inhibitor as a potential treatment for depression and urinary incontinence. In Japan, it is being jointly developed with Shionogi [187401]. Phase III trials for depression and phase II trials for urinary incontinence are underway in Japan [296442,328887]. Lilly expects to file for depression in 2002 and phase III trials for urinary incontinence are planned to start enrollment by the end of 2000 [358429,370526,373870]. Duloxetine has a half-life of 10 to 15 h in humans, and parameters reach a steady-state after 3 days of daily administration. In a 6-week, open-label study duloxetine was safe and well tolerated in 79 clinically depressed patients. Clinical response occurred in 78% of patients, and remission occurred in 60%. Insomnia and nausea occurred with an incidence of 20% [300881]. Duloxetine may offer advantages over existing antidepressants, such as Lilly's fluoxetine, because of faster recovery and fewer side effects [190226]. In June 2000, Morgan Stanley Dean Witter predicted duloxetine would reach the market in 2002 with annual sales in this year of US $50 million, rising to $200 million in 2005 [373870]. In February 1999, Deutsche Bank predicted Lilly's sales at US $200 million in 2002 rising to $400 million in 2003 [316821]. In May 2000, Deutsche Bank had made further predictions, stating that filing for duloxetine is expected in the fourth quarter of 2001, and peak sales are expected to exceed US $500 million. Also in February 1999, Lehman Brothers predicted the first major launch date (US and ex-US) to be 2002, with the year of peak sales to be 2008 [319225]. In August 1999, this prediction changed, and the expected launch date became 2001, with an 80% probability of reaching the market and sales peaking at US $150 million in 2012 [349228].
Saksamaa : türgi ärimeeste optimism / Carter Dougherty ; tõlk. Erik Aru
Dougherty, Carter
2006-01-01
Saksamaa türklastest ärimeeste hinnangul suureneb kaubavahetus Türgiga ja sinna investeerimine, kui Türgi peab läbirääkimisi EL-i liikmeks saamiseks. Saksamaal on 60% elanikest vastu Türgi liitumisele EL-iga. Türgi ja EL-i kaubavahetuse suurenemisest
Kak vernut flot pod Estonskii flag? / Leidur Rannamets
Rannamets, Leidur
2007-01-01
EL-is kasvab konkurents reisilaevaliinidel. Autori sõnul kinnitavad spetsialistid, et Eesti on ainus riik EL-is, mis ei kasuta õigust võimaldada oma laevakompaniidele riiklikku subsiidiumi. Laevaomanike hinnangul on 30 miljonit krooni, mis leiti lisaeelarvest laevanduse arendamiseks, vaid 10% vajalikust summast. Laevaomanike liidu seisukohtadest
Hollandi euroministri meelest peab EL kõnelema ühel häälel / Atzo Nicolai ; interv. Erkki Bahovski
Nicolai, Atzo
2004-01-01
Eestis viibinud Hollandi Euroopa asjade minister toetab Euroopa Liidu ühehäälset kõnelemist Venemaaga, et ta laiendaks partnerlus- ja koostöölepingut EL-i uutele liikmesriikidele. EL-i põhiseaduslikust leppest, stabiilsuspakti järgimisest, suhtumisest Türgi liitumisse EL-iga
Rauno Pukonen : Turule tulevad vaid oma klassi parimad rohud / Rauno Pukonen ; interv. Vilve Torn
Pukonen, Rauno
2006-01-01
Rahvusvahelise Ravimitootjate Liidu juhatuse esimees ja Eli Lilly Balti regiooni direktor vastab küsimustele, mis puudutavad innovatiivsusest ja kvaliteedist lähtumise põhimõtet ravimitootmises, ravimihindade teket, firma 70 miljoni dollari suurust toetust tuberkuloosiprogrammile, firma tulevikku. Lisad: Eli Lilly & Co 130; Ajalugu
Euroopa eelarvet võiks täita ühtne maks / Daniel Gros, Stefano Micossi
Gros, Daniel
2005-01-01
Ilmunud ka: Delovõje Vedomosti 30. märts lk. 6. Autorite arvates oleks EL-i eelarve parim lahendus umbes 2-protsendiline käibemaksumäära tõus kogu Euroopa Liidus, mis kataks kõik vajadused. Diagramm: EL-i eelarvest laekub lõviosa SKP alusel
75 FR 9333 - Implantation or Injectable Dosage Form New Animal Drugs; Tilmicosin
2010-03-02
... (NADA) filed by Elanco Animal Health, A Division of Eli Lilly & Co. The supplemental NADA provides a...: [email protected] . SUPPLEMENTARY INFORMATION: Elanco Animal Health, A Division of Eli Lilly & Co., Lilly Corporate Center, Indianapolis, IN 46285, filed a supplement to NADA 140-929 for MICOTIL...
Briti peaminister Tony Blair tuleb hiiobisõnumiga / Andris Feldmanis, Märt Kivine
Feldmanis, Andris, 1982-
2005-01-01
Eestisse visiidile saabuv Suurbritannia peaminister Tony Blair soovib toetust EL-i eelarveprojektile, mis säilitaks Suurbritannia tagasimakse EL-i eelarvest ning vähendaks uute liikmesriikide toetusi. Kommenteerib Andrus Ansip. Vt. samas intervjuud Toomas Hendrik Ilvesega; Märt Kivine. Vajalik täpsustus: saagem mandri-eurooplasteks!
Eestlane on Euroopas sage koju tagasi tulija / Urmas Jaagant
Jaagant, Urmas
2011-01-01
Sisekaitseakadeemia Euroopa rändevõrgustiku analüüsi kohaselt on Eesti nende kolme EL-i riigi seas, mille kodanikud enim tagasi pöörduvad. EL-i liikmesriikides suurenes 2008. a. väljaränne 13%. Eestisse sisserändajatest on ligi pooled Eesti kodanikud
Euroopa muutunud vaated laienemisele / Jeroen Bult
Bult, Jeroen
2006-01-01
Vt. ka Postimees : na russkom jazõke 5. okt. lk. 7. Bulgaaria ja Rumeenia liitumisse EL-iga ei suhtuta Euroopa Liidus väga positiivselt, arvab autor. Euroopa Komisjon püüab edasist EL-i laienemist vältida, kuid EL-i tegelikuks probleemiks on autoriteetide puudumine
2012-08-06
... Pharmaceutica NV, to Elanco Animal Health, a Division of Eli Lilly & Co. FDA is also amending the animal drug..., polymyxin B sulfate, prednisolone acetate) Otic Suspension to Elanco Animal Health, a Division of Eli Lilly & Co., Lilly Corporate Center, Indianapolis, IN 46285. Following these changes of sponsorship, Janssen...
Eesti Euroopas ja Euroopa Eestis / Ramon Loik
Loik, Ramon
2005-01-01
Autor annab ülevaate, milliseid uudiseid on välisajakirjandus Eesti kohta avaldanud, millised on lähiaastatel EL-i ees seisvad probleemid, kuhu läheb lõviosa EL-i maksumaksja rahast. Autori sõnul on Eesti sattunud nn. musta nimekirja Euroopa sotsiaalharta rikkumise pärast
Euroopa tulevik : liit või föderaalriik? / Paavo Palk
Palk, Paavo, 1968-
2002-01-01
Autor analüüsib 2002. aasta veebruaris Brüsselis kokku tulnud EL-i Tuleviku Konvendis toimuvat tulevikudebatti kolmest peamisest aspektist - liikmesriikide mõju suurendamine liidu arvelt või vastupidi, EL-i institutsioonide vahelise jõuvahekorra muutmine, teatud liikmesriikide võimaluste suurendamine või vähendamine. Tabel.
Koike, Mari; Greer, Preston; Owen, Kelly; Lilly, Guo; Murr, Lawrence E.; Gaytan, Sara M.; Martinez, Edwin; Okabe, Toru
2011-01-01
This study characterized properties of Ti-6Al-4V ELI (extra low interstitial, ASTM grade 23) specimens fabricated by a laser beam melting (LBM) and an electron beam melting (EBM) system for dental applications. Titanium alloy specimens were made into required size and shape for each standard test using fabrication methods. The LBM specimens were made by an LBM machine utilizing 20 µm of Ti-6Al-4V ELI powder. Ti-6Al-4V ELI specimens were also fabricated by an EBM using 40 µm of Ti-6Al-4V ELI powder (average diameter, 40 µm: Arcam AB®) in a vacuum. As a control, cast Ti-6Al-4V ELI specimens (Cast) were made using a centrifugal casting machine in an MgO-based mold. Also, a wrought form of Ti-6Al-4V ELI (Wrought) was used as a control. The mechanical properties, corrosion properties and grindability (wear properties) were evaluated and data was analyzed using ANOVA and a non-parametric method (α = 0.05). The strength of the LBM and wrought specimens were similar, whereas the EBM specimens were slightly lower than those two specimens. The hardness of both the LBM and EBM specimens was similar and slightly higher than that of the cast and wrought alloys. For the higher grindability speed at 1,250 m/min, the volume loss of Ti64 LBM and EBM showed no significant differences among all the fabrication methods. LBM and EBM exhibited favorable results in fabricating dental appliances with excellent properties as found for specimens made by other fabricating methods. PMID:28824107
Koike, Mari; Greer, Preston; Owen, Kelly; Lilly, Guo; Murr, Lawrence E; Gaytan, Sara M; Martinez, Edwin; Okabe, Toru
2011-10-10
This study characterized properties of Ti-6Al-4V ELI (extra low interstitial, ASTM grade 23) specimens fabricated by a laser beam melting (LBM) and an electron beam melting (EBM) system for dental applications. Titanium alloy specimens were made into required size and shape for each standard test using fabrication methods. The LBM specimens were made by an LBM machine utilizing 20 µm of Ti-6Al-4V ELI powder. Ti-6Al-4V ELI specimens were also fabricated by an EBM using 40 µm of Ti-6Al-4V ELI powder (average diameter, 40 µm: Arcam AB Ò ) in a vacuum. As a control, cast Ti-6Al-4V ELI specimens (Cast) were made using a centrifugal casting machine in an MgO-based mold. Also, a wrought form of Ti-6Al-4V ELI (Wrought) was used as a control. The mechanical properties, corrosion properties and grindability (wear properties) were evaluated and data was analyzed using ANOVA and a non-parametric method (α = 0.05). The strength of the LBM and wrought specimens were similar, whereas the EBM specimens were slightly lower than those two specimens. The hardness of both the LBM and EBM specimens was similar and slightly higher than that of the cast and wrought alloys. For the higher grindability speed at 1,250 m/min, the volume loss of Ti64 LBM and EBM showed no significant differences among all the fabrication methods. LBM and EBM exhibited favorable results in fabricating dental appliances with excellent properties as found for specimens made by other fabricating methods.
Directory of Open Access Journals (Sweden)
Toru Okabe
2011-10-01
Full Text Available This study characterized properties of Ti-6Al-4V ELI (extra low interstitial, ASTM grade 23 specimens fabricated by a laser beam melting (LBM and an electron beam melting (EBM system for dental applications. Titanium alloy specimens were made into required size and shape for each standard test using fabrication methods. The LBM specimens were made by an LBM machine utilizing 20 µm of Ti-6Al-4V ELI powder. Ti-6Al-4V ELI specimens were also fabricated by an EBM using 40 µm of Ti-6Al-4V ELI powder (average diameter, 40 µm: Arcam ABÒ in a vacuum. As a control, cast Ti-6Al-4V ELI specimens (Cast were made using a centrifugal casting machine in an MgO-based mold. Also, a wrought form of Ti-6Al-4V ELI (Wrought was used as a control. The mechanical properties, corrosion properties and grindability (wear properties were evaluated and data was analyzed using ANOVA and a non-parametric method (α = 0.05. The strength of the LBM and wrought specimens were similar, whereas the EBM specimens were slightly lower than those two specimens. The hardness of both the LBM and EBM specimens was similar and slightly higher than that of the cast and wrought alloys. For the higher grindability speed at 1,250 m/min, the volume loss of Ti64 LBM and EBM showed no significant differences among all the fabrication methods. LBM and EBM exhibited favorable results in fabricating dental appliances with excellent properties as found for specimens made by other fabricating methods.
Kõhklev Holland ootab riiki võõrtööliste horde / Aire Wilbrink
Wilbrink, Aire
2004-01-01
Hollandi valitsus otsustas kehtestada võõrtööliste maksimummäära. Esimesel kahel aastal pärast EL-i laienemist on uutest EL-i liikmesriikidest Hollandisse oodatud 20000-30000 võõrtöölist. Vt. samas: Maailmas oli mullu ilma tööta 186 miljonit inimest
Otto von Habsburg : III maailmasõda on läbi / Otto von Habsburg ; interv. Marianne Mikko
Habsburg, Otto von, 1912-2011
2002-01-01
Otto von Habsburg vastab küsimustele, mis puudutavad Euroopa konvendi presidendi teadet, et Türgi koht ei ole EL-is, Iraagi võimalikku ründamist, Hiina ja Venemaa suhteid, Tšetšeeniat, tshetsheene ja terrorismi, Venemaa, EL-i ja USA suhteid, III maailmasõda, Eesti Vabariigi tulevikku
International Nuclear Information System (INIS)
Levinsky, H.B.; Van Rij, M.L.D.
2011-01-01
By request of various market parties (suppliers and users of natural gas), the Dutch Ministry of Economic Affairs, Agriculture and Innovation (ELI) took a leading role in anticipating the future changes in gas quality. ELI requested an inventory of the consequences of variations in natural gas quality for end users. [nl
Liitumisjärgsed muutused majanduskeskkonnas : [eurointegratsioonist] / Urve Valdmaa, Ants Laansalu
Valdmaa, Urve
2005-01-01
Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 66-67. 2004. a maksti Eesti põllumajandustootjatele EL-i eelarvest 25% EL-i otsetoetuste tasemest, liikmesriigil oli võimalus täiendavalt juurde maksta kuni 55% tasemini. Tabel: 2004. a rakendatud toetused ja rahastamisallikad
Syracuse University English Language Institute: Business Communication for Executives
de Berly, Geraldine; McGraw, Deborah
2010-01-01
The Syracuse University English Language Institute (ELI), housed within University College, has been offering noncredit executive English courses on a contract basis for the past 12 years. Despite its small size and limited resources, the ELI, whose main mission is to prepare international students for academic study, also manages a successful…
Three’s Company: The Efficacy of Third-Party Intervention in Support of Counterinsurgency
2009-10-26
counterinsurgency is an appreciation for the unique role of the third-party intervener. Because these studies primarily examine conflicts 2 Thomas X...insurgency as a novel “technology of military conflict.”5 In a related study, Jason Lyall and Isaiah Wilson study conflict outcome and insurgencies...D. Fearon and David D. Laitin, "Ethnicity, Insurgency, and Civil War," 75 6 Jason Lyall and Isaiah Wilson, "Rage Against the Machines: Explaining
Directory of Open Access Journals (Sweden)
Montgomery W
2012-02-01
Full Text Available William Montgomery1, Tamas Treuer2, Jamie Karagianis3, Haya Ascher-Svanum4, Gavan Harrison51Global Health Outcomes, Eli Lilly and Company, Sydney, Australia; 2Emerging Markets Business Unit (Neuroscience, Eli Lilly and Company, Budapest, Hungary; 3Eli Lilly and Company, Indianapolis, IN, USA; 4Global Health Outcomes, Eli Lilly and Company, Indianapolis, IN, USA; 5Asia-Pacific Medical Communications, Eli Lilly and Company, Sydney, AustraliaAbstract: Orally disintegrating olanzapine (ODO is a rapid-dissolving formulation of olanzapine which disintegrates in saliva almost immediately, developed as a convenient and adherence-enhancing alternative to the standard olanzapine-coated tablet (SOT. Clinical studies, which form the basis of this review, have shown ODO and SOT to have similar efficacy and tolerability profiles. However, ODO appears to have a number of advantages over SOT in terms of adherence, patient preference, and reduction in nursing burden. Overall, the existing clinical data suggests that compared to SOT, ODO is not only well-suited for difficult-to-treat, agitated, and/or nonadherent patients but, due to its potential ability to improve adherence and greater patient preference, may also be an appropriate formulation for the majority of patients for which olanzapine is the antipsychotic of choice.Keywords: orodispersible formulation, orally disintegrating, olanzapine, atypical antipsychotics, patient adherence, preference, schizophrenia, bipolar disorder
The reliability of the Extra Load Index as a measure of relative load carriage economy.
Hudson, Sean; Cooke, Carlton; Lloyd, Ray
2017-09-01
The aim of this study was to measure the reliability of the extra load index (ELI) as a method for assessing relative load carriage economy. Seventeen volunteers (12 males, 5 females) performed walking trials at 3 km·h -1 , 6 km·h -1 and a self-selected speed. Trial conditions were repeated 7 days later to assess test-retest reliability. Trials involved four 4-minute periods of walking, each separated by 5 min of rest. The initial stage was performed unloaded followed in a randomised order by a second unloaded period and walking with backpacks of 7 and 20 kg. Results show ELI values did not differ significantly between trials for any of the speeds (p = 0.46) with either of the additional loads (p = 0.297). The systematic bias, limits of agreement and coefficients of variation were small in all trial conditions. We conclude the ELI appears to be a reliable measure of relative load carriage economy. Practitioner Summary: This paper demonstrates that the ELI is a reliable measure of load carriage economy at a range of walking speeds with both a light and heavy load. The ELI, therefore, represents a useful tool for comparing the relative economy associated with different load carriage systems.
Pamjat o Holokoste - vazhnaja tshast identitshnosti jevreiskogo gossudarstva / Erkki Bahovski
Bahovski, Erkki, 1970-
2008-01-01
Iisraeli välisministeeriumi nõunik Gil Artzyeli arvab, et pronkssõduri teisaldamine on Eesti asi, kuid ei nõustu kommunismi ja natsismi võrdsustamisega. Arvamusi EL-i laienemisest ning Iisraeli ja EL-i suhetest. 1. mai tähistamisest holokausti mälestamise päevana ja Yad Vashemi muuseumist Jeruusalemmas
Catherine Ashton avas naistele ukse / Siiri Oviir
Oviir, Siiri, 1947-
2009-01-01
Europarlamendi saadik Siiri Oviir peab Catherine Ashtoni EL-i välisministriks valimist suureks sammuks soolise võrdõiguslikkuse ja tasakaalustatuse poole. Samas taunib ta EL tippjuhtide valimist kinnises ringis, kuna otsuste kehv läbipaistvus ei soodusta liikmesriikide ja nende kodanike aktiivsuse kasvu ning nad ei tunne end piisavalt seotud ELi institutsioonidega
Impact of ITRS 2014 realizations on altimeter satellite precise orbit determination
Zelensky, Nikita P.; Lemoine, Frank G.; Beckley, Brian D.; Chinn, Douglas S.; Pavlis, Despina E.
2018-01-01
This paper evaluates orbit accuracy and systematic error for altimeter satellite precise orbit determination on TOPEX, Jason-1, Jason-2 and Jason-3 by comparing the use of four SLR/DORIS station complements from the International Terrestrial Reference System (ITRS) 2014 realizations with those based on ITRF2008. The new Terrestrial Reference Frame 2014 (TRF2014) station complements include ITRS realizations from the Institut National de l'Information Géographique et Forestière (IGN) ITRF2014, the Jet Propulsion Laboratory (JPL) JTRF2014, the Deutsche Geodätisches Forschungsinstitut (DGFI) DTRF2014, and the DORIS extension to ITRF2014 for Precise Orbit Determination, DPOD2014. The largest source of error stems from ITRF2008 station position extrapolation past the 2009 solution end time. The TRF2014 SLR/DORIS complement impact on the ITRF2008 orbit is only 1-2 mm RMS radial difference between 1992-2009, and increases after 2009, up to 5 mm RMS radial difference in 2016. Residual analysis shows that station position extrapolation error past the solution span becomes evident even after two years, and will contribute to about 3-4 mm radial orbit error after seven years. Crossover data show the DTRF2014 orbits are the most accurate for the TOPEX and Jason-2 test periods, and the JTRF2014 orbits for the Jason-1 period. However for the 2016 Jason-3 test period only the DPOD2014-based orbits show a strong and statistically significant margin of improvement. The positive results with DTRF2014 suggest the new approach to correct station positions or normal equations for non-tidal loading before combination is beneficial. We did not find any compelling POD advantage in using non-linear over linear station velocity models in our SLR & DORIS orbit tests on the Jason satellites. The JTRF2014 proof-of-concept ITRS realization demonstrates the need for improved SLR+DORIS orbit centering when compared to the Ries (2013) CM annual model. Orbit centering error is seen as an annual
Improvement of global and regional mean sea level derived from satellite altimetry multi missions
Ablain, M.; Faugere, Y.; Larnicol, G.; Picot, N.; Cazenave, A.; Benveniste, J.
2012-04-01
With the satellite altimetry missions, the global mean sea level (GMSL) has been calculated on a continual basis since January 1993. 'Verification' phases, during which the satellites follow each other in close succession (Topex/Poseidon--Jason-1, then Jason-1--Jason-2), help to link up these different missions by precisely determining any bias between them. Envisat, ERS-1 and ERS-2 are also used, after being adjusted on these reference missions, in order to compute Mean Sea Level at high latitudes (higher than 66°N and S), and also to improve spatial resolution by combining all these missions together. The global mean sea level (MSL) deduced from TOPEX/Poseidon, Jason-1 and Jason-2 provide a global rate of 3.2 mm from 1993 to 2010 applying the post glacial rebound (MSL aviso website http://www.jason.oceanobs.com/msl). Besides, the regional sea level trends bring out an inhomogeneous repartition of the ocean elevation with local MSL slopes ranging from + 8 mm/yr to - 8 mm/year. A study published in 2009 [Ablain et al., 2009] has shown that the global MSL trend unceratainty was estimated at +/-0.6 mm/year with a confidence interval of 90%. The main sources of errors at global and regional scales are due to the orbit calculation and the wet troposphere correction. But others sea-level components have also a significant impact on the long-term stability of MSL as for instance the stability of instrumental parameters and the atmospheric corrections. Thanks to recent studies performed in the frame of the SALP project (supported by CNES) and Sea-level Climate Change Initiative project (supported by ESA), strong improvements have been provided for the estimation of the global and regional MSL trends. In this paper, we propose to describe them; they concern the orbit calculation thanks to new gravity fields, the atmospheric corrections thanks to ERA-interim reanalyses, the wet troposphere corrections thanks to the stability improvement, and also empirical corrections
*ORANUSI, NATHANIEL A.; OGUGBUE, JASON C.
African Journals Online (AJOL)
Anderson and. Ahdelgan, 1980; Cencict et al, 1987; Liu et al; 1989). An ideal organism for toxicity bioassay must be sensitive and convenient use. Williamson and. Johnson (1981) reported that Nitobacter is an ideal organism for assessing the ...
Jason: heavy-ion-driven inertial fusion
International Nuclear Information System (INIS)
Callan, C.G. Jr.; Dashen, R.F.; Garwin, R.L.; Muller, R.A.; Richter, B.; Rosenbluth, M.N.
1978-02-01
A few of the problems in heavy-ion-driven inertial-fusion systems are reviewed. Nothing was found within the scope of this study that would in principle bar such systems from delivering the energy and peak power required to ignite the fuel pellet. Indeed, ion-fusion seems to show great promise, but the conceptual design of ion-fusion systems is still in a primitive state. A great deal of work, mostly theoretical, remains to be done before proceeding with massive hardware development. Conclusions are given about the state of the work
The JASON Remotely Operated Vehicle System
1993-02-01
University of Rhode Island , Mote Marine Laboratory, the Harbor Branch Foundation, the Great Lake Studies Group at the University of Wisconsin, and the... Clipperton Fracture Zone to 120 N., Geo-Marine Letters. v. 8, p. 131-138. I 38. Haymon, R., Fornari, D., Edwards, M., Carbotte, S., Wright, D. and Macdonald...Science Library FRANCE University of Rhode Island Narragansett Bay Campus3 Narragansett, RI 02882 I I0272-101 REPORT DOCUMENTATIO RM N HI-33 2. 3
Revival of pure titanium for dynamically loaded porous implants using additive manufacturing
International Nuclear Information System (INIS)
Wauthle, Ruben; Ahmadi, Seyed Mohammad; Amin Yavari, Saber; Mulier, Michiel; Zadpoor, Amir Abbas; Weinans, Harrie; Van Humbeeck, Jan; Kruth, Jean-Pierre; Schrooten, Jan
2015-01-01
Additive manufacturing techniques are getting more and more established as reliable methods for producing porous metal implants thanks to the almost full geometrical and mechanical control of the designed porous biomaterial. Today, Ti6Al4V ELI is still the most widely used material for porous implants, and none or little interest goes to pure titanium for use in orthopedic or load-bearing implants. Given the special mechanical behavior of cellular structures and the material properties inherent to the additive manufacturing of metals, the aim of this study is to investigate the properties of selective laser melted pure unalloyed titanium porous structures. Therefore, the static and dynamic compressive properties of pure titanium structures are determined and compared to previously reported results for identical structures made from Ti6Al4V ELI and tantalum. The results show that porous Ti6Al4V ELI still remains the strongest material for statically loaded applications, whereas pure titanium has a mechanical behavior similar to tantalum and is the material of choice for cyclically loaded porous implants. These findings are considered to be important for future implant developments since it announces a potential revival of the use of pure titanium for additively manufactured porous implants. - Highlights: • The mechanical properties of CP Ti grade 1 porous structures are studied. • The results are compared with identical structures in Ti6Al4V ELI and tantalum. • Ti6Al4V ELI structures are about two times stronger under a static compressive load. • CP Ti structures deform continuously without fracture while loaded statically. • CP Ti structures have a higher fatigue life compared to Ti6Al4V ELI structures
Revival of pure titanium for dynamically loaded porous implants using additive manufacturing
Energy Technology Data Exchange (ETDEWEB)
Wauthle, Ruben, E-mail: ruben.wauthle@3dsystems.com [KU Leuven, Department of Mechanical Engineering, Section Production Engineering, Machine Design and Automation (PMA), Celestijnenlaan 300B, 3001 Leuven (Belgium); 3D Systems - LayerWise NV, Grauwmeer 14, 3001 Leuven (Belgium); Ahmadi, Seyed Mohammad; Amin Yavari, Saber [Faculty of Mechanical, Maritime, and Materials Engineering, Delft University of Technology (TU Delft), Mekelweg 2, 2628 CD, Delft (Netherlands); Mulier, Michiel [KU Leuven, Department of Orthopaedics, Weligerveld 1, 3212 Pellenberg (Belgium); Zadpoor, Amir Abbas [Faculty of Mechanical, Maritime, and Materials Engineering, Delft University of Technology (TU Delft), Mekelweg 2, 2628 CD, Delft (Netherlands); Weinans, Harrie [Faculty of Mechanical, Maritime, and Materials Engineering, Delft University of Technology (TU Delft), Mekelweg 2, 2628 CD, Delft (Netherlands); Department of Orthopedics & department of Rheumatology, UMC Utrecht, Heidelberglaan 100, 3584 CX, Utrecht (Netherlands); Van Humbeeck, Jan [KU Leuven, Department of Materials Engineering, Kasteelpark Arenberg 44, PB 2450, 3001 Leuven (Belgium); Kruth, Jean-Pierre [KU Leuven, Department of Mechanical Engineering, Section Production Engineering, Machine Design and Automation (PMA), Celestijnenlaan 300B, 3001 Leuven (Belgium); Schrooten, Jan [KU Leuven, Department of Materials Engineering, Kasteelpark Arenberg 44, PB 2450, 3001 Leuven (Belgium); KU Leuven, Prometheus, Division of Skeletal Tissue Engineering, PB 813, O& N1, Herestraat 49, 3000 Leuven (Belgium)
2015-09-01
Additive manufacturing techniques are getting more and more established as reliable methods for producing porous metal implants thanks to the almost full geometrical and mechanical control of the designed porous biomaterial. Today, Ti6Al4V ELI is still the most widely used material for porous implants, and none or little interest goes to pure titanium for use in orthopedic or load-bearing implants. Given the special mechanical behavior of cellular structures and the material properties inherent to the additive manufacturing of metals, the aim of this study is to investigate the properties of selective laser melted pure unalloyed titanium porous structures. Therefore, the static and dynamic compressive properties of pure titanium structures are determined and compared to previously reported results for identical structures made from Ti6Al4V ELI and tantalum. The results show that porous Ti6Al4V ELI still remains the strongest material for statically loaded applications, whereas pure titanium has a mechanical behavior similar to tantalum and is the material of choice for cyclically loaded porous implants. These findings are considered to be important for future implant developments since it announces a potential revival of the use of pure titanium for additively manufactured porous implants. - Highlights: • The mechanical properties of CP Ti grade 1 porous structures are studied. • The results are compared with identical structures in Ti6Al4V ELI and tantalum. • Ti6Al4V ELI structures are about two times stronger under a static compressive load. • CP Ti structures deform continuously without fracture while loaded statically. • CP Ti structures have a higher fatigue life compared to Ti6Al4V ELI structures.
Transport and dosimetric solutions for the ELIMED laser-driven beam line
Energy Technology Data Exchange (ETDEWEB)
Cirrone, G.A.P. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Romano, F. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Medical Physics School, University of Catania, Via S. Sofia 64 - 95125 Catania (Italy); Scuderi, V. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, Na Slovance 2, 182 21 Prague (Czech Republic); Amato, A. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Candiano, G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Medical Physics School, University of Catania, Via S. Sofia 64 - 95125 Catania (Italy); Cuttone, G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Giove, D. [INFN Sezione di Milano, Via Celoria 16, Milano (Italy); Korn, G.; Krasa, J. [Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, Na Slovance 2, 182 21 Prague (Czech Republic); Leanza, R. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Universitá degli Studi di Catania, Dipartimento di Fisica e Astronomia, Via S. Sofia 64, Catania (Italy); Manna, R. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Maggiore, M. [INFN-LNL, Viale dell' Universitá 2 - 35020 Legnaro (PD) (Italy); Marchese, V. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Margarone, D. [Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, Na Slovance 2, 182 21 Prague (Czech Republic); Milluzzo, G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Universitá degli Studi di Catania, Dipartimento di Fisica e Astronomia, Via S. Sofia 64, Catania (Italy); Petringa, G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Sabini, M.G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Azienda Ospedaliera Cannizzaro, Via Messina 829 - 95100 Catania (Italy); Schillaci, F. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Medical Physics School, University of Catania, Via S. Sofia 64 - 95125 Catania (Italy); and others
2015-10-01
Within 2017, the ELIMED (ELI-Beamlines MEDical applications) transport beam-line and dosimetric systems for laser-generated beams will be installed at the ELI-Beamlines facility in Prague (CZ), inside the ELIMAIA (ELI Multidisciplinary Applications of laser–Ion Acceleration) interaction room. The beam-line will be composed of two sections: one in vacuum, devoted to the collecting, focusing and energy selection of the primary beam and the second in air, where the ELIMED beam-line dosimetric devices will be located. This paper briefly describes the transport solutions that will be adopted together with the main dosimetric approaches. In particular, the description of an innovative Faraday Cup detector with its preliminary experimental tests will be reported.
Eesti toetab koos Euroopa Liiduga tsunamiohvreid
2005-01-01
Brüsselis toimunud EL-i välisministrite kohtumisest, kus arutati tsunamiohvrite abistamise tõhustamist. Eesti abist tsunamis kannatanutele. Välisminister Kristiina Ojulandi sõnul on vaja humanitaarkriisidele reageerimisel EL-i riikide tihedamat koostööd, juhtiv roll rahvusvaheliste humanitaar- ja päästeoperatsioonide koordineerimisel kolmandates riikides peab aga jääma ÜRO-le
Made, Vahur, 1971-2017
2008-01-01
Autor leiab Kosovo iseseisvumisega seoses, et on kujunemas uus rahvusvahelise poliitika arusaam, mille kohaselt sõltub iseseisvumise edukus eelkõige sellest, kes selle taga seisab. Kosovo iseseisvumine on tõenäoliselt edukas, sest seda toetab USA koos EL-i ja NATO-ga. Eesti-poolne Kosovo iseseisvuse tunnustamine tugevdab EL-i välispoliitilist üksmeelt
78 FR 49723 - Humboldt-Toiyabe National Forests; Ely Ranger District; Ely Westside Rangeland Project
2013-08-15
... Month (AUM) production for the Humboldt National Forest while improving the gap between existing and...: 1. Current Management Alternative: Continue current grazing management. 2. No Grazing Alternative... documents. (Authority: 40 CFR 1501.7 and 1508.22; Forest Service Handbook 1909.15, Section 21) Dated: August...
Assessment of short-term memory in Arabic speaking children with specific language impairment.
Kaddah, F A; Shoeib, R M; Mahmoud, H E
2010-12-15
Children with Specific Language Impairment (SLI) may have some kind of memory disorder that could increase their linguistic impairment. This study assessed the short-term memory skills in Arabic speaking children with either Expressive Language Impairment (ELI) or Receptive/Expressive Language Impairment (R/ELI) in comparison to controls in order to estimate the nature and extent of any specific deficits in these children that could explain the different prognostic results of language intervention. Eighteen children were included in each group. Receptive, expressive and total language quotients were calculated using the Arabic language test. Assessment of auditory and visual short-term memory was done using the Arabic version of the Illinois Test of Psycholinguistic Abilities. Both groups of SLI performed significantly lower linguistic abilities and poorer auditory and visual short-term memory in comparison to normal children. The R/ELI group presented an inferior performance than the ELI group in all measured parameters. Strong association was found between most tasks of auditory and visual short-term memory and linguistic abilities. The results of this study highlighted a specific degree of deficit of auditory and visual short-term memories in both groups of SLI. These deficits were more prominent in R/ELI group. Moreover, the strong association between the different auditory and visual short-term memories and language abilities in children with SLI must be taken into account when planning an intervention program for these children.
Air & Space Power Journal. Volume 28, Number 3, May-June 2014
2014-06-01
Lt Col Jason Evenson, Maj Cyn- thia Wittnam, Maj Jason Haufschild, Capt Joe Rice , Capt D. Jerred Cooper, Capt Holden Leute, Capt Hudson Graham, Jim...thesis, Naval Postgraduate School, March 2011), 17–38, http://www.dtic.mil/cgi-bin/GetTRDoc?AD=ADA 543725. 55. MSgt Louis A. Arana-Barradas, “ Black ...Samuels point out, Even with the best of intentions, it is common to make surface-level, of- ten cosmetic , changes in the hope of alleviating the problem
2016-05-19
NUMBER 6. AUTHOR(S) Jason W. Grimm , Karen Johnson 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION...ABSTRACT SAR 18. NUMBER OF PAGES 5 19a. NAME OF RESPONSIBLE PERSON Jason Grimm a. REPORT U b. ABSTRACT U c. THIS PAGE U 19b... Grimm Karen Johns For correspo Vista at Gra J Emerg Nu 0099-1767 Published b http://dx.do ■ ■ • ■SAINT LOUIS CENTER FOR SUSTAINMENT OF TRAUMA AND
Rubik’s cube, an original subject for a remarkable project
Caroline Duc
2012-01-01
Thanks to a Rubik's cube, young French students Florentin Delaine, Joseph Gennetay and Jason Loyau won a week-long visit to CERN at the European Union’s 2011 contest for young scientists (EUCYS). They spent 17 to 24 July exploring the Laboratory. Florentin Delaine, Joseph Gennetay and Jason Loyau at the CERN Control Centre. “It all started with a friend who was playing with a Rubik's cube. At our lycée, we had to choose a subject for a research project. We thought it would be fun to build a robot to solve the puzzle,” recounts Jason. Two years later, their entry in the internationally recognised EUCYS 2011 competition, for young scientists between 14 and 20 years, was a prizewinner. The CERN prize came after the three 19-20 year-olds had faced more than 130 participants from 37 countries, including 29 European countries, at the 23rd EUCYS contest, held in Helsinki in September 2011. The jury, composed of scientis...
Euroopa netomaksjad tallavad Lissaboni sihil / Krister Paris
Paris, Krister, 1977-
2005-01-01
Kuus EL-i nn. netomaksjat on seisukohal, et EL-i ühiste kulutuste määr ei tohiks ületada 1% SKT-st. Euroopa Komisjon ja Euroopa Parlament aga leiavad, et rahaeraldised peavad olema suuremad, muidu satub ohtu ühiste eesmärkide saavutamine. Graafik: Eelarve järjest kahanenud. Vt. samas: Rohkem Euroopat, aga vähem raha selle jaoks?
Baltic Sea oil spill may be inevitable / Linas Jegelevicius
Jegelevicius, Linas
2011-01-01
23.-24. märtsil Budapestis toimunud EL-i keskkonnanõukogu konverentsil märgiti, et Läänemere maad peavad olema võimalikuks naftareostuse tekkeks valmis ja räägiti ka Jaapanis juhtunud tuumakatastroofist. EL-i keskkonnavolinik Janez Potocnik leiab, et Valgevene peaks oma Leedu piiri lähedale plaanitava tuumaelektrijaama küsimuses ka Leedu huvidega arvestama
Britid võitlevad ELile väejuhatuse loomise ideega / Evelyn Kaldoja
Kaldoja, Evelyn, 1980-
2011-01-01
Nn Weimari kolmikusse kuuluvad Saksamaa, Prantsusmaa ja Poola tahavad rajada ELile oma sõjalise väejuhatuse, kuid Suurbritannia leiab, et see dubleeriks NATO struktuure ning eraldaks ELi ja NATO planeerimise üksteisest püsivalt. Suurbritannia suursaadiku Eestis Peter Carteri ja kaitseminister Mart Laari arvamusi. Poola eurosaadik räägib oma raportist "Finantskriisi mõju ELi liikmesriikide kaitsesektorile"
Euroopa Liidu liitumine inimõiguste ja põhivabaduste kaitse konventsiooniga / Andra Laurand
Laurand, Andra
2013-01-01
Põhiõiguste kaitsest Euroopa Liidus Lissaboni lepingu jõustumisest 1. dets. 2009. aastal kuni konventsiooniga liitumiseni. Põhiõiguste kaitse eri tasanditest (põhiõigused ELi üldpõhimõtetena, ELi põhiõiguste harta, Euroopa inimõiguste ja põhivabaduste kaitse konventsioon). Võimalikest probleemidest, mis Euroopa Liidu põhiõiguste kaitse süsteemil pärast liitumist ees seisavad
Nagle, W A; Soloff, B L; Moss, A J; Henle, K J
1990-08-01
Cultured Chinese hamster V79 fibroblast cells at the transition from logarithmic to stationary growth have been shown to undergo apoptosis (programmed cell death) after cold shock [B. L. Soloff, W. A. Nagle, A. J. Moss, Jr., K. J. Henle, and J. T. Crawford, Biochem. Biophys. Res. Commun. 145, 876-883 (1987)]. In this report, we show that about 95% of the cell population was susceptible to cold-induced apoptosis, and the amount of cell killing was dependent on the duration of hypothermia. Cells treated for 0-90 min at 0 degrees C exhibited an exponential survival curve with a D0 of 32 min; thus, even short exposures to the cold (e.g., 5 min) produced measurable cell killing. The cold-induced injury was not produced by freezing, because similar results were observed at 6 degrees C, and cell killing was not influenced by the cryoprotective agent dimethyl sulfoxide. Cold-induced apoptosis was inhibited by rewarming at 23 degrees C, compared to 37 degrees C, by inhibitors of macromolecular synthesis, such as cycloheximide, and by 0.8 mM zinc sulfate. The results suggest that apoptosis represents a new manifestation of cell injury after brief exposure to 0-6 degrees C hypothermia.
Chan, Kwai S.; Koike, Marie; Mason, Robert L.; Okabe, Toru
2013-02-01
Additive layer deposition techniques such as electron beam melting (EBM) and laser beam melting (LBM) have been utilized to fabricate rectangular plates of Ti-6Al-4V with extra low interstitial (ELI) contents. The layer-by-layer deposition techniques resulted in plates that have different surface finishes which can impact significantly on the fatigue life by providing potential sites for fatigue cracks to initiate. The fatigue life of Ti-6Al-4V ELI alloys fabricated by EBM and LBM deposition techniques was investigated by three-point testing of rectangular beams of as-fabricated and electro-discharge machined surfaces under stress-controlled conditions at 10 Hz until complete fracture. Fatigue life tests were also performed on rolled plates of Ti-6Al-4V ELI, regular Ti-6Al-4V, and CP Ti as controls. Fatigue surfaces were characterized by scanning electron microscopy to identify the crack initiation site in the various types of specimen surfaces. The fatigue life data were analyzed statistically using both analysis of variance techniques and the Kaplan-Meier survival analysis method with the Gehan-Breslow test. The results indicate that the LBM Ti-6Al-4V ELI material exhibits a longer fatigue life than the EBM counterpart and CP Ti, but a shorter fatigue life compared to rolled Ti-6Al-4V ELI. The difference in the fatigue life behavior may be largely attributed to the presence of rough surface features that act as fatigue crack initiation sites in the EBM material.
Maa, vabaduse eest / Eli Pilvre
Pilvre, Eli
2008-01-01
Maareformist Eestis pärast iseseisvuse saavutamist 1918. aastal. Maaküsimuse korraldamisest ja maaseaduse eeltöödest. Mõisate võõrandamine, riikliku maatagavara loomine, autasumaad. Mõisamaade riigistamise seadusest ning riigimaade planeerimisest ja väljajagamisest. Lisa: Riigi Teatajas ilmunud õigusaktid. Lk. 335
Gilron, I
2001-09-01
Lilly is developing the racemic compound LY-215490, a selective and competitive AMPA antagonist, as a potential treatment for cerebral infarction, cerebrovascular ischemia, epilepsy and as an analgesic [135089], [158980], [254029], [278691]. By January 2000, LY-293558 was undergoing phase II trials for pain [414000].
EL : Iiri "ei" Lissaboni lepingut ei surmanud / Kaivo Kopli
Kopli, Kaivo
2008-01-01
Iirlased hääletasid Lissaboni lepingu vastu. EL-i välisministrite nõupidamisel Luksemburgis ütles Iiri välisminister, et rahva tahet tuleb austada. Enamik EL-i riike soovib, et lepingu ratifitseeriksid ka need riigid, kes pole veel seda teinud, Tšehhi asepeaministri Alexander Vondra on seisukohal, et riikidele ei tohi survet avaldada. Vt. samas: Pariis süüdistab juba Brüsselit
Askel edellä : Opas toimintakyvyn muutosten ennakointiin ALS-diagnosoiduille ja heidän omaisilleen
Sorvali, Mari; Harju, Mira
2014-01-01
Amyotrofinen lateraaliskleroosi eli ALS on etenevä liikehermosoluja eli motoneuroneita rappeuttava neurologinen sairaus. Sairauden syytä ei tunneta, mutta tapauksista noin 5-10 prosenttia selittyy perinnöllisyydellä. ALS surkastuttaa tahdonalaisesti säädeltyjä lihaksia aiheuttaen jo varhaisessa vaiheessa merkittävän toimintakyvyn alenemisen. Lihasheikkous, lihaskouristukset, faskikulaatiot, spastisuus, sekä hengitys- ja nielemisvaikeudet luokitellaan ALS:n suoriksi oireiksi. Sairauden etenemi...
de Soria-Santacruz Pich, Maria; Jun, Insoo; Evans, Robin
2017-09-01
The empirical AP8/AE8 model has been the de facto Earth's radiation belts engineering reference for decades. The need from the community for a better model incubated the development of AP9/AE9/SPM, which addresses several shortcomings of the old model. We provide additional validation of AP9/AE9 by comparing in situ electron and proton data from Jason-2, Polar Orbiting Environmental Satellites (POES), and the Van Allen Probes spacecraft with the 5th, 50th, and 95th percentiles from AE9/AP9 and with the model outputs from AE8/AP8. The relatively short duration of Van Allen Probes and Jason-2 missions means that their measurements are most certainly the result of specific climatological conditions. In low Earth orbit (LEO), the Jason-2 proton flux is better reproduced by AP8 compared to AP9, while the POES electron data are well enveloped by AE9 5th and 95th percentiles. The shape of the South Atlantic anomaly (SAA) from Jason-2 data is better captured by AP9 compared to AP8, while the peak SAA flux is better reproduced by AP8. The <1.5 MeV inner belt electrons from Magnetic Electron Ion Spectrometer (MagEIS) are well enveloped by AE9 5th and 95th percentiles, while AE8 overpredicts the measurements. In the outer radiation belt, MagEIS and Relativistic Electron and Proton Telescope (REPT) electrons closely follow the median estimate from AE9, while AP9 5th and 95th percentiles generally envelope REPT proton measurements in the inner belt and slot regions. While AE9/AP9 offer the flexibility to specify the environment with different confidence levels, the dose and trapped proton peak flux for POES and Jason-2 trajectories from the AE9/AP9 50th percentile and above are larger than the estimates from the AE8/AP8 models.
The global mean sea surface model WHU2013
Directory of Open Access Journals (Sweden)
Taoyong Jin
2016-05-01
Full Text Available The mean sea surface (MSS model is an important reference for the study of charting datum and sea level change. A global MSS model named WHU2013, with 2′ × 2′ spatial resolution between 80°S and 84°N, is established in this paper by combining nearly 20 years of multi-satellite altimetric data that include Topex/Poseidon (T/P, Jason-1, Jason-2, ERS-2, ENVISAT and GFO Exact Repeat Mission (ERM data, ERS-1/168, Jason-1/C geodetic mission data and Cryosat-2 low resolution mode (LRM data. All the ERM data are adjusted by the collinear method to achieve the mean along-track sea surface height (SSH, and the combined dataset of T/P, Jason-1 and Jason-2 from 1993 to 2012 after collinear adjustment is used as the reference data. The sea level variations in the non-ERM data (geodetic mission data and LRM data are mainly investigated, and a combined method is proposed to correct the sea level variations between 66°S and 66°N by along-track sea level variation time series and beyond 66°S or 66°N by seasonal sea level variations. In the crossover adjustment between multi-altimetric data, a stepwise method is used to solve the problem of inconsistency in the reference data between the high and low latitude regions. The proposed model is compared with the CNES-CLS2011 and DTU13 MSS models, and the standard derivation (STD of the differences between the models is about 5 cm between 80°S and 84°N, less than 3 cm between 66°S and 66°N, and less than 4 cm in the China Sea and its adjacent sea. Furthermore, the three models exhibit a good agreement in the SSH differences and the along-track gradient of SSH following comparisons with satellite altimetry data.
Uute muusikamaailmade otsinguil / Märt-Matis Lill
Lill, Märt-Matis, 1975-
2005-01-01
IX PÖFFi filmide muusikast : "Dallas Pashamende", "Maa ja tuhk" ("Earth and Ashes"), "Tapmine" ("Manslaughter"), "Kooripoisid" ("Chorists, The"), "Maailma kõige kurvem muusika" ("Saddest Music in the World, The"), "Eli, eli lema sabachtani", "Skritek", "Maavärinate klaverihäälestaja" ("Piano Tuner of the Earthquakes", "Laulukütt Lomax" ("Lomax the Songhunter"), "Silda ületades. Istanbuli helid" ("Crossing the Bridge. The Sound of Istanbul"), "Karjuv meistriteos" ("Screaming Masterpiece")
The extreme light infrastructure. Missions and challenges
International Nuclear Information System (INIS)
Mourou, G.
2010-01-01
Complete text of publication follows. ELI will be the first facility in the world dedicated to laser-matter interaction at unprecedented intensity levels. It will be also the first large scale infrastructure based in the eastern part of the European Community. It will explore ultrafast phenomena in the attosecond-zeptosecond domain and will be the gateway of a new regime in laser-matter interaction: the ultra relativistic regime that could reach into Nonlinear Quantum Electrodynamics, where vacuum polarization and elementary particle from vacuum can be produced. ELI's scientific mission will be a holistic investigation of the structure of matter, from atoms to vacuum. If the laser revolutionized atomic physics during the first fifty years, ELI in the same way could revolutionize nuclear physics. At the same time, it will also promote new technologies such as Relativistic Microelectronic with the development of compact laser-accelerators delivering very high-energy particles that could reach the 100 GeV level and photon sources in the MeV regime. ELI will have a large societal benefit offering in medicine new radiography and hadron therapy methods. It will also considerably contribute to material science with the possibility to unravel and slow down the aging process in nuclear reactor and in the environment by offering new ways of identifying radioactive elements.
Eestlased rabelevad 52 miljardi krooni jagamise pärast / Erik Aru
Aru, Erik
2006-01-01
Eesti saab aastatel 2007-2013 EL-i struktuurifondidelt 52 miljardit krooni, rahandusministeerium koostab riiklikku struktuurivahendite kasutamise strateegiat. Res Publica esimees Taavi Veskimägi kavatseb esitada seaduseparanduse, mille kohaselt peaks struktuurivahendite strateegia kinnitama Riigikogu. Struktuurivahendite jagamine loob EAS-i juhataja Alar Kolgi sõnul Eestis seniolematu majandusharu: projektijuhtimissektori. Lisa: EL-i raha loob uue majandussektori. Vt. samas: Andrus Ansip, Valdo Kalm, Heido Vitsur, Leev Kuum ja Linnar Viik vastavad küsimusele, mis on innovatsioon
Tony Blair ei saanud Balti riikidelt loodetud järeleandmisi / Andris Feldmanis
Feldmanis, Andris, 1982-
2005-01-01
Balti riigid ei olnud nõus loobuma kümnendikust eurotoetustest. Tallinnas viibinud Suurbritannia peaministri Tony Blairi väitel on EL-i uue finantsperspektiivi vastuvõtmine just uute liikmesriikide huvides. Vt. samas: Tiiu Laks. Riigijuhi visiit põhjustas Tallinnas vaid lühiajalisi liiklusseisakuid; Lisa: Blairi esinemine ei reetnud ebaedu; Kaivo Kopli. Uusliikmed andsid tuld juba enne ettepanekute saamist; Lisa: Toetus vanadelt liikmesmaadelt; Märt Kivine. EL-i eelarve: lahjem kui kunagi varem. Kommenteerib Taavi Veskimägi
Comparison of the eLearning Solution at MUAF in Brno and Polytechnic University in Madrid
Directory of Open Access Journals (Sweden)
Tomáš Foltýnek
2006-01-01
Full Text Available The necessity of eLearning support of the university studies is setting up (or was setting up at the universities all over the world. This paper compares the eLearning technologies available at Mendel University in Brno (MUAF, Czech Republic, and Polytechnic University in Madrid (UPM, Spain, in the context of different conditions at both universities. The level of using of these technologies and practical experiences with them are evaluated too. In concrete this paper deals with the systems GATE (GAbinete de TeleEducación and AulaWeb, used at the UPM and system ELIS, used at MUAF. The fifteen-year experiences with development of eLearning at UPM are very valuable study material for the developers of the ELIS system. Some, especially conception properties of the ELIS system, can be, on the other hand, useful for inspiration vice versa.
Performance of two strategies for urgent ANCA and anti-GBM analysis in vasculitis.
de Joode, Anoek A E; Roozendaal, Caroline; van der Leij, Marcel J; Bungener, Laura B; Sanders, Jan Stephan F; Stegeman, Coen A
2014-02-01
In anti-neutrophil cytoplasmic antibodies (ANCA) associated small vessel vasculitis (AAV), rapid testing for ANCA and anti-glomerular basement membrane (GBM) antibodies may be beneficial for therapeutic purpose. We analysed the diagnostic performance of two rapid ANCA and anti-GBM test methods in 260 patients with suspected AAV. Between January 2004 and November 2010, we analysed 260 samples by qualitative Dotblot (Biomedical Diagnostics); retrospective analysis followed with directly coated highly sensitive automated Phadia ELiA and ELiA anti-GBM. Results were related to the final clinical diagnosis and compared with routine capture ELISA. Seventy-four patients had a final diagnosis of AAV (n=62) or anti-GBM disease (n=12). Both Dotblot and ELiA detected all 12 cases of anti-GBM disease; 2 false positive results were found. Dotblot detected ANCA in 56 of 62 AAV patients (sensitivity 90%, NPV 97%), and showed 5 false positives (specificity 97%, PPV 90%). The Phadia ELiA anti-PR3(s) or anti-MPO(s) was positive in 57 of 62 AAV patients (sensitivity 92%, NPV 97%), and had 5 false positives (specificity 97%, PPV 88%). Routine capture ELISA was equally accurate (sensitivity 94%, specificity 97%, PPV 88%, NPV 98%). The Dotblot and Phadia ELiA on anti-GBM, anti-PR3(s) and anti-MPO(s) performed excellently; results were almost identical to routine ELISA. When suspicion of AAV or anti-GBM disease is high and diagnosis is urgently needed, both tests are very powerful for rapid serological diagnosis. Further studies have to confirm the test performances in samples routinely presented for ANCA testing and in follow-up of positive patients. Copyright © 2013 European Federation of Internal Medicine. Published by Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Ren, Yu; Wang, Fuchi [School of Materials Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China); National Key Laboratory of Science and Technology on Materials Under Shock and Impact, Beijing Institute of Technology, Beijing 100081 (China); Tan, Chengwen, E-mail: tanchengwen@126.com [School of Materials Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China); National Key Laboratory of Science and Technology on Materials Under Shock and Impact, Beijing Institute of Technology, Beijing 100081 (China); Wang, Shuyou [State Key Laboratory of Explosion Science and Technology, Beijing Institute of Technology, Beijing 100081 (China); Yu, Xiaodong [School of Materials Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China); National Key Laboratory of Science and Technology on Materials Under Shock and Impact, Beijing Institute of Technology, Beijing 100081 (China); Jiang, Jianwei [State Key Laboratory of Explosion Science and Technology, Beijing Institute of Technology, Beijing 100081 (China); Ma, Honglei [China Astronaut Research and Training Center, Beijing 100094 (China); Cai, Hongnian [School of Materials Science and Engineering, Beijing Institute of Technology, Beijing 100081 (China); National Key Laboratory of Science and Technology on Materials Under Shock and Impact, Beijing Institute of Technology, Beijing 100081 (China)
2013-08-20
The mechanical response and spall fracture behavior of an extra-low interstitial (ELI) grade Ti–6Al–4V alloy are systemically investigated during one-dimensional shock loading. The effects of oxygen content on the shock response and dynamic failure characteristic of Ti–6Al–4V are also shown through the comparison of the obtained results with those for commercial Ti–6Al–4V. The measured Hugoniot elastic limit (HEL) of Ti–6Al–4V ELI is lower than that of commercial Ti–6Al–4V. While the fitted shock parameters and the measured Hugoniot in the stress-particle velocity space of Ti–6Al–4V ELI are found to be almost identical to those of commercial Ti–6Al–4V. These results indicate that the oxygen content can significantly affect the HEL of Ti–6Al–4V, but has little or no influence on the shock response of this alloy beyond the HEL. The postshock Ti–6Al–4V ELI does not display shock-induced strengthening during quasistatic and dynamic compression tests. Transmission electron microscopy (TEM) analyses reveal that the lack of high density dislocations or dislocation cells limits the shock-induced strengthening effect, although dislocation multiplication and tangles lead to increased yield strength and strain hardening rate of the reloaded material. Finally, Ti–6Al–4V ELI is demonstrated to spall in a ductile manner, and has similar spall strengths to those of commercial Ti–6Al–4V under different shock loading conditions. The oxygen content exerts no effect on the spall fracture manner of Ti–6Al–4V, although reducing the oxygen content enables this alloy to endure more micro-damages.
International Nuclear Information System (INIS)
Ren, Yu; Wang, Fuchi; Tan, Chengwen; Wang, Shuyou; Yu, Xiaodong; Jiang, Jianwei; Ma, Honglei; Cai, Hongnian
2013-01-01
The mechanical response and spall fracture behavior of an extra-low interstitial (ELI) grade Ti–6Al–4V alloy are systemically investigated during one-dimensional shock loading. The effects of oxygen content on the shock response and dynamic failure characteristic of Ti–6Al–4V are also shown through the comparison of the obtained results with those for commercial Ti–6Al–4V. The measured Hugoniot elastic limit (HEL) of Ti–6Al–4V ELI is lower than that of commercial Ti–6Al–4V. While the fitted shock parameters and the measured Hugoniot in the stress-particle velocity space of Ti–6Al–4V ELI are found to be almost identical to those of commercial Ti–6Al–4V. These results indicate that the oxygen content can significantly affect the HEL of Ti–6Al–4V, but has little or no influence on the shock response of this alloy beyond the HEL. The postshock Ti–6Al–4V ELI does not display shock-induced strengthening during quasistatic and dynamic compression tests. Transmission electron microscopy (TEM) analyses reveal that the lack of high density dislocations or dislocation cells limits the shock-induced strengthening effect, although dislocation multiplication and tangles lead to increased yield strength and strain hardening rate of the reloaded material. Finally, Ti–6Al–4V ELI is demonstrated to spall in a ductile manner, and has similar spall strengths to those of commercial Ti–6Al–4V under different shock loading conditions. The oxygen content exerts no effect on the spall fracture manner of Ti–6Al–4V, although reducing the oxygen content enables this alloy to endure more micro-damages
Vicente-Herrero, M Teofila; Lladosa Marco, Silvia; Ramírez-Iñiguez de La Torre, M Victoria; Terradillos-García, M Jesús; López-González, Ángel Arturo
2014-05-01
Hearing loss due to noise is considered within the prevention plans of the most common occupational diseases. In addition to evaluation of working conditions, other personal factors increasing the risk of hypoacusis, such as diabetes, should be taken into account. To explore hearing loss in the workplace and its relationship to impaired fasting baseline blood glucose levels. An observational, cross-sectional study enrolling 1636 workers from service companies was conducted. Full audiometric evaluation was performed at different frequencies: high frequency (HF), early loss index (ELI), speech average loss (SAL), and monaural and binaural loss. Results were categorized by baseline blood glucose levels: G1 (125mg/dl). Based on both HF and ELI, 11% of workers had clear indication of deafness. Women with G3 levels showed significant differences in the results of HF and ELI indexes as compared to the G1 group (P=.038 and .046, respectively). A positive association was found between hearing loss and G3 blood glucose levels in HF (OR: .338; p=.002), ELI (OR: .407; p=.007), and the monaural test in the left ear (OR: 4.77×10-5; p=.006). Despite the methodological limitations of this study, there is evidence for an increased risk of high frequency hearing loss in workers with high baseline blood glucose levels. Copyright © 2013 SEEN. Published by Elsevier Espana. All rights reserved.
Jevrorealistõ stshitajut variantõ prognoza / Eteri Kekelidze
Kekelidze, Eteri, 1944-
2006-01-01
Professor Ivar Raig analüüsib, kuidas on mõjutanud ja mõjutab Eesti majandust liitumine EL-iga. Tema arvates on juba märke, et majanduskasv lähematel aastatel väheneb. Euroskeptikud on seisukohal, et eurot ei saa kasutusele võtta ilma põhiseadust muutmata. Professori väitel ei ole Eesti valitsusel vastust küsimustele, millisena näeb Eesti EL-i tulevikku ja kellelga ta EL-is koostööd hakkab tegema
Gregory, Jason
2014-01-01
""… this book is the best of its kind, and you're lucky to have found it. It covers the huge field of game engine architecture in a succinct, clear way, and expertly balances the breadth and depth of its coverage, offering enough detail that even a beginner can easily understand the concepts it presents. The author, Jason Gregory, is not only a world expert in his field; he's a working programmer with production-quality knowledge and many shipped game projects under his belt. … Jason is also an experienced educator who has taught in the top-ranked university game program in North America. …
Portrait of a Warming Ocean and Rising Sea Levels: Trend of Sea Level Change 1993-2008
2008-01-01
Warming water and melting land ice have raised global mean sea level 4.5 centimeters (1.7 inches) from 1993 to 2008. But the rise is by no means uniform. This image, created with sea surface height data from the Topex/Poseidon and Jason-1 satellites, shows exactly where sea level has changed during this time and how quickly these changes have occurred. It's also a road map showing where the ocean currently stores the growing amount of heat it is absorbing from Earth's atmosphere and the heat it receives directly from the Sun. The warmer the water, the higher the sea surface rises. The location of heat in the ocean and its movement around the globe play a pivotal role in Earth's climate. Light blue indicates areas in which sea level has remained relatively constant since 1993. White, red, and yellow are regions where sea levels have risen the most rapidly up to 10 millimeters per year and which contain the most heat. Green areas have also risen, but more moderately. Purple and dark blue show where sea levels have dropped, due to cooler water. The dramatic variation in sea surface heights and heat content across the ocean are due to winds, currents and long-term changes in patterns of circulation. From 1993 to 2008, the largest area of rapidly rising sea levels and the greatest concentration of heat has been in the Pacific, which now shows the characteristics of the Pacific Decadal Oscillation (PDO), a feature that can last 10 to 20 years or even longer. In this 'cool' phase, the PDO appears as a horseshoe-shaped pattern of warm water in the Western Pacific reaching from the far north to the Southern Ocean enclosing a large wedge of cool water with low sea surface heights in the eastern Pacific. This ocean/climate phenomenon may be caused by wind-driven Rossby waves. Thousands of kilometers long, these waves move from east to west on either side of the equator changing the distribution of water mass and heat. This image of sea level trend also reveals a significant
Kekäläinen, Reeta
2015-01-01
Opinnäytetyöni käsittelee CLT rakentamista kaikissa eri vaiheissa. CLT koostuu ristikkäin liimatuista lamelli- eli puulevykerroksista. Olen tutkinut CLT:n valmistamista ja tutustunut Suomen ensimmäiseen CLT-levytehtaaseen, joka sijaitsee Kemissä Ammattiopisto Lappian tiloissa. Opinnäytetyön tarkoituksena oli kerätä kattava tietopaketti CLT:stä eli ristiinliimatusta puusta (Cross laminated timber), koska rakennustapana se on vielä melko uusi ja Suomessa harvinainen. Lisäksi työssä esitellään u...
Centenario de Elie Metchnikoff (1845-1916
Directory of Open Access Journals (Sweden)
José Manuel Ribera Casado
2017-04-01
Full Text Available Celebramos en este año de 2016 el centenario de la muerte de una de las grandes figuras de la medicina, surgidas a finales del siglo xix y a principios del xx, Elias Metchnikoff, Premio Nobel con Paul Ehrlich en 1908. El objetivo de este trabajo es el de rendir un homenaje a su figura con motivo de este aniversario. Metchnikoff fue quien descubrió y describió el fenómeno de la fagocitosis y en función de ello ha sido considerado como el «padre de la inmunidad celular». En paralelo fue quien acuñó la palabra «gerontología», aplicándola al estudio del envejecimiento en toda su extensión y en cualquiera de sus formas, lo que le convirtió en un pionero del trabajo interdisciplinar. Consideraba que las bacterias intestinales generaban una autointoxicación que envenenaba nuestro organismo y que la acidificación del mismo a través de los bacilos ácidos que contienen los yogures podría contribuir a mantener la salud y a prolongar la vida.
Factors affecting treatment adherence to atomoxetine in ADHD: a systematic review
Directory of Open Access Journals (Sweden)
Treuer T
2016-05-01
Full Text Available Tamás Treuer,1 Luis Méndez,2 William Montgomery,3 Shenghu Wu4 1Neuroscience Research, Eli Lilly and Company, Budapest, Hungary; 2Eli Lilly de Mexico, Mexico City, Mexico; 3Global Patient Outcomes and Real World Evidence, Eli Lilly Australia Pty Ltd, West Ryde, NSW, Australia; 4Neuroscience Research, Eli Lilly Asia, Inc, Shanghai, People’s Republic of China Abstract: The purpose of this paper was to systematically review the literature related to research about the factors affecting treatment adherence and discontinuation of atomoxetine in pediatric, adolescent, and adult patients with attention-deficit/hyperactivity disorder (ADHD. Medline was systematically searched using the following prespecified terms: “ADHD”, “Adherence”, “Compliance”, “Discontinuation”, and “Atomoxetine”. We identified 31 articles that met all inclusion and exclusion criteria. The findings from this review indicate that persistence and adherence to atomoxetine treatment were generally high. Factors found to influence adherence and nonadherence to atomoxetine treatment in ADHD in this review include age, sex, the definition of response used, length of treatment, initial dose of treatment, comorbid conditions, and reimbursement. Tolerability was cited as an important reason for treatment discontinuation. More research is needed to understand those factors that can help to identify patients at risk for poor adherence and interventions that could improve treatment adherence early in the stage of this illness to secure a better long-term prognosis. Keywords: atomoxetine, treatment discontinuation, adherence, compliance, ADHD medication, relapse
Miljoona katselukertaa : Kuinka YouTubessa julkaistusta markkinointivideosta tulee viraali?
Liikala, Jussi; Saarijärvi, Marja
2016-01-01
Tiedon jatkuvan kasvun myötä videoista on tullut yksi tehokkaimpia keinoja siirtää viestejä taholta toiselle eli tässä tapauksessa yritykseltä asiakkaille. Informaatiotulvaan on kuitenkin helppo hukkua, joten viraaliuden eli laajalle leviävän ilmiön saavuttamiseksi yrityksen videoiden täytyy erottua miljoonien samankaltaisten teosten massasta. Tämän vuoksi videon tekijän olisi hyvä tuntea keinoja, jotka lisäävät mahdollisuuksia nostaa julkaisun laajempaa leviämistä ja tunnettuutta. Tutki...
Czech Academy of Sciences Publication Activity Database
Lancia, L.; Giribono, A.; Vassura, L.; Chiaramello, M.; Riconda, C.; Weber, Stefan A.; Castan, A.; Chatelain, A.; Frank, A.; Gangolf, T.; Quinn, M.N.; Fuchs, J.; Marqués, J.-R.
2016-01-01
Roč. 116, č. 7 (2016), 1-5, č. článku 075001. ISSN 0031-9007 R&D Projects: GA MŠk EF15_008/0000162; GA MŠk ED1.1.00/02.0061 EU Projects: European Commission(XE) 284464 - LASERLAB-EUROPE Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : light-pulses * compression * plasmas * Raman Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 8.462, year: 2016
Erkki Luuk kuulab eksprimentaalset ambient'i / Erkki Luuk
Luuk, Erkki, 1971-
2003-01-01
Heliplaatidest: Killy Dog Box "The Silent Light", Legion "Zodiac", Erinevad esinejad "Bip-Hop Generation vol 6", Jason Lescalleet "Matresslessness", Francisco Lopez / Steve Roden "Le Chemin du Paradis"
The AORTA Architecture : Integrating Organizational Reasoning in Jason
Schmidt Jensen, A.; Dignum, V.; Villadsen, J.
2014-01-01
Open systems are characterized by a diversity of heterogeneous and autonomous agents that act according to private goals, and with a behavior that is hard to predict. They can be regulated through organizations similar to human organizations, which regulate the agents' behavior space and describe
The AORTA Architecture: Integrating Organizational Reasoning in Jason
DEFF Research Database (Denmark)
Jensen, Andreas Schmidt; Dignum, Virginia; Villadsen, Jørgen
2014-01-01
the expected behavior of the agents. Agents need to be able to reason about the regulations, so that they can act within the expected boundaries and work towards the objectives of the organization. In this paper, we describe the AORTA (Adding Organizational Reasoning to Agents) architecture for making agents...
Nano and micro structured targets to modulate the spatial profile of laser driven proton beams
Czech Academy of Sciences Publication Activity Database
Giuffrida, Lorenzo; Svensson, K.; Pšikal, Jan; Margarone, Daniele; Lutoslawski, P.; Scuderi, Valentina; Milluzzo, G.; Kaufman, Jan; Wiste, Tuomas; Dalui, M.; Ekerfelt, H.; Gallardo Gonzalez, I.; Lundh, O.; Persson, A.; Picciotto, A.; Crivellari, M.; Bagolini, A.; Bellutti, P.; Magnusson, J.; Gonoskov, A.; Klimša, Ladislav; Kopeček, Jaromír; Laštovička, Tomáš; Cirrone, G.A.P.; Wahlström, C.-G.; Korn, Georg
2017-01-01
Roč. 12, Mar (2017), s. 1-6, č. článku C03040. ISSN 1748-0221. [Medical and Multidisciplinary Applications of Laser -Driven Ion Beams at Eli-Beamlines. Catania, 07.09.2016-10.09.2016] R&D Projects: GA ČR(CZ) GA15-02964S; GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : accelerator Applications * Beam dynamics Subject RIV: BH - Optics, Masers, Laser s OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.220, year: 2016
Computer simulations of X-ray six-beam diffraction in a perfect silicon crystal. I
Czech Academy of Sciences Publication Activity Database
Kohn, V.G.; Khikhlukha, Danila
2016-01-01
Roč. 72, May (2016), s. 349-356 ISSN 2053-2733 R&D Projects: GA MŠk EF15_008/0000162; GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : X-ray diffraction * silicon crystal * six-beam diffraction * section topography * computer simulations Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 5.725, year: 2016
Seidel aberrations in grating pulse stretchers
Czech Academy of Sciences Publication Activity Database
Vyhlídka, Štěpán; Kramer, Daniel; Kalinchenko, Galina; Rus, Bedřich
2016-01-01
Roč. 24, č. 26 (2016), s. 30421-30432 ISSN 1094-4087 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE.2.3.20.0091; GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; OP VK 1 LaserSys(XE) CZ.1.07/2.3.00/20.0091; ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : ultrafast optics * pulse compression Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.307, year: 2016
Submarine Ring of Fire 2014 - Ironman
National Oceanic and Atmospheric Administration, Department of Commerce — There will be 4 primary data types collected, multibeam sonar data, CTD water column data, hydrophone records, and Jason ROV dive data.
Pedaru, Tõnu
1999-01-01
Heliplaatidest " Jordan Knight "S/T", "Full Of House", Clinton "Disco & The Halfway To Discontent", Apollo 440 "Gettin" High On Your Own Supply", Ben & Jason "Emoticons", Murry The hump "Thrown Like A Stone"
Teel infoühiskonda - sedakorda Euroopa Liidu abiga / Katre Talviste, Anne Märdimäe
Talviste, Katre
1997-01-01
Euroopa Liidu infotehnika arendusprogrammid: ACTS - arenenud sidetehnika ja teenused, ESPRIT - infotehnika, TELEMATICS APPLICATIONS - telemaatikarakendused, FEMIRC Eesti (EL'i Innovatsiooniinfo keskus Eestis)
Santos, Pedro Fernandes; Niinomi, Mitsuo; Cho, Ken; Nakai, Masaaki; Liu, Huihong; Ohtsu, Naofumi; Hirano, Mitsuhiro; Ikeda, Masahiko; Narushima, Takayuki
2015-10-01
The microstructures, mechanical properties and biocompatibility of low cost β-type Ti-(6-18)Mn alloys were investigated after solution treatment. Ti-9 Mn exhibits the best combination of tensile strength and elongation among the fabricated alloys, and its performance is comparable to or superior to those of Ti-6Al-4V ELI (Ti-64 ELI) in terms of every parameter evaluated. A hardness of 338 HV, a Young's modulus of 94 GPa, a 0.2% proof stress of 1023 MPa, an ultimate tensile strength of 1048 MPa and elongation of 19% were obtained for Ti-9 Mn. Furthermore, the cell viability and metallic ion release ratios are comparable to those of commercially pure titanium, making this alloy promising for biomedical applications. The Young's modulus is also lower than that of Ti-64 ELI (110 GPa), which can possibly reduce the stress shielding effect in implanted patients. This study evaluates mechanical and biological performance of low cost solution treated β-type Ti-(6, 9, 13 and 18 mass%)Mn alloys. It includes alloys containing a Mn content range higher than most previously published works (which is around or lower than 8 mass%). Furthermore, the effects of the ω phase and the β phase stability of the alloys over some mechanical properties and microstructures are discussed. Ion release behavior under simulated body fluids and cell viability are also evaluated. For the case of the Ti-9 Mn, a mechanical and biological performance that is comparable to or superior than that of the widely used Ti-6Al-4V ELI and commercially pure Ti was observed. Copyright © 2015 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.
A novel type of pathogen defense-related cinnamyl alcohol dehydrogenase.
Logemann, E; Reinold, S; Somssich, I E; Hahlbrock, K
1997-08-01
We describe an aromatic alcohol dehydrogenase with properties indicating a novel type of function in the defense response of plants to pathogens. To obtain the enzyme free of contamination with possible isoforms, a parsley (Petroselinum crispum) cDNA comprising the entire coding region of the elicitor-responsive gene, ELI3, was expressed in Escherichia coli. In accord with large amino acid sequence similarities with established cinnamyl and benzyl alcohol dehydrogenases from other plants, the enzyme efficiently reduced various cinnamyl and benzyl aldehydes using NADPH as a co-substrate. Highest substrate affinities were observed for cinnamaldehyde, 4-coumaraldehyde and coniferaldehyde, whereas sinapaldehyde, one of the most efficient substrates of several previously analyzed cinnamyl alcohol dehydrogenases and a characteristic precursor molecule of angiosperm lignin, was not converted. A single form of ELI3 mRNA was strongly and rapidly induced in fungal elicitor-treated parsley cells. These results, together with earlier findings that the ELI3 gene is strongly activated both in elicitor-treated parsley cells and at fungal infection sites in parsley leaves, but not in lignifying tissue, suggest a specific role of this enzyme in pathogen defense-related phenylpropanoid metabolism.
The Development of a Roof Integrated Solar Hot Water System
Energy Technology Data Exchange (ETDEWEB)
Menicucci, David F. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Energy Infrastructure and DER Dept.; Moss, Timothy A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Solar Technologies Dept.; Palomino, G. Ernest [Salt River Project (SRP), Tempe, AZ (United States)
2006-09-01
The Salt River Project (SRP), in conjunction with Sandia National Laboratories (SNL) and Energy Laboratories, Inc. (ELI), collaborated to develop, test, and evaluate an advanced solar water-heating product for new homes. SRP and SNL collaborated under a Department of Energy Cooperative Research and Development Agreement (CRADA), with ELI as SRP's industry partner. The project has resulted in the design and development of the Roof Integrated Thermal Siphon (RITH) system, an innovative product that features complete roof integration, a storage tank in the back of the collector and below the roofline, easy installation by homebuilders, and a low installed cost. SRP's market research guided the design, and the laboratory tests conducted at SNL provided information used to refine the design of field test units and indicated that the RITH concept is viable. ELI provided design and construction expertise and is currently configured to manufacture the units. This final report for the project provides all of the pertinent and available materials connected to the project including market research studies, the design features and development of the system, and the testing and evaluation conducted at SNL and at a model home test site in Phoenix, Arizona.
Full Text Available ... UNWIND YOUR MIND Before Sleep Meditation (Spoken with Music) A Guided Meditation Insomnia Sleeping - Duration: 2:02:40. Jason Stephenson - Sleep Meditation Music 1,992,912 views 2:02:40 Problems ...
Directory of Open Access Journals (Sweden)
Jason P Block
2015-12-01
Full Text Available Jason Block and S. V. Subramanian explore avenues for improving the health of Americans through reducing dietary inequalities and look at whether concern over "food deserts" has been taken too far.
Full Text Available ... to continue to work to my full capacity? Will I be able to drive? Patient Stories Angie M. Caregiver for Brother Charles DiAngelo Hepatic Encephalopathy Jason Dedmon Alcohol-related Cirrhosis ...
Kanada koolimõrv nõudis ühe ohvri / Rein Kärner
Kärner, Rein
1999-01-01
Veidi enam kui nädal pärast tapatalguid Colorado osariigi Littletoni koolis laskis Kanadas Taberi väikelinnas W. R. Myersi keskkoolis sama kooli endine õpilane Jason Lang maha oma endise koolikaaslase
Full Text Available ... UNWIND YOUR MIND Before Sleep Meditation (Spoken with Music) A Guided Meditation Insomnia Sleeping - Duration: 2:02:40. Jason Stephenson - Sleep Meditation Music 1,998,568 views 2:02:40 Provent: ...
2013-12-10
... Contact: Jason George, Gomez and Sullivan Engineers, P.C., P.O. Box 2179, Henniker, NH 03242, (603) 428... the Stream Flow and Water Level Monitoring Plan to reflect recent upgrades to the three turbine...
Czech Academy of Sciences Publication Activity Database
De Marco, Massimo; Krása, Josef; Cikhardt, Jakub; Pfeifer, Miroslav; Krouský, Eduard; Margarone, Daniele; Ahmed, H.; Borghesi, M.; Kar, S.; Giuffrida, Lorenzo; Vrána, Roman; Velyhan, Andriy; Limpouch, J.; Korn, Georg; Weber, Stefan A.; Velardi, L.; Delle Side, D.; Nassisi, V.; Ullschmied, Jiří
2016-01-01
Roč. 11, Jun (2016), 1-8, č. článku C06004. ISSN 1748-0221 R&D Projects: GA MŠk LQ1606; GA MŠk EF15_008/0000162; GA ČR(CZ) GA15-02964S; GA MŠk(CZ) LD14089; GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 ; RVO:61389021 Keywords : lasers * pulsed power Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.220, year: 2016
Ivančir, Monika
2018-01-01
Ovim diplomskim radom ukazuje se na problematiku današnjice glede poslovne etike. Naglasak se stavlja na etiku u poduzetništvu. Istaknuti su najčešći moralni problemi s kojima se susreću današnji poduzetnici i želi se naglasiti važnost etike u svim poslovnim odnosima i odlukama. Zadaća svakog poduzetnika, koji se želi voditi načelima etike, jest da uspostavi ravnotežu između ekonomske i društveno odgovorne strane poslovanja. Samo na taj način, na današnjem promjenjivom tržištu, poduzetnik...
Expectation values of the e+Li system
International Nuclear Information System (INIS)
Mitroy, J.
2004-01-01
Close to converged energies and expectation values for e + Li are computed using a ground state wave function consisting of 1200 explicitly correlated Gaussians. The best estimate of the e + Li energy was -7.532 895 5 hartree which has a binding energy of 0.002 482 hartree against dissociation into Ps+Li + . The 2γ annihilation rate for the spin singlet state was 6.996x10 9 s -1 . The annihilation rate for the triplet state, taking into account core annihilation and the 3γ decay, was 9.36x10 6 s -1
National Oceanic and Atmospheric Administration, Department of Commerce — Expedition produced 600 DVDs of video recorded from a Science Camera, a Brow Camera and a Pilot's Camera from the JASON submersible; a video annotations log...
Mediationsgesetze in Südosteuropa / Judith Knieper
Knieper, Judith
2011-01-01
Lepitusmenetluse seadustest Albaanias, Bosnias ja Hertsegoviinas, Makedoonias, Kosovos, Horvaatias, Montenegros ja Serbias. ELi direktiivist (2008/52) vahendusmenetluse teatavate aspektide kohta tsiviil- ja kaubandusasjades
Majandusvabadusi kujundav majanduspoliitika Eestis ja selle perspektiivid Euroopa Liidus / Ivar Raig
Raig, Ivar, 1953-
2004-01-01
Lühiülevaade majandusvabadusi kujundavast majanduspoliitikast taasiseseisvunud Eestis, EL-i mõju Eesti majanduspoliitikale, uuringu tulemustest majandusvabaduste kohta Eesti erinevates majandussektorites. Tabel
Full Text Available ... views 2:34 UNWIND YOUR MIND Before Sleep Meditation (Spoken with Music) A Guided Meditation Insomnia Sleeping - Duration: 2:02:40. Jason Stephenson - Sleep Meditation Music 1,992,912 views 2:02:40 ...
National Oceanic and Atmospheric Administration, Department of Commerce — Data and information collected by the ROV Jason along its track during sixteen dives of the 2007 "Expedition to the Deep Slope" expedition sponsored by the National...
Tikerpe, Lauri
2006-01-01
Heliplaatidest: Stereotyp "Keepin' Me", Bent "Intercept!", The Mars Volta "Amputechture", X-press 2 "Makeshift Feelgood", Kosmikud "Pulmad ja matused", Beck "The Information", Ursula "Armastan end aeglaselt", Envy "Insomniac Doze", Joe Colley & Jason Lescalleet "Annihilate This Week"
A Comparative Look at Citizenship Education in the Western World
Kathleen Tobin
2016-01-01
Book review of Citizenship, Democracy and Higher Education in Europe, Canada, and the USA. Edited by Jason Laker, Concepción Naval and Kornelija Mrnjaus. New York: Palgrave Macmillan, 2014. ISBN: 978-1-137-28747-2
75 FR 44050 - Qualification of Drivers; Exemption Applications; Vision
2010-07-27
..., Mitchell L. Carmen, Christopher R. Cone, Walter O. Connelly, Stephen B. Copeland, Armando P. D'Angeli..., Andrew C. Kelly, Jason W. King, James T. Leek, Billy J. Lewis, Velmer L. McClelland, Larry McCoy, Sr...
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ely tryptophan synthetase alpha chain [Candida albicans SC5314] ... Length = 222 ... Query: 1 ... MSALLKETFARC...KKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIELGVPFSDPIA 60 ... MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNM...QNAGVDIIELGVPFSDPIA Sbjct: 1 ... MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIE
Directory of Open Access Journals (Sweden)
Wacheck V
2011-05-01
Full Text Available Volker Wacheck1, Michael Lahn2, Gemma Dickinson3, Wolfgang Füreder4, Renata Meyer4, Susanne Herndlhofer4, Thorsten Füreder1, Georg Dorfner5, Sada Pillay2, Valérie André6, Timothy P Burkholder7, Jacqueline K Akunda8, Leann Flye-Blakemore9, Dirk Van Bockstaele9, Richard F Schlenk10, Wolfgang R Sperr4, Peter Valent4,111Department of Clinical Pharmacology, Medical University of Vienna, Währinger Gürtel, Vienna, Austria; 2Early Oncology Clinical Investigation, Eli Lilly and Company, Indianapolis, IN, USA; 3Department of Pharmacokinetics, Eli Lilly and Company, Erl Wood Research Centre, Windlesham, Surrey, UK; 4Department of Internal Medicine I, Division of Hematology and Hemostaseology, Medical University of Vienna, Währinger Gürtel, Vienna, Austria; 5Eli Lilly GesmbH, Medical Department, Vienna, Austria; 6Department of Statistics, Eli Lilly and Company, Erl Wood Research Centre, Surrey, UK; 7Discovery Chemistry Research and Technology, Eli Lilly and Company, Indianapolis, IN, USA; 8Nonclinical Toxicology, Eli Lilly and Company, Indianapolis, IN, USA; 9Flow Cytometry and Cell Analysis, Esoterix Clinical Trials Services, Mechelen, Belgium; 10Universitätsklinikum Ulm, Klinik für Innere Medizin III, Ulm, Germany; 11Ludwig Boltzmann Cluster Oncology, Vienna, AustriaBackground: Acute myeloid leukemia (AML is a life-threatening malignancy with limited treatment options in chemotherapy-refractory patients. A first-in-human dose study was designed to investigate a safe and biologically effective dose range for LY2457546, a novel multikinase inhibitor, in patients with relapsed AML.Methods: In this nonrandomized, open-label, dose escalation Phase I study, LY2457546 was administered orally once a day. Safety, pharmacokinetics, changes in phosphorylation of target kinases in AML blasts, and risk of drug–drug interactions (DDI were assessed.Results: Five patients were treated at the starting and predicted minimal biologically effective dose of 50 mg
National Oceanic and Atmospheric Administration, Department of Commerce — This cruise used the remotely operated vehicle (ROV) Jason II to: explore 4-6 new sites for the occurrence of deep water coral reefs; made collections of Lophelia...
AT26-10 Chemosynthetic Microbial Communities at Deep-Sea Vents (EM122)
National Oceanic and Atmospheric Administration, Department of Commerce — The cruise will include 16 dives with DSV Alvin or ROV Jason, to allow time for deployment and collection of experiments and for extensive sampling of discrete vents...
National Oceanic and Atmospheric Administration, Department of Commerce — This cruise used the remotely operated vehicle (ROV) Jason II to: explore 4-6 new sites for the occurrence of deep water coral reefs; made collections of Lophelia...
(New) NASA Administrator Sean O'Keefe comes to Ames for employee briefing and tour. Here he welcomes
2002-01-01
(New) NASA Administrator Sean O'Keefe comes to Ames for employee briefing and tour. Here he welcomes JASON kids to NASA while handing out patches and pins. Tom Clausen and Donald James, Ames Education Office in background.
75 FR 60861 - Qualification of Drivers; Exemption Renewals; Vision
2010-10-01
.... Connelly, Stephen B. Copeland, Armando P. D'Angeli, Donald R. Davis, Ivory Davis, Louis A. DiPasqua, Jr..., Jesse P. Jamison, James A. Jones, Ronnie M. Jones, Andrew C. Kelly, Jason W. King, James T. Leek, Billy...
Full Text Available ... has been rented. This feature is not available right now. Please try again later. Published on Dec ... 2:02:40. Jason Stephenson - Sleep Meditation Music 1,992,912 views 2:02:40 Problems with ...
EU law on nuclear safety / Ana Stanic
Stanic, Ana
2010-01-01
Tuumaseadmete tuumaohutust käsitlevast õigusest Euroopa Liidus. ELi direktiivist 2009/71 ja 1994. aasta tuumaohutuse konventsioonist (Convention on Nuclear Safety), Rahvusvahelise Aatomienergiaagentuuri (IAEA) standarditest
Putin mängib jätkuvalt eurooplastega / Teresa de Sousa
Sousa, Teresa de
2007-01-01
Autori arvates andis Mafras peetud EL-i ja Venemaa tippkohtumine Venemaa presidendile Vladimir Putinile võimaluse vastata Euroopa kriitikale seoses oma autoritaarsusega. Venemaa agressiivsest poliitikast
Ravimikontsern võitis soodusravimitülis kohtus sotsiaalministeeriumi / Signe Kalberg
Kalberg, Signe, 1959-
2007-01-01
Tallinna halduskohtu otsusest rahvusvahelise farmaatsiakontserni Eli Lilly ja sotsiaalministeeriumi vahelises kohtuasjas aktiivsus- ja tähelepanuhäiretega lastele mõeldud ravimi soodustuse taotlumise kohta
EU-Geheimnisschutzrichtlinie und Schutz von Whistleblowern / Alexander Eufinger
Eufinger, Alexander
2016-01-01
Nn vilepuhujate kaitse regulatsioonist riigisiseses õiguses ja ELi direktiivist 2016/943 (avalikustamata oskusteabe ja äriteabe (ärisaladuste) ebaseadusliku omandamise, kasutamise ja avalikustamise vastane kaitse)
Directory of Open Access Journals (Sweden)
Elis Artz
2016-08-01
Full Text Available A pintura de Elis Artz é feita com muita alma e transborda alegria. A vitalidade de seu trabalho transparece nas cores fortes e nos traços simples e harmoniosos. Confira o trabalho da artista nesta edição da Revista Jangada. ELIS by ELIS Descobri meu talento artístisco e criativo há uns 25 anos. Nasci no Brasil e me mudei para os EUA 10 anos atrás por puro amor. Embora seja psicóloga de formação, o meu apreço pela pintura só cresceu e, com o passar dos anos, a paixão pelas tintas me direcionou a fazer cursos com artistas brasileiros renomados. Já morando nos EUA e com essa grande paixão adormecida, durante anos, decidi me entregar para as cores que sempre me trouxeram alegria e cor para os meus dias. Embora muitas de minhas pinturas tenham ido para minha família e amigos no Brasil, vendi inúmeras outras pelo país através de exposições em galerias de arte. Em 2014, fui uma das artistas em destaque no MTD ART nos Estados Unidos. Minha obra estava dentro de cada ônibus das cidades de Champaign e Urbana e exposta em destaque na Estação de Trem. Em maio de 2015, tive o prazer de ter outro trabalho meu nos outdoors da cidade, destacando a minha tela 'Frida' o ano inteiro e de expor em conjunto com alguns artistas locais no final de outubro. Desde então, tenho pintado cada vez mais e me interessado em divulgar o meu trabalho. E, como diria um amigo meu "Elis, você me mostrou que a vida não é só preto no branco". Ele estava certo.
77 FR 46153 - Qualification of Drivers; Exemption Applications; Vision
2012-08-02
.... Carman (OH) Christopher R. Cone (GA) Walter O. Connelly (WA) Stephen B. Copeland (GA) Armando P. D'Angeli... (PA) Jesse P. Jamison (TN) Ronnie M. Jones (ID) Andrew C. Kelly (WV) Jason W. King (MT) James T. Leek...
"Predprinimatelstvo - eto neprestizhno" / Jaroslav Tolstikov
Tolstikov, Jaroslav
2000-01-01
Uurimus Ida-Virumaa Vene noorte hulgas "Noored muutuvas maailmas". Diagrammid: perekondade majanduslik oukord, murettekitavad probleemid, millises riigis soovitakse tulevikus töötada, suhtumine EL-i
Cross-border insolvency and admiralty: a middle path of reciprocal comity / Martin Davies
Davies, Martin
2018-01-01
Laevomanike pankrotist ja piiriülesest pankrotimenetlusest pankrotiõiguse ja mereõiguse regulatsioonides; menetluse universaalsuse kontseptsioonist, UNCITRALi mudelseadusest ja ELi määrusest 2015/848
Promoting accessibility for disabled people using EU standardisation policy / David L. Hosking
Hosking, David L.
2017-01-01
Euroopa puuetega inimeste strateegiast juurdepääsetavusõiguste (tooted, teenused) aspektist ning ELi standardiseerimispoliitika osast selles ja ÜRO puuetega inimeste õiguste konventsiooni mõjust
The ELIMED transport and dosimetry beamline for laser-driven ion beams
Czech Academy of Sciences Publication Activity Database
Romano, F.; Schillaci, F.; Cirrone, G.A.P.; Cuttone, G.; Scuderi, Valentina; Allegra, L.; Amato, A.; Amico, A.; Candiano, G.; De Luca, G.; Gallo, G.; Giordanengo, S.; Guarachi, L.F.; Korn, Georg; Larosa, G.; Leanza, R.; Manna, R.; Marchese, V.; Marchetto, F.; Margarone, Daniele; Milluzzo, G.; Petringa, G.; Pipek, J.; Pulvirenti, S.; Rizzo, D.; Sacchi, R.; Salamone, S.; Sedita, M.; Vignati, A.
2016-01-01
Roč. 829, Sep (2016), s. 153-158 ISSN 0168-9002 R&D Projects: GA MŠk LQ1606; GA MŠk EF15_008/0000162; GA MŠk EE2.3.30.0057; GA ČR(CZ) GA15-02964S; GA MŠk ED1.1.00/02.0061 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057; ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061 Institutional support: RVO:68378271 Keywords : laser-driven beams * beam handling Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.362, year: 2016
Usher, R W
1995-12-01
Toxicology and Quality Assurance (QA) at Eli Lilly and Company are well integrated, yet still independent organizations that are aligned with the same overall business objective: to efficiently deliver a high-quality product to the customer. One of the keys to success has been the implementation of a monitoring/metric and trend analysis program of key work processes that are central to the delivery of final product. Our metrics program indicates that the multiple changes that we have made have resulted in a higher quality product. This paper will discuss the practical changes we have made as a part of our Total Quality journey. This article is based solely on the authors' experiences while at Eli Lilly and Company.
Vliv oceánských slapů na nízké oběžné dráhy družic Země
Czech Academy of Sciences Publication Activity Database
Štěpánek, P.; Bezděk, Aleš
2013-01-01
Roč. 59, č. 5 (2013), s. 89-99 ISSN 0016-7096 Grant - others:GA(CZ) GCP209/11/J082 Institutional support: RVO:67985815 Keywords : SPOT-5 * Jason-2 * perturbation forces Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics
78 FR 17640 - National Climate Assessment and Development Advisory Committee
2013-03-22
.... SUMMARY: The Department of Commerce's Chief Financial Officer and Assistant Secretary for Administration... the USGCRP.'' Dated: March 5, 2013. Jason Donaldson, Chief Financial Officer/Chief Administrative... INFORMATION CONTACT: Dr. Cynthia J. Decker, Designated Federal Officer, National Climate Assessment and...
Diaries reveal the commitment and care nurses give every day.
2017-03-15
You almost certainly do not know Liz Alderton, Jason Gray O'Connor or Hilda Hayo, but after reading this week's Nursing Standard you will gain an idea of what these three nurses get up to in a typical day.
Djavol kurit Marlboro. Prekrasnaja habalka. Iosseliani uhhodit na pensiju / Stass Tõrkin
Tõrkin, Stass
2006-01-01
Mängufilm "Thank You for Smoking" : režissöör Jason Reitman : Ameerika Ühendriigid 2005, Woody Alleni mängufilm "Sensatsioon" ("Scoop") : Ameerika Ühendriigid 2006 ja Otar Ioseliani "Sügisaiad" ("Gardens in Autumn") : Prantsusmaa 2006
A Comparative Look at Citizenship Education in the Western World
Directory of Open Access Journals (Sweden)
Kathleen Tobin
2016-09-01
Full Text Available Book review of Citizenship, Democracy and Higher Education in Europe, Canada, and the USA. Edited by Jason Laker, Concepción Naval and Kornelija Mrnjaus. New York: Palgrave Macmillan, 2014. ISBN: 978-1-137-28747-2
Tshernjavskaja, Jana
2004-01-01
Tollivabatsooni mõistest ja ülesannetest vastavalt Euroopa Liidu tollikoodeksile. Eestis tegutsevate vabatsoonide (Muuga, Sillamäe, Valga) vastavusse viimisest EL-i vabakaubanduspiirkondade tüüpidega
Kosovo ootab nüüd iseseisvuse väljakuulutamist tuleval aastal / Liisi Poll
Poll, Liisi, 1980-
2007-01-01
Kosovo valimised võitis Kosovo Vabastusarmee (UCK) poliitilise tiiva juhi Hashim Thaci Kosovo Demokraatlik Partei. Kosovlaste lootusest EL-i ja USA abile iseseisvuse saavutamisel. Lisa: Verine ajalugu
Brussels set to take Germany to task / Elahe Merel
Merel, Elahe
2003-01-01
EL-i rahandusministrite otsusest peatada sisuliselt eelarvereeglite rakendamine, et säästa suure eelarvedefitsiidiga Saksamaad ja Prantsusmaad distsiplinaarmeetmetest. Euroopa Komisjon nõuab eurot toetavast stabiilsuspaktist kinnipidamist
Dimopoulos, Andreas
2017-01-01
Sõnavabadusest ja puuetega inimeste kaasamisest ringhäälinguseaduse tähenduses Suurbritannia, Prantsuse ja ELi õiguses; puuetega inimeste õiguste konventsiooni artikli 8 mõjust riigisisesele regulatsioonile
Revival of pure titanium for dynamically loaded porous implants using additive manufacturing.
Wauthle, Ruben; Ahmadi, Seyed Mohammad; Amin Yavari, Saber; Mulier, Michiel; Zadpoor, Amir Abbas; Weinans, Harrie; Van Humbeeck, Jan; Kruth, Jean-Pierre; Schrooten, Jan
2015-09-01
Additive manufacturing techniques are getting more and more established as reliable methods for producing porous metal implants thanks to the almost full geometrical and mechanical control of the designed porous biomaterial. Today, Ti6Al4V ELI is still the most widely used material for porous implants, and none or little interest goes to pure titanium for use in orthopedic or load-bearing implants. Given the special mechanical behavior of cellular structures and the material properties inherent to the additive manufacturing of metals, the aim of this study is to investigate the properties of selective laser melted pure unalloyed titanium porous structures. Therefore, the static and dynamic compressive properties of pure titanium structures are determined and compared to previously reported results for identical structures made from Ti6Al4V ELI and tantalum. The results show that porous Ti6Al4V ELI still remains the strongest material for statically loaded applications, whereas pure titanium has a mechanical behavior similar to tantalum and is the material of choice for cyclically loaded porous implants. These findings are considered to be important for future implant developments since it announces a potential revival of the use of pure titanium for additively manufactured porous implants. Copyright © 2015 Elsevier B.V. All rights reserved.
Expressive and receptive language skills in preschool children from a socially disadvantaged area.
Ryan, Ashling; Gibbon, Fiona E; O'shea, Aoife
2016-02-01
Evidence suggests that children present with receptive language skills that are equivalent to or more advanced than expressive language skills. This profile holds true for typical and delayed language development. This study aimed to determine if such a profile existed for preschool children from an area of social deprivation and to investigate if particular language skills influence any differences found between expressive and receptive skills. Data from 187 CELF P2 UK assessments conducted on preschool children from two socially disadvantaged areas in a city in southern Ireland. A significant difference was found between Receptive Language Index (RLI) and Expressive Language Index (ELI) scores with Receptive scores found to be lower than Expressive scores. The majority (78.6%) of participants had a lower Receptive Language than Expressive score (RLI ELI), with very few (3.2%) having the same Receptive and Expressive scores (RLI = ELI). Scores for the Concepts and Following Directions (receptive) sub-test were significantly lower than for the other receptive sub tests, while scores for the Expressive Vocabulary sub-test were significantly higher than for the other expressive sub tests. The finding of more advanced expressive than receptive language skills in socially deprived preschool children is previously unreported and clinically relevant for speech-language pathologists in identifying the needs of this population.
Numerical studies of acceleration of thorium ions by a laser pulse of ultra-relativistic intensity
Directory of Open Access Journals (Sweden)
Domanski Jaroslaw
2018-01-01
Full Text Available One of the key scientific projects of ELI-Nuclear Physics is to study the production of extremely neutron-rich nuclides by a new reaction mechanism called fission-fusion using laser-accelerated thorium (232Th ions. This research is of crucial importance for understanding the nature of the creation of heavy elements in the Universe; however, they require Th ion beams of very high beam fluencies and intensities which are inaccessible in conventional accelerators. This contribution is a first attempt to investigate the possibility of the generation of intense Th ion beams by a fs laser pulse of ultra-relativistic intensity. The investigation was performed with the use of fully electromagnetic relativistic particle-in-cell code. A sub-μm thorium target was irradiated by a circularly polarized 20-fs laser pulse of intensity up to 1023 W/cm2, predicted to be attainable at ELI-NP. At the laser intensity ~ 1023 W/cm2 and an optimum target thickness, the maximum energies of Th ions approach 9.3 GeV, the ion beam intensity is > 1020 W/cm2 and the total ion fluence reaches values ~ 1019 ions/cm2. The last two values are much higher than attainable in conventional accelerators and are fairly promising for the planned ELI-NP experiment.
78 FR 46923 - National Climate Assessment and Development Advisory Committee
2013-08-02
.... SUMMARY: The Department of Commerce's Chief Financial Officer and Assistant Secretary for Administration.... Dated: --July 29, 2013. Jason Donaldson, Chief Financial Officer/Chief Financial Officer, Office of... INFORMATION CONTACT: Dr. Cynthia J. Decker, Executive Director and Designated Federal Officer, NOAA Science...
2013-09-09
.../index.html . Dated: September 3, 2013. Jason Donaldson, Chief Financial Officer/Chief Administrative Officer, Office of Oceanic and Atmospheric Research, National Oceanic and Atmospheric Administration... Act Science Program's roles within the context of NOAA's ocean missions and policies. They should be...
Interannual variability of the Equatorial Jets in the Indian Ocean from the merged altimetry data
Digital Repository Service at National Institute of Oceanography (India)
Somayajulu, Y.K.; Murty, V.S.N.; Neelima, C.; Jagadeesh, P.S.V.
The merged ERS-1/2, TOPEX/Poseidon and Jason-1 altimeter weekly sea level anomalies (SLAs) for the period 1997- 2005 were analyzed to study the variability of sea level and computed geostrophic currents in relation to the equatorial jets...
2010-03-30
... all of the required information and warrants further consideration. Study Fleet projects are managed by the University of Massachusetts Dartmouth School of Marine Science and Technology (SMAST). The EFP... INFORMATION CONTACT: Jason Berthiaume, Fishery Management Specialist, (978) 281-9177. SUPPLEMENTARY...
2013-04-12
... Massachusetts, Dartmouth, School for Marine Science and Technology. Regulations under the Magnuson-Stevens... preliminary determination that an exempted fishing permit application contains all of the required information....'' Fax: (978) 281-9135. FOR FURTHER INFORMATION CONTACT: Jason Berthiaume, Fishery Management Specialist...
Prima Vistale tuleb tuntud kirjanikke mitmest Euroopa riigist / Kaarel Kressa
Kressa, Kaarel, 1983-
2010-01-01
Prima Vista kirjandusfestivali külalisi: Leonie Swann, Attila Bartis, Dmitri Bõkov, Zinaida Lindén, Mihhail Šiškin, Fay Weldon, Jason Goodwin, Rosa Maria Rodríguez Magda, Inga Gaile, Juris Kronbergs, Guntars Godinš, Liana Langa
Full Text Available ... Duration: 2:05:59. Jason Stephenson - Sleep Meditation Music 787,088 views 2:05:59 How to ... TheLankyLefty27 187,201 views 4:37 Deep Sleep Music: Ocean Waves, Fall Asleep Fast, Relaxing Music, Sleeping ...
Energy Technology Data Exchange (ETDEWEB)
Moon, Byeong-Seok; Kim, Sungwon; Kim, Hyoun-Ee; Jang, Tae-Sik, E-mail: cgamja@snu.ac.kr
2017-04-01
Hierarchical micro-nano (HMN) surface structuring of dental implants is a fascinating strategy for achieving fast and mechanically stable fixation due to the synergetic effect of micro- and nano-scale surface roughness with surrounding tissues. However, the introduction of a well-defined nanostructure on a microstructure having complex surface geometry is still challenging. As a means of fabricating HMN surface on Ti6Al4V-ELI, target-ion induced plasma sputtering (TIPS) was used onto a sand-blasted, large-grit and acid-etched substrate. The HMN surface topography was simply controlled by adjusting the tantalum (Ta) target power of the TIPS technique, which is directly related to the Ta ion flux and the surface chemical composition of the substrate. Characterization using scanning electron microscopy (SEM), transmission electron microscopy (TEM), and laser scanning microscopy (LSM) verified that well-defined nano-patterned surface structures with a depth of ~ 300 to 400 nm and a width of ~ 60 to 70 nm were uniformly distributed and followed the complex micron-sized surface geometry. In vitro cellular responses of pre-osteoblast cells (MC3T3-E1) were assessed by attachment and proliferation of cells on flat, nano-roughened, micro-roughened, and an HMN surface structure of Ti6Al4V-ELI. Moreover, an in vivo dog mandible defect model study was used to investigate the biological effect of the HMN surface structure compared with the micro-roughened surface. The results showed that the surface nanostructure significantly increased the cellular activities of flat and micro-roughened Ti, and the bone-to-implant contact area and new bone volume were significantly improved on the HMN surface structured Ti. These results support the idea that an HMN surface structure on Ti6Al4V-ELI alloy has great potential for enhancing the biological performance of dental implants. - Highlights: • A micro-nano-hierarchical (MNH) surface structure on Ti6Al4V-ELI was fabricated via TIPS
International Nuclear Information System (INIS)
Moon, Byeong-Seok; Kim, Sungwon; Kim, Hyoun-Ee; Jang, Tae-Sik
2017-01-01
Hierarchical micro-nano (HMN) surface structuring of dental implants is a fascinating strategy for achieving fast and mechanically stable fixation due to the synergetic effect of micro- and nano-scale surface roughness with surrounding tissues. However, the introduction of a well-defined nanostructure on a microstructure having complex surface geometry is still challenging. As a means of fabricating HMN surface on Ti6Al4V-ELI, target-ion induced plasma sputtering (TIPS) was used onto a sand-blasted, large-grit and acid-etched substrate. The HMN surface topography was simply controlled by adjusting the tantalum (Ta) target power of the TIPS technique, which is directly related to the Ta ion flux and the surface chemical composition of the substrate. Characterization using scanning electron microscopy (SEM), transmission electron microscopy (TEM), and laser scanning microscopy (LSM) verified that well-defined nano-patterned surface structures with a depth of ~ 300 to 400 nm and a width of ~ 60 to 70 nm were uniformly distributed and followed the complex micron-sized surface geometry. In vitro cellular responses of pre-osteoblast cells (MC3T3-E1) were assessed by attachment and proliferation of cells on flat, nano-roughened, micro-roughened, and an HMN surface structure of Ti6Al4V-ELI. Moreover, an in vivo dog mandible defect model study was used to investigate the biological effect of the HMN surface structure compared with the micro-roughened surface. The results showed that the surface nanostructure significantly increased the cellular activities of flat and micro-roughened Ti, and the bone-to-implant contact area and new bone volume were significantly improved on the HMN surface structured Ti. These results support the idea that an HMN surface structure on Ti6Al4V-ELI alloy has great potential for enhancing the biological performance of dental implants. - Highlights: • A micro-nano-hierarchical (MNH) surface structure on Ti6Al4V-ELI was fabricated via TIPS
The inextricable saga of „pay for delay” cases: the EU versus the US approach / Marianna Meriani
Meriani, Marianna
2017-01-01
Konkurentsi ja seaduslike äristrateegiate seostest ning makseid sisaldavatest patendialastest kompromisskokkulepetest farmaatsiatööstuse näitel ELi ja Ameerika Ühendriikide käsitluste võrdluses
Paas, Tiiu, 1949-
2004-01-01
Uurimistulemused kinnitavad piiriüleste kaubandussidemete olemasolu ning Läänemere regiooni riikide omavahelise kaubandusintegratsiooni tugevust ühinevas Euroopas, millega tuleb EL-i regionaalpoliitika kujundamisel arvestada. Diagrammid. Tabel
Regionalnõje energetitsheskije problemõ JeS i stranõ Baltii / Eugene Eteris
Eteris, Eugene
2006-01-01
Ilmunud ka: The Baltic Course 2007 Winter (nr. 24) lk. 38-39. ELi energiaturg ning Baltimaade energeetika probleemid. Võimalikud lahendused. Alternatiivne energeetika. Tabel: Gaasi ja elektrienergia hinnad Euroopas
Fostering deep and comprehensive free trade agreements for the eastern partners / Per Magnus Wijkman
Wijkman, Per Magnus
2011-01-01
Laiaulatusliku ja kõikehõlmava vabakaubanduslepinguga (DCFTA) liitumise läbirääkimistest ELi idapartnerluse riikidega. Ida-Euroopa riikide ühinemisest kaupade ja teenuste vaba liikumisega. Joonised
Agriculture sector looks to restors profitability / Aleksei Gunter
Gunter, Aleksei, 1979-
2004-01-01
Väikeste põllumajandusettevõtete olukord halveneb EL-is eelkõige tänu kehtestatavatele kvootidele, rangetele normidele ja regulatsioonidele. Kommentaarid Eesti Põllumajandusülikooli professorilt Andres Annukilt
LNG terminalil on idaraha keeld / Raimo Poom
Poom, Raimo
2011-01-01
Euroopa Komisjon kiirustab Balti riike LNG (vedeldatud maagaasi) terminali asukohas kokku leppima. Kolmest tingimusest, millele peab LNG terminali projekt vastama, et tekiks võimalus kandideerida EL-i toetusele
Freak weather throws Balts into confusion / Talis Saule Archdeacon
Archdeacon, Talis Saule
2007-01-01
Erakordselt soe talv Baltimaades võib kahjustada suusakeskuste ja põllumajandusettevõtete majandustulemusi. Baltimaade võimalused EL-i uue kasvuhoonegaaside vähendamist nõudva keskkonnastrateegia täitmiseks
19 CFR 101.4 - Entry and clearance of vessels at Customs stations.
2010-04-01
... Jacksonville. Port St. Joe Panama City. Indiana Fort Wayne Indianapolis. Maine Bucksport Belfast. Coburn Gore.... Ely Duluth, MN-Superior, WI. Lancaster Noyes. Oak Island Warroad. Mississippi Biloxi Mobile, AL...
Sotsiaalne kapital ja majandusareng Euroopa Liidu kandidaatmaades / Eve Parts
Parts, Eve, 1970-
2003-01-01
Ülevaade sotsiaalse kapitali tasemest EL-i kandidaatmaades, kas ja kuidas mõjutab kandidaatriikide sotsiaalse kapitali taset liitumine EL-iga, kuidas oleks võimalik sotsiaalse kapitali akumulatsiooni kiirendada. Tabelid
Schengen Facility hankeprojektid on täies hoos / Helena Loorents
Loorents, Helena
2005-01-01
Schengen Facility toetusest uutele EL-i liikmesriikidele. Schengen Facility programmi vahenditest toetatakse Eesti piirivalvele RIB C-1100 tüüpi paatide ning piirivalvekopter hankimist, valminud on uus merevalvekeskus
Rethinking the principle of subsidiarity / Erkki Vedder
Vedder, Erkki
2004-01-01
Peipsi Koostöö Keskus oli üks 22 partnerist, kes osales EL-i Activite Citizens Network'i poolt algatatud projektis, mille raames tutvustati horisontaalse subsidiaarsuse printsiipi erinevates riikides
Uwera, Giesele
2016-01-01
Probleemist, kas investori ja riigi vaidluse lahendamine on kooskõlas ELi õigusega ja kui, siis millistel tingimustel. Liikmesriikide ja kolmandate riikide vahel sõlmitavatest investeeringuid käsitlevatest lepingutest
Experimental Validation of BDI Agents for Distributed Control of Electric Power Grids
DEFF Research Database (Denmark)
Issicaba, Diego; Rosa, Mauro A.; Prostejovsky, Alexander Maria
2017-01-01
This paper presents initial laboratory experiments designed to test belief-desire-intention agent reasoning in a webof-cell context. The work introduces the application of the bridge between JASON and the Common Artifact Infrastructure for Agents Open Environments to agent and environment modelin...
Ukraina on nõus WTO nimel ekspordimakse vähendama / Signe Ratso ; interv. Sirje Rank
Ratso, Signe, 1960-
2008-01-01
Euroopa Komisjoni kaubanduse peadirektoraadi direktor Signe Ratso vastab küsimustele Ukraina liitumise kohta WTO-ga ning Ukraina ja EL-i vabakaubanduslepingu sõlmimise kohta. Lisa: Euroopa Liit ja Ukraina
Männasoo, Kadri
2005-01-01
Uuringust selgus, et kõrgem laenu osakaal panga varades viitas EL-i uute liikmesriikide puhul riskantsematele pankadele, Kesk- ja Ida-Euroopa riikide puhul oli sama fenomen stabiilsemate pankade tunnuseks. Tabelid
Veemajandus saab jõudsalt areneda / Aare Lepaste
Lepaste, Aare, 1970-
2004-01-01
8. detsembril kirjutasid seitsme vee-ettevõtte esindajad, KIK-i juhataja ja keskkonnaminister alla Eesti suurimale keskkonnaprojektile. Projekti eesmärk on viia omavalitsuste veemajanduse infrastruktuur vastavusse EL-i direktiividega.
Europarechtliche Probleme bei Verlust beamtenrechtlicher Versorgungsanwartschaften / Arno Bokeloh
Bokeloh, Arno
2017-01-01
Töötajate vabast liikumisest ELis ja riigiametnike sotsiaalkaitsest (eelkõige pensionikindlustusest) erasektorisse või teise liikmesriiki tööle suundumisel Euroopa Kohtu lahendi C-187/15 põhjal
LEADER jõudis Eestisse / Harda Roosna
Roosna, Harda, 1956-
2006-01-01
EL-i maaelu toetusprogrammi LEADER+ rakendamist on katsetatud Põlva-, Valga-, Pärnu- ja Võrumaal. Hiiumaal arutletakse programmi rakendamiseks vajaliku tegevusgrupi moodustamise üle märtsis. Lisad: Ajalugu; Näited
Portugal: uus valitsus, vanad probleemid. Reformidest pole pääsu / Katri Soe-Surén
Soe-Surén, Katri
2011-01-01
Valimiste-eelsete küsitluste kohaselt on Portugali ennetähtaegsetel parlamendivalimistel oodata võimuvahetust. EL-i ja IMF-i finantsabist Portugalile, Portugali säästuplaanist, plaanitavatest reformidest, erastamisprogrammist
Tulevikukujundaja avaldas kavandi Ühendatud Euroopast / Kaivo Kopli
Kopli, Kaivo
2002-01-01
Prantsuse endine president Valery Giscard d'Estaing, kes juhib Euroopa tulevikku kavandavat konventi, esitas esialgse plaani EL-i tulevikust Ühendatud Euroopa või lausa Euroopa Ühendriikide nime all
Eesti Vabariigi president Arnold Rüütel kuulab naise sõna / Arnold Rüütel ; interv. Argo Soolep
Rüütel, Arnold
2001-01-01
Ilmunud ka Severnoje Poberezhje : Subbota (2001/Oct/13) lk. 5 ; Narvskaja Nedelja (2001/Oct/13) lk. 6. Eesti arengut on vaja tasakaalustada, leiab vastne president. Suhtumine EL-i, elektrijaamade erastamisesse
Prodavaja Estoniju zapadu / Toomas Hendrik Ilves ; interv. Charles Ehnman
Ilves, Toomas Hendrik, 1953-
1998-01-01
Tõlge Toomas Hendrik Ilvese antud intervjuust Kanada ajalehele "The Ottawa Citizen". Eesti majanduse olukord, ühinemine EL-i ja NATO-ga. Venelaste integreerimise tingimused. Kanada-Eesti suhted. Majanduslik olukord Venemaal
Conceptual design of 100 J cryogenically-cooled multi-slab laser for fusion research
Directory of Open Access Journals (Sweden)
Divoky M.
2013-11-01
Full Text Available We present a comparison of two alternative laser layouts for HiLASE and ELI Beamlines projects. The cryogenically cooled laser is 100 J class with 2 ns pulse length and operates at 10 Hz repetition rate. The laser beam is intended for industrial applications in HiLASE, for OPCPA pumping in ELI Beamlines and can serve as a test bed for large scale high repetition rate fusion lasers. First layout utilizes classical scheme with preamplifier and main amplifier, while the second layout utilizes single amplifier scheme with two amplifier heads. The comparison is based on the results obtained from homemade MATLAB code for evaluation of amplified spontaneous emission and stored energy and on a beam propagation simulated in MIRÓ code.
Euroopa viis kriisi kartus pühenduda / Jeremy Rifkin ; interv. Arko Olesk
Rifkin, Jeremy
2005-01-01
Ameerika mõjukas mõtleja ja majandusteadlane Prantsusmaa ning Hollandi Euroopa Liidu põhiseaduse tagasilükkamise mõjust organisatsiooni arengule, ELi laienemise mõjust vanadele ja uutele liikmesriikidele, Eesti majandusmudelist
Portugali saadik : Venemaaga räägime kõigest / Ana Paula Zacarias ; interv. Raimo Poom
Zacarias, Ana Paula
2007-01-01
Euroopa Liidu uue eesistujamaa Portugali suursaadik Eestis Ana Paula Zacarias Euroopa Liidu välispoliitika kujundamise põhimõtetest, suhetest Venemaaga, tööst EL-i põhiseaduslepingut asendava reformilepinguga
2004-01-01
Innovaatilise ettevõtluse arendamise projektist, mis keskendub EL-i liikmes- ning kandidaatriikide väike- ja keskmiste ettevõtete innovaatilise ettevõtluspotentsiaali arendamisele rahvusvahelise teabevahetuse ning tehnoloogiasiirde partnerluse kaudu. Tabelid. Skeem
Tiblafoobia ja euro-optimism / Mihhail Stalnuhhin
Stalnuhhin, Mihhail, 1961-
2002-01-01
Ilmunud ka: Pravo i Pravda detsember nr. 13 lk. 8. Autor arutleb, miks Eesti muulased suhtuvad EL-i astumisse optimistlikumalt kui eestlased. Kriitika russofoobia levikule Eesti ühiskonnas. Autor: Keskerakond. Parlamendisaadik
Parts, Juhan, 1966-
2003-01-01
Peaminister Juhan Parts Euroopa Liiduga liitumise mõjust Eesti iseseisvusele ja rahvusliku identiteeti säilimisele, julgeolekule ning majanduslikule arengule, Eesti rollist EL-i piiririigina, euroliidu võimalikest arengusuundadest kaugemas perspektiivis
Verheugen tahab EL-ist teha arvestava kosmosejõu / Arko Olesk
Olesk, Arko, 1981-
2007-01-01
Euroopa Komisjoni tööstusvolinik Günter Verheugen peab oluliseks ühiseid suuri kosmoseprojekte. Ekspertide koosolekust Münchenis, kus arutati EL-i ühise globaalse keskkonna- ja julgeolekuvalve (GMES) arendamist
500 miljardi eurone abipakett eurotsoonile / Katri Soe-Surén
Soe-Surén, Katri
2011-01-01
Euroopa Stabiilsusfondi maht on vähemalt 500 mld. eurot, sellele võivad lisanduda vabatahtlikud maksed eurotsooni mitte kuuluvatelt EL-i liikmesriikidelt. Konkurentsivõime parandamise pakti osas on veel suuri lahkarvamusi
Eesti maaelu arengukava 2004-2006 toetused / Ülle Puusta
Puusta, Ülle
2005-01-01
Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 71-72. Eesti maaelu arengukava meetmete rahastamisallikateks on EL-i eelarve (80%) ning Eesti riigieelarve (20%)
Hofmann, Ekkehard
2016-01-01
ELi liikmesriikidele antavast rahalisest abist Kreeka näitel viimase 10 aasta jooksul; Kreeka kõrgema halduskohtu lahendist 2287/2015 pensionite vähendamise kohta ja selle õiguslikest tagajärgedest
Gaming the System: A Game Theory Analysis of Theater Airborne ISR
2014-02-13
Brown , Jason M., Col, USAF. "Strategy for Intelligence, Surveillance, and Reconnaissance." AWC Research Report, Air University, 2013. Builder, Carl H...Nathan, MAJ, USA (division collection manager in Regional Command – South, 2012- 2013), Interview by Author. September 2013. Morgan, Gareth . Images of
Video - Real Rights: Decentralization and Women in South Asia ...
International Development Research Centre (IDRC) Digital Library (Canada)
2010-10-20
Oct 20, 2010 ... Material from the videos are based on research projects lead by the Centre for Development Studies, ForestAction, Rural Support Programmes, Society for Promoting Participative Eco-System Management, and UNATI – Organization for Development Education. Photography and video are by Jason Taylor.
2012-12-26
... was to include identification of gaps and areas appropriate for consolidation with on-going efforts... of constrained financial resources in the coming years and believe the PRTF's review will provide... comments. Dated: December 17, 2012. Jason Donaldson, Chief Financial Officer, Office of Oceanic and...
Review of Capitalism in the Web of Life. Ecology and Accumulation of Capital (Moore, 2015
Directory of Open Access Journals (Sweden)
Germán Palacio
2017-01-01
Full Text Available Jason Moore. 2015. Capitalism in the Web of Life. Ecology and Accumulation of Capital [Capitalismo en la red de la vida. Ecología y acumulación de capital]. London New York: Verso Books. 336 pp. ISBN 978-1781689028.
Combined Arms in the Electro-Magnetic Spectrum: Integrating Non-kinetic Operations
2013-05-23
Greene , Robert. The 33 Strategies of War. New York: Penguin, 2007. Halpern, Jason. IP Telephony Security in Depth. Cisco Systems, 2003...Theory of John Boyd. New York, NY: Routledge, 2007. Paiget, J., & Inhelder, B. Memory and Intelligence. London: Routledge and Kegan Paul, 1973. Qiao
[1012.5676] The Exoplanet Orbit Database
: The Exoplanet Orbit Database Authors: Jason T Wright, Onsi Fakhouri, Geoffrey W. Marcy, Eunkyu Han present a database of well determined orbital parameters of exoplanets. This database comprises parameters, and the method used for the planets discovery. This Exoplanet Orbit Database includes all planets
Digital Repository Service at National Institute of Oceanography (India)
Sreejith, K.M.; Rajesh, S.; Majumdar, T.J.; Rao, G.S.; Radhakrishna, M.; Krishna, K.S.; Rajawat, A.S.
') geoid anomaly map of the northern Indian Ocean generated from the altimeter data obtained from Geodetic Missions of GEOSAT and ERS-1 along with ERS-2, TOPEX/POSIDEON and JASON satellites is presented. The geoid map of the Indian Ocean is dominated by a...
Kuula. Kuu artist The Verve. Kuu plaat / Mart Juur
Juur, Mart, 1964-
2008-01-01
Inglise ansamblist. Heliplaatidest: Rulers of the Deep "Ready to Go Overground", Roni Size Reprazent "New Forms", Jason Mraz "We sing, We dance, We Steal Things", Morten Harket "Letter From Egypt", Primal Scream "Beautiful Future", Bill Frisell "History, Mystery", We Are Scientists "Brain Thurst Mastery"
Asevälisminister Tshizhov avas Vene kaardid / Vladimir Tshizhov ; interv. Toomas Sildam
Tshizhov, Vladimir
2004-01-01
Vene asevälisminister rääkis visiidil Tallinna ajakirjanikele Venemaa murest seoses EL-i laienemisega euroliidu-Venemaa partnerluslepingust, Eesti-Vene suhetest, slaavi vähemustest Eestis, NATO kohustustest Venemaa suhtes
Vizõ reshajut vsjo / Jevgenija Garanzha
Garanža, Jevgenija, 1979-
2004-01-01
Euroopa Komisjoni ja Venemaa läbirääkimistest, ettepanekutest lihtsustatud korra kehtestamise kohta Venemaa kodanikele viisade väljastamisel, mis viiks kaugemas tulevikus viisavabaduse kehtestamiseni Venemaa ja EL-i vahel
Riik õpetab, kuidas kodud säästvalt soojaks saada / Kadri Bank
Bank, Kadri
2008-01-01
Riik kulutab järgneva kuue aasta jooksul elamute energiasäästlikumaks muutmisele 300 miljonit Euroopa Liidu eluasemepoliitikale mõeldud rahast. Diagramm: Energiatarbimine EL-is. Kommenteerivad Harri Paabo ja Jaan Tepp
Luubi all : www.lilly.com / Piret Potisepp
Potisepp, Piret
2009-01-01
Ravimifirma Eli Lilly & Company kogemusi, kuidas uusimate teadusuuringute tulemusi ravimitööstuses kasutades on võimalik arendada jätkusuutlikku tootmist ning laiendada tooteportfelli koostöövõrgustiku kujundamise teel
Mari e-raamatukogu / Tatjana Verina ; vene keelest tõlkinud Ene Riet
Verina, Tatjana
2011-01-01
Mari e-raamatukogu loomise aluseks on Mari-Eli Vabariigi etnokultuuriliste ja rahvusvaheliste suhete arendamise projekt, hetkel on elektroonilises raamatukogus 52 täistekstilist teavikut Tšavaini nimelise Mari Rahvusraamatukogu haruldaste raamatute kogust
Godovshtshina bez eiforii / Aleksei Klepikov
Klepikov, Aleksei
2005-01-01
EL-i ja NATO-ga liitumise mõjudest Baltimaade elanike turvatundele ning majandusele. Arvamust avaldavad Tiit Matsulevitsh, Ivar Sikk, Toivo Kuldkepp jt. Toimetuse kommentaar. Diagramm: Inflatsioonimäärad Ida-Euroopa riikides
Lithuanians lead way to the EU
2003-01-01
Leedus toimunud euroreferendumil hääletas 91% osalenutest EL-iga liitumise poolt. Eesti ja Läti EL-i pooldajate hinnangul avaldab see positiivset mõju referendumi tulemustele ka teistes Balti riikides
Managergehälter als Gegenstand europäischer und staatlicher Regulierung / Ulrich Jan Schröder
Schröder, Ulrich Jan
2016-01-01
Investeerimispankurite lisatasudest. Tegevjuhtide, juhatuste ja järelevalvenõukogude töö hüvitamise regulatsioonist ELi (nt direktiiv 2013/36/EL) ja Saksa õiguses. Hüvitiste regulatsiooni põhiõiguslikest piiridest
Back to the future: the UK’s EU exit and the conflict of laws / Andrew Dickinson
Dickinson, Andrew
2016-01-01
Suurbritannia EList lahkumise mõjust Suurbritannia tsiviilkohtusüsteemile ja rahvusvahelise eraõiguse normide kohaldamisele piiriüleste kaubandus- ja tsiviilvaidluste lahendamisel; rahvusvahelise eraõiguse, ELi õiguse ja riigisisese õiguse tõlgendamisest
Säre, Margit
2004-01-01
2003. a. käivitunud rahvusvaheline projekti Jõgede Dialoog eesmärgiks on uurida uusi efektiivseid meetodeid avalikkuse kaasamiseks veemajandus-alaste otsuste tegemisse. Üldsuse osalust nõuab EL-i Veepoliitika Raamdirektiiv
Ahnus ajab Euroopa Liidu upakile / Uno Silberg
Silberg, Uno, 1964-
2002-01-01
Autori sõnul on EL-i ittalaienemise eesmärk seniste liikmesriikide heaolu suurendamine liituda soovivate maade arvel. Vanade ja uute liikmesriikide võrdset kohtlemist ei ole EL-il kavaski olnud. Euroskeptitsism
Birma sõjavägi jätkab protestide mahasurumist toore jõuga / Karin Dean
Dean, Karin
2007-01-01
Sõjaväe ja meeleavaldajate kokkupõrgetest Birmas, armee rünnakutest kloostritele ja protestijatele, mille tulemusel on hukkunuid. ÜRO ja EL-i hukkamõistvast suhtumisest. Lisa: Sõjaväeline Birma
The impact of the EU support measures to Estonian agriculture / Sirli Jurjev
Jurjev, Sirli, 1976-
2003-01-01
Ülevaade praegusel ajal Eestis makstavatest põllumajandustoetustest ning EL-i ühtse põllumajanduspoliitika ja selle reformiga kehtestatud toetusskeemidest. Kalkulatsiooni aluseks on Eurostati metoodikal põhinev põllumajanduse majanduslik arvestus. Tabelid
Jevropa boretsja s tsenovõm krizisom / Aleksei Toom
Toom, Aleksei
2008-01-01
EL suurendab Euroopa riikide puudust tundva elanikkonna toiduabile eraldatud summat 300 miljonilt eurolt 500 miljoni euroni. Nafta ja toiduainete hinna pidurdamatu tõus on pannud EL-i juhid otsima teid kriisi peatamiseks
Adamkus, Kirkilas take Lithuania's energy case to East European partners
2008-01-01
Euroopa tuumaenergia foorumil esinedes palusid Leedu peaminister Gediminas Kirkilas ja president Valdas Adamkus EL-i partneritel taas kaaluda Ignalina tuumajaama lahtiolekuaja pikendamist. Hispaania ja Tšehhi esindaja ning Jose Manuel Barroso arvamused
„EU”: short for „ethical” union? The role of ethics in European Union law / Markus Frischhut
Frischhut, Markus
2015-01-01
Eetika ja moraali põhimõtetest ELi esmases ja teiseses õiguses ning institutsioonide tegevuses; Euroopa Kohtu praktikast ning Teaduse ja uute tehnoloogiate eetika Euroopa töörühma (EGE) hinnangutest
Directory of Open Access Journals (Sweden)
Zhao J
2014-02-01
Full Text Available Jingping Zhao,1 Jianjun Ou,1 Haibo Xue,2 Li Liu,2 William Montgomery,3 Tamas Treuer4 1Mental Health Institute of The Second Xiangya Hospital, Hunan Province Technology Institute of Psychiatry, Key Laboratory of Psychiatry and Mental Health of Hunan Province, Central South University, Changsha, Hunan, 2Lilly Suzhou Pharmaceutical Co, Ltd, Jiangsu, People's Republic of China; 3Global Health Outcomes, Eli Lilly and Company, Sydney, Australia; 4Emerging Markets Business Unit (Neuroscience, Eli Lilly and Company, Budapest, Hungary Abstract: The primary objective of this systematic review was to examine the evidence for the efficacy, effectiveness, and safety of orally disintegrating olanzapine in Chinese populations. A systematic literature search was conducted using databases covering international and Chinese journals, ClinicalTrials.gov, and internal and external trial registries at Eli Lilly and Company using search terms related to target countries (People's Republic of China, Hong Kong, and Taiwan and orally disintegrating olanzapine treatment. A publication and one clinical study report were retrieved. The clinical study showed orally disintegrating olanzapine and the standard oral tablet to have similar efficacy and tolerability profiles. A bioequivalence study has shown that orally disintegrating olanzapine and the standard oral tablet have similar pharmacokinetic profiles. Orally disintegrating olanzapine and the standard oral tablet have similar efficacy and tolerability profiles. Keywords: orally disintegrating, olanzapine, Chinese, schizophrenia, patients
Microsoft vaidlustas ELi nõudmised kohtus / Sirje Rank
Rank, Sirje, 1966-
2006-01-01
Microsoft kaebas Euroopa Komisjoni konkurentsiameti otsuse, mille eesmärgiks oli reguleerida Microsofti tegevust turul, Euroopa esimese instantsi kohtusse. Vt. samas: Microsofti vastasseis Euroopa konkurentsiametnikega
Majanduse tulemuslikkus ELi riikide enda asi / Stefano Micossi
Micossi, Stefano
2004-01-01
Autori hinnangul peaks Euroopa Komisjoni uus koosseis Lissaboni strateegia kõrvale jätma, keskendudes selle asemel Euroopa ühisturu loomise lõpuniviimisele ning liikmesriikide eelarvepoliitikate kontrolli all hoidmisele
Bosnia esimesed sammud EL-i teel / Krister Paris
Paris, Krister, 1977-
2005-01-01
EL alustas Bosnia ja Hertsegoviinaga läbirääkimisi stabilisatsiooni ja assotsiatsioonilepingu sõlmimiseks. Riigi kolme etnilise grupi - serblaste, horvaatide ja muslimite juhid andsid lubaduse luua ühtne riigipea ametikoht. Olukorrast Bosnias ja Hertsegoviinas kümme aastat pärast Daytoni rahuleppe sõlmimist. Skeem: Riigi ülesehitus. Vt. samas: Ahtisaari üritab Kosovo staatust kokku leppida
Õiglasem ja moodsam ELi arve / Jack Straw
Straw, Jack
2005-01-01
Suurbritannia välisminister selgitab Suurbritannia kui Euroopa Liidu eesistujamaa poolt esitatud ettepanekuid Euroopa Liidu järgmise, 2007.-2013. aasta eelarveperioodi rahastamiskava kohta ning kinnitab, et Suurbritannia on valmis maksma oma osa ühenduse eelarvesse, kuid ainult oma õiglase osa
Vaja on uut kliimakokkulepet / Urmas Paet, Per Stig Moller
Paet, Urmas, 1974-
2007-01-01
Leevendamaks kliimamuutuste mõjusid ning tagamaks usaldusväärsed ja soodsad energiatarned, tuleb teha karme otsuseid. EL-i ülesanne on toetada keskkonnasõbralike tehnoloogiate arendamist ja julgustada energiaefektiivsemat tarbijakäitumist
Beckers, Anna
2017-01-01
Ettevõtete sotsiaalse vastutuse poliitika õiguslikust määratlemisest ELi õiguses tarbijakaitse direktiivide 2005/29/EÜ (ebaausad kaubandustavad ettevõtjate ja tarbijate vahel) ja 1993/13/EMÜ (ebaõiglased tingimused tarbijalepingutes) taustal
Talvik, Andres, 1947-
2002-01-01
Eesti suursaadik Prantsusmaal Andres Talvik Prantsusmaa presidendivalimistest, paremäärmuslase Jean-Marie Le Peni pääsemisest selle II vooru, prantslaste vastuseisust EL-i laienemisele, Prantsuse-Saksa suhetest. Andres Talviku elulooandmeid
Omavalitsuse areng sõltub liialt toetustest / Merit Tatar
Tatar, Merit
2005-01-01
Kohalike omavalitsuste vajaduste selgitamiseks viis Innopolis Konsultatsioonid AS koostöös SEB Eesti Ühispangaga läbi uuringu, mis kaardistas omavalitsuste ootused ja vajadused seoses EL-i struktuurivahendite jaotamisega 2007-2013.
Baltic PMs urge support for EU
2003-01-01
Eesti peaministri Juhan Partsi, Läti peaministri Einars Repshe ja Leedu peaministri Algirdas Brazauskase ühisavaldusest Eestile ning Lätile järgimaks Leedu eeskuju referendumil EL-i poolt hääletamises
Sotsiaalse kapitali mõju majanduse jätkusuutlikule arengule / Agne Nettan
Nettan, Agne
2004-01-01
Majanduse jätkusuutliku arengu ja sotsiaalse kapitali mõistetest, seosest majandusarenguga; sotsiaalse kapitali mõjust majanduslikule arengule EL-i liikmes- ja kandidaatriikides, kasutades alternatiivseid jätku- ja haldussuutlikkuse näitajaid
Valitsus sel korral sügisest majandusennustust ei tee / Raimo Poom
Poom, Raimo
2009-01-01
Rahandusministeeriumi osakonnajuhataja Andrus Sääliku selgitusel on sügisese majandusprognoosi edasilükkamise taga EL-i otsus lükata sel aastal stabiilsus- ja konvergentsiprogrammide raportite esitamine kaks kuud edasi. Diagramm
Lithuania lifts ban on EU-Russia talks / Rokas M. Tracevskis
Tracevskis, Rokas M.
2008-01-01
Leedu nõustus loobuma oma vetost Venemaa ja EL-i vahelise strateegilise partnerlusleppe kõneluste alustamisele. Leedu, Poola, Rootsi ja Sloveenia välisministrid otsustasid arvestada kõnelustes ka Leedu tõstatatud probleeme
Hoffman, Jan
2011-01-01
ELi direktiivist (1999/94), milles käsitletakse kütusesäästuga ja süsinikdioksiidi heitmetega seotud andmete tarbijale kättesaadavust uute sõiduautode turustamisel, rakendamisest Poolas ja Saksamaal
Baltic companies prepare for stiff competition / Jorgen Johansson
Johansson, Jorgen
2001-01-01
"Baltic Sea Partenariat 2001" on Rootsi valitsuse toetatav projekt ärisidemete arendamiseks Rootsi ja Baltimaade ettevõtete vahel ning aitamaks läänemeremaade väikeettevõtetel valmistuda konkurentsiks EL-i turul
A million trees for joining Europe / Aleksei Gunter
Gunter, Aleksei, 1979-
2004-01-01
Mai esimesel nädalal istutavad laulu- ja tantsupeost osavõtjad ligikaudu miljon uut puuistikut. Kommentaarid metsaistutamise eestvedajatelt, Eesti Laulu- ja Tantsupeo Fondi esinaiselt Aet Maateelt ja EL-i infosekretariaadi juhilt Hannes Rummilt
SOLVIT ئ abimees EL siseturul tekkivate probleemide lahendamisel
2008-01-01
Majandus- ja kommunikatsiooniministeeriumis asuvast SOLVIT keskusest, mis on koostöövõrgustik ELi liikmesriikide vahel ja aitab lahendada siseturu probleeme kohtuväliselt. Täiendav teave aadressilt: http://www.mkm.ee/solvit
"See on etnotsiid puhtal kujul!" / Vladimir Kozlov ; interv. Igor Taro
Kozlov, Vladimir
2005-01-01
Mari rahvusliidri arvates oli talle korraldatud rünnak seotud tema tegevusega. Olukorrast Marimaal, kus kõrvaldatakse marisid juhtivatelt ametikohtadelt, raskes seisus on praegu ka udmurdid, mordvalased ja komid. Kaart: Mari Eli Vabariik
75 FR 7291 - Northeastern Great Basin Resource Advisory Council Meetings, Nevada
2010-02-18
...., Elko, Nevada; June 17 and 18 at the Eureka Opera House, 31 S. Main St., Eureka, Nevada; and September...; September 30 (Ely)--minerals, grazing, energy, and sustainable development Managers' reports of field office...
Parts : oleme valmis kompromissideks / Juhan Parts ; interv. Külli-Riin Tigasson
Parts, Juhan, 1966-
2004-01-01
Peaminister Juhan Parts vastab küsimustele, mis on seotud Brüsselis algava Euroopa Liidu ülemkogu ehk EL-i valitsusjuhtide tippkohtumisega, põhiseaduse lepingu projektiga. Vt. samas: Volinike arvu piiramine kasulik
Põlvamaa veeprojektidesse paigutatakse ligi 157 miljonit / Raivo Sihver
Sihver, Raivo
2008-01-01
AS-i Põlva Vesi juhataja Olev Elmik ja AS-i Water Ser tegevjuht Indrek Hiiemäe allkirjastasid Põlvamaa veeprojekti 22 ehituslepingust neli Räpina lepingut. 85% rahast tuleb EL-i Ühtekuuluvusfondist
Sangaji, Maguy Kabuya; Mukuku, Olivier; Mutombo, Augustin Mulangu; Mawaw, Paul Makan; Swana, Edouard Kawawa; Kabulo, Benjamin Kasongo; Mutombo, André Kabamba; Wembonyama, Stanis Okitotsho; Luboya, Oscar Numbi
2015-01-01
Introduction Le rotavirus est un problème de santé publique, non seulement dans les pays en développement où tous les enfants sont infectés avant l’âge de deux à trois ans mais aussi dans les pays développés où les conditions d'hygiène sont bonnes. La présente étude est la première à fournir des informations sur la prévalence de l'infection à rotavirus dans les diarrhées aiguës des nourrissons dans la ville de Lubumbashi. Elle s'est fixée comme objectifs de déterminer la fréquence hospitalière ainsi que la saisonnalité, les caractéristiques sociodémographiques, cliniques et évolutives de l'infection à Rotavirus chez les nourrissons admis à l'hôpital Jason Sendwe de Lubumbashi pour une diarrhée aiguë. Méthodes Il s'agit d'une étude descriptive et transversale menée pendant la période allant du 1er janvier au 31 décembre 2012. Les paramètres épidémio-cliniques et évolutifs (âge, sexe, saison, signes cliniques, nombre journalier de selles et évolution) des enfants diagnostiqués positifs au rotavirus ont été comparés à ceux des enfants dont le test au rotavirus était négatif. Le degré de signification était de 5%. Résultats Nous avons récolté 193 cas de diarrhées aiguës dont 104 nourrissons étaient infectés par le rotavirus soit 53,8%. Des taux élevés des diarrhées à rotavirus sont enregistrés au cours de la saison sèche comparativement à la saison des pluies (p0,05). Par ailleurs, les enfants infectés par le rotavirus étaient 6 fois plus susceptibles de présenter une déshydratation modérée/sévère (p0,05). Conclusion Le rotavirus est confirmé dans la ville de Lubumbashi et touche souvent les enfants d’âge ≤12 mois, pendant la saison sèche sans distinction de sexe et conduit rapidement à une déshydratation modérée/sévère. Une prise en charge adaptée et précoce permet d’éviter les décès et l'assainissement du milieu, le lavage des mains, la prise d'eau potable et la
2012-12-13
... Climate Change Science; The NCA Long-Term Process. Dated: December 6, 2012. Jason Donaldson, Chief Financial Officer/Chief Administrative Officer, Office of Oceanic and Atmospheric Research, National Oceanic... Assessment 2013 Draft Report. Review Editor Role In the NCA Process: One Review Editor for each NCA 2013...
Video - Real Rights: Decentralization and Women in South Asia ...
International Development Research Centre (IDRC) Digital Library (Canada)
Material from the videos are based on research projects lead by the Centre for Development Studies, ForestAction, Rural Support Programmes, Society for Promoting Participative Eco-System Management, and UNATI – Organization for Development Education. Photography and video are by Jason Taylor. Videos are in ...
2013-10-31
... India, the Republic of Korea, the Republic of the Philippines, Saudi Arabia, Taiwan, Thailand, the... Vladimirov at (202) 482- 0665 (the Philippines); Jason Rhoads at (202) 482-0123 (Saudi Arabia); Thomas... tubular goods from India, the Republic of Korea, the Republic of the Philippines, Saudi Arabia, Taiwan...
2013 Schroth faces of the future symposium to highlight early career professionals in Mycology
The 2013 Schroth Faces of the Future symposium was created to recognize early career professionals (those within 10 years of graduation) who represent the future in their field via innovative research. For this year, future faces in mycology research were recognized. Drs. Jason Slot, Erica Goss, Jam...
78 FR 10607 - National Sea Grant Advisory Board
2013-02-14
... extension, science and technology programs, and other matters as described in the agenda found on the National Sea Grant College Program Web site at http://www.seagrant.noaa.gov/leadership/advisory_board.html....seagrant.noaa.gov/leadership/advisory_board.html . Dated: February 6, 2013. Jason Donaldson, Chief...
Secretary of the Navy Professor of Oceanography
2013-11-18
of Oceanography, La Jolla, CA; 5-10 June 2011 Attended: Algae + Fish = Ocean Mixing? Conference, La Jolla, CA; 5-6 July 2011 Attended: JASON Summer...the scientific work of Klaus Hasselmann at the Max Planck Institute for Meteorology; Hamburg , Germany; 09 November 2011 Keynote Address: Nansen
77 FR 58175 - Resale Royalty Right
2012-09-19
... special instructions. FOR FURTHER INFORMATION CONTACT: Jason Okai, Counsel, Office of Policy and... copyright policy justification for enacting resale royalty right or droit de suite legislation in the United... and Montenegro, Tunisia, Turkey, Uruguay and Venezuela.\\8\\ \\6\\ See id. at 8; see also The Artist's...
2010-06-30
... and Nationality Act and Other Authorities AGENCY: Office of the Secretary, DHS. ACTION: Final rule... consolidated the asset seizure and forfeiture procedures for customs and immigration purposes. The interim... Ressin, Penalties Branch, U.S. Customs and Border Protection (202) 325-0050. For ICE: Jason J. Johnsen...
Investigating Alternatives to Broad-Scale Pesticide Spraying for Control of Lyme Disease Risk
More than 20,000 cases of Lyme disease are reported annually in the US. Here in the Northeast, the geographic range of the disease and infection rates continue to increase. Beginning this summer, scientists from EPA Region 1 (Robert Koethe, Bart Hoskins) and ORD (Jason Grear) w...
2014-12-22
Shona McLaughlin2, Jason S. H. Lo1, Chao Shi1, Jared Lenos3, and Andrew Vincelli4 1CanmetMATERIALS, Natural Resources Canada, 183 Longwood Road...Steel”, REVISTA DE METALURGIA, 2011, 47, 426-444. Figures Fig. 1 EMI shielding effectiveness calculated via Equation (1) vs
International Nuclear Information System (INIS)
Rogers, M.D.; Lakey, J.R.A.
1976-09-01
The activities of the Royal Naval College, Greenwich, Department of Nuclear Science and Technology, during 1975/1976 are reported under sections entitled: general; radiation physics and technology; environmental studies; chemistry and materials; engineering research; computing; the Jason Research and Training Reactor; personal research interest. (U.K.)
New laser-driven nuclear excitation studies. Concepts and proposals
International Nuclear Information System (INIS)
Drska, L.; Hanus, V.; Sinor, M.
2010-01-01
Complete text of publication follows. There has been a great interest in the processes of nuclear excitation and triggering in high-parameter laser-produced plasmas in recent years. A series of papers devoted to the theory of this event has been published. Several experiments have already been attempted to study the excitation of the lowest nuclear levels of medium / high-Z nuclides (Ta 181, U 235 etc.), all the same unsuccessful or inconclusive. In the first part of this paper, the situation will be overviewed and analysis of the reasons of this unsatisfactory state of affairs will be accomplished. Prospects of the possible solving of the problem by using novel / projected laser facilities (esp. LIL / PETAL, XFEL, ELI-Phase) will be outlined. Potential of the future ELI Beam Facility in the Czech Republic in this area will be stressed. In the second part, some proposals for the excitation and triggering studies using combined high-power and high-intensity LIL / PETAL system (2012) with multi-kilojoule and multi-petawatt parameters will be discussed. Results of preliminary simulations supporting the thinking about potential projects will be shown and conditions essential for meaningful effort in this area will be analyzed. Problems of realistic simulations of such experiments will be addressed. Completely novel chances for the excitation / triggering studies would be started by constructed / projected facilities XFEL (coherent X-rays ∼ 12 keV, 2014) and ELI (multi-petawatt Phase 1, 2015). Application of intense / coherent high-energy X-rays and / or intense electron / ion beams allows new experimental schemes, extends the range of nuclides to be studied and (maybe) will enable to test some new triggering methods. In the last part of the presentation some possibilities in point (esp. for ELI Beamlines), will be drawn up. Acknowledgements. This research has been supported by the Research Program no. 6840770022 of the Ministry of Education, Youth and Sports of the