WorldWideScience

Sample records for socioscientific issues ssi

  1. Science teachers teaching socioscientific issues (SSI): Four case studies

    Science.gov (United States)

    Lee, Hyunju

    Socioscientific issues (SSI) are a class of issues that represent the social, ethical, and moral aspects of science in society. The need for the inclusion of SSI into science curricula has been generally accepted, but relatively few science teachers have incorporated SSI into their courses. Most science teachers feel that their most important task by far is to teach the principles of science, and any substantive pedagogical changes represent a burden. However, there are some teachers who address SSI out of personal initiatives. This dissertation study investigates four high school science teachers who address SSI out of their own initiative and explores their deeper inspirations, values, philosophies, and personal ideals that lead them to teach SSI. The overall approach is based on essentialist methodology (Witz, Goodwin, Hart, & Thomas, 2001; Witz, 2006a) with its focus on "the participant as ally" and "essentialist portraiture." The primary data source is four to six in-depth interviews with individual teachers (about 40-90 minutes for each interview). The interviews are complemented by extensive classroom observations of individual teachers' teaching SSI and by document analysis (including teaching materials, rubrics, student group projects and journals, etc.). There are two major findings. First, the teachers' deeper values and ideals are a source of larger inspiration that plays a significant role in changing their teaching practice. This inspiration may involve higher aspects (e.g., deep concern for students' development, unselfishness, caring, etc.) and commitment. Their teaching represents an integration of their personal experiences, values, concerns, and worldviews, which forms a larger inspiration for teaching. Teaching SSI is a part of this larger process. Second, the current curriculum reforms (STS, SSI, and NOS) only suggest theoretical ideals and do not effectively touch teachers' deeper values and ideals. Basically, the teachers are doing what they

  2. Using Social Media to Promote Pre-Service Science Teachers' Practices of Socio-Scientific Issue (SSI) - Based Teaching

    Science.gov (United States)

    Pitiporntapin, Sasithep; Lankford, Deanna Marie

    2015-01-01

    This paper addresses using social media to promote pre-service science teachers' practices of Socio-Scientific Issue (SSI) based teaching in a science classroom setting. We designed our research in two phases. The first phase examined pre-service science teachers' perceptions about using social media to promote their SSI-based teaching. The…

  3. THE EFFECT OF 5E LEARNING CYCLE INSTRUCTIONAL MODEL USING SOCIOSCIENTIFIC ISSUES (SSI LEARNING CONTEXT ON STUDENTS’ CRITICAL THINKING

    Directory of Open Access Journals (Sweden)

    A. Cahyarini

    2016-11-01

    Full Text Available The aim of this study was to investigate the effect of 5E learning cycle instructional model using socioscientific issues (SSI learning context on students’ critical thinking skills of acid-base. This study used quasi-experimental posttest only control group design. The sample consisted of three classes, which were XI MIA-4class (n = 32 that learned using 5E LC model, XI MIA-5 class (n = 33 that learned using 5E LC+SSI, and XI MIA-6 class (n = 32 that learned using conventional method. The samples were choosen by convenience sampling technique. The test instrument consisted of 15 multiple choice items which were valid and reliable (r = 0.806. The data were analyzed using one way ANOVA test and LSD posthoc test. The results of this study indicated that the students who learned using 5E LC+SSI model showed greater levels of critical thinking skills (  = 74,95 than both the student who learned using 5E LC model (  = 74,17 and  the student who learned using conventional method (  = 68,96. Based on statistics analysis, there was significant differences on students’ critical thinkings between students taught using conventional method and students taught either using 5E LC+SSI model and 5E LC model. However,  there was no significant differences on students’ critical thinking skills between students taught using 5E LC+SSI model and the students taught using 5E LC model.

  4. Contribution of socio-scientific issues to development of critical

    Directory of Open Access Journals (Sweden)

    Solbes, Jordi

    2013-01-01

    Full Text Available In this paper we try to justify that socio-scientific issues can help to develop critical thinking of students, based on the science education and history of science. These considerations of the history of science can be transformed into socio-scientific issues (SSI, which can be used in science classes.

  5. Lack of Evolution Acceptance Inhibits Students' Negotiation of Biology-Based Socioscientific Issues

    Science.gov (United States)

    Fowler, S. R.; Zeidler, D. L.

    2016-01-01

    The purpose of this study was to explore science content used during college students' negotiation of biology-based socioscientific issues (SSI) and examine how it related to students' conceptual understanding and acceptance of biological evolution. The Socioscientific Issues Questionnaire (SSI-Q) was developed to measure depth of evolutionary…

  6. A Framework for Teachers' Assessment of Socio-Scientific Argumentation: An Example Using the GMO Issue

    Science.gov (United States)

    Christenson, Nina; Chang Rundgren, Shu-Nu

    2015-01-01

    Socio-scientific issues (SSI) have proven to be suitable contexts for students to actively reflect on and argue about complex social issues related to science. Research has indicated that explicitly teaching SSI argumentation is a good way to help students develop their argumentation skills and make them aware of the complexity of SSI. However,…

  7. Turkish Preservice Science Teachers' Socioscientific Issues-Based Teaching Practices in Middle School Science Classrooms

    Science.gov (United States)

    Genel, Abdulkadir; Topçu, Mustafa Sami

    2016-01-01

    Background: Despite a growing body of research and curriculum reforms including socioscientific issues (SSI) across the world, how preservice science teachers (PST) or in-service science teachers can teach SSI in science classrooms needs further inquiry. Purpose: The purpose of this study is to describe the abilities of PSTs to teach SSI in middle…

  8. Positive Emotional Responses to Hybridised Writing about a Socio-Scientific Issue

    Science.gov (United States)

    Tomas, Louisa; Ritchie, Stephen M.

    2012-01-01

    In order to understand better the role of affect in learning about socio-scientific issues (SSI), this study investigated Year 12 students' emotional arousal as they participated in an online writing-to-learn science project about the socio-scientific issue of biosecurity. Students wrote a series of hybridised scientific narratives, or BioStories,…

  9. Promoting the Role of the Personal Narrative in Teaching Controversial Socio-Scientific Issues

    Science.gov (United States)

    Levinson, Ralph

    2008-01-01

    Citizens participating in contemporary socio-scientific issues (SSI) need to draw on local knowledge and personal experience. If curricular developments in the teaching of controversial SSI are to reflect contemporary notions of citizenship then the personal narrative is an indispensable instrument in bridging the gap between the local/personal…

  10. Teaching with Socio-Scientific Issues in Physical Science: Teacher and Students' Experiences

    Science.gov (United States)

    Talens, Joy

    2016-01-01

    Socio-scientific issues (SSI) are recommended by many science educators worldwide for learners to acquire first hand experience to apply what they learned in class. This investigated experiences of teacher-researcher and students in using SSI in Physical Science, Second Semester, School Year 2012-2013. Latest and controversial news articles on…

  11. Socioscientific Issues-Based Instruction: An Investigation of Agriscience Students' Content Knowledge Based on Student Variables

    Science.gov (United States)

    Shoulders, Catherine W.; Myers, Brian E.

    2013-01-01

    Numerous researchers in science education have reported student improvement in areas of scientific literacy resulting from socioscientific issues (SSI)-based instruction. The purpose of this study was to describe student agriscience content knowledge following a six-week SSI-based instructional unit focusing on the introduction of cultured meat…

  12. Pre-service Science Teachers’ Self-efficacy Beliefs to Teach Socio-scientific Issues

    OpenAIRE

    Muğaloğlu, Ebru Z.; Küçük, Zerrin Doğança; Güven, Devrim

    2016-01-01

    This study aims to examine self-efficacy of pre-service science teachers to teach socio-scientific issues (SSI). Twenty-three senior pre-service science teachers participated in the study. Science Teaching Efficacy Belief Instrument (STEBI) was modified with an emphasis on SSI rather than scientific issues. The modified STEBI was applied to the participants before and after the intervention. As for the six-week intervention, three modules, which focused on understanding nature of SSI, teachin...

  13. Case Studies of Secondary School Teachers Designing Socioscientific Issues-Based Instruction and Their Students' Socioscientific Reasoning

    Science.gov (United States)

    Karahan, Engin

    Addressing socioscientific issues (SSI) has been one of the main focuses in science education since the Science, Technology, and Society (STS) movement in the 1970s (Levinson, 2006); however, teaching controversial socioscientific issues has always been challenging for teachers (Dillon, 1994; Osborne, Duschl, & Fairbrother, 2002). Although teachers exhibit positive attitudes for using controversial socioscientific issues in their science classrooms, only a small percentage of them actually incorporate SSI content into their science curricula on a regular basis (Sadler, Amirshokoohi, Kazempour, & Allspaw, 2006; Lee & Witz, 2009). The literature in science education has highlighted the signi?cant relationships among teacher beliefs, teaching practices, and student learning (Bryan & Atwater, 2002; King, Shumow, & Lietz, 2001; Lederman, 1992). Despite the fact that the case studies present a relatively detailed picture of teachers' values and motivations for teaching SSI (e.g. Lee, 2006; Lee & Witz, 2009; Reis & Galvao, 2004), these studies still miss the practices of these teachers and potential outcomes for their students. Therefore, there is a great need for in-depth case studies that would focus on teachers' practices of designing and teaching SSI-based learning environments, their deeper beliefs and motivations for teaching SSI, and their students' response to these practices (Lee, 2006). This dissertation is structured as three separate, but related, studies about secondary school teachers' experiences of designing and teaching SSI-based classes and their students' understanding of science and SSI reasoning. The case studies in this dissertation seek answers for (1) teachers' practices of designing and teaching SSI-based instruction, as well as its relation to their deeper personal beliefs and motivations to teach SSI, and (2) how their students respond to their approaches of teaching SSI in terms of their science understanding and SSI reasoning. The first paper

  14. Learning Science Content through Socio-Scientific Issues-Based Instruction: A Multi-Level Assessment Study

    Science.gov (United States)

    Sadler, Troy D.; Romine, William L.; Topçu, Mustafa Sami

    2016-01-01

    Science educators have presented numerous conceptual and theoretical arguments in favor of teaching science through the exploration of socio-scientific issues (SSI). However, the empirical knowledge base regarding the extent to which SSI-based instruction supports student learning of science content is limited both in terms of the number of…

  15. Students' Environmental NOS Views, Compassion, Intent, and Action: Impact of Place-Based Socioscientific Issues Instruction

    Science.gov (United States)

    Herman, Benjamin C.

    2018-01-01

    Preparing students to achieve the lofty goal of functional scientific literacy entails addressing the normative and non-normative facets of socioscientific issues (SSI) such as scientific processes, the nature of science (NOS) and diverse sociocultural perspectives. SSI instructional approaches have demonstrated some efficacy for promoting…

  16. Contextualization of Nature of Science within the Socioscientific Issues Framework: A Review of Research

    Science.gov (United States)

    Karisan, Dilek; Zeidler, Dana L.

    2017-01-01

    The aim of this paper is to examine the importance of contextualization of Nature of Science (NOS) within the Socioscientific Issues (SSI) framework, because of the importance to science education. The emphasis on advancing scientific literacy is contingent upon a robust understanding and appreciation of NOS, as well as the acquisition of…

  17. A Pedagogical Model for Ethical Inquiry into Socioscientific Issues in Science

    Science.gov (United States)

    Saunders, Kathryn J.; Rennie, Leonie J.

    2013-01-01

    Internationally there is concern that many science teachers do not address socioscientific issues (SSI) in their classrooms, particularly those that are controversial. However with increasingly complex, science-based dilemmas being presented to society, such as cloning, genetic screening, alternative fuels, reproductive technologies and…

  18. Thai Pre-Service Science Teachers' Struggles in Using Socio-Scientific Issues (SSIs) during Practicum

    Science.gov (United States)

    Pitiporntapin, Sasithep; Yutakom, Naruemon; Sadler, Troy D.

    2016-01-01

    In educational reform, teaching through socio-scientific issues (SSIs) is considered the best way to promote scientific literacy for citizenship as the goal of science teaching. To bring SSIs into the science classroom, Thai pre-service science teachers (PSTs) are expected to understand the concept of SSI-based teaching and to use it effectively…

  19. Preservice Science Teachers' Efficacy Regarding a Socioscientific Issue: A Belief System Approach

    Science.gov (United States)

    Kilinç, Ahmet; Kartal, Tezcan; Eroglu, Baris; Demiral, Ümit; Afacan, Özlem; Polat, Dilber; Demirci Guler, Mutlu P.; Görgülü, Özkan

    2013-01-01

    The aim of the present study was to understand the nature of teaching efficacy beliefs related to a socioscientific issue (SSI). We investigated Turkish preservice science teachers' teaching efficacy beliefs about genetically modified (GM) foods using a belief system approach. We assumed that preservice teachers' beliefs about GM foods (content…

  20. Promoting Preservice Teachers' Attitudes toward Socioscientific Issues

    Science.gov (United States)

    Yerdelen, Sundus; Cansiz, Mustafa; Cansiz, Nurcan; Akcay, Hakan

    2018-01-01

    In this study, we aimed to improve preservice teachers' attitudes toward socioscientific issues through socioscientific issue course. Moreover, we investigated whether this course influences preservice teachers studying in a science education and non-science education in a similar way. For this purpose, a semester-long socioscientific issues…

  1. The Relationship of Science Knowledge, Attitude and Decision Making on Socio-Scientific Issues: The Case Study of Students' Debates on a Nuclear Power Plant in Korea

    Science.gov (United States)

    Jho, Hunkoog; Yoon, Hye-Gyoung; Kim, Mijung

    2014-01-01

    The purpose of this study was to investigate the relationship of students' understanding of science knowledge, attitude and decision making on socio-scientific issues (SSI), especially on the issues of nuclear energy in Korea. SSI-focused instructions were developed to encourage students to understand and reflect on knowledge, attitude and…

  2. A Comparison Study of Augmented Reality versus Interactive Simulation Technology to Support Student Learning of a Socio-Scientific Issue

    Science.gov (United States)

    Chang, Hsin-Yi; Hsu, Ying-Shao; Wu, Hsin-Kai

    2016-01-01

    We investigated the impact of an augmented reality (AR) versus interactive simulation (IS) activity incorporated in a computer learning environment to facilitate students' learning of a socio-scientific issue (SSI) on nuclear power plants and radiation pollution. We employed a quasi-experimental research design. Two classes (a total of 45…

  3. Engaging Elementary School Pre-service Teachers in Modeling a Socioscientific Issue as a Way to Help Them Appreciate the Social Aspects of Science

    OpenAIRE

    Evagorou, Maria; Puig Mauriz, Blanca

    2017-01-01

    Socioscientific issues are ill-structured problems that involve moral, ethical, and financial aspects, and lack clear-cut solutions. Teaching socioscientific issues necessarily puts a demand on teachers to draw on knowledge stemming from other domains, and to also appreciate, and present to the students the societal aspects of science. For new teachers, and those who have not tried integrating complex social issues into their instruction, SSI-based teaching may seem too great a hurdle to over...

  4. Socioscientific Issues and the Affective Domain: Scientific Literacy's Missing Link.

    Science.gov (United States)

    Sadler, Troy D.

    The promotion of scientific literacy has become an important goal for science education, and the ability to negotiate socioscientific issues is at least one aspect of scientific literacy. This paper focuses on how the moral dimensions of socioscientific issues influence decision-making regarding these issues. Morality is examined from multiple…

  5. Socioscientific Issues and Multidisciplinarity in School Science Textbooks

    Science.gov (United States)

    Morris, Helen

    2014-05-01

    The inclusion of socioscientific issues (SSIs) in the science curriculum is a well-established trend internationally. Apart from claims about its innate value, one of the rationales for this approach is its potential for helping to counter declining interest and participation. SSIs involve the use of science and are of interest to society, also raising ethical and moral dilemmas. Introducing such problems presents a significant and usually cross-disciplinary challenge to curriculum developers and teachers. The aim of this paper is to examine how this challenge has been met when judged against contemporary views of the issues concerned. It first explores how SSIs have been interpreted in an important and innovative science course for students aged 14-16 in England, entitled Twenty First Century Science. This paper analyses the Twenty First Century Science textbooks, focusing in detail on two SSIs, reproductive genetic technology and climate change. For each of these issues, the key ideas present in the social science literature surrounding the problems are outlined. This review is then used as an analytical framework to examine how the issues are presented in the textbooks. It is argued in this paper that the perspectives the textbooks take on these issues largely do not include perspectives from social science disciplines. It goes on to suggest that the development of future SSI-based curricula needs to take account of these wider, often interdisciplinary, perspectives.

  6. Saudi Science Teachers' Views and Teaching Strategies of Socioscientific Issues

    Science.gov (United States)

    Alamri, Aziz S.

    Scientific developments such as cloning and nuclear energy have generated many controversial issues pertain to many political, social, environmental, ethical and cultural values in different societies around the globe. These controversies delimited and encircled the potential of including and teaching some important aspects of science in schools and therefore caused less consideration to the influence of these issues on enhancing the scientific literacy of people in general. The purpose of this study was to investigate how Saudi science teachers in the city of Tabuk in Saudi Arabia view and teach SSI in Saudi Arabia. This study employed semi-structured interviews with Saudi science teachers. Methodologically, this study used a constructivist grounded theory as a method for analysis to generate in-depth descriptive data about Saudi science teachers' views and teaching strategies of socio-scientific issues. Some direct and indirect benefits pertain to teaching science, understanding the relationship between science, religion, and society and some other topics are discussed in this study.

  7. Turkish preservice science teachers' socioscientific issues-based teaching practices in middle school science classrooms

    Science.gov (United States)

    Genel, Abdulkadir; Sami Topçu, Mustafa

    2016-01-01

    Background: Despite a growing body of research and curriculum reforms including socioscientific issues (SSI) across the world, how preservice science teachers (PST) or in-service science teachers can teach SSI in science classrooms needs further inquiry. Purpose: The purpose of this study is to describe the abilities of PSTs to teach SSI in middle school science classrooms, and the research question that guided the present study is: How can we characterize Turkish PSTs' SSI-based teaching practices in middle school science classrooms (ages 11-14)? Sample: In order to address the research question of this study, we explored 10 Turkish PSTs' SSI-based teaching practices in middle school science classrooms. A purposeful sampling strategy was used, thus, PSTs were specifically chosen because they were ideal candidates to teach SSI and to integrate SSI into the science curricula since they were seniors in the science education program who had to take the field experience courses. Design and method: The participants' SSI teaching practices were characterized in light of qualitative research approach. SSI-based teaching practices were analyzed, and the transcripts of all videotape recordings were coded by two researchers. Results: The current data analysis describes Turkish PSTs' SSI-based teaching practices under five main categories: media, argumentation, SSI selection and presentation, risk analysis, and moral perspective. Most of PSTs did not use media resources in their lesson and none of them considered moral perspective in their teaching. While the risk analyses were very simple and superficial, the arguments developed in the classrooms generally remained at a simple level. PSTs did not think SSI as a central topic and discussed these issues in a very limited time and at the end of the class period. Conclusions: The findings of this study manifest the need of the reforms in science education programs. The present study provides evidence that moral, media

  8. Socioscientific Issues as a Vehicle for Promoting Character and Values for Global Citizens

    Science.gov (United States)

    Lee, Hyunju; Yoo, Jungsook; Choi, Kyunghee; Kim, Sung-Won; Krajcik, Joseph; Herman, Benjamin C.; Zeidler, Dana L.

    2013-08-01

    Our guiding presupposition in this study was that socioscientific issues (SSI) instruction, given the humanistic features that comprise this type of instruction, could play a role as a vehicle for cultivating character and values as global citizens. Our main objective was to observe how and to what extent SSI instruction might contribute to this. In order to achieve this aim, we implemented a SSI program on genetic modification technology for 132 ninth-grade students over 3-4 weeks and identified its educational effects using a mixed method approach. Data sources included student responses to questionnaire items that measure the students' character and values, records of student discussions, and semi-structured interviews with the students and their teachers. Results indicated that the students became more sensitive to moral and ethical aspects of scientific and technological development and compassionate to diverse people who are either alienated by the benefits of advanced technology or who are vulnerable to the dangers of its unintended effects. In addition, the students felt more responsible for the future resolution of the genetic SSI. However, the students struggled to demonstrate willingness and efficacy to participate within broader communities that entailed action toward SSI resolution.

  9. A Pedagogical Model for Ethical Inquiry into Socioscientific Issues In Science

    Science.gov (United States)

    Saunders, Kathryn J.; Rennie, Léonie J.

    2013-02-01

    Internationally there is concern that many science teachers do not address socioscientific issues (SSI) in their classrooms, particularly those that are controversial. However with increasingly complex, science-based dilemmas being presented to society, such as cloning, genetic screening, alternative fuels, reproductive technologies and vaccination, there is a growing call for students to be more scientifically literate and to be able to make informed decisions on issues related to these dilemmas. There have been shifts in science curricula internationally towards a focus on scientific literacy, but research indicates that many secondary science teachers lack the support and confidence to address SSI in their classrooms. This paper reports on a project that developed a pedagogical model that scaffolded teachers through a series of stages in exploring a controversial socioscientific issue with students and supported them in the use of pedagogical strategies and facilitated ways of ethical thinking. The study builds on existing frameworks of ethical thinking. It presents an argument that in today's increasingly pluralistic society, these traditional frameworks need to be extended to acknowledge other worldviews and identities. Pluralism is proposed as an additional framework of ethical thinking in the pedagogical model, from which multiple identities, including cultural, ethnic, religious and gender perspectives, can be explored.

  10. The role of socioscientific issues in biology teaching – from the perspective of teachers

    OpenAIRE

    Tidemand, Sofie; Nielsen, Jan Alexis

    2017-01-01

    Previous research has documented that students who engage with socioscientific issues can acquire some of the complex competences and skills typically related to scientific literacy. But an emerging field of research on science teachers’ understanding and use of socioscientific issues, has documented that a range of challenges hinders the uptake of socioscientific issues. In this study we investigated the interpretation and implementation of socioscientific issues among Danish biology teacher...

  11. Developing Character and Values for Global Citizens: Analysis of pre-service science teachers' moral reasoning on socioscientific issues

    Science.gov (United States)

    Lee, Hyunju; Chang, Hyunsook; Choi, Kyunghee; Kim, Sung-Won; Zeidler, Dana L.

    2012-04-01

    Character and values are the essential driving forces that serve as general guides or points of reference for individuals to support decision-making and to act responsibly about global socioscientific issues (SSIs). Based on this assumption, we investigated to what extent pre-service science teachers (PSTs) of South Korea possess character and values as global citizens; these values include ecological worldview, socioscientific accountability, and social and moral compassion. Eighteen PSTs participated in the SSI programs focusing on developing character and values through dialogical and reflective processes. SSIs were centered on the use of nuclear power generation, climate change, and embryonic stem cell research. The results indicated that PSTs showed three key elements of character and values, but failed to apply consistent moral principles on the issues and demonstrated limited global perspectives. While they tended to approach the issues with emotion and sympathy, they nonetheless failed to perceive themselves as major moral agents who are able to actively resolve large-scale societal issues. This study also suggests that the SSI programs can facilitate socioscientific reasoning to include abilities such as recognition of the complexity of SSIs, examine issues from multiple perspectives, and exhibit skepticism about information.

  12. The role of socioscientific issues in biology teaching – from the perspective of teachers

    DEFF Research Database (Denmark)

    Tidemand, Sofie; Nielsen, Jan Alexis

    2017-01-01

    Previous research has documented that students who engage with socioscientific issues can acquire some of the complex competences and skills typically related to scientific literacy. But an emerging field of research on science teachers’ understanding and use of socioscientific issues, has...... documented that a range of challenges hinders the uptake of socioscientific issues. In this study we investigated the interpretation and implementation of socioscientific issues among Danish biology teachers – who teach in a curriculum that, on paper, is permeated by socioscientific issues. We conducted five...... harbour a content-centred interpretation of socioscientific issues which manifests itself in at least three separate ways. First, the teachers generally use socioscientific issues as a means to an end of teaching factual biological content. Second, the teachers had a clear emphasis on mastery of factual...

  13. The Relationship of Discipline Background to Upper Secondary Students' Argumentation on Socioscientific Issues

    Science.gov (United States)

    Christenson, Nina; Chang Rundgren, Shu-Nu; Zeidler, Dana L.

    2014-08-01

    In the present STEM (Science, Technology, Engineering, and Mathematics)-driven society, socioscientific issues (SSI) have become a focus globally and SSI research has grown into an important area of study in science education. Since students attending the social and science programs have a different focus in their studies and research has shown that students attending a science program are less familiar with argumentation practice, we make a comparison of the supporting reasons social science and science majors use in arguing different SSI with the goal to provide important information for pedagogical decisions about curriculum and instruction. As an analytical framework, a model termed SEE-SEP covering three aspects (of knowledge, value, and experiences) and six subject areas (of sociology/culture, economy, environment/ecology, science, ethics/morality, and policy) was adopted to analyze students' justifications. A total of 208 upper secondary students (105 social science majors and 103 science majors) from Sweden were invited to justify and expound their arguments on four SSI including global warming, genetically modified organisms (GMO), nuclear power, and consumer consumption. The results showed that the social science majors generated more justifications than the science majors, the aspect of value was used most in students' argumentation regardless of students' discipline background, and justifications from the subject area of science were most often presented in nuclear power and GMO issues. We conclude by arguing that engaging teachers from different subjects to cooperate when teaching argumentation on SSI could be of great value and provide students from both social science and science programs the best possible conditions in which to develop argumentation skills.

  14. Argumentation, critical thinking, nature of science and socioscientific issues: a dialogue between two researchers

    Science.gov (United States)

    Yacoubian, Hagop A.; Khishfe, Rola

    2018-05-01

    The purpose of this paper is to compare and contrast between two theoretical frameworks for addressing nature of science (NOS) and socioscientific issues (SSI) in school science. These frameworks are critical thinking (CT) and argumentation (AR). For the past years, the first and second authors of this paper have pursued research in this area using CT and AR as theoretical frameworks, respectively. Yacoubian argues that future citizens need to develop a critical mindset as they are guided to (1) practice making judgments on what views of NOS to acquire and (2) practice making decisions on SSI through applying their NOS understandings. Khishfe asserts that AR is an important component of decision making when dealing with SSI and the practice in AR in relation to controversial issues is needed for informed decision making. She argues that AR as a framework may assist in the development of more informed understandings of NOS. In this paper, the authors delve into a dialogue for (1) elucidating strengths and potential of each framework, (2) highlighting challenges that they face in their research using the frameworks in question, (3) exploring the extent to which the frameworks can overlap, and (4) proposing directions for future research.

  15. Students' Positioning in the Classroom: a Study of Teacher-Student Interactions in a Socioscientific Issue Context

    Science.gov (United States)

    Bossér, Ulrika; Lindahl, Mats

    2017-07-01

    The integration of socioscientific issues (SSI) in science education calls for emphasizing dialogic classroom practices that include students' views together with multiple sources of knowledge and diverse perspectives on the issues. Such classroom practices aim to empower students to participate in decision-making on SSI. This can be accomplished by enhancing their independence as learners and positioning them as legitimate participants in societal discussions. However, this is a complex task for science teachers. In this study, we introduce positioning theory as a lens to analyse classroom discourse on SSI in order to enhance our knowledge of the manners by which teachers' interactions with students make available or promote different positions for the students, that is, different parts for the students to play as participants, when dealing with SSI in the classroom. Transcripts of interactions between one teacher and six student groups, recorded during two lessons, were analysed with respect to the positioning of the students as participants in the classroom, and in relation to the SSI under consideration. The results show that the teacher-student interactions made available contrasting student positions. The students were positioned by the teacher or positioned themselves as independent learners or as dependent on the teacher. Furthermore, the students were positioned as affected by the issue but as spectators to public negotiations of the issue. Knowledge about the manner in which teacher-student interactions can function to position students seems important for dialogic classroom practices and the promotion of student positions that sustain the pursuit of intended educational outcomes.

  16. Citizenship Education and Socioscientific Issues: Implicit Concept of Citizenship in the Curriculum, Views of French Middle School Teachers

    Science.gov (United States)

    Barrue, Catherine; Albe, Virginie

    2013-05-01

    The educative goal of citizenship education through science education converges to the declared purpose of the SSI research movement. Socioscientific issues formulated in science education research covering topics as biotechnology, environmental issues, sustainable development, energy choices, have been introduced in French Middle Schools. But citizenship is often not clarified and can be multiple. After having clarified who is the citizen targeted by SSI research movement, the concept of citizen in the French curriculum needs to be clarify. What do these citizens have in common with the citizen that a sociology literature review let see oscillating between obedience and critical thinking has also been investigated. The paper also looks at the teachers' views and their contribution to citizenship education through socioscientific topics described in the national curriculum. From the analysis, different teachers' views of citizenship education have been highlighted: a normative citizenship education in connection with civility and rules and an emancipatory citizenship education to develop pupils' skills such as searching and evaluating information, argumentation and critical thinking in order to enable pupils to build their own argued opinion and to participate to public debates. This last emancipatory view of citizenship education is congruent with the aim of social empowerment within the SSI research movement.

  17. Evolution of a Model for Socio-Scientific Issue Teaching and Learning

    Science.gov (United States)

    Sadler, Troy D.; Foulk, Jaimie A.; Friedrichsen, Patricia J.

    2017-01-01

    Socio-scientific teaching and learning (SSI-TL) has been suggested as an effective approach for supporting meaningful learning in school contexts; however, limited tools exist to support the work of designing and implementing this approach. In this paper, we draw from a series of four design based research projects that have produced SSI…

  18. Secondary School Students' Understanding of Science and Their Socioscientific Reasoning

    Science.gov (United States)

    Karahan, Engin; Roehrig, Gillian

    2017-01-01

    Research in socioscientific issue (SSI)-based interventions is relatively new (Sadler in "Journal of Research in Science Teaching" 41:513-536, 2004; Zeidler et al. in "Journal of Research in Science Teaching" 46:74-101, 2009), and there is a need for understanding more about the effects of SSI-based learning environments…

  19. Implementation of Socioscientific Issues Instruction to Fostering Students’ Decision Making Based Gender on Environmental Pollution

    Science.gov (United States)

    Rizal, H. P.; Siahaan, P.; Yuliani, G.

    2017-02-01

    The purpose of this study was to investigate the implementation socioscientific issues (SSI) instruction to examine students’ decision making based gender. Selection of environmental problem based on the consideration this issue has potential to evaluate from various scientific disciplines and may initiate to make decision. The participant was students grade VII in South Sulawesi. Pre experiment method was utilized in study with one group pre-test and post-test design. The instrument used in this study comprised of open-ended question, observation sheets for group discussion, sheet for interview and observation sheet of implementation instruction in class. The result indicated that instruction has been implemented successfully. It was found that pre-test and post-test was fostered with N-gain for male and female in medium category. Based on independent t test was found there was no difference improvement of decision making between male and female students. The group showed there was no difference between male group and female group, but a significant difference was noted in mix group. Students and teacher give positive response to the implementation of instruction. It is concluded that science instruction based SSI can be implemented to foster male and female decision making by forming group discussion.

  20. Measurement Model of Reasoning Skills among Science Students Based on Socio Scientific Issues (SSI

    Directory of Open Access Journals (Sweden)

    MOHD AFIFI BAHURUDIN SETAMBAH

    2018-05-01

    Full Text Available The lack of reasoning skills has been recognized as one of the contributing factors to the declined achievement in the Trends in Mathematics and Science Studies (TIMSS and Programme for International Student Assessment (PISA assessments in Malaysia. The use of socio-scientific issues (SSI as a learning strategy offers the potential of improving the level of students' reasoning skills and consequently improves students’ achievement in science subjects. This study examined the development of a measurement model of reasoning skills among science students based on SSI using the analysis of moment structure (AMOS approach before going to second level to full structured equation modelling (SEM. A total of 450 respondents were selected using a stratified random sampling. Results showed a modified measurement model of reasoning skills consisting of the View Knowledge (VK was as a main construct. The items that measure the level of pre-reflection of students fulfilled the elements of unidimensionality, validity, and reliability. Although the level of student reasoning skills was still low but this development of measurement model could be identified and proposed teaching methods that could be adopted to improve students’ reasoning skills.

  1. Science Teachers Taking their First Steps toward Teaching Socioscientific Issues through Collaborative Action Research

    Science.gov (United States)

    Lee, Hyunju; Yang, Jung-eun

    2017-06-01

    This study presents two science teachers, Catherine and Jennifer, who took their first steps toward teaching socioscientific issues through collaborative action research. The teachers participated in the collaborative action research project because they wanted to address socioscientific issues but had limited experience in teaching them. The research questions included what kinds of challenges the teachers encountered when implementing socioscientific issues and to what extent they resolved the challenging issues as participating in collaborative action research. The primary data source consisted of audiotapes of regular group meetings containing information on the process of constructing and implementing lesson plans and reflecting on their teaching of socioscientific issues. We also collected classroom videotapes of the teachers' instruction and audiotapes of students' small group discussions and their worksheets. The findings indicated that when addressing socioscientific issues in the classes, the teachers encountered several challenging issues. We categorized them into four: (1) restructuring classroom dynamics and culture, (2) scaffolding students' engagement in socioscientific issues, (3) dealing with values, and (4) finding their niche in schools. However, this study showed that collaborative action research could be a framework for helping the teachers to overcome such challenges and have successful experiences of teaching socioscientific issues. These experiences became good motivation, to gradually develop their understanding of teaching socioscientific issues and instructional strategies for integrating the knowledge and skills that they had accumulated over the years.

  2. The Role of Socioscientific Issues in Biology Teaching: From the Perspective of Teachers

    Science.gov (United States)

    Tidemand, Sofie; Nielsen, Jan Alexis

    2017-01-01

    Previous research has documented that students who engage with socioscientific issues can acquire some of the complex competences and skills typically related to scientific literacy. But an emerging field of research on science teachers' understanding and use of socioscientific issues, has documented that a range of challenges hinders the uptake…

  3. The Morality of Socioscientific Issues: Construal and Resolution of Genetic Engineering Dilemmas

    Science.gov (United States)

    Sadler, Troy D.; Zeidler, Dana L.

    2004-01-01

    The ability to negotiate and resolve socioscientific issues has been posited as integral components of scientific literacy. Although philosophers and science educators have argued that socioscientific issues inherently involve moral and ethical considerations, the ultimate arbiters of morality are individual decision-makers. This study explored…

  4. Lakatos' Scientific Research Programmes as a Framework for Analysing Informal Argumentation about Socio-Scientific Issues

    Science.gov (United States)

    Chang, Shu-Nu; Chiu, Mei-Hung

    2008-01-01

    The purpose of this study is to explore how Lakatos' scientific research programmes might serve as a theoretical framework for representing and evaluating informal argumentation about socio-scientific issues. Seventy undergraduate science and non-science majors were asked to make written arguments about four socio-scientific issues. Our analysis…

  5. Preservice Science Teachers' Epistemological Beliefs and Informal Reasoning Regarding Socioscientific Issues

    Science.gov (United States)

    Ozturk, Nilay; Yilmaz-Tuzun, Ozgul

    2017-12-01

    This study investigated preservice elementary science teachers' (PSTs) informal reasoning regarding socioscientific issues (SSI), their epistemological beliefs, and the relationship between informal reasoning and epistemological beliefs. From several SSIs, nuclear power usage was selected for this study. A total of 647 Turkish PSTs enrolled in three large universities in Turkey completed the open-ended questionnaire, which assessed the participants' informal reasoning about the target SSI, and Schommer's (1990) Epistemological Questionnaire. The participants' epistemological beliefs were assessed quantitatively and their informal reasoning was assessed both qualitatively and quantitatively. The findings revealed that PSTs preferred to generate evidence-based arguments rather than intuitive-based arguments; however, they failed to generate quality evidence and present different types of evidence to support their claims. Furthermore, among the reasoning quality indicators, PSTs mostly generated supportive argument construction. Regarding the use of reasoning modes, types of risk arguments and political-oriented arguments emerged as the new reasoning modes. The study demonstrated that the PSTs had different epistemological beliefs in terms of innate ability, omniscient authority, certain knowledge, and quick learning. Correlational analyses revealed that there was a strong negative correlation between the PSTs' certain knowledge and counterargument construction, and there were negative correlations between the PSTs' innate ability, certain knowledge, and quick learning dimensions of epistemological beliefs and their total argument construction. This study has implications for both science teacher education and the practice of science education. For example, PST teacher education programs should give sufficient importance to training teachers that are skillful and knowledgeable regarding SSIs. To achieve this, specific SSI-related courses should form part of science

  6. The implementation of integrated science teaching materials based socio-scientific issues to improve students scientific literacy for environmental pollution theme

    Science.gov (United States)

    Yenni, Rita; Hernani, Widodo, Ari

    2017-05-01

    The study aims to determine the increasing of students' science literacy skills on content aspects and competency of science by using Integrated Science teaching materials based Socio-scientific Issues (SSI) for environmental pollution theme. The method used in the study is quasi-experiment with nonequivalent pretest and posttest control group design. The students of experimental class used teaching materials based SSI, whereas the students of control class were still using the usual textbooks. The result of this study showed a significant difference between the value of N-gain of experimental class and control class, whichalso occurred in every indicator of content aspects and competency of science. This result indicates that using of Integrated Science teaching materials based SSI can improve content aspect and competency of science and can be used as teaching materials alternative in teaching of Integrated Science.

  7. Socio-Scientific Issues in Health Contexts: Treading a rugged terrain

    Science.gov (United States)

    Chung Lee, Yeung

    2012-02-01

    The science-technology-society agenda has evolved over time to meet emerging educational aims in the light of changes in society and the environment. There is increasing emphasis on students' decision-making on socio-scientific issues (SSIs) not only to highlight the intricate relationships between science, technology, society, and the environment, but also to allow students to incorporate multiple viewpoints into the development of critical reasoning and responsible citizenship. Most research emphases have been on the rationality of reasoning rather than on the internal psychological context that underpins reasoning. This paper explores how these various aspects of reasoning interact in decision-making on SSIs in health contexts through case studies of recent issues in this field. The case studies reveal the negotiation of multiple influences in addressing SSIs in health contexts and the potential interactions between the psychological processes of individuals, science, and sociocultural perspectives. A tentative model to address these interactions emerges from this explorative study and has implications for the use of health-related issues in promoting SSI education.

  8. The Effects of Emotive Reasoning on Secondary School Students' Decision-Making in the Context of Socioscientific Issues

    Science.gov (United States)

    Powell, Wardell A.

    The discrepancy between what students are being taught within K-12 science classrooms and what they experience in the real world has been well documented. This study sought to explore the ways a high school biology curriculum, which integrates socioscientific issues, impacts students' emotive reasoning and their ability to evaluate evidence, make informed decisions on contemporary scientific dilemmas, and integrate scientific content knowledge in their reasoning on SSI. Both quantitative and qualitative methods were used to examine differences within and between an SSI treatment group and a comparison group as well as individual differences among students' responses over a semester of high school biology. Results indicated students used emotions largely to evaluate evidence and make decisions on contentious scientific dilemmas. In addition, the results showed students used newly gained scientific content knowledge to make logical predictions on contentious scientific issues. Statistical significance was found between groups of students in regard to their interest in the use of embryonic stem cell treatments to restore rats' vision, as well as students' abilities to evaluate evidence. Theoretical implications regarding the use of SSI in the classroom are presented.

  9. Development of Socioscientific Issues-Based Teaching for Preservice Science Teachers

    OpenAIRE

    Prasart Nuangchalerm

    2009-01-01

    Problem statement: In the context of science education reform in Thailand, we need to prepare science teachers who can face science and social issues controversial; teachers can response the question socioscientific issues and let their students to meet the goal of science education. This study investigated the conception leading preservice science teachers approaching socioscientific issues-based teaching. The activities in classroom emphasized on peer discussion about science and social ref...

  10. Socioscientific issues: topics and importance to the scientific education

    Directory of Open Access Journals (Sweden)

    Díaz Moreno, Naira;

    2012-01-01

    Full Text Available Socioscientific debates arise and become widespread concerning the most popular and innovative issues in our society: transgenics, homeopathy, the impact of mobile phone network and so on. For this reason we believe it is important to analyse the meaning of these debates and the relationship between information processing in newspapers and teaching literature and to determine their possible use in a school context. The common image of scientific news that tends to appear in the media hampers its use in the classroom. On analysing didactic literature, we have selected activities that can be used as a model to plan debates in the science classroom with the objective of developing a series of capacities in students related to scientific literacy, critical thinking and the promotion of a scientific culture.

  11. Students' understandings of nature of science and their arguments in the context of four socio-scientific issues

    Science.gov (United States)

    Khishfe, Rola; Alshaya, Fahad S.; BouJaoude, Saouma; Mansour, Nasser; Alrudiyan, Khalid I.

    2017-02-01

    The purpose of this study was to examine students understandings about nature of science (NOS) and their arguments in context of controversial socio-scientific issue (SSI). A total of 74 11th graders in six schools in Saudi Arabia participated in the study. The instrument used was a questionnaire consisting of four scenarios addressing SSI about global warming, genetically modified food, acid rain, and human cloning. The scenarios were followed by questions relating to argumentation and NOS. Quantitative and qualitative measures were employed to analyze the data related to participants understandings of three NOS aspects (subjective, tentative, and empirical) and their arguments components (argument, counterargument, and rebuttal). Results showed no significant correlations between argument components and the NOS aspects. On the other hand, qualitative data showed that participants who generated well-developed arguments across the four SSI also exhibited more informed understandings of the NOS aspects, especially for female participants. Further, the chi-square analyses did not show significant differences in participants arguments and NOS understandings across the four scenarios. Again, the qualitative data from questionnaires showed differences in participants responses to the different scenarios. The results were interpreted along contextual factors, emotional factors, and cultural factors. Implications for the teaching of NOS and arguments were discussed.

  12. Using the SEE-SEP Model to Analyze Upper Secondary Students' Use of Supporting Reasons in Arguing Socioscientific Issues

    Science.gov (United States)

    Christenson, Nina; Chang Rundgren, Shu-Nu; Höglund, Hans-Olof

    2012-06-01

    To achieve the goal of scientific literacy, the skills of argumentation have been emphasized in science education during the past decades. But the extent to which students can apply scientific knowledge to their argumentation is still unclear. The purpose of this study was to analyse 80 Swedish upper secondary students' informal argumentation on four socioscientific issues (SSIs) to explore students' use of supporting reasons and to what extent students used scientific knowledge in their arguments. Eighty upper secondary students were asked to express their opinions on one SSI topic they chose through written reports. The four SSIs in this study include global warming, genetically modified organisms (GMO), nuclear power, and consumption. To analyse students' supporting reasons from a holistic view, we used the SEE-SEP model, which links the six subject areas of sociology/culture (So), environment (En), economy (Ec), science (Sc), ethics/morality (Et) and policy (Po) connecting with three aspects, knowledge, value and personal experience (KVP). The results showed that students used value to a greater extent (67%) than they did scientific knowledge (27%) for all four SSI topics. According to the SEE-SEP model, the distribution of supporting reasons generated by students differed among the SSI topics. Also, some alternative concepts were disclosed in students' arguments. The implications for research and education are discussed.

  13. Body talk: students' identity construction while discussing a socioscientific issue

    Science.gov (United States)

    Ideland, Malin; Malmberg, Claes

    2012-06-01

    Vision II school science is often stated to be a democratic and inclusive form of science education. But what characterizes the subject who fits into the Vision II school science? Who is the desirable student and who is constructed as ill-fitting? This article explores discourses that structure the Vision II science classroom, and how different students construct their identities inside these discourses. In the article we consider school science as an order of discourses which restricts and enables what is possible to think and say and what subject-positions those are available and non-available. The results show that students' talk about a SSI about body and health is constituted by several discourses. We have analyzed how school science discourse, body discourse and general school discourse are structuring the discussions. But these discourses are used in different ways depending on how the students construct their identities in relation to available subject positions, which are dependent on how students at the same time are "doing" gender and social class. As an example, middle class girls show resistance against SSI-work since the practice is threatening their identity as "successful students". This article uses a sociopolitical perspective in its discussions on inclusion and exclusion in the practice of Vision II. It raises critical issues about the inherited complexity of SSI with meetings and/or collisions between discourses. Even if the empirical results from this qualitative study are situated in specific cultural contexts, they contribute with new questions to ask concerning SSI and Vision II school science.

  14. Prospective Elementary School Teachers’ Views about Socioscientific Issues: A Concurrent Parallel Design Study

    OpenAIRE

    Muhammet ÖZDEN

    2015-01-01

    The purpose of this research is to examine the prospective elementary school teachers’ perceptions on socioscientific issues. The research was conducted on prospective elementary school teachers studying at a university located in western Turkey. The researcher first taught the subjects of global warming and nuclear power plants from a perspective of socioscientific issues in the science and technology education course and then conducted the research. Concurrent parallel design, one of the mi...

  15. Learning outcomes between Socioscientific Issues-Based Learning and Conventional Learning Activities

    OpenAIRE

    Piyaluk Wongsri; Prasart Nuangchalerm

    2010-01-01

    Problem statement: Socioscientific issues-based learning activity is essential for scientific reasoning skills and it could be used for analyzing problems be applied to each situation for more successful and suitable. The purposes of this research aimed to compare learning achievement, analytical thinking and moral reasoning of seventh grade students who were organized between socioscientific issues-based learning and conventional learning activities. Approach: The samples used in research we...

  16. Teaching Controversial Socio-Scientific Issues in Biology and Geology Classes: A Case Study

    OpenAIRE

    Reis, Pedro; Galvão, Cecília

    2009-01-01

    Several educators in science have called for the inclusion of controversial socio-scientific issues’ discussion in science curricula because of its potential for creating a more real, humane image of scientific activity and for promoting scientific literacy, an essential tool for a responsible citizenship regarding decision-making processes related to socio-scientific issues. However, despite all the favourable opinions and empirical evidence concerning the educational potentia...

  17. "It's Still Science but Not Like Normal Science": Girls' Responses to the Teaching of Socio-Scientific Issues

    Science.gov (United States)

    Morris, Helen

    2014-01-01

    Socio-scientific issues, which are often controversial, involve the use of science and are of interest to society, raising ethical and moral dilemmas. Examples of these issues could include genetic technology or air pollution. Following a curriculum reform in England in 2006, socioscientific issues now have a heightened presence in the 14-16…

  18. Students' Use of Decision-Making Strategies with Regard to Socioscientific Issues: An Application of the Rasch Partial Credit Model

    Science.gov (United States)

    Eggert, Sabina; Bogeholz, Susanne

    2010-01-01

    Decision making about socioscientific issues is an important aspect of modern science education worldwide. Among the many topics that represent socioscientific issues, issues relating to the sustainable development of our environment are one crucial topic. However, difficulties exist with respect to the assessment of teaching outcomes related to…

  19. Using Our Heads and HARTSS*: Developing Perspective-Taking Skills for Socioscientific Reasoning (*Humanities, ARTS, and Social Sciences)

    Science.gov (United States)

    Kahn, Sami; Zeidler, Dana L.

    2016-01-01

    Functional scientific literacy demands an informed citizenry capable of negotiating controversial socioscientific issues (SSI). Perspective taking is critical to SSI implementation as it enables understanding of the diverse cognitive and emotional perspectives of others. Science teacher educators must therefore facilitate teachers' promotion of…

  20. Development of Lesson Plans and Student Worksheets Based Socio-Scientific Issues on Pollution Environmental Topic

    Science.gov (United States)

    Rahayu, S.; Meyliana, M.; Arlingga, A.; Reny, R.; Siahaan, P.; Hernani, H.

    2017-09-01

    The aim of this study is to develop lesson plans and student worksheets based socio-scientific issues on pollution environmental topic for seventh-grade junior high school students. Environmental pollution topic split into several subtopics namely air pollution, water pollution and soil pollution. The composing of lesson plans were developed based on socio-scientific issues with five stages, namely (1) Motivate; (2) Challenge; (3) Collect scientific evidence; (4) Analyse the evidence; (5) Build knowledge and make connections; and (6) Use evidence. While student worksheets contain articles on socio-scientific issues, practice, and there are a few questions to determine students’ reasoning. The method that is used in this research is research and development (R & D method). Development model used in this study is a model of Plomp that consists of four stages, namely: (1) Initial Research; (2) Design; (3) Realization or Construction; (4) Testing, evaluation and revision; (5) Implementation, while the research was limited to the fourth stage. Lesson plans and student worksheets based on socio-scientific issues was validated through an expert validation. The result showed that lesson plans and student worksheets based socio-scientific issues on pollution theme have a very decent and be able to apply in science classroom.

  1. Moral Sensitivity and Its Contribution to the Resolution of Socio-Scientific Issues

    Science.gov (United States)

    Sadler, Troy

    2004-01-01

    This study explores models of how people perceive moral aspects of socio-scientific issues. Thirty college students participated in interviews during which they discussed their reactions to and resolutions of two genetic engineering issues. The interview data were analyzed qualitatively to produce an emergent taxonomy of moral concerns recognized…

  2. Students' Reasoning Processes in Making Decisions about an Authentic, Local Socio-Scientific Issue: Bat Conservation

    Science.gov (United States)

    Lee, Yeung Chung; Grace, Marcus

    2010-01-01

    Education for scientific literacy entails the development of scientific knowledge and the ability to apply this knowledge and value judgments to decisions about real-life issues. This paper reports an attempt to involve secondary level biology students in making decisions about an authentic socio-scientific issue--that of bat conservation--through…

  3. Secondary School Students' Understanding of Science and Their Socioscientific Reasoning

    Science.gov (United States)

    Karahan, Engin; Roehrig, Gillian

    2017-08-01

    Research in socioscientific issue (SSI)-based interventions is relatively new (Sadler in Journal of Research in Science Teaching 41:513-536, 2004; Zeidler et al. in Journal of Research in Science Teaching 46:74-101, 2009), and there is a need for understanding more about the effects of SSI-based learning environments (Sadler in Journal of Research in Science Teaching 41:513-536, 2004). Lee and Witz (International Journal of Science Education 31:931-960, 2009) highlighted the need for detailed case studies that would focus on how students respond to teachers' practices of teaching SSI. This study presents case studies that investigated the development of secondary school students' science understanding and their socioscientific reasoning within SSI-based learning environments. A multiple case study with embedded units of analysis was implemented for this research because of the contextual differences for each case. The findings of the study revealed that students' understanding of science, including scientific method, social and cultural influences on science, and scientific bias, was strongly influenced by their experiences in SSI-based learning environments. Furthermore, multidimensional SSI-based science classes resulted in students having multiple reasoning modes, such as ethical and economic reasoning, compared to data-driven SSI-based science classes. In addition to portraying how participants presented complexity, perspectives, inquiry, and skepticism as aspects of socioscientific reasoning (Sadler et al. in Research in Science Education 37:371-391, 2007), this study proposes the inclusion of three additional aspects for the socioscientific reasoning theoretical construct: (1) identification of social domains affecting the SSI, (2) using cost and benefit analysis for evaluation of claims, and (3) understanding that SSIs and scientific studies around them are context-bound.

  4. Resistance to Dialogic Discourse in SSI Teaching: The Effects of an Argumentation-Based Workshop, Teaching Practicum, and Induction on a Preservice Science Teacher

    Science.gov (United States)

    Kilinc, Ahmet; Demiral, Umit; Kartal, Tezcan

    2017-01-01

    Teaching socioscientific issues (SSI) necessitates dialogic discourse activities. However, a majority of science teachers prefer monologic discourse in SSI contexts. In addition, some of these teachers are resistant to change (from monologic to dialogic discourse) despite certain professional development attempts. The purpose of the present…

  5. Nutrition Labelling: Applying Biological Concepts and Reasoning to Socio-Scientific Issues

    Science.gov (United States)

    Lee, Yeung Chung

    2016-01-01

    Nutrition labelling, which helps consumers to make informed choices, can be used as both a context and a vehicle for students to consolidate and apply their knowledge of food and nutrition to improve health. It also facilitates students' ability to negotiate socio-scientific issues from scientific and other perspectives. This article reports a…

  6. Introducing Argumentation About Climate Change Socioscientific Issues in a Disadvantaged School

    Science.gov (United States)

    Dawson, Vaille; Carson, Katherine

    2018-03-01

    Improving the ability of young people to construct arguments about controversial science topics is a desired outcome of science education. The purpose of this research was to evaluate the impact of an argumentation intervention on the socioscientific issue of climate change with Year 10 students in a disadvantaged Australian school. After participation in a professional development workshop on climate change science, socioscientific issues and argumentation, an early career teacher explicitly taught argumentation over four non-consecutive lessons as part of a 4 week (16 lesson) topic on Earth science. Thirty students completed a pre- and post-test questionnaire to determine their understanding of climate change science and their ability to construct an argument about a climate change socioscientific issue. Students' understanding of climate change improved significantly (p size. There was also a significant increase (p Qualitative data, comprising classroom observation field notes, lesson transcripts, work samples, and teacher and student interviews, were analysed for the extent to which the students' argumentation skills improved. At the end of the intervention, students became aware of the need to justify their decisions with scientific evidence. It is concluded that introducing argumentation about climate change socioscientific issues to students in a disadvantaged school can improve their argumentation skills.

  7. Science Teachers' Use of Mass Media to Address Socio-Scientific and Sustainability Issues

    Science.gov (United States)

    Klosterman, Michelle L.; Sadler, Troy D.; Brown, Julie

    2012-01-01

    The currency, relevancy and changing nature of science makes it a natural topic of focus for mass media outlets. Science teachers and students can capitalize on this wealth of scientific information to explore socio-scientific and sustainability issues; however, without a lens on how those media are created and how representations of science are…

  8. Prospective Elementary School Teachers’ Views about Socioscientific Issues: A Concurrent Parallel Design Study

    Directory of Open Access Journals (Sweden)

    Muhammet ÖZDEN

    2015-06-01

    Full Text Available The purpose of this research is to examine the prospective elementary school teachers’ perceptions on socioscientific issues. The research was conducted on prospective elementary school teachers studying at a university located in western Turkey. The researcher first taught the subjects of global warming and nuclear power plants from a perspective of socioscientific issues in the science and technology education course and then conducted the research. Concurrent parallel design, one of the mixed-method research approaches, was used to conduct the research. In this context, semi-structured interviews were conducted with eight teachers in the qualitative strand of the study to explore the phenomenon. The data obtained from the interviews were analyzed using thematic analysis. During the quantitative strand of the research, 113 prospective teachers were administered a questionnaire form. The results of the study revealed that none of the participating prospective teachers mentioned about the religious and cultural characteristics of socioscientific issues, and they need training about how to use socioscientific issues in teaching.

  9. Prospective elementary school teachers’ views about socioscientific issues: A concurrent parallel design study

    Directory of Open Access Journals (Sweden)

    Muhammet Özden

    2015-07-01

    Full Text Available The purpose of this research is to examine the prospective elementary school teachers’ perceptions on socioscientific issues. The research was conducted on prospective elementary school teachers studying at a university located in western Turkey. The researcher first taught the subjects of global warming and nuclear power plants from a perspective of socioscientific issues in the science and technology education course and then conducted the research. Concurrent parallel design, one of the mixed-method research approaches, was used to conduct the research. In this context, semi-structured interviews were conducted with eight teachers in the qualitative strand of the study to explore the phenomenon. The data obtained from the interviews were analyzed using thematic analysis. During the quantitative strand of the research, 113 prospective teachers were administered a questionnaire form. The results of the study revealed that none of the participating prospective teachers mentioned about the religious and cultural characteristics of socioscientific issues, and they need training about how to use socioscientific issues in teaching.

  10. Enhancing Students' Communication Skills in the Science Classroom through Socioscientific Issues

    Science.gov (United States)

    Chung, Yoonsook; Yoo, Jungsook; Kim, Sung-Won; Lee, Hyunju; Zeidler, Dana L.

    2016-01-01

    Communication skills are one of the most important competencies for 21st century global citizens. Our guiding presupposition was that socioscientific issues (SSIs) could be used as an effective pedagogical tool for promoting students' communication skills by increasing peer interactions, stimulating students' reasoning, and in constructing shared…

  11. Students' Reasoning and Decision Making about a Socioscientific Issue: A Cross-Context Comparison

    Science.gov (United States)

    Lee, Yeung Chung; Grace, Marcus

    2012-01-01

    It has been argued that decision making about socioscientific issue (SSIs) necessitates informal reasoning, which involves multiperspective thinking and moral judgment. This study extends the scope of the literature concerning students' reasoning on SSIs to a cross-contextual study by comparing decisions made on avian flu by 12-13-year-old Chinese…

  12. Turkish Preservice Science Teachers' Informal Reasoning regarding Socioscientific Issues and the Factors Influencing Their Informal Reasoning

    Science.gov (United States)

    Topcu, Mustafa Sami; Yilmaz-Tuzun, Ozgul; Sadler, Troy D.

    2011-01-01

    The purpose of the study is to explore Turkish preservice science teachers' informal reasoning regarding socioscientific issues and the factors influencing their informal reasoning. The researchers engaged 39 preservice science teachers in informal reasoning interview and moral decision-making interview protocols. Of the seven socioscientific…

  13. Post It!--A Cross-Disciplinary Approach to Teach Socioscientific Issues

    Science.gov (United States)

    Rundgren, Shu-Nu Chang

    2011-01-01

    Various socioscientific issues (SSIs) are emerging in today's science--and technology--dominant society, e.g. genetically modified organisms and global warming. To achieve the goal of scientific literacy, more and more science educators have devoted their attention to enhancing students' understanding of the multidimensional aspects of SSIs as…

  14. Students' Argumentation Skills across Two Socio-Scientific Issues in a Confucian Classroom: Is Transfer possible?

    Science.gov (United States)

    Foong, Chan-Choong; Daniel, Esther G. S.

    2013-01-01

    This paper argues the possible simultaneous development and transfer of students' argumentation skills from one socio-scientific issue to another in a Confucian classroom. In Malaysia, the Chinese vernacular schools follow a strict Confucian philosophy in the teaching and learning process. The teacher talks and the students listen. This case study…

  15. The Significance of Content Knowledge for Informal Reasoning regarding Socioscientific Issues: Applying Genetics Knowledge to Genetic Engineering Issues

    Science.gov (United States)

    Sadler, Troy D.; Zeidler, Dana L.

    2005-01-01

    This study focused on informal reasoning regarding socioscientific issues. It sought to explore how content knowledge influenced the negotiation and resolution of contentious and complex scenarios based on genetic engineering. Two hundred and sixty-nine students drawn from undergraduate natural science and nonnatural science courses completed a…

  16. The use of narrative in supporting the teaching of socio-scientific issues: a study of teachers’ reflections

    OpenAIRE

    Levinson, Ralph

    2006-01-01

    While narratives which integrate aspects of human consciousness can be a powerful instrument in teaching and learning about socio-scientific issues, the science curriculum offers unfruitful grounds for the development of narrative in school students. Learning science and learning about socio-scientific issues are epistemologically distinct activities. The way teachers across the curriculum use narratives suggests that an interdisciplinary approach might be more effective for te...

  17. Turkish Preservice Science Teachers' Informal Reasoning Regarding Socioscientific Issues and the Factors Influencing Their Informal Reasoning

    Science.gov (United States)

    Topçu, Mustafa Sami; Yılmaz-Tüzün, Özgül; Sadler, Troy D.

    2011-06-01

    The purpose of the study is to explore Turkish preservice science teachers' informal reasoning regarding socioscientific issues and the factors influencing their informal reasoning. The researchers engaged 39 preservice science teachers in informal reasoning interview and moral decision-making interview protocols. Of the seven socioscientific issues, three issues were related to gene therapy, another three were related to human cloning, and one was related to global warming. The data were analyzed using an interpretive qualitative research approach. The characteristic of informal reasoning was determined as multidimensional, and the patterns of informal reasoning emerged as rationalistic, emotive, and intuitive reasoning. The factors influencing informal reasoning were: personal experiences, social considerations, moral-ethical considerations, and technological concerns.

  18. The morality of socioscientific issues: Construal and resolution of genetic engineering dilemmas

    Science.gov (United States)

    Sadler, Troy D.; Zeidler, Dana L.

    2004-01-01

    The ability to negotiate and resolve socioscientific issues has been posited as integral components of scientific literacy. Although philosophers and science educators have argued that socioscientific issues inherently involve moral and ethical considerations, the ultimate arbiters of morality are individual decision-makers. This study explored the extent to which college students construe genetic engineering issues as moral problems. Twenty college students participated in interviews designed to elicit their ideas, reactions, and feelings regarding a series of gene therapy and cloning scenarios. Qualitative analyses revealed that moral considerations were significant influences on decision-making, indicating a tendency for students to construe genetic engineering issues as moral problems. Students engaged in moral reasoning based on utilitarian analyses of consequences as well as the application of principles. Issue construal was also influenced by affective features such as emotion and intuition. In addition to moral considerations, a series of other factors emerged as important dimensions of socioscientific decision-making. These factors included personal experiences, family biases, background knowledge, and the impact of popular culture. The implications for classroom science instruction and future research are discussed.

  19. Scepticism and Trust: Two Counterpoint Essentials in Science Education for Complex Socio-Scientific Issues

    Science.gov (United States)

    Fensham, Peter J.

    2014-01-01

    In this response to Tom G. K. Bryce and Stephen P. Day's ("Cult Stud Sci Educ." doi:10.1007/s11422-013-9500-0, 2013) original article, I share with them their interest in the teaching of climate change in school science, but I widen it to include other contemporary complex socio-scientific issues that also need to be discussed. I…

  20. Enhancing nature of science understanding, reflective judgment, and argumentation through socioscientific issues

    Science.gov (United States)

    Callahan, Brendan E.

    There is a distinct divide between theory and practice in American science education. Research indicates that a constructivist philosophy, in which students construct their own knowledge, is conductive to learning, while in many cases teachers continue to present science in a more traditional manner. This study sought to explore possible relationships between a socioscientific issues based curriculum and three outcome variables: nature of science understanding, reflective judgment, and argumentation skill. Both quantitative and qualitative methods were used to examine both whole class differences as well as individual differences between the beginning and end of a semester of high school Biology I. Results indicated that the socioscientific issues based curriculum did not produce statistically significant changes over the course of one semester. However, the treatment group scored better on all three instruments than the comparison group. The small sample size may have contributed to the inability to find statistical significance in this study. The qualitative interviews did indicate that some students provided more sophisticated views on nature of science and reflective judgment, and were able to provide slightly more complex argumentation structures. Theoretical implications regarding the use of explicit use of socioscientific issues in the classroom are presented.

  1. Socio-Scientific Controversial Issues in 1st Cycle of Basic Education

    Directory of Open Access Journals (Sweden)

    Fábio Ribeiro

    2014-12-01

    Full Text Available Assuming the importance of science education, from early years, aiming to educate citizens capable of thinking critically and act in scientific and technological contexts, a study was carried out in order to develop learning situations focused on controversial socio-scientific issues to promote students’ argumentation skills and scientific knowledge building / mobilization. The study was based on a qualitative methodology, following an action research plan. It was conducted with a class of 3th grade, having been addressed controversial socio-scientific issues, framed in science curriculum topics, using strategies of debate, role-play and argumentative essays. Data was collected using an analyzing instrument of student´s oral and written productions. In data analysis the privileged technique was content analysis. The results suggest that students mobilized requested scientific knowledge, showing improvement in the effective use of argumentation skills required. This allows us to conclude that the approach of controversial socio-scientific issues contributes to the promotion students´ argumentation skills as well as for scientific knowledge construction / mobilization.

  2. The Effect of Using Socio-Scientific Issues Approach in Teaching Environmental Issues on Improving the Students' Ability of Making Appropriate Decisions towards These Issues

    Science.gov (United States)

    Zo'bi, Abdallah Salim

    2014-01-01

    This study aimed to identify nature of students' decisions patterns towards environmental issues and the possibility to improve these decisions during teaching process using Socio-Scientific Issues Approach. And to achieve this, the researcher prepared and developed tools of the study represented by a test of open questions focused on…

  3. Learning as change: Responding to socio-scientific issues through informal education

    Science.gov (United States)

    Allen, Lauren Brooks

    Informal learning is an important venue for educating the general public about complex socio-scientific issues: intersections of scientific understanding and society. My dissertation is a multi-tiered analysis of how informal education, and particularly informal educators, can leverage learning to respond to one particular socio-scientific issue: climate change. Life-long, life-wide, and life-deep learning not only about the science of climate change, but how communities and society as a whole can respond to it in ways that are commensurate with its scale are necessary. In my three-article dissertation, I investigated the changes in practice and learning that informal educators from a natural history museum underwent in the process of implementing a new type of field trip about climate change. This study focused on inquiry-based learning principles taken on by the museum educators, albeit in different ways: learner autonomy, conversation, and deep investigation. My second article, a short literature review, makes the argument that climate change education must have goals beyond simply increasing learners' knowledge of climate science, and proposes three research-based principles for such learning: participation, relevance, and interconnectedness. These principles are argued to promote learning to respond to climate change as well as increased collective efficacy, necessary for responding. Finally, my third article is an in-depth examination of a heterogeneous network of informal educators and environmental professionals who worked together to design and implement a city-wide platform for informal climate change learning. By conceptualizing climate change learning at the level of the learning ecology, educators and learners are able to see how it can be responded to at the community level, and understand how climate change is interconnected with other scientific, natural, and social systems. I briefly discuss a different socio-scientific issue to which these

  4. A case-study of a socio-scientific issues curricular and pedagogical intervention in an undergraduate microbiology course: A focus on informal reasoning

    Science.gov (United States)

    Schalk, Kelly A.

    The purpose of this investigation was to measure specific ways a student interest SSI-based curricular and pedagogical affects undergraduates' ability informally reason. The delimited components of informal reasoning measured were undergraduates' Nature of Science conceptualizations and ability to evaluate scientific information. The socio-scientific issues (SSI) theoretical framework used in this case-study has been advocated as a means for improving students' functional scientific literacy. This investigation focused on the laboratory component of an undergraduate microbiology course in spring 2008. There were 26 participants. The instruments used in this study included: (1) Individual and Group research projects, (2) journals, (3) laboratory write-ups, (4) a laboratory quiz, (5) anonymous evaluations, and (6) a pre/post article exercise. All instruments yielded qualitative data, which were coded using the qualitative software NVivo7. Data analyses were subjected to instrumental triangulation, inter-rater reliability, and member-checking. It was determined that undergraduates' epistemological knowledge of scientific discovery, processes, and justification matured in response to the intervention. Specifically, students realized: (1) differences between facts, theories, and opinions; (2) testable questions are not definitively proven; (3) there is no stepwise scientific process; and (4) lack of data weakens a claim. It was determined that this knowledge influenced participants' beliefs and ability to informally reason. For instance, students exhibited more critical evaluations of scientific information. It was also found that undergraduates' prior opinions had changed over the semester. Further, the student interest aspect of this framework engaged learners by offering participants several opportunities to influentially examine microbiology issues that affected their life. The investigation provided empirically based insights into the ways undergraduates' interest

  5. Socioscientific Argumentation: The effects of content knowledge and morality

    Science.gov (United States)

    Sadler, Troy D.; Donnelly, Lisa A.

    2006-10-01

    Broad support exists within the science education community for the incorporation of socioscientific issues (SSI) and argumentation in the science curriculum. This study investigates how content knowledge and morality contribute to the quality of SSI argumentation among high school students. We employed a mixed-methods approach: 56 participants completed tests of content knowledge and moral reasoning as well as interviews, related to SSI topics, which were scored based on a rubric for argumentation quality. Multiple regression analyses revealed no statistically significant relationships among content knowledge, moral reasoning, and argumentation quality. Qualitative analyses of the interview transcripts supported the quantitative results in that participants very infrequently revealed patterns of content knowledge application. However, most of the participants did perceive the SSI as moral problems. We propose a “Threshold Model of Knowledge Transfer” to account for the relationship between content knowledge and argumentation quality. Implications for science education are discussed.

  6. Analysis of students critical thinking skills in socio-scientific issues of biodiversity subject

    Science.gov (United States)

    Santika, A. R.; Purwianingsih, W.; Nuraeni, E.

    2018-05-01

    Critical thinking is a skills the which students should have in order to face 21st century demands. Critical thinking skills can help people in facing their daily problems, especially problems roommates relate to science. This research is aimed to analyze students critical thinking skills in socio-scientific issues of biodiversity subject. The method used in this research was descriptive method. The research subject is first-grade students’ in senior high school. The data collected by interview and open-ended question the which classified based on framework : (1) question at issue, (2) information (3) purpose (4) concepts (5) assumptions, (6) point of view, (7) interpretation and inference, and (8) implication and consequences, then it will be assessed by using rubrics. The result of the data showed students critical thinking skills in socio-scientific issues of biodiversity subject is in low and medium category. Therefore we need a learning activity that is able to develop student’s critical thinking skills, especially regarding issues of social science.

  7. Teacher formation related to socio-scientific issues: complexity, contributions and limitations of an educational practice

    Directory of Open Access Journals (Sweden)

    Mariuce Campos de Moraes

    2015-12-01

    Full Text Available This reflection refers to teacher formation related to socio-scientific issues. Whereas such matters take into account the impact of scientific development in society, including ethical aspects and encompass dilemmas involving a wide range of prospects for its resolution, we propose analysis of the complexity that is inherent in their teaching. Thus, we aimed to analyze different spaces and teaching time that produce and are produced in close linkage between theory and practice, as well as their contributions and limitations. The study required a dynamic conversation system that led to the analysis indicators. The issue of sustainability was shown to be feasible for educational planning as cover technical and scientific knowledge, ethical, social and economic pressures. The collective production allowed understand arguments and reflective-creative processes. The lived relations in schools has accompanied and limited the ideas expressed on the socio-scientific issues. We understand that the simultaneity of research and reflection in the sociocultural context has strengthened teacher formation.

  8. The Integration of HIV and AIDS as a Socio-Scientific Issue in the Life Sciences Curriculum

    Science.gov (United States)

    Wolff, Eugenie; Mnguni, Lindelani

    2015-01-01

    The potential of science to transform lives has been highlighted by a number of scholars. This means that critical socio-scientific issues (SSIs) must be integrated into science curricula. Development of context-specific scientific knowledge and twenty-first-century learning skills in science education could be used to address SSIs such as…

  9. Students' Socioscientific Reasoning and Decision-Making on Energy-Related Issues--Development of a Measurement Instrument

    Science.gov (United States)

    Sakschewski, Mark; Eggert, Sabina; Schneider, Susanne; Bögeholz, Susanne

    2014-01-01

    The concept of energy is one key component of science education curricula worldwide. While it is still being taught in many science classrooms from a mainly conceptual knowledge perspective, the need to frame the concept of energy as a socioscientific issue and implement it in the context of citizenship education and education for sustainable…

  10. Training in Decision-Making Strategies: An Approach to Enhance Students' Competence to Deal with Socio-Scientific Issues

    Science.gov (United States)

    Gresch, Helge; Hasselhorn, Marcus; Bögeholz, Susanne

    2013-01-01

    Dealing with socio-scientific issues in science classes enables students to participate productively in controversial discussions concerning ethical topics, such as sustainable development. In this respect, well-structured decision-making processes are essential for elaborate reasoning. To foster decision-making competence, a computer-based…

  11. Argumentation as a Strategy for Increasing Preservice Teachers' Understanding of Climate Change, a Key Global Socioscientific Issue

    Science.gov (United States)

    Lambert, Julie L.; Bleicher, Robert E.

    2017-01-01

    Findings of this study suggest that scientific argumentation can play an effective role in addressing complex socioscientific issues (i.e. global climate change). This research examined changes in preservice teachers' knowledge and perceptions about climate change in an innovative undergraduate-level elementary science methods course. The…

  12. Rhetorical Use of Inscriptions in Students' Written Arguments About Socioscientific Issues

    Science.gov (United States)

    Xiao, Sihan

    2018-05-01

    Educators expect that students be able to make informed decisions about science-related problems in their everyday lives. Engaging science in such problems often entails evaluating available evidence for given arguments. This study explores how students use inscriptions as evidence to argue about socioscientific issues. Fifth- and sixth-grade students (N = 102) in two intact classrooms completed written argument tasks in which they were asked to cite given inscriptions to support their decisions about energy use or genetically modified organisms. Qualitative content analyses of these written arguments, which focused on the coordination between inscriptions and claims, show three patterns of rhetorical use of inscriptions: seeing is believing, believing is seeing, and asserting is inferring. What counts as evidence was not the inscriptions per se, but the rhetorical functions they performed in particular arguments. These findings suggest that justifying socioscientific decisions is functionally different from explaining scientific phenomena. Linking these two activities in school may help students more productively engage with science in their everyday lives.

  13. Informal reasoning regarding socioscientific issues: The influence of morality and content knowledge

    Science.gov (United States)

    Sadler, Troy Dow

    This study focused on informal reasoning regarding socioscientific issues. It explored how morality and content knowledge influenced the negotiation and resolution of contentious and complex scenarios based on genetic engineering. Two hundred and sixty-nine undergraduate students completed a quantitative test of genetics concepts. A sub-set of the students (n = 30) who completed this instrument and represented divergent levels of content knowledge participated in two individual interviews, during which they discussed their ideas, reactions, and solutions to three gene therapy scenarios and three cloning scenarios. A mixed-methods approach was used to examine patterns of informal reasoning and the influence of morality, the effects of content knowledge on the use of informal reasoning patterns, and the effects of content knowledge on the quality of informal reasoning. Students demonstrated evidence of rationalistic, emotive, and intuitive forms of informal reasoning. Rationalistic informal reasoning described reason-based considerations; emotive informal reasoning described care-based considerations; and intuitive reasoning described considerations based on immediate reactions to the context of a scenario. Participants frequently relied on combinations of these reasoning patterns as they worked to resolve individual socioscientific scenarios. Most of the participants appreciated at least some of the moral implications of their decisions, and these considerations were typically interwoven within an overall pattern of informal reasoning. Although differences in content knowledge were not found to be related to modes of informal reasoning (rationalistic, emotive, and informal), data did indicate that differences in content knowledge were related to variations in informal reasoning quality. Participants, with more advanced understandings of genetics, demonstrated fewer instances of reasoning flaws, as defined by a priori criteria (intra-scenario coherence, inter

  14. Integrating Bioethics in Sciences’ curricula using values in science and socio-scientific issues

    Directory of Open Access Journals (Sweden)

    C. Sousa

    2017-04-01

    Full Text Available The  The main objective of the present work is selection of ethical issues that should be addressed with first year undergraduate and K-12 students. Since K-12 Sciences’ curriculum, in Portugal, does not include bioethics content in any discipline explicitly, teachers need to make an effort to include it. Some online materials are available to use in high school classes and will be discussed. My proposal combines inquiry learning-teaching methods with the aim of promoting the discussion of bioethics issues in accordance to UNESCO Bioethics Core Curriculum already adopted by twenty universities throughout the world (Darwish 2015. Some of the issues that are addressed are: ecology and environment ethics, infectious diseases and vaccination, water for all, intellectual property, genomes and patents, biotechnological advances (genetic modified organisms and synthesis of genomes, future generations, climate hanges and natural resources, biomedical advances and human rights, authorship and contributions in scientific publications, and biobanks. In conclusion, this study may constitute an example to facilitate the implementation, by K-12 teachers, of active inquiry strategies, using features of science such as values and socio-scientific issues, and focused on the discussion of concrete ethical issues facing humanity. It also constitutes a proposal of integrating Bioethics in undergraduate sciences’ curricula.

  15. Argumentation as a Strategy for Increasing Preservice Teachers’ Understanding of Climate Change, a Key Global Socioscientific Issue

    OpenAIRE

    Lambert, Julie L.; Bleicher, Robert E.

    2017-01-01

    Findings of this study suggest that scientific argumentation can play an effective role in addressing complex socioscientific issues (i.e. global climate change). This research examined changes in preservice teachers’ knowledge and perceptions about climate change in an innovative undergraduate-level elementary science methods course. The preservice teachers’ understanding of fundamental concepts (e.g., the difference between weather and climate, causes of recent global warming, etc.) increas...

  16. Effects of socioscientific issues-based instruction on argumentation ability and biology concepts of upper secondary school students

    Science.gov (United States)

    Faelt, Surasak; Samiphak, Sara; Pattaradilokrat, Sittiporn

    2018-01-01

    Argumentation skill is an essential skill needed in students, and one of the competencies in scientific literacy. Through arguing on socioscientific issues, students may gain deeper conceptual understanding. The purpose of this research is to examine the efficacy of a socioscientific issues-based instruction compared with an inquirybased instruction. This is to determine which one is better in promoting 10th grade students' argumentation ability and biology concepts of digestive system and cellular respiration. The forty 10th grade students included in this study were from two mathematics-science program classes in a medium-sized secondary school located in a suburb of Buriram province, Thailand. The research utilizes a quasi-experimental design; pre-test post-test control group design. We developed and implemented 4 lesson plans for both socioscientific issues-based instruction and inquiry-based instruction. Ten weeks were used to collect the data. A paper-based questionnaire and informal interviews were designed to test students' argumentation ability, and the two-tier multiple-choice test was designed to test their biology concepts. This research explore qualitatively and quantitatively students' argumentation abilities and biology concepts, using arithmetic mean, mean of percentage, standard deviation and t-test. Results show that there is no significant difference between the two group regarding mean scores of the argumentation ability. However, there is significant difference between the two groups regarding mean scores of the biology concepts. This suggests that socioscientific issues-based instruction could be used to improve students' biology concepts.

  17. Progression in Ethical Reasoning When Addressing Socio-scientific Issues in Biotechnology

    Science.gov (United States)

    Berne, Birgitta

    2014-11-01

    This article reports on the outcomes of an intervention in a Swedish school in which the author, a teacher-researcher, sought to develop students' (14-15 years old) ethical reasoning in science through the use of peer discussions about socio-scientific issues. Prior to the student discussions various prompts were used to highlight different aspects of the issues. In addition, students were given time to search for further information themselves. Analysis of students' written arguments, from the beginning of the intervention and afterwards, suggests that many students seem to be moving away from their use of everyday language towards using scientific concepts in their arguments. In addition, they moved from considering cloning and 'designer babies' solely in terms of the present to considering them in terms of the future. Furthermore, the students started to approach the issues in additional ways using not only consequentialism but also the approaches of virtue ethics, and rights and duties. Students' progression in ethical reasoning could be related to the characteristics of the interactions in peer discussions as students who critically and constructively argued with each other's ideas, and challenged each other's claims, made progress in more aspects of ethical reasoning than students merely using cumulative talk. As such, the work provides valuable indications for the importance of introducing peer discussions and debates about SSIs in connection to biotechnology into the teaching of science in schools.

  18. Western Australian High School Students' Understandings about the Socioscientific Issue of Climate Change

    Science.gov (United States)

    Dawson, Vaille

    2015-05-01

    Climate change is one of the most significant science issues facing humanity; yet, teaching students about climate change is challenging: not only is it multidisciplinary, but also it is contentious and debated in political, social and media forums. Students need to be equipped with an understanding of climate change science to be able to participate in this discourse. The purpose of this study was to examine Western Australian high school students' understanding of climate change and the greenhouse effect, in order to identify their alternative conceptions about climate change science and provide a baseline for more effective teaching. A questionnaire designed to elicit students' understanding and alternative conceptions was completed by 438 Year 10 students (14-15 years old). A further 20 students were interviewed. Results showed that students know different features of both climate change and the greenhouse effect, however not necessarily all of them and the relationships between. Five categories of alternative conceptions were identified. The categories were (1) the greenhouse effect and the ozone layer; (2) types of greenhouse gases; (3) types of radiation; (4) weather and climate and (5) air pollution. These findings provide science educators a basis upon which to develop strategies and curriculum resources to improve their students' understanding and decision-making skills about the socioscientific issue, climate change.

  19. Argumentation Quality of Socio-scientific Issue between High School Students and Postgraduate Students about Cancer

    Science.gov (United States)

    Anisa, A.; Widodo, A.; Riandi, R.

    2017-09-01

    Argumentation is one factor that can help improve critical thinking skills. Arguing means to defend statements with the various data, denials, evidence, and reinforcement that support the statement. The research aimed to capture the quality of argument skills by students in grade 12 high school students and in postgraduate student on social-scientific issues of cancer. Both group subjects are not in the same school or institution, chosen purposively with the subject of 39 high school students of grade 12 in one district of West Java and 13 students of Biology education postgraduate in one of University in West Java - Indonesia. The results of the quality structure of arguments in both subject groups show the same pattern, which is claim - warrant - and ground, with the quality of counterclaim aspects on the postgraduate students look better than grade 12 students. This provides an illustration that the ability in argumentation between students and teachers in the socio-scientific issue of cancer should be evaluate so that the learning process would be more refined in schools.

  20. Adults' decision-making about the electronic waste issue: The role of the nature of science conceptualizations and moral concerns in socio-scientific decision-making

    Science.gov (United States)

    Yu, Yuqing

    Socio-scientific issues have become increasingly important in Science-Technology-Society (STS) education as a means to make science learning more relevant to students' lives. This study used the e-waste issue as a context to investigate two aspects of socio-scientific decision-making: (1) the relationship between the nature of science (NOS) conceptualizations and decision-making; and (2) moral concerns involved in the process of decision-making. This study contributes to the field of socio-scientific issue research and STS education in the following ways. First, it is the first study that performed meta-analysis to seek the relationship between the NOS understanding and decision-making. This study concludes that valuable NOS conceptualizations that are highly related to the socio-scientific issue under investigation, rather than general NOS understanding, exert statistically significant influences on decision-making. Second, this study empirically examined the Multiple Responses Model (MRM), which enables the transfer of qualitative NOS responses into quantitative data, and hence, inferential statistics. The current study justifies the significance of unidimensionality to the application of the MRM. It addresses the limitations associated with the MRM and provides implications for future use of the MRM in other contexts. Finally, the study explores the role of moral concerns in socio-scientific decision-making. Eight participants engaged in interviews that were designed to elicit their reactions and feelings regarding the issue of exporting e-waste to poor countries. Qualitative analyses demonstrated that moral considerations were significant influences on decision-making. In addition, participants' action responses revealed that they were motivated to take action to help the environment. The study has implications for socio-scientific issue studies in other contexts and for teacher education programs that use socio-scientific issues to advance teachers' reasoning

  1. Scepticism and trust: two counterpoint essentials in science education for complex socio-scientific issues

    Science.gov (United States)

    Fensham, Peter J.

    2014-09-01

    In this response to Tom G. K. Bryce and Stephen P. Day's (Cult Stud Sci Educ. doi: 10.1007/s11422-013-9500-0, 2013) original article, I share with them their interest in the teaching of climate change in school science, but I widen it to include other contemporary complex socio-scientific issues that also need to be discussed. I use an alternative view of the relationship between science, technology and society, supported by evidence from both science and society, to suggest science-informed citizens as a more realistic outcome image of school science than the authors' one of mini-scientists. The intellectual independence of students Bryce and Day assume, and intend for school science, is countered with an active intellectual dependence. It is only in relation to emerging and uncertain scientific contexts that students should be taught about scepticism, but they also need to learn when, and why to trust science as an antidote to the expressions of doubting it. Some suggestions for pedagogies that could lead to these new learnings are made. The very recent fifth report of the IPCC answers many of their concerns about climate change.

  2. Does Evidence Matter? How Middle School Students Make Decisions About Socioscientific Issues

    Science.gov (United States)

    Emery, Katherine Beth

    People worldwide are faced with making decisions daily. While many decisions are quick (e.g., what clothes to wear), others, such as those about environmental issues (e.g., overfishing), require more thought and have less immediate outcomes. How one makes such decisions depends on how one interprets, evaluates, and uses evidence. The central objective of this thesis was to investigate environmental science literacy in general, and specifically, to understand how evidence and other factors impact decision-making. I conducted three main studies: First, I provide an example of how decision-making practices affect environmental systems and services through a descriptive case study of Atlantic bluefin tuna overfishing. I reviewed the scientific, historical and cultural factors contributing to a paradox of marine preservation in the Mediterranean and highlighted the need for education and informed decision-making about such social and ecological issues. This study motivated me to investigate how people make decisions about environmental issues. Second, I interviewed middle school students to understand how they describe and evaluate evidence hypothetically and in practice about environmental issues---a key component of environmental literacy. Students discussed how they would evaluate evidence and then were then given a packet containing multiple excerpts of information from conflicting stakeholders about an environmental issue and asked how they would make voting or purchasing decisions about these issues. Findings showed that students' ideas about evaluating evidence (e.g., by scientific and non-scientific criteria) match their practices in part. This study was unique in that it investigated how students evaluate evidence that (1) contradicts other evidence and (2), conflicts with the student's prior positions. Finally, I investigated whether middle school students used evidence when making decisions about socioscientific issues. I hypothesized that holding a strong

  3. Middle School Students' Use of Epistemological Resources while Reasoning about Science Performance Tasks and Media Reports of Socioscientific Issues

    Science.gov (United States)

    Buckingham, Brandy L. E.

    The goal of science education is to prepare students to make decisions about the complicated socioscientific issues that are an inescapable part of modern life, from personal medical decisions to evaluating a political candidate's environmental platform. We cannot expect adults to maintain a deep conceptual understanding of the current state of every branch of science that might prove relevant to their lives, so we must prepare them to rely on other knowledge to make these decisions. Epistemological beliefs about scientific knowledge--what it is, its purpose, how it is constructed--are one type of knowledge that could be brought to bear when evaluating scientific claims. Complicating this situation is the fact that most adults will get most of their information about these socioscientific issues from the news media. Journalists do not have the same goals or norms as scientists, and this media lens can distort scientific issues. This dissertation addresses the question of whether we can assess epistemological change in a way that gives us meaningful information about how people will apply their epistemological understanding of science when they make decisions in the real world. First, I designed a written assessment made up of performance tasks to assess middle school students' implicit epistemological beliefs, and looked at whether we can use such an assessment to see epistemological change over two years. I then gave the same students news articles about whether there is a link between vaccines and autism and looked at their reasoning about this issue and how the journalistic features of two different articles impacted their reasoning. Finally, I examined the external validity of the epistemology assessment by looking at whether it predicted anything about students' responses to the news articles. While I was able to find evidence of differences between eighth graders' and sixth graders' use of epistemological resources within the performance tasks, I found that

  4. A Framework for Guiding Future Citizens to Think Critically about Nature of Science and Socioscientific Issues

    Science.gov (United States)

    Yacoubian, Hagop A.

    2015-01-01

    In this article, I introduce a framework for guiding future citizens to think critically about nature of science (NOS) and "with" NOS as they engage in socioscientific decision making. The framework, referred to as the critical thinking--nature of science (CT-NOS) framework, explicates and targets both NOS as a learning objective and NOS…

  5. Designing and Implementing Web-Based Scaffolding Tools for Technology-Enhanced Socioscientific Inquiry

    Science.gov (United States)

    Shin, Suhkyung; Brush, Thomas A.; Glazewski, Krista D.

    2017-01-01

    This study explores how web-based scaffolding tools provide instructional support while implementing a socio-scientific inquiry (SSI) unit in a science classroom. This case study focused on how students used web-based scaffolding tools during SSI activities, and how students perceived the SSI unit and the scaffolding tools embedded in the SSI…

  6. Training in Decision-making Strategies: An approach to enhance students' competence to deal with socio-scientific issues

    Science.gov (United States)

    Gresch, Helge; Hasselhorn, Marcus; Bögeholz, Susanne

    2013-10-01

    Dealing with socio-scientific issues in science classes enables students to participate productively in controversial discussions concerning ethical topics, such as sustainable development. In this respect, well-structured decision-making processes are essential for elaborate reasoning. To foster decision-making competence, a computer-based programme was developed that trains secondary school students (grades 11-13) in decision-making strategies. The main research question is: does training students to use these strategies foster decision-making competence? In addition, the influence of meta-decision aids was examined. Students conducted a task analysis to select an appropriate strategy prior to the decision-making process. Hence, the second research question is: does combining decision-making training with a task analysis enhance decision-making competence at a higher rate? To answer these questions, 386 students were tested in a pre-post-follow-up control-group design that included two training groups (decision-making strategies/decision-making strategies combined with a task analysis) and a control group (decision-making with additional ecological information instead of strategic training). An open-ended questionnaire was used to assess decision-making competence in situations related to sustainable development. The decision-making training led to a significant improvement in the post-test and the follow-up, which was administered three months after the training. Long-term effects on the quality of the students' decisions were evident for both training groups. Gains in competence when reflecting upon the decision-making processes of others were found, to a lesser extent, in the training group that received the additional meta-decision training. In conclusion, training in decision-making strategies is a promising approach to deal with socio-scientific issues related to sustainable development.

  7. The Development of a Socioscientific Issues-Based Curriculum Unit for Middle School Students: Global Warming Issue

    Science.gov (United States)

    Atabey, Nejla; Topçu, Mustafa Sami

    2017-01-01

    In this study, we aimed at developing "Human and Environment" unit around SSI based instruction. We followed action research methodology in development and implementation of the unit. The participants of this study were 24 seventh graders students and the instruction was extended to eight and a half weeks, taking four hours in a week.…

  8. The correlation between concept mastery and stage of moral reasoning student using socio-scientific issues on reproductive system material

    Science.gov (United States)

    Lestari, T. A.; Saefudin; Priyandoko, D.

    2018-05-01

    This research aims to analyze the correlation between concept mastery and moral stages of students. The research method using a correlational study with stratified random sampling technique. The population in this research is all of eleventh grade students in Senior High School Bandung. Data were collected from 297 eleventh grade students of three Senior High School in Bandung with use the instrument in the form of examination and stage of moral reasoning questionnaire. The stage of moral reasoning in this research consists of two student’s moral reasoning categories based on 16 questionnaire as the indicators from Jones et al. (2007). The results of this research shows that the average of eleventh grade student’s moral reasoning stage is the advanced stage. The results of this research shows that the concept mastery and the stage of moral reasoning indicates that there are 0.370 0f a positive correlation. This research provides an overview of eleventh grade student about concept mastery and stage of moral reasoning using socio-scientific issues.

  9. Navigating the Complexity of Socio-scientific Controversies—How Students Make Multiple Voices Present in Discourse

    Science.gov (United States)

    Solli, Anne; Hillman, Thomas; Mäkitalo, Åsa

    2017-10-01

    In this article, we argue that students' unfolding discourse on socio-scientific issues (SSI) can be fruitfully analyzed by using dialogical theories of language and communication (Bakhtin 1986; Linell 2009). While research in science education often reports on how individual reasoning changes when bringing SSI into the classroom, we argue for the relevance of analyzing how the individual is "in dialogue" with present as well as remote interlocutors and contexts on the internet. We suggest that the analytical approach is particularly sensitized to illuminate how students' handle multiple perspectives. A dialogical perspective takes as its premise that SSI are part of society, where politicians, interest groups, and scientists engage in debates and offer perspectives that are often in conflict. Rather than assuming that the individual student is the primary unit for analysis, a dialogical approach is premised on an analysis that incorporates several perspectives and voices—a multivocality that also resides with the individual. Arguing for the relevance of this analytical approach to studies of SSI in the classroom, we analyze a group of students in upper secondary school as they discuss hydraulic fracturing after having worked with online data. The results illuminate how students discursively manage multivocality and multimodality inherent in the following SSI online. We describe a set of discursive means that the students use to handle the many perspectives involved when communicating about the issue. In addition, we describe and articulate what kind of communicative competences that are involved and, hence, could be cultivated through education, when engaging in public debates.

  10. Teaching Strategies for Developing Students' Argumentation Skills about Socioscientific Issues in High School Genetics

    Science.gov (United States)

    Dawson, Vaille Maree; Venville, Grady

    2010-01-01

    An outcome of science education is that young people have the understandings and skills to participate in public debate and make informed decisions about science issues that influence their lives. Toulmin's argumentation skills are emerging as an effective strategy to enhance the quality of evidence based decision making in science classrooms. In…

  11. Western Australian High School Students' Understandings about the Socioscientific Issue of Climate Change

    Science.gov (United States)

    Dawson, Vaille

    2015-01-01

    Climate change is one of the most significant science issues facing humanity; yet, teaching students about climate change is challenging: not only is it multidisciplinary, but also it is contentious and debated in political, social and media forums. Students need to be equipped with an understanding of climate change science to be able to…

  12. Debate on global warming as a socio-scientific issue: science teaching towards political literacy

    Science.gov (United States)

    dos Santos, Wildson Luiz Pereira

    2014-09-01

    The focus of this response to the original article by Tom G. H. Bryce and Stephen P. Day (Cult Stud Sci Educ. doi: 10.1007/s11422-012-9407-1, 2013) is the use of empirical data to illustrate and expand the understanding of key points of their argument. Initially, I seek to discuss possible answers to the three questions posed by the authors related to: (1) the concerns to be addressed and the scientific knowledge to be taken into account in the climate change debate, (2) the attention to be paid to perspectives taken by "alarmists" and "deniers," and (3) the approaches to be used to conduct controversial global warming debate. In this discussion, I seek to contribute to the debate proposed by the original paper, illustrating various points commented on by the authors and expanding to other possibilities, which highlight the importance of political issues in the debate. Therefore, I argue that socio-political issues must be taken into account when I aim for a scientific literacy that can enhance students' political education. Likewise, I extend the debate presented in the original article, emphasizing the attention that should be paid to these aspects and approaching science education from a critical perspective. Highlighting only the confirmation bias without considering political implications of the debate can induce a reductionist and empiricist view of science, detached from the political power that acts on scientific activity. In conclusion, I support the idea that for a critical science education, the discussion of political issues should be involved in any controversial debate, a view, which goes beyond the confirmation bias proposed by Bryce and Day for the global warming debate. These issues are indeed vital and science teachers should take them into account when preparing their lessons for the debate on climate change.

  13. Integrating Bioethics in Sciences’ curricula using values in science and socio-scientific issues

    OpenAIRE

    Sousa, C.

    2017-01-01

    [EN] The The main objective of the present work is selection of ethical issues that should be addressed with first year undergraduate and K-12 students.Since K-12 Sciences’ curriculum, in Portugal, does not include bioethics content in any discipline explicitly, teachers need to make an effort to include it. Some online materials are available to use in high school classes and will be discussed.My proposal combines inquiry learning-teaching methods with the aim of promoting the discussion of ...

  14. Socio-scientific issues with CTS focus on training of science teachers: complementary perspective

    Directory of Open Access Journals (Sweden)

    Rosa Oliveira Marins Azevedo

    2013-06-01

    Full Text Available Theoretical work that seeks to highlight the possible reasons why the STS approach has not effectively be inserted in the educational process and point out alternative to its insertion. It thus explores the origin of the STS movement and discusses its focus on education, science teaching and teacher education. It is a study in a critical perspective, from a documentary research focused on scientific production published in books, theses, papers presented in conference proceedings and journals in the field of education. The readings allowed direct the discussions, assuming the interpretative analysis for the organization of the text. The study shows that teacher education, the problems presented in its theoretical and epistemological aspects and ethical, is the main obstacle to the insertion of the STS approach in the educational process. Alternatively, points to issues of social-scientific approach to STS approach in a complementary perspective, as the possibility of improvements in the aspects highlighted

  15. Pengaruh Learning Cycle–5E Berkonteks SSI Terhadap Pemahaman Hakikat Sains Pada Materi Larutan Penyangga Dan Hidrolisis Garam Siswa SMA

    Directory of Open Access Journals (Sweden)

    Eris Ratnawati

    2017-03-01

    Key words: Learning Cycle-5E , Socioscientific Issues, Nature Of Science, Buffer Solution, Salt Hydrolysis   Abstrak: Penelitian ini bertujuan menguji perbedaan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional pada materi larutan penyangga dan hidrolisis garam. Penelitian ini menggunakan rancangan penelitian eksperimen semu dengan pretes dan pascates. Sampel terdiri dari dua kelas dan dipilih menggunakan teknik convenience sampling di SMAN Tulungagung. Data diperoleh menggunakan instrumen angket hakikat sains berskala likert (R = 0,883 dan dianalisis dengan ANCOVA satu jalur dan effect size. Hasil penelitian menunjukkan ada perbedaan signifikan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional. Berdasarkan effect size, aspek hakikat sains yang berkontribusi tinggi adalah metode ilmiah, empiris, inferensi, dimensi sosial sains, dan penerapan sains dalam bidang sosbud. Aspek hakikat sains yang berkontribusi sedang adalah tentatif, kreatif, dan theory driven. Sedangkan hukum dan teori berkontribusi kecil. Kata kunci: Learning Cycle-5E , Socioscientific Issues, Hakikat Sains, Larutan Penyangga, Hidrolisis Garam

  16. A Conceptual Analysis of Perspective Taking in Support of Socioscientific Reasoning

    Science.gov (United States)

    Kahn, Sami

    Scientific literacy is concerned with the informed citizens' ability to negotiate scientifically-related societal issues. The suite of skills necessary to negotiate these complex issues is referred to as Socioscientific Reasoning (SSR). SSR requires, among other things, perspective-taking abilities in order to consider the multi-faceted nature of these open-ended, debatable socioscientific issues (SSI). Developing interventions and instruments to foster and measure perspective taking in support of SSR is therefore critical to the promotion of functional scientific literacy through both research and practice. Although widely studied in many disciplines, perspective taking is a particularly tangled construct that has been used to describe a range of activities representing different psychological domains and applied interchangeably with related constructs such as role taking, empathy, and theory of mind. This ambiguity makes it difficult to ensure construct validity and prevents science education researchers from honing in on the precise skills they wish to study and promote. To clarify the construct of perspective taking, this study undertook a conceptual analysis to operationalize perspective taking, drawing comparisons and distinctions between it and related constructs. Further, by applying a method known as conception development, perspective taking was positioned in the context of SSR, particularly as it relates to moral development, in order to devise a more precise construct relating perspective taking to SSR called socioscientific perspective taking (SSPT). It is asserted that SSPT requires engagement with others or their circumstances, an etic/emic shift, and a moral context comprised of reflective and reflexive judgment. Finally, in order to identify promising interventions for promoting SSPT in the science classroom, the newly-developed SSPT construct was applied to a series of extensively researched curricular frameworks that promote perspective taking in

  17. Framing student dialogue and argumentation: Content knowledge development and procedural knowing in SSI inquiry group work

    Directory of Open Access Journals (Sweden)

    Anne Kristine Byhring

    2014-10-01

    Full Text Available In this article, we discuss the negotiation of the situated common ground in classroom conversations. Decision making on socioscientific issues (SSI includes norms of diverse funds of knowledge and interests. Arguments and justification may include warrants that cannot necessarily be weighed on the same scale. We discuss Roberts’ Visions 1 and 2 of scientific literacy as framing the common ground of classroom discussions. Two teacher–student dialogue sequences with 11th grade students from the Norwegian research project ElevForsk exemplify the negotiation of the situated common ground and the students’ deliberations. Our analysis examines what goes on in the thematic content, as well as at the interpersonal level of language use. Further, we suggest that different framings may complement each other and provide a space for the students’ emerging scientific conceptual development as well as for deliberation as a form of emerging procedural knowing.

  18. SSI's Review of RD and D Programme 98

    International Nuclear Information System (INIS)

    1999-06-01

    The report contains SSI's review of SKB's research programme and SSI's background review PM. In the interest of transparency of the site selection process, SSI has made requirements concerning additional reporting from SKB, prior to the next step in the site selection process, and advice to the government regarding the need for clarification on a number of issues

  19. Longitudinal study of a cooperation-driven, socio-scientific issue intervention on promoting students' critical thinking and self-regulation in learning science

    Science.gov (United States)

    Wang, Hsin-Hui; Chen, Hsiang-Ting; Lin, Huann-shyang; Huang, Yu-Ning; Hong, Zuway-R.

    2017-10-01

    This longitudinal study explored the effects of a Cooperation-driven Socioscientific Issue (CDSSI) intervention on junior high school students' perceptions of critical thinking (CT) and self-regulation (SR) in Taiwan. Forty-nine grade 7 students were randomly selected as an experimental group (EG) to attend a 3-semester 72-hour intervention; while another 49 grade 7 students from the same school were randomly selected as the comparison group (CG). All participants completed a 4-wave student questionnaire to assess their perceptions of CT and SR. In addition, 8 target students from the EG with the lowest scores on either CT or SR were purposefully recruited for weekly observation. These target students and their teachers were interviewed one month after the intervention in each semester. Analyses of covariance and paired-wise t-tests revealed that the EG students' perceptions of CT and SR in learning science were improved during the study and were significantly better than their counterparts' at the end of the study. Systematic interview and classroom observation results were consistent with the quantitative findings. This study adds empirical evidence and provides insights into how CDSSI can be integrated into planning and implementing effective pedagogical strategies aimed at increasing students' perceptions of CT and SR in learning science.

  20. Controversial socio-scientific issues / Controvérsias sociocientíficas: aspectos metodológicos para a aproximação...

    Directory of Open Access Journals (Sweden)

    Ralph Levinson

    2016-07-01

    Full Text Available Entrevista com Ralph Levinson coordenada pelo Prof. Dr. Danilo Seithi Kato (UFTM. Ralph Levinson é professor do Instituto de Educação da Universidade de Londres. Ele dirige o mestrado em Educação para Ciências e orienta trabalhos de doutorado. Seus interesses de pesquisa são questões sociocientíficas controversas, ciência e justiça social, educação para ciências e criatividade e pedagogia em ciência. Ele é o autor de “Towards a theoretical framework for teaching controversial socio‐scientific issues” (2006 e de “Science education and democratic participation: an uneasy congruence” (2010. * * * Interview with Ralph Levinson coordinated by professor Danilo Seithi Kato (Federal University of Triângulo Mineiro - UFTM. Ralph Levinson is Reader in Education at the Institute of Education (University of London. He is programme director of the MA in Science Education and supervises doctoral students. His research interests are in socio-scientific issues, science and social justice, science education and creativity, and pedagogy in science. He is the author of “Towards a theoretical framework for teaching controversial socio‐scientific issues” (2006 and “Science education and democratic participation: an uneasy congruence” (2010.

  1. The Reasoned Arguments of a Group of Future Biotechnology Technicians on a Controversial Socio-Scientific Issue: Human Gene Therapy

    Science.gov (United States)

    Simonneaux, Laurence; Chouchane, Habib

    2011-01-01

    We tried to determine the reasoning behind the stances taken by a group of 19-21-year-old students on the controversial issue of the feasibility and acceptability of human gene therapy. The students were in training at a biotechnology institute. We organised classroom debates, punctuated by phases of epistemological "disturbances". We…

  2. A teaching-learning sequence on a socio-scientific issue: analysis and evaluation of its implementation in the classroom*

    Science.gov (United States)

    Vázquez-Alonso, Ángel; Aponte, Abdiel; Manassero-Mas, María-Antonia; Montesano, Marisa

    2016-07-01

    This study examines the effectiveness of a teaching-learning sequence (TLS) to improve the understanding of the influences and interactions between a technology (mining) and society. The aim of the study is also to show the possibility of both teaching and assessing the most innovative issues and aspects of scientific competence and their impact on the understanding of the nature of science. The methodology used a quasi-experimental, pre-post-test design with a control group, with pre-post-test differences as the empirical indicators of improved understanding. Improvements were modest, as the empirical differences (pre-post and experimental-control group) were not large, but the experimental group scored more highly than the control group. The areas that showed improvement were identified. The paper includes the TLS itself and the standardized assessment tools that are functional and transferable to other researchers and teachers. This paper first appeared in Educ. Quim (2014), 25(1), 190-202, a journal in Spanish. It appears by kind permission of the Editor, Professor Jose Chamizo. It was chosen because it illustrates the value of studies that use a standard procedure to address learning in a novel context.

  3. Student Difficulties in Socio-Scientific Argumentation and Decision-Making Research Findings: Crossing the Borders of Two Research Lines

    Science.gov (United States)

    Acar, Omer; Turkmen, Lutfullah; Roychoudhury, Anita

    2010-01-01

    Students' poor argumentation in the context of socio-scientific issues has become a concern in science education. Identified problems associated with student argumentation in socio-scientific issues are misevaluation of evidence, naive nature of science conceptualizations, and inappropriate use of value-based reasoning. In this theoretical paper,…

  4. Delusions About Evidence: On Why Scientific Evidence Should Not Be the Main Concern in Socioscientific Decision-Making

    DEFF Research Database (Denmark)

    Nielsen, Jan Alexis

    2013-01-01

    This article takes issue with the widespread assumption that students’ socioscientific decisions ought to be evidence based. On the basis of a careful conceptual analysis, it is argued that it is misleading to think in terms of evidence in socioscientific decision making because such decision mak...

  5. Photovoice: A Community-Based Socioscientific Pedagogical Tool

    Science.gov (United States)

    Cook, Kristin; Buck, Gayle

    2010-01-01

    Situating instruction in a local context, socioscientific issues (SSIs) offers students an opportunity to become active participants in the community and has the potential to encourage them to authentically and critically participate and engage in understanding, caring for, and transforming the world to which they belong. Photovoice is one way…

  6. International Expert Review of SRCan: Engineered Barrier Issues. External review contribution in support of SKI's and SSI's review of SR-Can

    International Nuclear Information System (INIS)

    Savage, David; Bennett, David; Apted, Mick; Saellfors, Goeran; Saario, Timo; Segle, Peter

    2008-03-01

    The Swedish Nuclear Fuel and Waste Management Company (SKB) has recently submitted a license application for the construction of a spent fuel encapsulation plant. SKB plans to submit a further license application in 2009 for the construction of a repository for the disposal spent nuclear fuel. In connection with the first of these applications, SKB published a safety report, known as SR-Can, which assessed the safety of a spent-fuel repository. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Authority (SSI) (the Authorities) will make formal reviews of the licence applications, and have, therefore, jointly commissioned a team of independent experts to assess and provide comments on SKB's safety reports. The Authorities will consider the views of the independent review team in completing their own reviews. This document presents the comments and findings of the Engineered Barrier System (EBS) review group on SR-Can. The SR-Can safety report includes an examination of EBS design and performance for a range of scenarios, including expected repository evolution and possible variant scenarios, that together address processes and events that might result in the loss of certain repository safety functions. Furthermore, a series of sensitivity analyses is also presented that provides helpful insights into the relative importance of many key parameters and processes related to the EBS. In general, the explanatory text of the SR-Can safety report is clear, and the cited references provide adequate technical justifications for the assumptions, models, and data that are abstracted into the SR-Can safety report. The review group considers, therefore, that SKB's development of SR-Can has been a very valuable exercise, and that SKB should be congratulated on the breadth, depth and general clarity of its research and development and safety assessment programmes. Notwithstanding these successes, the EBS review group has identified a range of

  7. International Expert Review of SRCan: Engineered Barrier Issues. External review contribution in support of SKI's and SSI's review of SR-Can

    Energy Technology Data Exchange (ETDEWEB)

    Savage, David (Quintessa Limited, Henley-on-Thames (GB)); Bennett, David (TerraSalus Limited, Oakham (GB)); Apted, Mick (Monitor Scientific LLC, Denver, CO (US)); Saellfors, Goeran (Chalmers Univ. of Technology, Goeteborg (SE)); Saario, Timo (VTT Materials and Building (FI)); Segle, Peter (Inspecta, Stockholm (SE))

    2008-03-15

    The Swedish Nuclear Fuel and Waste Management Company (SKB) has recently submitted a license application for the construction of a spent fuel encapsulation plant. SKB plans to submit a further license application in 2009 for the construction of a repository for the disposal spent nuclear fuel. In connection with the first of these applications, SKB published a safety report, known as SR-Can, which assessed the safety of a spent-fuel repository. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Authority (SSI) (the Authorities) will make formal reviews of the licence applications, and have, therefore, jointly commissioned a team of independent experts to assess and provide comments on SKB's safety reports. The Authorities will consider the views of the independent review team in completing their own reviews. This document presents the comments and findings of the Engineered Barrier System (EBS) review group on SR-Can. The SR-Can safety report includes an examination of EBS design and performance for a range of scenarios, including expected repository evolution and possible variant scenarios, that together address processes and events that might result in the loss of certain repository safety functions. Furthermore, a series of sensitivity analyses is also presented that provides helpful insights into the relative importance of many key parameters and processes related to the EBS. In general, the explanatory text of the SR-Can safety report is clear, and the cited references provide adequate technical justifications for the assumptions, models, and data that are abstracted into the SR-Can safety report. The review group considers, therefore, that SKB's development of SR-Can has been a very valuable exercise, and that SKB should be congratulated on the breadth, depth and general clarity of its research and development and safety assessment programmes. Notwithstanding these successes, the EBS review group has identified a range

  8. SSI's review of SKB's RDandD Program 2007

    International Nuclear Information System (INIS)

    Wiebert, Anders

    2008-05-01

    In this report, the Swedish Radiation Protection Authority (SSI) provides a review of the Swedish Nuclear Fuel and Waste Managements Company's (SKB) RDandD programme 2007. The report is a statement from SSI in the matter submitted earlier to SKI. In the review, SSI comments SKB's feedback to the continuous research and development program on the basis of the latest carried out safety analysis, SR-Can and the biosphere research. In the statement SSI points to a number of issues that need to be resolved before a licence application is handed in. SSI suggests that the Government asks for complements to the RDandD programme 2007. According to SSI, the programme concerning low and intermediate level waste and decommissioning of the nuclear power plants does not fulfil the requirements established by the Act on Nuclear Activities. Neither does the programme fulfil the expectations set by the Government decision regarding the RDandD programme 2004. SSI suggests that the programme should be complemented

  9. Toward socio-scientific participation: changing culture in the science classroom and much more. Setting the stage

    Science.gov (United States)

    Taylor, Peter; Lee, Stuart H.; Tal, Tali

    2006-12-01

    In response to Tali and Yarden's presentation of their efforts to teach socioscientific issues, the discussants address issues of authentic versus simulated activities; teachers as learners or co-creators with their students; educating people to contribute to science-based decisionmaking; the development of such socioscientific competence; the relationship between group or participatory processes and individual development; framing real world cases for every age of student; making space to delve into the historical and social background to any scientific theory, practice, or application; educating teachers who can coach students in socioscientific inquiry; and facing off against the traditional and resurgent emphasis on highstakes, content-oriented testing of students in science.

  10. The TANF/SSI connection.

    Science.gov (United States)

    Wamhoff, Steve; Wiseman, Michael

    Interactions and overlap of social assistance programs across clients interest policymakers because such interactions affect both the clients' well-being and the programs' efficiency. This article investigates the connections between Supplemental Security Income (SSI) and Temporary Assistance for Needy Families (TANF) and TANF's predecessor, the Aid to Families with Dependent Children (AFDC) program. Connections between receipt of TANF and SSI are widely discussed in both disability policy and poverty research literatures because many families receiving TANF report disabilities. For both states and the individuals involved, it is generally financially advantageous for adults and children with disabilities to transfer from TANF to SSI. States gain because the federal government pays for the SSI benefit, and states can then use the TANF savings for other purposes. The families gain because the SSI benefits they acquire are greater than the TANF benefits they lose. The payoff to states from transferring welfare recipients to SSI was substantially increased when Congress replaced AFDC with TANF in 1996. States retained less than half of any savings achieved through such transfers under AFDC, but they retain all of the savings under TANF. Also, the work participation requirements under TANF have obligated states to address the work support needs of adults with disabilities who remain in TANF, and states can avoid these costs if adults have disabilities that satisfy SSI eligibility requirements. The incentive for TANF recipients to apply for SSI has increased over time as inflation has caused real TANF benefits to fall relative to payments received by SSI recipients. Trends in the financial incentives for transfer to SSI have not been studied in detail, and reliable general data on the extent of the interaction between TANF and SSI are scarce. In addition, some estimates of the prevalence of TANF receipt among SSI awardees are flawed because they fail to include adults

  11. Students' socio-scientific reasoning on controversies from the viewpoint of education for sustainable development

    Science.gov (United States)

    Simonneaux, Laurence; Simonneaux, Jean

    2009-09-01

    In this article, we study third-year university students' reasoning about three controversial socio-scientific issues from the viewpoint of education for sustainable development: local issues (the reintroduction of bears in the Pyrenees in France, wolves in the Mercantour) and a global one (global warming). We used the theoretical frameworks of social representations and of socio-scientific reasoning. Students' reasoning varies according to the issues, in particular because of their emotional proximity with the issues and their socio-cultural origin. About this kind of issues, it seems pertinent to integrate into the operations of socio-scientific reasoning not only the consideration of values, but also the analysis of the modes of governance and the place given to politics.

  12. SSI and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1987-01-01

    This paper presents the latest results of the ongoing program entitled, Standard Problems for Structural Computer Codes, currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to cut-off depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils. Further, the paper presents some key aspects of the Soil-Structure Interaction Workshop (NUREG/CP-0054) which was held in Bethesda, MD on June 1, 1986. Finally, recent efforts related to the task on the structural benchmarks are described

  13. Searching for Scientific Literacy and Critical Pedagogy in Socioscientific Curricula: A Critical Discourse Analysis

    Science.gov (United States)

    Cummings, Kristina M.

    2017-01-01

    The omnipresence of science and technology in our society require the development of a critical and scientifically literate citizenry. However, the inclusion of socioscientific issues, which are open-ended controversial issues informed by both science and societal factors such as politics, economics, and ethics, do not guarantee the development of…

  14. Beyond Evidence: A Critical Appraisal of Global Warming as a Socio-Scientific Issue and a Reflection on the Changing Nature of Scientific Literacy in School

    Science.gov (United States)

    Colucci-Gray, L.

    2014-01-01

    Tom G. K. Bryce and Stephen P. Day's (2013) original article on scepticism and doubt in science education explores the context of citizens' attitudes towards the complexities and uncertainties of global issues, namely global warming. This response aims to stimulate reflection on some of the implicit assumptions underpinning the…

  15. 49 CFR 15.13 - Marking SSI.

    Science.gov (United States)

    2010-10-01

    ... SSI. (a) Marking of paper records. In the case of paper records containing SSI, a covered person must... limitation statement on the bottom, of— (1) The outside of any front and back cover, including a binder cover... types of records. In the case of non-paper records that contain SSI, including motion picture films...

  16. Beyond evidence: a critical appraisal of global warming as a socio-scientific issue and a reflection on the changing nature of scientific literacy in school

    Science.gov (United States)

    Colucci-Gray, L.

    2014-09-01

    Tom G. K. Bryce and Stephen P. Day's (2013) original article on scepticism and doubt in science education explores the context of citizens' attitudes towards the complexities and uncertainties of global issues, namely global warming. This response aims to stimulate reflection on some of the implicit assumptions underpinning the relationships between science, technology and the public. I argue that an underestimation of the political and ethical dimensions of science and technology limits the possibilities for education to set the agenda for citizens' participation in science and technological matters. Drawing on Sheila Jasanoff's model of co-production, this paper proposes a radical re-affirmation of the aims and purposes of science education to embrace a multiplicity of disciplines, narratives and ways of knowing in science, technology and society issues.

  17. Writing from Different Cultural Contexts: How College Students Frame an Environmental SSI through Written Arguments

    Science.gov (United States)

    Balgopal, Meena M.; Wallace, Alison M.; Dahlberg, Steven

    2017-01-01

    The research objective of this study was to describe the frames that students from two culturally distinct institutions used in their argumentative essays on a locally relevant environmental socioscientific issue. Participants (n = 47) were recruited from biology courses designed for pre-service elementary teachers at both a public university and…

  18. Evaluation of Student Models on Current Socio-Scientific Topics Based on System Dynamics

    Science.gov (United States)

    Nuhoglu, Hasret

    2014-01-01

    This study aims to 1) enable primary school students to develop models that will help them understand and analyze a system, through a learning process based on system dynamics approach, 2) examine and evaluate students' models related to socio-scientific issues using certain criteria. The research method used is a case study. The study sample…

  19. Socio-scientific controversies and beginning teachers’ pedagogical practice

    Directory of Open Access Journals (Sweden)

    Pedro Reis

    2005-08-01

    Full Text Available The current investigation aimed to study the impact of recent socio-scientific controversies, made public through the media, on the concepts and practices of a group of Natural Science teachers at the start of their careers. This study is particularly relevant at a time that is heavily marked by much debate regarding the social and environmental impact of several scientific and technological innovations and by the implementation of new science curricula, that stress the importance of discussing socio-scientific controversies in the context of students’ scientific alphabetisation (namely in their understanding of the nature of science and its relation to society and culture (McComas, 2000. This investigation followed an interpretative approach of a qualitative nature. Through the construction of case studies, it sought to analyse the possible impact of socio-scientific controversies on the teachers’ concepts (about the nature, teaching and learning of science and pedagogic practice. For data collection semi-structured interviews were conducted and classes observed.The controversial issues raised by certain recent technological innovations – namely the environmental, social and cultural impact they may have – did have an impact on the teachers’ concepts about the nature, teaching and learning of science. Besides reinforcing the duality of feelings as regards science and technology, as a source of both progress and concern, they triggered in these teachers the idea of the need for a widespread scientific alphabetisation that empowers the population for understanding and deciding and acting upon these issues. However, the concept of scientific alphabetisation and the best way to achieve it vary among the teachers participating in this study.

  20. Searching for scientific literacy and critical pedagogy in socioscientific curricula: A critical discourse analysis

    Science.gov (United States)

    Cummings, Kristina M.

    The omnipresence of science and technology in our society require the development of a critical and scientifically literate citizenry. However, the inclusion of socioscientific issues, which are open-ended controversial issues informed by both science and societal factors such as politics, economics, and ethics, do not guarantee the development of these skills. The purpose of this critical discourse analysis is to identify and analyze the discursive strategies used in intermediate science texts and curricula that address socioscientific topics and the extent to which the discourses are designed to promote or suppress the development of scientific literacy and a critical pedagogy. Three curricula that address the issue of energy and climate change were analyzed using Gee's (2011) building tasks and inquiry tools. The curricula were written by an education organization entitled PreSEES, a corporate-sponsored group called NEED, and a non-profit organization named Oxfam. The analysis found that the PreSEES and Oxfam curricula elevated the significance of climate change and the NEED curriculum deemphasized the issue. The PreSEES and Oxfam curricula promoted the development of scientific literacy while the NEED curricula suppressed its development. The PreSEES and Oxfam curricula both promoted the development of the critical pedagogy; however, only the Oxfam curricula provided authentic opportunities to enact sociopolitical change. The NEED curricula suppressed the development of critical pedagogy. From these findings, the following conclusions were drawn. When socioscientific issues are presented with the development of scientific literacy and critical pedagogy, the curricula allow students to develop fact-based opinions about the issue. However, curricula that address socioscientific issues without the inclusion of these skills minimize the significance of the issue and normalize the hegemonic worldview promoted by the curricula's authors. Based on these findings

  1. Discussing agrochemical themes: an approach through socio-scientific controversies

    Directory of Open Access Journals (Sweden)

    Eril Medeiros da Fonseca

    2017-12-01

    Full Text Available The theme of "agro-toxicology" in the Rural Education pervades key issues to be problematized, such as the care of rural workers, from the concept of health as something broad, involving access to cultural goods, leisure and communication and still, the collective physical, mental and social well-being. The use of pesticides, in addition to compromising the health of those who work in the field and those who feed on what is produced in the field, brings with it a conception of health that, in addition to suffering and individualizing, affects our biological diversity. The objective of this study is to discuss pesticides and their implications for health, through the approach of Socio-Scientific Controversies (CSC in Science Teaching and Rural Education.

  2. Raciocínio moral na tomada de decisões em relação a questões sociocientíficas: o exemplo do melhoramento genético humano Moral reasoning in decision-making regarding socioscientific issues: the human genetic improvement example

    Directory of Open Access Journals (Sweden)

    Márcio Andrei Guimarães

    2010-01-01

    Full Text Available Nos últimos anos, os avanços nas Ciências Biológicas têm levado a sociedade a discutir diversas questões no campo da moral e da ética. Questões como engenharia genética, clonagem e pesquisas com células-tronco são questões chamadas de sociocientíficas por estarem na interface entre a ciência e a sociedade. Nesse trabalho buscamos entender como estudantes de Ensino Médio percebem e interpretam questões relacionadas à manipulação genética em seres humanos. Houve divisão de opiniões em relação à eugenia negativa, que se destina a remover características desfavoráveis das pessoas; mas a eugenia positiva, que busca melhoramento de características estéticas, foi rejeitada por todos os estudantes. As variações nas opiniões em relação ao assunto tratado podem ser, em grande medida, devidas às representações sociais dos estudantes.In the recent years the advances in biological sciences has been convincing society to discuss issues concerning moral and ethics. Issues as cloning, stem-cell research and genetic engineering are called socioscientific issues because they put into evidence the interface between science and society. In this paper we aimed at understanding how High School students realize and interpret issues regarding human genetic improvement. As a result we have found divergent opinions regarding negative eugenics, specifically about its attempts of taking out undesirable characteristics of individuals; but there was an agreement among all the students in rejecting positive eugenics, that aims at improving individuals esthetical characteristics. The divergences and differences of opinions may be related to the students' social representations.

  3. 49 CFR 1520.13 - Marking SSI.

    Science.gov (United States)

    2010-10-01

    ... SECURITY INFORMATION § 1520.13 Marking SSI. (a) Marking of paper records. In the case of paper records... back cover, including a binder cover or folder, if the document has a front and back cover; (2) Any.... 552 and 49 CFR parts 15 and 1520. (d) Other types of records. In the case of non-paper records that...

  4. SSI's review of ASAR Oskarshamn 1

    International Nuclear Information System (INIS)

    Godaas, T.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Oskarshamn 1. The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs

  5. SSI and the Environmental Code

    International Nuclear Information System (INIS)

    Loefgren, T.

    1997-12-01

    Radiation is, to some extent, included in the environmental code being prepared by the government. As a consequence both the Radiation Protection Institute and the proposed Environmental Court may set legal conditions concerning radiation protection for the proponent. Legal and other matters related to this issue are discussed in the report

  6. 73. Surgical site infection after CABG: Root cause analysis and quality measures recommendation SSI quality improvement project

    Directory of Open Access Journals (Sweden)

    A. Arifi

    2016-07-01

    Full Text Available Surgical site infection (SSI, is a preventable and devastating complication with significant morbidity after cardiac surgery. The reported SSI rate at our center, ranging from 3.4% to 11.2% (2007–2013. This rate is considered to be above the standardized rate recommended by the NHSN. Quality improvement project team to address the issue of SSI, (SCIP, where formed by the medical administration late 2014. The aim of the study was to identify SSI risk factors at our cardiac surgical unit, using evidence based practices while taking a local approach to problem solving. We performed Root Cause Analysis (RCA, and we applied other quality improvement tools to identify the area for potential improvement. Data include a Process Map of the pre-operative, intra-operative and post-operative factors that might contribute to SSI risk. We prospectively used the RCA form to investigate all the stages of the patient process map (pre, intra op, and post operatively. The data included the Patient related factors, the sterilization and the hygiene practice in the operating room, and the operating room traffic, and the compliance to the bundle of care. Figure represent the “Fishbone” diagram of the possible causes of SSI after cardiac surgery in our unit. Demographic features of patients with SSI were as follows: mean age-65 years; female 83%; time to infection (mean 101 days; range 1–36 days;. The root cause analysis identified a significant weakness in the compliance to the bundle of care to prevent SSI. Furthermore, the patient flow, the operating theatre cleaning and traffic was also identified as a contributing factor to SSI. Surgical site infection after cardiac surgery is a preventable complication. The application of the evidence based practice and structured way of thinking in problem solving, will help identify the potential risk factors. Focusing on solving the right patient process and visually represents the problem will help identifying the

  7. Dicty_cDB: SSI473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU

  8. Dicty_cDB: SSI339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

  9. Development of a surgical site infection (SSI) surveillance system, calculation of SSI rates and specification of important factors affecting SSI in a digestive organ surgical department.

    Science.gov (United States)

    Kimura, Koji; Sawa, Akihiro; Akagi, Shinji; Kihira, Kenji

    2007-06-01

    We have developed an original system to conduct surgical site infection (SSI) surveillance. This system accumulates SSI surveillance information based on the National Nosocomial Infections Surveillance (NNIS) System and the Japanese Nosocomial Infections Surveillance (JNIS) System. The features of this system are as follows: easy input of data, high generality, data accuracy, SSI rate by operative procedure and risk index category (RIC) can be promptly calculated and compared with the current NNIS SSI rate, and the SSI rates and accumulated data can be exported electronically. Using this system, we monitored 798 patients in 24 operative procedure categories in the Digestive Organs Surgery Department of Mazda Hospital, Mazda Motor Corporation, from January 2004 through December 2005. The total number and rate of SSI were 47 and 5.89%, respectively. The SSI rates of 777 patients were calculated based on 15 operative procedure categories and Risk Index Categories (RIC). The highest SSI rate was observed in the rectum surgery of RIC 1 (30%), followed by the colon surgery of RIC3 (28.57%). About 30% of the isolated infecting bacteria were Enterococcus faecalis, Staphylococcus aureus, Klebsiella pneumoniae, Pseudomonas aeruginosa, and Escherichia coli. Using quantification theory type 2, the American Society of Anesthesiology score (4.531), volume of hemorrhage under operation (3.075), wound classification (1.76), operation time (1.352), and history of diabetes (0.989) increased to higher ranks as factors for SSI. Therefore, we evaluated this system as a useful tool in safety control for operative procedures.

  10. Preoperative antiseptic skin preparations and reducing SSI.

    Science.gov (United States)

    Al Maqbali, Mohammed Abdullah

    Surgical site infection (SSI) can affect the quality of care and increase the morbidity and mortality rate in after-surgical procedure. The use of an antiseptic skin preparation agent before the procedure can reduce the pathogens in the skin surface around the incision. Indicating the type of skin antiseptic preparation could prevent the infection and contamination of the wound. The most commonly used types of skin preparations are chlorhexidine and povidone iodine. However, the antiseptic solutions of both agents are strengthened with alcohol to prevent postoperative wound infection. The aim of this paper is to identify the best antiseptic agent in terms of skin preparation by evaluating the evidence in the literature. The factors associated with choosing the antiseptic skin agent, such as patients' allergies, skin condition and environmental risk, are also taken into account. This review suggests that cholorhexdine with alcohol may be the most effective in terms of reducing SSI.

  11. SSI's review of ASAR Ringhals 2, 1994

    International Nuclear Information System (INIS)

    Hofvander, P.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Ringhals 2, 1994 . The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs

  12. Sensitivity Study of Poisson's Ratio Used in Soil Structure Interaction (SSI) Analyses

    International Nuclear Information System (INIS)

    Han, Seung-ju; You, Dong-Hyun; Jang, Jung-bum; Yun, Kwan-hee

    2016-01-01

    The preliminary review for Design Certification (DC) of APR1400 was accepted by NRC on March 4, 2015. After the acceptance of the application for standard DC of APR1400, KHNP has responded the Request for Additional Information (RAI) raised by NRC to undertake a full design certification review. Design certification is achieved through the NRC's rulemaking process, and is founded on the staff's review of the application, which addresses the various safety issues associated with the proposed nuclear power plant design, independent of a specific site. The USNRC issued RAIs pertain to Design Control Document (DCD) Ch.3.7 'Seismic Design' is DCD Tables 3.7A-1 and 3.7A-2 show Poisson’s ratios in the S1 and S2 soil profiles used for SSI analysis as great as 0.47 and 0.48 respectively. Based on staff experience, use of Poisson's ratio approaching these values may result in numerical instability of the SSI analysis results. Sensitivity study is performed using the ACS SASSI NI model of APR1400 with S1 and S2 soil profiles to demonstrate that the Poisson’s ratio values used in the SSI analyses of S1 and S2 soil profile cases do not produce numerical instabilities in the SSI analysis results. No abrupt changes or spurious peaks, which tend to indicate existence of numerical sensitivities in the SASSI solutions, appear in the computed transfer functions of the original SSI analyses that have the maximum dynamic Poisson’s ratio values of 0.47 and 0.48 as well as in the re-computed transfer functions that have the maximum dynamic Poisson’s ratio values limited to 0.42 and 0.45

  13. Socioscientific Argumentation of Pre-Service Teachers about Genetically Modified Organisms

    Science.gov (United States)

    Herawati, D.; Ardianto, D.

    2017-09-01

    This study aims to investigate socioscientific argumentation of pre-service teachers of science and non-science major regarding Genetically Modified Organisms (GMOs) issue. We used descriptive study and involved second-year pre-service teachers from two major, 28 pre-service science teachers (PSTs) and 28 pre-service non-science teachers (PNSTs) as participants. Paper and pencil test was administered in order to obtain the data of PSTs’ and PNSTs’ argument about GMOs. All of the data were analyzed by descriptive analysis. We applied Toulmin Argumentation Pattern (TAP) as a basic framework to identify the argumentation component. The result showed that both PSTs and PNSTs were able to propose an argument with a claim, data, and/or warrant.. Most of their argument contain data which provided in the text, without any further reasoning or relevant scientific knowledge. So, the coherency between argumentation component in both PSTs and PNSTs was limited. However, PSTs are more able to propose coherent arguments than PNSTs. These findings indicated that educational background and learning experiences may influence to pre-service teacher argumentation in the context of GMOs. Beside that, teaching and learning process which focused on the socioscientific issues is necessary to develop pre-service teachers’ argumentation

  14. "Jazz Ruuler" toob dzhässi Rock Cafesse

    Index Scriptorium Estoniae

    2008-01-01

    Muhu tulevikumuusika festival "Ju jääb" ja Rock Cafe avavad uue dzhässiürituste sarja "Jazz Ruuler", mille raames soovitakse igal kuul Eesti publiku ette tuua mõni maailma dzhässi tuntud artist. Kontserdist 24. jaan. Rock Cafés

  15. Dicty_cDB: SSI468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

  16. Dicty_cDB: SSI527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI527 (Link to dictyBase) - - - Contig-U16209-1 SSI527F (Link... to Original site) SSI527F 685 - - - - - - Show SSI527 Library SS (Link to library) Clone ID SSI527 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...N BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDNA 5' ...6357825 5' similar to SW:RSP4_CHICK P50890 40S RIBOSOMAL PROTEIN SA ;, mRNA sequence. 46 4e-06 2 BQ096846 |BQ096846.1 IfHdk00487 Ict

  17. Dicty_cDB: SSI485 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ate cortex cDNA, RIKEN full-length enriched library, clone:A830088K09, 3' end partial sequence. 42 5.7 1 AC068663 |AC068663.4 Mus mu...SS (Link to library) SSI485 (Link to dictyBase) - - - Contig-U14077-1 SSI485F (Link... to Original site) SSI485F 438 - - - - - - Show SSI485 Library SS (Link to library) Clone ID SSI485 (Link to dic...cia MC0-3 ... 115 4e-25 EF100191_35( EF100191 |pid:none) Uncultured marine bacterium HF10_... 115 5e-25 AP00...9385_2657( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 114 1e-24 BC056

  18. Supporting Students' Learning and Socioscientific Reasoning About Climate Change—the Effect of Computer-Based Concept Mapping Scaffolds

    Science.gov (United States)

    Eggert, Sabina; Nitsch, Anne; Boone, William J.; Nückles, Matthias; Bögeholz, Susanne

    2017-02-01

    Climate change is one of the most challenging problems facing today's global society (e.g., IPCC 2013). While climate change is a widely covered topic in the media, and abundant information is made available through the internet, the causes and consequences of climate change in its full complexity are difficult for individuals, especially non-scientists, to grasp. Science education is a field which can play a crucial role in fostering meaningful education of students to become climate literate citizens (e.g., NOAA 2009; Schreiner et al., 41, 3-50, 2005). If students are, at some point, to participate in societal discussions about the sustainable development of our planet, their learning with respect to such issues needs to be supported. This includes the ability to think critically, to cope with complex scientific evidence, which is often subject to ongoing inquiry, and to reach informed decisions on the basis of factual information as well as values-based considerations. The study presented in this paper focused on efforts to advance students in (1) their conceptual understanding about climate change and (2) their socioscientific reasoning and decision making regarding socioscientific issues in general. Although there is evidence that "knowledge" does not guarantee pro-environmental behavior (e.g. Schreiner et al., 41, 3-50, 2005; Skamp et al., 97(2), 191-217, 2013), conceptual, interdisciplinary understanding of climate change is an important prerequisite to change individuals' attitudes towards climate change and thus to eventually foster climate literate citizens (e.g., Clark et al. 2013). In order to foster conceptual understanding and socioscientific reasoning, a computer-based learning environment with an embedded concept mapping tool was utilized to support senior high school students' learning about climate change and possible solution strategies. The evaluation of the effect of different concept mapping scaffolds focused on the quality of student

  19. Patterns of informal reasoning in the context of socioscientific decision making

    Science.gov (United States)

    Sadler, Troy D.; Zeidler, Dana L.

    2005-01-01

    The purpose of this study is to contribute to a theoretical knowledge base through research by examining factors salient to science education reform and practice in the context of socioscientific issues. The study explores how individuals negotiate and resolve genetic engineering dilemmas. A qualitative approach was used to examine patterns of informal reasoning and the role of morality in these processes. Thirty college students participated individually in two semistructured interviews designed to explore their informal reasoning in response to six genetic engineering scenarios. Students demonstrated evidence of rationalistic, emotive, and intuitive forms of informal reasoning. Rationalistic informal reasoning described reason-based considerations; emotive informal reasoning described care-based considerations; and intuitive reasoning described considerations based on immediate reactions to the context of a scenario. Participants frequently relied on combinations of these reasoning patterns as they worked to resolve individual socioscientific scenarios. Most of the participants appreciated at least some of the moral implications of their decisions, and these considerations were typically interwoven within an overall pattern of informal reasoning. These results highlight the need to ensure that science classrooms are environments in which intuition and emotion in addition to reason are valued. Implications and recommendations for future research are discussed.

  20. The SSI reviews of the SKB research programs 1992

    International Nuclear Information System (INIS)

    Jensen, Mikael.

    1993-02-01

    The Swedish Radiation Protection Institute (SSI) has scrutinized the research programs 1992 of the Swedish Nuclear Fuel and Waste Management Co (SKB). The judgement is that SKB has both the competence and resources to perform the presented research programs

  1. Intertextuality for Handling Complex Environmental Issues

    Science.gov (United States)

    Byhring, Anne Kristine; Knain, Erik

    2016-01-01

    Nowhere is the need for handling complexity more pertinent than in addressing environmental issues. Our study explores students' situated constructs of complexity in unfolding discourses on socio-scientific issues. Students' dialogues in two group-work episodes are analysed in detail, with tools from Systemic Functional Linguistics. We identify…

  2. Multi-equilibrium property of metabolic networks: SSI module

    Directory of Open Access Journals (Sweden)

    Chen Luonan

    2011-06-01

    Full Text Available Abstract Background Revealing the multi-equilibrium property of a metabolic network is a fundamental and important topic in systems biology. Due to the complexity of the metabolic network, it is generally a difficult task to study the problem as a whole from both analytical and numerical viewpoint. On the other hand, the structure-oriented modularization idea is a good choice to overcome such a difficulty, i.e. decomposing the network into several basic building blocks and then studying the whole network through investigating the dynamical characteristics of the basic building blocks and their interactions. Single substrate and single product with inhibition (SSI metabolic module is one type of the basic building blocks of metabolic networks, and its multi-equilibrium property has important influence on that of the whole metabolic networks. Results In this paper, we describe what the SSI metabolic module is, characterize the rates of the metabolic reactions by Hill kinetics and give a unified model for SSI modules by using a set of nonlinear ordinary differential equations with multi-variables. Specifically, a sufficient and necessary condition is first given to describe the injectivity of a class of nonlinear systems, and then, the sufficient condition is used to study the multi-equilibrium property of SSI modules. As a main theoretical result, for the SSI modules in which each reaction has no more than one inhibitor, a sufficient condition is derived to rule out multiple equilibria, i.e. the Jacobian matrix of its rate function is nonsingular everywhere. Conclusions In summary, we describe SSI modules and give a general modeling framework based on Hill kinetics, and provide a sufficient condition for ruling out multiple equilibria of a key type of SSI module.

  3. The Coastal Zone: Man and Nature. An Application of the Socio-Scientific Reasoning Model.

    Science.gov (United States)

    Maul, June Paradise; And Others

    The curriculum model described here has been designed by incorporating the socio-scientific reasoning model with a simulation design in an attempt to have students investigate the onshore impacts of Outer Continental Shelf (OCS) gas and oil development. The socio-scientific reasoning model incorporates a logical/physical reasoning component as…

  4. Investigation on the Inclusion of Socio-Scientific Acquisitions in Curriculum of Science and Technology Lesson

    Science.gov (United States)

    Guler, Mutlu Pinar Demirci

    2013-01-01

    According to its definition, socio-scientific subjects emerge during scientific and technologic developments. Besides information, attitude and value constraints are effective in decision-making processes and thus there is no consensus on socio-scientific subjects yet and it leads to social discussions. These subjects comprise decision making…

  5. Science Learning and Citizenship (Proceedings of ESERA 2011) Proceedings of the ESERA 2011 Conference

    DEFF Research Database (Denmark)

    2012-01-01

    Teaching about scientific literacy, science and citizenship education, science and media education, information literacy, informal reasoning and critical thinking, decision making, debates on socioscientific issues (SSI), discourse communities, social dimension of science and technoscientific...... practices, public engagement in science, schools', students' and teachers' engagement in socioscientific issues....

  6. Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility, December 2010

    Data.gov (United States)

    Social Security Administration — The Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility (December 2010) is produced using the data found in Table 10 from the SSI...

  7. Supplemental Security Income (SSI) Recipients in each State by Sex and Age, December 2010

    Data.gov (United States)

    Social Security Administration — The Supplemental Security Income (SSI) Recipients in each State by Sex and Age (December 2010) is produced using the data found in Table 10 from the SSI Report of...

  8. Influence of different boundary conditions on analysis of SSI

    International Nuclear Information System (INIS)

    Wang Jiachun

    2005-01-01

    In the discussions of structural response to earthquakes, it has been assumed that the foundation medium is very stiff and that the seismic motions applied at the structure support points are the same as the free-field earthquake motions at those locations; in other words, the effects of soil structure interaction (SSI) have been neglected. However, its effects can be significant when the structure supported on a soft soil. Structures on the ground are affected by ground motion when there is seismic loading. The inability of the foundation to resist to deformation of soil would cause huge damages on the structures. The different codes and boundary conditions affect on analysis results of SSI. A comparison of the reactor buildings response as predicted by CLASSI and FLUSH shows substantial differences. To absorb, rather than reflect, the outwardly radiated energy, transmitting boundary conditions and soil structure interface should be taken into consideration in analysis of SSI. The paper discusses influence of several different boundary conditions on analysis of SSI. (author)

  9. ssi plaat saab 30aastaseks / Gerli Romanovitsh

    Index Scriptorium Estoniae

    Romanovitš, Gerli, 1977-

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 22. dets. 2004, lk. 4. Aasta aega Šveitsi investeerimisfirmale Sorbes AG kuulunud Püssi Repo Vabrikud tähistab puitlaastvabrikute kombinaadi 30. sünnipäeva. Praegu toodetakse 170 000 m3 puitlaastplaati aastas

  10. 20 CFR 416.266 - Continuation of SSI status for Medicaid

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Continuation of SSI status for Medicaid 416... Disabling Impairment § 416.266 Continuation of SSI status for Medicaid If we stop your benefits because of... to be considered an SSI recipient for purposes of eligibility for Medicaid during the time it takes...

  11. Hyper- and hyporesponsive mutant forms of the Saccharomyces cerevisiae Ssy1 amino acid sensor

    DEFF Research Database (Denmark)

    Poulsen, Peter; Gaber, Richard F.; Kielland-Brandt, Morten

    2008-01-01

    The Saccharomyces cerevisiae integral membrane protein Ssy1p functions with Ssy5p and Ptr3p to sense extracellular amino acids. Signal transduction leads to processing and nuclear localization of Stp1p and Stp2p, transcriptional activators of many amino acid transporter genes. Ssy1p is structural...

  12. 20 CFR 416.1816 - Information we need concerning marriage when you apply for SSI.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Information we need concerning marriage when you apply for SSI. 416.1816 Section 416.1816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION....1816 Information we need concerning marriage when you apply for SSI. When you apply for SSI benefits...

  13. SKI's and SSI's experiences from their participation in the siting of a final repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Westerlind, M.; Hedberg, B.

    2000-01-01

    This paper summarises some experiences gained by the SKI and SSI during the ongoing process for siting a final repository for spent nuclear fuel. The focus is on activities in the municipalities involved in the siting process. In order to give the proper context some basic elements in the legislation, which are important for public participation and confidence in the siting process, are outlined. The importance of clearly defined responsibilities and early participation of the regulators in the siting process are emphasised. It should be pointed out that this paper is not a comprehensive review of the Swedish situation but only contains a few selected issues and personal remarks from the authors. Thus, the views and opinions do not necessarily coincide with those of SKI and SSI. (authors)

  14. The systemic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho's report for project RISCOM

    International Nuclear Information System (INIS)

    Espejo, R.; Gill, A.

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section 'A problem of identity'. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI's regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions

  15. A Persian-version of the stuttering severity instrument-version four (SSI-4): How the new additions to SSI-4 complement its stuttering severity score?

    Science.gov (United States)

    Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood

    The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to translate SSI-4 into Persian language and to discuss its relative and absolute reliability as well as its criterion validity for Persian adults who stutter (PWS). We also aimed to study how the new subjective self-reports of the SSI-4 complement the stuttering severity score obtained from the SSI-3 or the SSI-4. The cross-cultural guideline recommended by the International Quality of Life Assessment project was used to translate the SSI-4 into Persian language. Thirty five PWS from ages 17 to 42 were recruited and 10 speech and language pathologists assessed their stuttering severity using either the SSI-4 or stuttering severity ratings (SR) to test validity and reliability of the Persian translated version. A very high inter-judge relative reliability along with a poor absolute inter-judge reliability was found for the SSI-4 scores. The results were more promising for the intra-judge absolute reliability. Test-retest reliability of the complementary questions to the SSI-4 was also found acceptable. However, no strong relationship was found between the SSI-4 scores and its complementary questions. The Persian version of the SSI-4 can be used reliably by trained SLPs for research and clinical purposes, but not to document small changes in stuttering severity. We argue that the response of participants to the complementary self-report questions should also be considered in calculating their stuttering severity score. Copyright © 2018 Elsevier Inc. All rights reserved.

  16. SSI's International Development Co-operation (SIUS). Annual report 1998

    International Nuclear Information System (INIS)

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI's International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  17. Galileo SSI Observations of Volcanic Activity at Tvashtar Catena, Io

    Science.gov (United States)

    Milazzo, M. P.; Keszthely, L. P.; Radebaugh, J.; Davies, A. G.; Turtle, E. P.; Geissler, P.; Klaasen, K. P.; McEwen, A. S.

    2005-01-01

    Introduction: We report on the analysis of the Galileo SSI's observations of the volcanic activity at Tvashtar Catena, Io as discussed by Milazzo et al. Galileo's Solid State Imager (SSI) observed Tvashtar Catena (63 deg N, 120 deg W) four times between November 1999 and October 2001, providing a unique look at the distinctive high latitude volcanism on Io. The November 1999 observation spatially resolved, for the first time, an active extraterrestrial fissure eruption. The brightness temperature of the lavas at the November 1999 fissure eruption was 1300 K. The second observation (orbit I27, February 2000) showed a large (approx. 500 sq km) region with many, small spots of hot, active lava. The third observation was taken in conjunction with a Cassini observation in December 2000 and showed a Pele-like plume deposition ring, while the Cassini images revealed a 400 km high Pele-type plume above the Catena. The final Galileo SSI observation of Tvashtar was acquired in October 2001, and all obvious (to SSI) activity had ceased, although data from Galileo's Near Infrared Mapping Spectrometer (NIMS) indicated that there was still significant thermal emission from the Tvashtar region. We have concentrated on analyzing the style of eruption during orbit I27 (February 2000). Comparison with a lava flow cooling model indicates that the behavior of the Tvashtar eruption during I27 does not match that of "simple" advancing lava flows. Instead, it may be an active lava lake or a complex set of lava flows with episodic, overlapping (in time and space) eruptions.

  18. ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF ORGANISMS CAUSING SURGICAL SITE INFECTIONS (SSI

    Directory of Open Access Journals (Sweden)

    Rohini Murlidhar Gajbhiye

    2017-02-01

    Full Text Available BACKGROUND CDC defines surgical site infection as ‘Infections related to operative procedure that occurs at or near surgical incision within 30 days of operative procedure or within one year if the implant is left in situ’. Surgical site infection (SSI is 3 rd most frequently reported nosocomial infection (12%-16% as per National Nosocomial Infection Surveillance (NNIS. The aim of this study was to investigate the antimicrobial susceptibility pattern of organisms causing SSI. MATERIALS AND METHODS During a two year study period in a tertiary care hospital, 19,127 patients underwent surgeries in various surgical departments. Of these 517 (2.7% developed surgical site infection. The surgical wounds were classified by CDC & NNIS criteria into 4 classes. Two wound swabs were taken and processed by standard microbiological techniques. Antimicrobial susceptibility along with testing of ESBLs, MBLs, AmpCβ lactamases was done for all isolates causing SSI. RESULTS Among 19,127 patients, 517 (2.7% developed SSI. It was highest in patients of perforation peritonitis (11.99%.Among 517 specimens, 340 (65.76% showed growth and 177 (34.23% were culture negative. E.coli (23.33% was the commonest organism isolated followed by Acinetobacter spp. (16%, Klebsiella spp. (15.66%, Pseudomonas spp. (15.33%, S. aureus (10.33%, S. epidermidis(7.3%, Proteus spp. (6.00% and Citrobacter spp. (2.66%.Staphylococcus spp. were 100 % sensitive to Vancomycin & Linezolid. (27.5% S. aureus were MRSA and (17.5% were Inducible Clindamycin resistant (ICR. Enterobacteriaceae isolates showed maximum sensitivity towards Imipenem, Piperacillin-Tazobactam and Amikacin. Klebsiella spp. (40.62%, E.coli (35.89%, Citrobacter spp. (33.33%, Proteus spp. (26.08% were ESBL producers. Klebsiella spp. (17.18%, E.coli (10.25%, Proteus spp. (11.11% and Citrobacter spp. (8.69% were AmpC producers. Acinetobacter spp. (28.57% was commonest MBL producer followed by Klebsiella spp. (20

  19. Incorporation of Socio-scientific Content into Active Learning Activities

    Science.gov (United States)

    King, D. B.; Lewis, J. E.; Anderson, K.; Latch, D.; Sutheimer, S.; Webster, G.; Moog, R.

    2014-12-01

    Active learning has gained increasing support as an effective pedagogical technique to improve student learning. One way to promote active learning in the classroom is the use of in-class activities in place of lecturing. As part of an NSF-funded project, a set of in-class activities have been created that use climate change topics to teach chemistry content. These activities use the Process Oriented Guided Inquiry Learning (POGIL) methodology. In this pedagogical approach a set of models and a series of critical thinking questions are used to guide students through the introduction to or application of course content. Students complete the activities in their groups, with the faculty member as a facilitator of learning. Through assigned group roles and intentionally designed activity structure, process skills, such as teamwork, communication, and information processing, are developed during completion of the activity. Each of these climate change activities contains a socio-scientific component, e.g., social, ethical and economic data. In one activity, greenhouse gases are used to explain the concept of dipole moment. Data about natural and anthropogenic production rates, global warming potential and atmospheric lifetimes for a list of greenhouse gases are presented. The students are asked to identify which greenhouse gas they would regulate, with a corresponding explanation for their choice. They are also asked to identify the disadvantages of regulating the gas they chose in the previous question. In another activity, where carbon sequestration is used to demonstrate the utility of a phase diagram, students use economic and environmental data to choose the best location for sequestration. Too often discussions about climate change (both in and outside the classroom) consist of purely emotional responses. These activities force students to use data to support their arguments and hypothesize about what other data could be used in the corresponding discussion to

  20. Analysis of student’s scientific literacy skills through socioscientific issue’s test on biodiversity topics

    Science.gov (United States)

    Purwani, L. D.; Sudargo, F.; Surakusumah, W.

    2018-05-01

    The aim of this study was to describe student’s scientific literacy skills on biodiversity topics at grade X of senior high school. Dimension of scientific literacy that was asses is science’s competence and attitude towards science. The science competency tests and attitude rating scale based on biodiversity’s socio-scientific issue is used to measure scientific literacy skills. The result of study showed that student’s scientific literacy skills for science competence dimension are low (15.84% for class A and 19.50% for class B) and also for attitude toward science dimension (31.15% for class A and 37.05%). We concluded that student’s scientific literacy skills are low (23.49% and 28.55%).

  1. The Citizens' Exhibition: A Combination of Socio-scientific, Participative and Artistic Elements

    Directory of Open Access Journals (Sweden)

    Birgit Böhm

    2008-05-01

    Full Text Available Through its incorporation of socio-scientific, participative and artistic elements, the "Citizens' Exhibition" is an example of how applied performative social science can be implemented. The method was created by teaching qualitative methods and community psychology approaches in courses for students of psychology in the 1990's. The Citizens' Exhibition combines qualitative methods, such as interview and text interpretation, with artistic-aesthetic methods, such as photography and film, to form an integrated concept. In the tradition of action research, the practice is applied in the exploration of societal issues. The Citizens' Exhibition supports dialogue and furthering communication processes between the stakeholders through the presentation of diverse perspectives. In this regard, the staging of the exhibition opening has a particular importance. The following article about the Citizens' Exhibition presents the practice's origin and history in the first section and, in the second section, offers an introduction to the individual methodological steps. In the third section, various Citizens' Exhibitions are described as illustrations of the method. The last section discusses the vision of the Citizens' Exhibition, its performative component, strengths and limitations, considers the results of an existing evaluation study and looks at the future uses of the practice. Particular regard should be paid here to a combination of methods that enable a long-term participation effect, the expansion of participatory possibilities for the research subjects, and experimentation with additional artistic methods. URN: urn:nbn:de:0114-fqs0802337

  2. FT4 Data Analysis Summary (SSI-ARC)

    Science.gov (United States)

    Isaacson, Douglas R.; Gong, Chester; Reardon, Scott Edward; Santiago, Confesor

    2016-01-01

    Standards for Unmanned Aircraft System (UAS) Detect-and-Avoid (DAA) systems are currently being developed under the auspices of the RTCA Special Committee 228 (SC-228). To support the development of these standards, a series of flight tests has been conducted at NASAs Armstrong Flight Research Center (NASA-AFRC). The fourth in this series of flight test activities (Flight Test 4, or simply FT4) was conducted during the Spring and Summer of 2016. FT4 supported the objectives of numerous organizations working toward UAS DAA Minimum Operational Performance Standards (MOPS) and UAS DAA Radar MOPS. The summary provided herein is limited to the objectives, analysis and conclusions of the NASA Ames Research Center (NASA-ARC) SSI team toward the refinement of UAS DAA MOPS. This document provides a high-level overview of FT4 and the SSI-ARC objectives, a summary of the data analysis methodology and recommendations for UAS DAA MOPS refinements based on the data analysis results. A total of 72 encounters were flown to support SSI-ARC objectives. Test results were generally consistent with acceptable UAS DAA system performance and will be considered in broader SC-228 requirements validation efforts. Observed alert lead times indicated acceptable UAS DAA alerting performance. Effective interoperability between the UAS DAA system and the Traffic Alert and Collision Avoidance System (TCAS) was observed with one notable exception: TCAS Resolutions Advisories (RA) were observed in the absence of any DAA alert on two occasions, indicating the need for alert parameter refinement. Findings further indicated the need for continued work in the areas of DAA Well Clear Recovery logic and alert stability for Mode-C-only intruders. Finally, results demonstrated a high level of compliance with a set of evaluation criteria designed to provide anecdotal evidence of acceptable UAS DAA system performance.

  3. Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI in adolescents

    Directory of Open Access Journals (Sweden)

    Ruuttu Titta

    2005-02-01

    Full Text Available Abstract Background Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. Methods 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Results Cronbach's α for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. Conclusions SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.

  4. Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI) in adolescents.

    Science.gov (United States)

    Holi, Matti M; Pelkonen, Mirjami; Karlsson, Linnea; Kiviruusu, Olli; Ruuttu, Titta; Heilä, Hannele; Tuisku, Virpi; Marttunen, Mauri

    2005-02-03

    Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI) is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Cronbach's alpha for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC) curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.

  5. SSI response of a typical shear wall structure. Volume 1

    International Nuclear Information System (INIS)

    Johnson, J.J.; Schewe, E.C.; Maslenikov, O.R.

    1984-04-01

    The Simplified Methods project of the US NRC-funded Seismic Safety Margins Research Program (SSMRP) has as its goal the development of a methodology to perform routine seismic probabilistic risk assessments of commercial nuclear power plants. The study reported here develops calibration factors to relate best estimate response to design values accounting for approximations and simplifications in SSI analysis procedures. Nineteen cases were analyzed and in-structure response compared. The structure of interest was a typical shear wall structure. 6 references, 44 figures, 22 tables

  6. "Should We Kill the Grey Squirrels?" A Study Exploring Students' Justifications and Decision-Making

    Science.gov (United States)

    Evagorou, Maria; Jimenez-Aleixandre, Maria Pilar; Osborne, Jonathan

    2012-01-01

    A problem that is still unexplored in the field of socioscientific issues (SSI) and that was explored in this study is how different students decide upon a SSI they are discussing, how their justifications change during the instruction and how they use (or not) the evidence from the learning environment to support their justifications. For the…

  7. Effect of Religious Belief on Informal Reasoning about Biotechnology Issues

    Science.gov (United States)

    Pope, Timothy; Dawson, Vaille; Koul, Rekha

    2017-01-01

    The advances of modern biotechnology provide teachers with a number of opportunities to explore socioscientific issues, and in doing so to enhance students' reasoning skills. Although some attempt has been made to understand cultural differences in students' informal reasoning across international and regional boundaries, there is limited research…

  8. SSI and the Environmental Code; SSI och miljoebalken - utvaerdering av raettsliga konsekvenser

    Energy Technology Data Exchange (ETDEWEB)

    Loefgren, T

    1997-12-01

    Radiation is, to some extent, included in the environmental code being prepared by the government. As a consequence both the Radiation Protection Institute and the proposed Environmental Court may set legal conditions concerning radiation protection for the proponent. Legal and other matters related to this issue are discussed in the report.

  9. SSI's review of SKB's RD and D programme 2001

    Energy Technology Data Exchange (ETDEWEB)

    Hedberg, Bjoern; Larsson, Carl-Magnus; Wiebert, Anders [and others

    2002-08-01

    In the report SSI's review of SKB's RD and D programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need for a strategy document, SKB's safety and system analysis and SKB's biosphere studies.

  10. Impact of a surgical site infection (SSI) surveillance program in orthopedics and traumatology.

    Science.gov (United States)

    Mabit, C; Marcheix, P S; Mounier, M; Dijoux, P; Pestourie, N; Bonnevialle, P; Bonnomet, F

    2012-10-01

    Surveillance of surgical site infections (SSI) is a priority. One of the fundamental principles for the surveillance of SSI is based on receiving effective field feedback (retro-information). The aim of this study was to report the results of a program of SSI surveillance and validate the hypothesis that there is a correlation between creating a SSI surveillance program and a reduction in SSI. The protocol was based on the weekly collection of surveillance data obtained directly from the different information systems in different departments. A delay of 3 months was established before extraction and analysis of data and information from the surgical teams. The NNIS index (National Nosocomial Infections Surveillance System) developed by the American surveillance system and the reduction of length of hospital stay index Journées d'hospitalisation évitées (JHE). Since the end of 2009, 7156 surgical procedures were evaluated (rate of inclusion 97.3%), and 84 SSI were registered with a significant decrease over time from 1.86% to 0.66%. A total of 418 days of hospitalization have been saved since the beginning of the surveillance system. Our surveillance system has three strong points: follow-up is continuous, specifically adapted to orthopedic traumatology and nearly exhaustive. The extraction of data directly from hospital information systems effectively improves the collection of data on surgical procedures. The implementation of a SSI surveillance protocol reduces SSI. Level III. Prospective study. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  11. 49 CFR 1520.15 - SSI disclosed by TSA or the Coast Guard.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false SSI disclosed by TSA or the Coast Guard. 1520.15... PROTECTION OF SENSITIVE SECURITY INFORMATION § 1520.15 SSI disclosed by TSA or the Coast Guard. (a) In... available for public inspection or copying, nor does TSA or the Coast Guard release such records to persons...

  12. 76 FR 446 - Supplemental Security Income (SSI) for the Aged, Blind, and Disabled; Dedicated Accounts and...

    Science.gov (United States)

    2011-01-05

    ... also were concerned that paying SSI in installments could distress SSI recipients. These commenters... increase an installment payment. Congress itemized certain outstanding debts relating to food, clothing... authority to make exceptions of this type. We can only approve impairment-related expenses. Comment: Several...

  13. Effective Strategies To Improve the Employment of SSI/SSDI Participants.

    Science.gov (United States)

    Radtke, Jean, Ed.

    This document is for administrators, rehabilitation counselors, and other professionals who support the employment of Social Security Disability Insurance (SSDI) beneficiaries and Supplemental Security Income (SSI) recipients with disabilities. It contains strategies for vocational rehabilitation (VR) programs to improve an SSI or SSDI…

  14. SSI response of a typical shear wall structure

    International Nuclear Information System (INIS)

    Johnson, J.J.; Maslenikov, O.R.; Schewe, E.C.

    1985-01-01

    The seismic response of a typical shear structure in a commercial nuclear power plant was investigated for a series of site and foundation conditions using best estimate and design procedures. The structure selected is a part of the Zion AFT complex which is a connected group of reinforced concrete shear wall buildings, typical of nuclear power plant structures. Comparisons between best estimate responses quantified the effects of placing the structure on different sites and founding it in different manners. Calibration factors were developed by comparing simplified SSI design procedure responses to responses calculated by best estimate procedures. Nineteen basic cases were analyzed - each case was analyzed for ten earthquakes targeted to the NRC R.G. 1.60 design response spectra. The structure is a part of the Zion auxiliary-fuel handling turbine building (AFT) complex to the Zion nuclear power plants. (orig./HP)

  15. Active Volcanism on Io as Seen by Galileo SSI

    Science.gov (United States)

    McEwen, A.S.; Keszthelyi, L.; Geissler, P.; Simonelli, D.P.; Carr, M.H.; Johnson, T.V.; Klaasen, K.P.; Breneman, H.H.; Jones, T.J.; Kaufman, J.M.; Magee, K.P.; Senske, D.A.; Belton, M.J.S.; Schubert, G.

    1998-01-01

    Active volcanism on Io has been monitored during the nominal Galileo satellite tour from mid 1996 through late 1997. The Solid State Imaging (SSI) experiment was able to observe many manifestations of this active volcanism, including (1) changes in the color and albedo of the surface, (2) active airborne plumes, and (3) glowing vents seen in eclipse. About 30 large-scale (tens of kilometers) surface changes are obvious from comparison of the SSI images to those acquired by Voyager in 1979. These include new pyroclastic deposits of several colors, bright and dark flows, and caldera-floor materials. There have also been significant surface changes on Io during the Galileo mission itself, such as a new 400-km-diameter dark pyroclastic deposit around Pillan Patera. While these surface changes are impressive, the number of large-scale changes observed in the four months between the Voyager 1 and Voyager 2 flybys in 1979 suggested that over 17 years the cumulative changes would have been much more impressive. There are two reasons why this was not actually the case. First, it appears that the most widespread plume deposits are ephemeral and seem to disappear within a few years. Second, it appears that a large fraction of the volcanic activity is confined to repeated resurfacing of dark calderas and flow fields that cover only a few percent of Io's surface. The plume monitoring has revealed 10 active plumes, comparable to the 9 plumes observed by Voyager. One of these plumes was visible only in the first orbit and three became active in the later orbits. Only the Prometheus plume has been consistently active and easy to detect. Observations of the Pele plume have been particularly intriguing since it was detected only once by SSI, despite repeated attempts, but has been detected several times by the Hubble Space Telescope at 255 nm. Pele's plume is much taller (460 km) than during Voyager 1 (300 km) and much fainter at visible wavelengths. Prometheus-type plumes (50

  16. Cl@ssi 2.0: experience in Emilia Romagna

    Directory of Open Access Journals (Sweden)

    Elena Pacetti

    2013-06-01

    Full Text Available This article presents some of the results of the Ministerial Initiative Cl@ssi 2.0 in the Emilia Romagna Region. Having described the reference field in which the scaffolding action of the research group of the University of Bologna, coordinated by Prof. Luigi Guerra, is positioned, the paper presents the coaching model through which the design and documentation of the teaching practices adopted in schools was supported. Analysing the experiences of the ER classes, we have identified eight project themes, subsequently modelled on two levels: the didactic modelling of the experiences (construction of interpretation hypotheses; and the construction of a themes/models map (checking/adapting the hypotheses, experimentation through which each school was able to describe and publish processes, products, etc. which characterised their specific project experience. The paper concludes with a series of general reflections on the three years' work.

  17. Using the Socioscientific Context of Climate Change to Teach Chemical Content and the Nature of Science

    Science.gov (United States)

    Flener-Lovitt, Charity

    2014-01-01

    A thematic course called "Climate Change: Chemistry and Controversy" was developed for upper-level non-STEM students. This course used the socioscientific context of climate change to teach chemical principles and the nature of science. Students used principles of agnotology (direct study of misinformation) to debunk climate change…

  18. Pre-service teachers and socio-scientific inquiry : Opportunities and challenges

    NARCIS (Netherlands)

    Knippels, M.C.P.J.; van Harskamp, M.; Verhoeff, R.P.; Postma, P.A.

    2017-01-01

    This paper presents the results of a teacher training program aiming to enable pre-service teachers to engage secondary education students in Socio-Scientific Inquiry-Based Learning (SSIBL). In SSIBL – an approach developed within the European project PARRISE – students formulate questions about

  19. Optimization as a Reasoning Strategy for Dealing with Socioscientific Decision-Making Situations

    Science.gov (United States)

    Papadouris, Nicos

    2012-01-01

    This paper reports on an attempt to help 12-year-old students develop a specific optimization strategy for selecting among possible solutions in socioscientific decision-making situations. We have developed teaching and learning materials for elaborating this strategy, and we have implemented them in two intact classes (N = 48). Prior to and after…

  20. College Students' Scientific Epistemological Views and Thinking Patterns in Socioscientific Decision Making

    Science.gov (United States)

    Liu, Shiang-Yao; Lin, Chuan-Shun; Tsai, Chin-Chung

    2011-01-01

    This study aims to test the nature of the assumption that there are relationships between scientific epistemological views (SEVs) and reasoning processes in socioscientific decision making. A mixed methodology that combines both qualitative and quantitative approaches of data collection and analysis was adopted not only to verify the assumption…

  1. What's Natural about Nature? Deceptive Concepts in Socio-Scientific Decision-Making

    Science.gov (United States)

    Lindahl, Mats Gunnar; Linder, Cedric

    2015-01-01

    The conflicts between nature and nurture are brought to the fore and challenges socio-scientific decision-making in science education. The multitude of meanings of these concepts and their roles in societal discourses can impede students' development of understanding for different perspectives, e.g. on gene technology. This study problematizes…

  2. DoSSiER: Database of Scientific Simulation and Experimental Results

    CERN Document Server

    Wenzel, Hans; Genser, Krzysztof; Elvira, Daniel; Pokorski, Witold; Carminati, Federico; Konstantinov, Dmitri; Ribon, Alberto; Folger, Gunter; Dotti, Andrea

    2017-01-01

    The Geant4, GeantV and GENIE collaborations regularly perform validation and regression tests for simulation results. DoSSiER (Database of Scientific Simulation and Experimental Results) is being developed as a central repository to store the simulation results as well as the experimental data used for validation. DoSSiER can be easily accessed via a web application. In addition, a web service allows for programmatic access to the repository to extract records in json or xml exchange formats. In this article, we describe the functionality and the current status of various components of DoSSiER as well as the technology choices we made.

  3. The systematic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho`s report for project RISCOM

    Energy Technology Data Exchange (ETDEWEB)

    Espejo, R. [Syncho, Solihull (United Kingdom); Gill, A. [Syncho, Oxon (United Kingdom)

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section `A problem of identity`. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI`s regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions.

  4. NOAA Climate Data Record (CDR) of Solar Spectral Irradiance (SSI), NRLSSI Version 2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) contains solar spectral irradiance (SSI) as a function of time and wavelength created with the Naval Research Laboratory model for...

  5. Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area, December 2010

    Data.gov (United States)

    Social Security Administration — The Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area (December 2010) is produced using the data found in Table 38...

  6. 20 CFR 416.250 - Experimental, pilot, and demonstration projects in the SSI program.

    Science.gov (United States)

    2010-04-01

    ... administration of the SSI program. These projects will test the advantages of altering certain requirements... demonstration project will have a termination date (up to 10 years from the start of the project). [48 FR 7576...

  7. SSI analysis of a massive concrete structure based on a novel ...

    Indian Academy of Sciences (India)

    1Structural Engineering Research Centre, CSIR Campus, Taramani,. Chennai ... In the numerical analysis of an SSI problem, the main difficulty is in representation of the ... validated software tools to execute the task is considered as the main ...

  8. SSI [soil-structure interactions] and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1986-01-01

    This paper presents the latest results of the ongoing program entitled, ''Standard Problems for Structural Computer Codes'', currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to ''cut-off'' depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils

  9. SKI's and SSI's review of SKB's safety report SR-Can

    International Nuclear Information System (INIS)

    Dverstorp, Bjoern; Stroemberg, Bo

    2008-03-01

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be further developed for the licence application. -SKB's quality

  10. A Persian-version of the stuttering severity instrument-version four (SSI-4) : How the new additions to SSI-4 complement its stuttering severity score?

    NARCIS (Netherlands)

    Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood

    2018-01-01

    Purpose: The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to

  11. Seismic Response of Steel Braced Building Frame Considering Soil Structure Interaction (SSI): An Experimental Study

    Science.gov (United States)

    Hirave, Vivek; Kalyanshetti, Mahesh

    2018-02-01

    Conventional fixed-base analysis ignoring the effect of soil-flexibility may result in unsafe design. Therefore, to evaluate the realistic behavior of structure the soil structure interaction (SSI) effect shall be incorporated in the analysis. In seismic analysis, provision of bracing system is one of the important option for the structure to have sufficient strength with adequate stiffness to resist lateral forces. The different configuration of these bracing systems alters the response of buildings, and therefore, it is important to evaluate the most effective bracing systems in view point of stability against SSI effect. In present study, three RC building frames, G+3, G+5 and G+7 and their respective scaled down steel model with two types of steel bracing system incorporating the effect of soil flexibility is considered for experimental and analytical study. The analytical study is carried out using Elastic continuum approach and the experimental study is carried out using Shake Table. The influence of SSI on various seismic parameters is presented. The study reveals that, steel bracing system is beneficial to control SSI effect and it is observed that V bracing is more effective, in resisting seismic load considering SSI.

  12. SSI and SKI's Review of SKB's Updated Final Safety Report for SFR 1. Review Report

    International Nuclear Information System (INIS)

    2003-10-01

    The Repository for Radioactive Operational Waste (SFR 1) is now the object of a new review by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). One of the stipulations for operating SFR 1 was that a new assessment of the long-term performance and environmental consequences of the repository should be conducted once every 10 years by the licensee, the Swedish Nuclear Fuel and Waste Management Co (SKB). During the time that SFR 1 has been in operation, experience has been gained of operating the facility and new knowledge of long-term performance of SFR 1 has been obtained. New regulations for nuclear facilities have been promulgated since SFR 1 was taken into operation (1988). A review committee comprising employees from SKI and SSI has conducted the review of SSR 2001. This review report has resulted in the committee's evaluation of the safety of SFR 1 and is the basis of the regulatory authorities' decision concerning any amendments to the stipulations for the operation of SFR 1. However, the review has found deficiencies in the follow up of the development of design basis norms since the facility was constructed as well as deficiencies in learning from operating experience. However, the overall evaluation is that the facility is being operated in an acceptable manner from the standpoint of safety. With respect to the long-term performance of the repository, it is a deficiency that SSR 2001 does not describe how compliance with the stipulated radiation protection requirements on optimisation and use of the best available technology (BAT) is achieved during operation. In the opinion of the review committee, issues relating to occupational radiation protection are being handled satisfactorily and the operational releases of radioactive substances are very small. Safety and Radiation Protection after Closure SKB's long-term repository performance assessment contains essential updates and improvements compared with the

  13. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel; Utgaangspunkter foer SSI:s granskning av ansoekan foer en inkapslingsanlaeggning och ett slutfoervar foer anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    Oehlen, Elisabeth

    2006-09-15

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect.

  14. Secondary signal imaging (SSI) electron tomography (SSI-ET): A new three-dimensional metrology for mesoscale specimens in transmission electron microscope.

    Science.gov (United States)

    Han, Chang Wan; Ortalan, Volkan

    2015-09-01

    We have demonstrated a new electron tomography technique utilizing the secondary signals (secondary electrons and backscattered electrons) for ultra thick (a few μm) specimens. The Monte Carlo electron scattering simulations reveal that the amount of backscattered electrons generated by 200 and 300keV incident electrons is a monotonic function of the sample thickness and this causes the thickness contrast satisfying the projection requirement for the tomographic reconstruction. Additional contribution of the secondary electrons emitted from the edges of the specimens enhances the visibility of the surface features. The acquired SSI tilt series of the specimen having mesoscopic dimensions are successfully reconstructed verifying that this new technique, so called the secondary signal imaging electron tomography (SSI-ET), can directly be utilized for 3D structural analysis of mesoscale structures. Published by Elsevier Ltd.

  15. Validation of seismic soil structure interaction (SSI) methodology for a UK PWR nuclear power station

    International Nuclear Information System (INIS)

    Llambias, J.M.

    1993-01-01

    The seismic loading information for use in the seismic design of equipment and minor structures within a nuclear power plant is determined from a dynamic response analysis of the building in which they are located. This dynamic response analysis needs to capture the global response of both the building structure and adjacent soil and is commonly referred to as a soil structure interaction (SSI) analysis. NNC have developed a simple and cost effective methodology for the seismic SSI analysis of buildings in a PWR nuclear power station at a UK soft site. This paper outlines the NNC methodology and describes the approach adopted for its validation

  16. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Oehlen, Elisabeth

    2006-09-01

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect

  17. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    International Nuclear Information System (INIS)

    Wilmot, R.D.; Galson, D.A.; Hora, S.C.

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session, designed to

  18. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    Energy Technology Data Exchange (ETDEWEB)

    Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session

  19. Indicators of Informal and Formal Decision-Making about a Socioscientific Issue

    Science.gov (United States)

    Dauer, Jenny M.; Lute, Michelle L.; Straka, Olivia

    2017-01-01

    We propose two contrasting types of student decision-making based on social and cognitive psychology models of separate mental processes for problem solving. Informal decision-making uses intuitive reasoning and is subject to cognitive biases, whereas formal decision-making uses effortful, logical reasoning. We explored indicators of students'…

  20. Debate on Global Warming as a Socio-Scientific Issue: Science Teaching towards Political Literacy

    Science.gov (United States)

    Pereira dos Santos, Wildson Luiz

    2014-01-01

    The focus of this response to the original article by Tom G. H. Bryce and Stephen P. Day ("Cult Stud Sci Educ." doi:10.1007/s11422-012-9407-1, 2013) is the use of empirical data to illustrate and expand the understanding of key points of their argument. Initially, I seek to discuss possible answers to the three questions posed by the…

  1. Changing Perspectives: Exploring a Pedagogy to Examine Other Perspectives about Stem Cell Research

    Science.gov (United States)

    France, Bev; Mora, Helen A.; Bay, Jacquie L.

    2012-01-01

    This study explores how teachers developed and critically evaluated a range of teaching strategies that could support the discussion of a socio-scientific issue (SSI) that had the potential to be controversial. The issue was stem cell research and six New Zealand teachers of senior biology students (grades 12/13) took part in an action research…

  2. University Students' Knowledge Structures and Informal Reasoning on the Use of Genetically Modified Foods: Multidimensional Analyses

    Science.gov (United States)

    Wu, Ying-Tien

    2013-01-01

    This study aims to provide insights into the role of learners' knowledge structures about a socio-scientific issue (SSI) in their informal reasoning on the issue. A total of 42 non-science major university students' knowledge structures and informal reasoning were assessed with multidimensional analyses. With both qualitative and…

  3. 75 FR 1271 - Technical Revisions to the Supplemental Security Income (SSI) Regulations on Income and Resources

    Science.gov (United States)

    2010-01-11

    ... extend the home exclusion to beneficiaries who, because of domestic abuse, leave a home that had... Domestic Abuse An SSI applicant's or beneficiary's home and associated land are excluded from resources by... abuse leaves the home and resides elsewhere. Currently, a victim fleeing from domestic abuse may return...

  4. Galileo SSI Observations of Io During Orbits C30 I33

    Science.gov (United States)

    Keszthelyi, L.; Turtle, E.; McEwen, A.; Simonelli, D.; Geissler, P.; Williams, D.; Milazzo, M.; Radebaugh, J.; Jaeger, W.; Klaasen, K. P.

    2002-01-01

    New Galileo SSI imaging of Io from orbits C30 I33 will be presented. The aging Galileo spacecraft continues to produce spectacular new results, including the tallest volcanic plume yet found on Io. Additional information is contained in the original extended abstract.

  5. 20 CFR 416.1826 - Showing that you are not married when you apply for SSI.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Showing that you are not married when you apply for SSI. 416.1826 Section 416.1826 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... used on mail for each of you? (iv) Who owns or rents the place where you live? (v) Do any deeds, leases...

  6. Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter

    Science.gov (United States)

    Bakhtiar, Mehdi; Seifpanahi, Sadegh; Ansari, Hossein; Ghanadzade, Mehdi; Packman, Ann

    2010-01-01

    There is a pressing need in Iran for the translation of widely used speech-language assessment tools into Persian. This study reports the interjudge and intrajudge reliability of a Persian translation of the Stuttering Severity Instrument-3 (SSI-3) (Riley, 1994). There was greater than 80% interjudge and intrajudge agreement on scale scores for…

  7. Confidence interval of intrinsic optimum temperature estimated using thermodynamic SSI model

    Institute of Scientific and Technical Information of China (English)

    Takaya Ikemoto; Issei Kurahashi; Pei-Jian Shi

    2013-01-01

    The intrinsic optimum temperature for the development of ectotherms is one of the most important factors not only for their physiological processes but also for ecological and evolutional processes.The Sharpe-Schoolfield-Ikemoto (SSI) model succeeded in defining the temperature that can thermodynamically meet the condition that at a particular temperature the probability of an active enzyme reaching its maximum activity is realized.Previously,an algorithm was developed by Ikemoto (Tropical malaria does not mean hot environments.Journal of Medical Entomology,45,963-969) to estimate model parameters,but that program was computationally very time consuming.Now,investigators can use the SSI model more easily because a full automatic computer program was designed by Shi et al.(A modified program for estimating the parameters of the SSI model.Environmental Entomology,40,462-469).However,the statistical significance of the point estimate of the intrinsic optimum temperature for each ectotherm has not yet been determined.Here,we provided a new method for calculating the confidence interval of the estimated intrinsic optimum temperature by modifying the approximate bootstrap confidence intervals method.For this purpose,it was necessary to develop a new program for a faster estimation of the parameters in the SSI model,which we have also done.

  8. From the American Academy of Pediatrics: Policy statements--Supplemental Security Income (SSI) for children and youth with disabilities.

    Science.gov (United States)

    2009-12-01

    The Supplemental Security Income (SSI) program remains an important source of financial support for low-income families of children with special health care needs and disabling conditions. In most states, SSI eligibility also qualifies children for the state Medicaid program, providing access to health care services. The Social Security Administration (SSA), which administers the SSI program, considers a child disabled under SSI if there is a medically determinable physical or mental impairment or combination of impairments that results in marked and severe functional limitations. The impairment(s) must be expected to result in death or have lasted or be expected to last for a continuous period of at least 12 months. The income and assets of families of children with disabilities are also considered when determining financial eligibility. When an individual with a disability becomes an adult at 18 years of age, the SSA considers only the individual's income and assets. The SSA considers an adult to be disabled if there is a medically determinable impairment (or combination of impairments) that prevents substantial gainful activity for at least 12 continuous months. SSI benefits are important for youth with chronic conditions who are transitioning to adulthood. The purpose of this statement is to provide updated information about the SSI medical and financial eligibility criteria and the disability-determination process. This statement also discusses how pediatricians can help children and youth when they apply for SSI benefits.

  9. The Effect of Socioscientific Topics on Discourse within an Online Game Designed to Engage Middle School Students in Scientific Argumentation

    Science.gov (United States)

    Craig-Hare, Jana; Ault, Marilyn; Rowland, Amber

    2017-01-01

    The purpose of this study was to investigate the types of argumentation discourse displayed by students when they engaged in chat as part of an online multiplayer game about both socioscientific and scientific topics. Specifically, this study analyzed discourse episodes created by middle school students as they discussed scientific and…

  10. SSI's Review of the RDandD Program 2004 of the Swedish Nuclear Fuel and Waste Management Co; SSI:s granskning av SKB:s Fud-program 2004

    Energy Technology Data Exchange (ETDEWEB)

    Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others

    2005-06-01

    In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.

  11. Effects of different SSI parameters on the floor response spectra of a nuclear reactor building

    International Nuclear Information System (INIS)

    Kabir, A.F.; Bolourchi, S.; Maryak, M.E.

    1991-01-01

    The effects of several critical soil-structure interaction (SSI) parameters on the floor response spectra (FRS) of a typical nuclear reactor building have been examined. These parameters are computation of soil impedance functions using different approaches, scattering effects (reductions in ground motion due to embedment and rigidity of building foundation) and strain dependency of soil dynamic properties. This paper reports that the significant conclusions of the study, which are applicable to a deeply embedded very rigid nuclear reactor building, are as follows: FRS generated without considering scattering effects are highly conservative; differences between FRS, generated considering strain-dependency of soil dynamic properties, and those generated suing low-strain values, are not significant; and the lumped-parameter approach of SSI calculations, which only uses a single value of soil shear modulus in impedance calculations, may not be able to properly compute the soil impedances for a soil deposit with irregularly varying properties with depth

  12. The SSI TOOLBOX Source Term Model SOSIM - Screening for important radionuclides and parameter sensitivity analysis

    Energy Technology Data Exchange (ETDEWEB)

    Avila Moreno, R.; Barrdahl, R.; Haegg, C.

    1995-05-01

    The main objective of the present study was to carry out a screening and a sensitivity analysis of the SSI TOOLBOX source term model SOSIM. This model is a part of the SSI TOOLBOX for radiological impact assessment of the Swedish disposal concept for high-level waste KBS-3. The outputs of interest for this purpose were: the total released fraction, the time of total release, the time and value of maximum release rate, the dose rates after direct releases of the biosphere. The source term equations were derived and simple equations and methods were proposed for calculation of these. A literature survey has been performed in order to determine a characteristic variation range and a nominal value for each model parameter. In order to reduce the model uncertainties the authors recommend a change in the initial boundary condition for solution of the diffusion equation for highly soluble nuclides. 13 refs.

  13. Socioscience and Ethics in Science Classrooms: Teacher Perspectives and Strategies

    Science.gov (United States)

    Sadler, Troy D.; Amirshokoohi, Aidin; Kazempour, Mahsa; Allspaw, Kathleen M.

    2006-01-01

    This study explored teacher perspectives on the use of socioscientific issues (SSI) and on dealing with ethics in the context of science instruction. Twenty-two middle and high school science teachers from three US states participated in semi-structured interviews, and researchers employed inductive analyses to explore emergent patterns relative…

  14. Assessing Students' Performances in Decision-Making: Coping Strategies of Biology Teachers

    Science.gov (United States)

    Steffen, Benjamin; Hößle, Corinna

    2017-01-01

    Decision-making in socioscientific issues (SSI) constitutes a real challenge for both biology teachers and learners. The assessment of students' performances in SSIs constitutes a problem, especially for biology teachers. The study at hand was conducted in Germany and uses a qualitative approach following the research procedures of grounded theory…

  15. Incoherent SSI Analysis of Reactor Building using 2007 Hard-Rock Coherency Model

    International Nuclear Information System (INIS)

    Kang, Joo-Hyung; Lee, Sang-Hoon

    2008-01-01

    Many strong earthquake recordings show the response motions at building foundations to be less intense than the corresponding free-field motions. To account for these phenomena, the concept of spatial variation, or wave incoherence was introduced. Several approaches for its application to practical analysis and design as part of soil-structure interaction (SSI) effect have been developed. However, conventional wave incoherency models didn't reflect the characteristics of earthquake data from hard-rock site, and their application to the practical nuclear structures on the hard-rock sites was not justified sufficiently. This paper is focused on the response impact of hard-rock coherency model proposed in 2007 on the incoherent SSI analysis results of nuclear power plant (NPP) structure. A typical reactor building of pressurized water reactor (PWR) type NPP is modeled classified into surface and embedded foundations. The model is also assumed to be located on medium-hard rock and hard-rock sites. The SSI analysis results are obtained and compared in case of coherent and incoherent input motions. The structural responses considering rocking and torsion effects are also investigated

  16. SKI's and SSI's review of SKB's safety report SR-Can

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjoern; Stroemberg, Bo (and others)

    2008-03-15

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be

  17. Where Did You Come From? Where Will You Go? Human Evolutionary Biology Education and American Students' Academic Interests and Achievements, Professional Goals, and Socioscientific Decision-making

    Science.gov (United States)

    Schrein, Caitlin M.

    In the United States, there is a national agenda to increase the number of qualified science, technology, engineering, and maths (STEM) professionals and a movement to promote science literacy among the general public. This project explores the association between formal human evolutionary biology education (HEB) and high school science class enrollment, academic achievement, interest in a STEM degree program, motivation to pursue a STEM career, and socioscientific decision-making for a sample of students enrolled full-time at Arizona State University. Given a lack of a priori knowledge of these relationships, the Grounded Theory Method was used and was the foundation for a mixed-methods analysis involving qualitative and quantitative data from one-on-one interviews, focus groups, questionnaires, and an online survey. Theory development and hypothesis generation were based on data from 44 students. The survey instrument, developed to test the hypotheses, was completed by 486 undergraduates, age 18--22, who graduated from U.S. public high schools. The results showed that higher exposure to HEB was correlated with greater high school science class enrollment, particularly for advanced biological science classes, and that, for some students, HEB exposure may have influenced their enrollment, because the students found the content interesting and relevant. The results also suggested that students with higher K--12 HEB exposure felt more prepared for undergraduate science coursework. There was a positive correlation between HEB exposure and interest in a STEM degree and an indirect relationship between higher HEB exposure and motivation to pursue a STEM career. Regarding a number of socioscientific issues, including but not limited to climate change, homosexuality, and stem cell research, students' behaviors and decision-making more closely reflected a scientific viewpoint---or less-closely aligned to a religion-based perspective---when students had greater HEB exposure

  18. Socio-scientific research contribution to energy practice; Sozialwissenschaftlicher Forschungsbeitrag fuer die Energiepraxis

    Energy Technology Data Exchange (ETDEWEB)

    Artho, J.; Soland, M.

    2009-01-15

    This final report for the Swiss Federal Office of Energy (SFOE) takes a look at the findings of a study made by the University of Zurich, Switzerland, on socio-scientific aspects of energy use. Basic socio-psychological mechanisms are examined on which energy policy instruments can be based. Basic mechanisms are discussed such as enforced behaviour, non-enforced action, habitual acts and action taken on the basis of heuristics and rules-of-thumb. The second part of the paper looks at examples of the use of these principles, discussing, amongst other things, cost-benefit and moral reasoning, habits, mental accounting and boomerang effects. Finally the analyses are summarised and further research needed as a result of these analyses is noted.

  19. Changes in Pre-service Science Teachers' Understandings After Being Involved in Explicit Nature of Science and Socioscientific Argumentation Processes

    Science.gov (United States)

    Kutluca, A. Y.; Aydın, A.

    2017-08-01

    The study explored the changes in pre-service science teachers' understanding of the nature of science and their opinions about the nature of science, science teaching and argumentation after their participation in explicit nature of science (NOS) and socioscientific argumentation processes. The participants were 56 third-grade pre-service science teachers studying in a state university in Turkey. The treatment group comprised 27 participants, and there were 29 participants in the comparison group. The comparison group participants were involved in a student-centred science-teaching process, and the participants of the treatment group were involved in explicit NOS and socioscientific argumentation processes. In the study, which lasted a total of 11 weeks, a NOS-as-argumentation questionnaire was administered to all the participants to determine their understanding of NOS at the beginning and end of the data collection process, and six random participants of the treatment group participated in semi-structured interview questions in order to further understand their views regarding NOS, science teaching and argumentation. Qualitative and quantitative data analysis revealed that the explicit NOS and socioscientific argumentation processes had a significant effect on pre-service science teachers' NOS understandings. Furthermore, NOS, argumentation and science teaching views of the participants in the treatment group showed a positive change. The results of this study are discussed in light of the related literature, and suggestions are made within the context of contribution to science-teaching literature, improvement of education quality and education of pre-service teachers.

  20. Effect of the gate scaling on the analogue performance of s-Si CMOS devices

    International Nuclear Information System (INIS)

    Fobelets, K; Calvo-Gallego, J; Velázquez-Pérez, J E

    2011-01-01

    In this contribution, we present a detailed study of the analogue performance of deep submicron strained n-channel Si/SiGe (s-Si) MOSFETs. The study was carried out using a 2D device simulator based on the hydrodynamic model and the impedance field method to self-consistently obtain the current noise at the device's terminals. The analysis focused on the possible benefits of the gate scaling on the ac and noise performance of the transistor for low-power applications while keeping constant the oxide thickness equal to 2 nm to guarantee negligible level of the gate tunnel current. For a drain to source bias of 50 mV, it was found that a pure scaling of the transistor's gate length under 32 nm is detrimental for subthreshold operation in terms of the subthreshold slope (S) and transconductance (g m ) but would lead to reasonably low values of the minimum noise figure (NF min ). For the sake of comparison, SOI MOSFETs with the same layout and operating under the same conditions were simulated. The SOI MOSFETs showed better immunity against the gate scaling in terms of S than the s-Si MOSFETs, but lower values of g m and a higher value of NF min at the same level of the drain current. Finally, the devices have been studied in the saturation region for a drain to source bias of 1 V. In this region, it was found that the dependence of the current level SOI or s-Si MOSFET may outperform its counterparts

  1. SSI`s International Development Co-operation (SIUS). Annual report 1998

    Energy Technology Data Exchange (ETDEWEB)

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI`s International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  2. Non-technical issues in safety assessments for nuclear disposal facilities

    International Nuclear Information System (INIS)

    Kallenbach-Herbert, Beate; Brohmann, Bettina

    2010-09-01

    The paper highlights that a comprehensive approach to safety affords the consideration of technology, organisation, personnel and social environment. In several safety relevant contexts of nuclear waste disposal these fields are closely interrelated. The approach for the consideration of socio-scientific aspects which is sketched in this paper supports the systematic treatment of safety relevant non-technical issues in the safety case or in safety assessments for a disposal project. Furthermore it may foster the dialogue among specialists from the technical, the natural- and the socio-scientific field on questions of disposal safety. In this way it may contribute to a better understanding among the affected scientific disciplines in nuclear waste disposal.

  3. The role of the cerebellum in auditory processing using the SSI test A participação do cerebelo no processamento auditivo com o uso do teste SSI

    Directory of Open Access Journals (Sweden)

    Patricia Maria Sens

    2011-10-01

    Full Text Available The Synthetic Sentence Identification (SSI test assesses central auditory pathways by measuring auditory and visual sensitivity and testing selective attention. Cerebellum activation in auditory attention and sensorial activity modulation have already been described. Assessing patients with cerebellar lesions alone using the SSI test can confirm the role of the cerebellum in auditory processing. AIM: To evaluate the role of the cerebellum in auditory processing in individuals with normal hearing and in those with chronic cerebellum lesions, using the SSI test. MATERIALS AND METHODS: Cross-sectional cohort study. A study group comprising 18 patients with chronic cerebellar lesion and a control group of 20 healthy individuals were assessed. The SSI test was applied in an Ipsilateral Competitive Message (ICM and Contralateral Competitive Message (CCM modes. To compare the results between groups, we used the chi-square test for qualitative variables. RESULTS: A statistically significant difference was found between the study and control groups using the ICM mode of the SSI test (p=0.035, but not in the CCM mode (p=0.083. CONCLUSION: The results on the SSI confirmed cerebellar participation in auditory processing in individuals with chronic cerebellar lesions and in those with normal hearing assessed in this study.O teste de Identificação de Sentenças Sintéticas (SSI avalia as vias centrais da audição utilizando a sensibilidade auditiva e visual e testando a atenção seletiva. A ativação do cerebelo na atenção auditiva, assim como na modulação da atividade sensorial, já é descrita. Avaliar pacientes com lesão exclusiva do cerebelo por meio do teste SSI pode confirmar ou refutar a hipótese da participação do cerebelo no processamento auditivo. OBJETIVO: Avaliar pelo teste SSI a participação do cerebelo no processamento auditivo, em indivíduos com lesão crônica do cerebelo e audição normal. MATERIAL E MÉTODOS: Estudo coorte

  4. Development of generic soil profiles and soil data development for SSI analyses

    Energy Technology Data Exchange (ETDEWEB)

    Parker, Josh, E-mail: jparker@nuscalepower.com [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States); Khan, Mohsin; Rajagopal, Raj [ARES Corporation, 1990N California Boulevard, Suite 500, Walnut Creek, CA 94596 (United States); Groome, John [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States)

    2014-04-01

    This paper presents the approach to developing generic soil profiles for the design of reactor building for small modular reactor (SMR) nuclear power plant developed by NuScale Power. The reactor building is a deeply embedded structure. In order to perform soil structure interaction (SSI) analyses, generic soil profiles are required to be defined for the standardized Nuclear Power Plant (NPP) designs for the United States Nuclear Regulatory Commission (NRC) in a design control document (DCD). The development of generic soil profiles is based on utilization of information on generic soil profiles from the new standardized nuclear power plant designs already submitted to the NRC for license certification. Eleven generic soil profiles have been recommended, and those profiles cover a wide range of parameters such as soil depth, shear wave velocity, unit weight, Poisson's ratio, water table, and depth to rock strata. The soil profiles are developed for a range of shear wave velocities between bounds of 1000 fps and 8000 fps as inferred from NRC Standard Review Plan (NUREG 0800) Sections 3.7.1 and 3.7.2. To account for the soil degradation due to seismic events, the strain compatible soil properties are based on the EPRI generic soil degradation curves. In addition, one dimensional soil dynamic response analyses were performed to study the soil layer input motions for performing the SSI analyses.

  5. Nonlinear Time Domain Seismic Soil-Structure Interaction (SSI) Deep Soil Site Methodology Development

    International Nuclear Information System (INIS)

    Spears, Robert Edward; Coleman, Justin Leigh

    2015-01-01

    Currently the Department of Energy (DOE) and the nuclear industry perform seismic soil-structure interaction (SSI) analysis using equivalent linear numerical analysis tools. For lower levels of ground motion, these tools should produce reasonable in-structure response values for evaluation of existing and new facilities. For larger levels of ground motion these tools likely overestimate the in-structure response (and therefore structural demand) since they do not consider geometric nonlinearities (such as gaping and sliding between the soil and structure) and are limited in the ability to model nonlinear soil behavior. The current equivalent linear SSI (SASSI) analysis approach either joins the soil and structure together in both tension and compression or releases the soil from the structure for both tension and compression. It also makes linear approximations for material nonlinearities and generalizes energy absorption with viscous damping. This produces the potential for inaccurately establishing where the structural concerns exist and/or inaccurately establishing the amplitude of the in-structure responses. Seismic hazard curves at nuclear facilities have continued to increase over the years as more information has been developed on seismic sources (i.e. faults), additional information gathered on seismic events, and additional research performed to determine local site effects. Seismic hazard curves are used to develop design basis earthquakes (DBE) that are used to evaluate nuclear facility response. As the seismic hazard curves increase, the input ground motions (DBE's) used to numerically evaluation nuclear facility response increase causing larger in-structure response. As ground motions increase so does the importance of including nonlinear effects in numerical SSI models. To include material nonlinearity in the soil and geometric nonlinearity using contact (gaping and sliding) it is necessary to develop a nonlinear time domain methodology. This

  6. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    International Nuclear Information System (INIS)

    2001-03-01

    included no discussion in the safety report as to which R and D activities they intend to prioritise. According to the current SKB timetable, siting and construction of SFL 3-5 will not begin for another 30 years. However, SKI and SSI do not consider this to be a reason to postpone essential R and D work. If a complete and thorough basis is not produced for assessing the long-term safety of an SFL 3-5 repository, the risk that these waste categories will have to undergo interim storage for an indefinite period of time increases. A future siting of SFL 3-5 based on our current level of knowledge is problematic. The present safety assessment points toward a substantial site-specific effect on the repository's protective capacity that can be related primarily to the local groundwater flow rate, but also to relevant geochemical conditions. Calculated doses for cases involving consumption of drinking water give the impression that the margins are small vis-a-vis the existing requirement framework, at least based on the methods used heretofore. In their main report, SKB discuss the possibility of improving the technical barriers to increase their impact on long-term safety (thereby mitigating the impact of site-specific factors). SKI and SSI feel that this approach is reasonable from the current preliminary perspective, but not for subsequent stages. SKB should in future formulate a proposed repository design that can be considered sufficiently robust with respect to the effects of the site-specific factors and their long-term evolution. The requirements and criteria that are relevant to the siting of SFL 3-5 must be addressed therein. In addition, more in-depth studies regarding the optimum storage depth for SFL 3-5 and the importance of the interactions between SFL 2 and SFL 3-5 should be undertaken relatively soon. The importance of these issues needs to be well documented in order to provide a basis for identifying suitable rock volumes for potential siting of SFL 3-5. Once

  7. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    that SKB have included no discussion in the safety report as to which R and D activities they intend to prioritise. According to the current SKB timetable, siting and construction of SFL 3-5 will not begin for another 30 years. However, SKI and SSI do not consider this to be a reason to postpone essential R and D work. If a complete and thorough basis is not produced for assessing the long-term safety of an SFL 3-5 repository, the risk that these waste categories will have to undergo interim storage for an indefinite period of time increases. A future siting of SFL 3-5 based on our current level of knowledge is problematic. The present safety assessment points toward a substantial site-specific effect on the repository's protective capacity that can be related primarily to the local groundwater flow rate, but also to relevant geochemical conditions. Calculated doses for cases involving consumption of drinking water give the impression that the margins are small vis-a-vis the existing requirement framework, at least based on the methods used heretofore. In their main report, SKB discuss the possibility of improving the technical barriers to increase their impact on long-term safety (thereby mitigating the impact of site-specific factors). SKI and SSI feel that this approach is reasonable from the current preliminary perspective, but not for subsequent stages. SKB should in future formulate a proposed repository design that can be considered sufficiently robust with respect to the effects of the site-specific factors and their long-term evolution. The requirements and criteria that are relevant to the siting of SFL 3-5 must be addressed therein. In addition, more in-depth studies regarding the optimum storage depth for SFL 3-5 and the importance of the interactions between SFL 2 and SFL 3-5 should be undertaken relatively soon. The importance of these issues needs to be well documented in order to provide a basis for identifying suitable rock volumes for potential

  8. Earth-based and Galileo SSI multispectral observations of eastern mare serenitatis and the Apollo 17 landing site

    Science.gov (United States)

    Hiesinger, H.; Jaumann, R.; Neukum, G.

    1993-01-01

    Both the Apollo 17 and the Mare Serenitatis region were observed by Galileo during its fly-by in December 1992. We used earth-based multispectral data to define mare units which then can be compared with the results of the Galileo SSI data evaluation.

  9. Incorporating higher order WINKLER springs with 3-D finite element model of a reactor building for seismic SSI analysis

    International Nuclear Information System (INIS)

    Ermutlu, H.E.

    1993-01-01

    In order to fulfill the seismic safety requirements, in the frame of seismic requalification activities for NPP Muehleberg, Switzerland, detailed seismic analysis performed on the Reactor Building and the results are presented previously. The primary objective of the present investigation is to assess the seismic safety of the reinforced concrete structures of reactor building. To achieve this objective requires a rather detailed 3-D finite element modeling for the outer shell structures, the drywell, the reactor pools, the floor decks and finally, the basemat. This already is a complicated task, which enforces need for simplifications in modelling the reactor internals and the foundation soil. Accordingly, all internal parts are modelled by vertical sticks and the Soil Structure Interaction (SSI) effects are represented by sets of transitional and higher order rotational WINKLER springs, i.e. avoiding complicated finite element SSI analysis. As a matter of fact, the availability of the results of recent investigations carried out on the reactor building using diversive finite element SSI analysis methods allow to calibrate the WINKLER springs, ensuring that the overall SSI behaviour of the reactor building is maintained

  10. Sintered silicon carbides for sliding applications in pumps; Pumpenbauteile aus SSiC

    Energy Technology Data Exchange (ETDEWEB)

    Fundus, M. [Wacker Engineer Ceramics, Inc., Adrian, MI (United States)

    2000-07-01

    The focus of the paper is on enhancement and optimization of the tribological properties of SSiC materials based on field experience obtained with the materials EKasic {sup trademark} D, TRIBO 2000, and TRIBO 2000-1. Current product development activities discussed in this paper concentrate on slide bearings and seal rings. (orig./cB) [German] Mit EKasic {sup trademark} D, TRIBO 2000 und TRIBO 2000-1 stehen drei SiC-Werkstoffe zur Verfuegung, die in der Lage sind die ganze Bandbreite der Anwendungen abzudecken. Durch eine konsequente Fortsetzung der tribologischen Optimierung der SiC-Werkstoffe koennen auch die in den naechsten Jahren weiter steigenden Anforderungen im Lager- und Dichtungsbereich erfuellt werden (Gleitringdichtungen, Gleitlager). (orig./MM)

  11. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    Energy Technology Data Exchange (ETDEWEB)

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches.

  12. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    International Nuclear Information System (INIS)

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches

  13. The final Galileo SSI observations of Io: Orbits G28-I33

    Science.gov (United States)

    Turtle, E.P.; Keszthelyi, L.P.; McEwen, A.S.; Radebaugh, J.; Milazzo, M.; Simonelli, D.P.; Geissler, P.; Williams, D.A.; Perry, J.; Jaeger, W.L.; Klaasen, K.P.; Breneman, H.H.; Denk, T.; Phillips, C.B.

    2004-01-01

    We present the observations of Io acquired by the Solid State Imaging (SSI) experiment during the Galileo Millennium Mission (GMM) and the strategy we used to plan the exploration of Io. Despite Galileo's tight restrictions on data volume and downlink capability and several spacecraft and camera anomalies due to the intense radiation close to Jupiter, there were many successful SSI observations during GMM. Four giant, high-latitude plumes, including the largest plume ever observed on Io, were documented over a period of eight months; only faint evidence of such plumes had been seen since the Voyager 2 encounter, despite monitoring by Galileo during the previous five years. Moreover, the source of one of the plumes was Tvashtar Catena, demonstrating that a single site can exhibit remarkably diverse eruption styles - from a curtain of lava fountains, to extensive surface flows, and finally a ??? 400 km high plume - over a relatively short period of time (??? 13 months between orbits 125 and G29). Despite this substantial activity, no evidence of any truly new volcanic center was seen during the six years of Galileo observations. The recent observations also revealed details of mass wasting processes acting on Io. Slumping and landsliding dominate and occur in close proximity to each other, demonstrating spatial variation in material properties over distances of several kilometers. However, despite the ubiquitous evidence for mass wasting, the rate of volcanic resurfacing seems to dominate; the floors of paterae in proximity to mountains are generally free of debris. Finally, the highest resolution observations obtained during Galileo's final encounters with Io provided further evidence for a wide diversity of surface processes at work on Io. ?? 2003 Elsevier Inc. All rights reserved.

  14. Changes in Pre-Service Science Teachers' Understandings After Being Involved in Explicit Nature of Science and Socioscientific Argumentation Processes

    Science.gov (United States)

    Kutluca, A. Y.; Aydin, A.

    2017-01-01

    The study explored the changes in pre-service science teachers' understanding of the nature of science and their opinions about the nature of science, science teaching and argumentation after their participation in explicit nature of science (NOS) and socioscientific argumentation processes. The participants were 56 third-grade pre-service science…

  15. Science Education: Issues, Approaches and Challenges

    Directory of Open Access Journals (Sweden)

    Shairose Irfan Jessani

    2015-06-01

    Full Text Available In today’s global education system, science education is much more than fact-based knowledge. Science education becomes meaningless and incomprehensible for learners, if the learners are unable to relate it with their lives. It is thus recommended that Pakistan, like many other countries worldwide should adopt Science Technology Society (STS approach for delivery of science education. The purpose of the STS approach lies in developing scientifically literate citizens who can make conscious decisions about the socio-scientific issues that impact their lives. The challenges in adopting this approach for Pakistan lie in four areas that will completely need to be revamped according to STS approach. These areas include: the examination system; science textbooks; science teacher education programs; and available resources and school facilities.

  16. Análise da versão espanhola do Sport Satisfaction Instrument (SSI adaptado à Educação Física Analysis of the Spanish version of the Sport Satisfaction Instrument (SSI adapted to Physical Education

    Directory of Open Access Journals (Sweden)

    Antonio Granero-Gallegos

    2013-03-01

    Full Text Available O objetivo deste estudo foi analisar as propriedades psicométricas do Sport Satisfation Instrument (SSI adaptado para a Educação Física (EF por meio de uma análise fatorial exploratória da estrutura bidimensional do instrumento em uma amostra espanhola. Com isso, buscou-se determinar, de maneira preliminar, se o SSI constitui um instrumento válido e fiável para ser utilizado em futuras pesquisas. O instrumento foi elaborado em um modelo teórico de dois fatores: Satisfação/Diversão e Tédio. A amostra constituiu-se de um total de 224 alunos de secundária entre 12 e 19 anos. A versão [espanhola] do instrumento adaptado para a EF demonstrou níveis aceitáveis de consistência interna.The objective of this study was to analyze the psychometric properties of Sport Satisfaction Instrument (SSI adapted physical education (PE using exploratory factor analysis of the dimensional structure of the instrument in a Spanish sample. It was intended to determine, on a preliminary basis, whether it constitutes a valid and reliable for use in future research. Was administered to a total of 224 high school students 12 to 19 years. This analysis supports the hypothesized theoretical model of two factors (satisfaction / fun and boredom. The Spanish version of the instrument for PE showed acceptable levels of internal consistency.

  17. Using the SEE-SEP Model to Analyze Upper Secondary Students' Use of Supporting Reasons in Arguing Socioscientific Issues

    Science.gov (United States)

    Christenson, Nina; Chang Rundgren, Shu-Nu; Hoglund, Hans-Olof

    2012-01-01

    To achieve the goal of scientific literacy, the skills of argumentation have been emphasized in science education during the past decades. But the extent to which students can apply scientific knowledge to their argumentation is still unclear. The purpose of this study was to analyse 80 Swedish upper secondary students' informal argumentation on…

  18. Scepticism and doubt in science and science education: the complexity of global warming as a socio-scientific issue

    Science.gov (United States)

    Bryce, Tom G. K.; Day, Stephen P.

    2014-09-01

    This article looks critically at the complexity of the debate among climate scientists; the controversies in the science of global temperature measurement; and at the role played by consensus. It highlights the conflicting perspectives figuring in the mass media concerned with climate change, arguing that science teachers should be familiar with them, particularly given the sharply contested views likely to be brought into classroom discussion and the importance of developing intellectual scepticism and robust scientific literacy in students. We distinguish between rational scepticism and the pejorative meaning of the expression associated with attitudinal opposition to global warming—similar to the way in which Bauer (2006) contrasts micro- scepticism and macro- scepticism in reasoning generally. And we look closely and critically at the approaches which teachers might adopt in practice to teach about global warming at this difficult time.

  19. Changes in Primary Students' Informal Reasoning during an Environment-Related Curriculum on Socio-Scientific Issues

    Science.gov (United States)

    Karpudewan, Mageswary; Roth, Wolff-Michael

    2018-01-01

    Recent studies emphasize the importance of learning science while considering multiple perspectives on environment, society, economy, and technology, which allows learners to relate what they do in the classroom to the world beyond. In this study, 68 12-year-old primary students from 1 Malaysian school were followed while they engaged in a science…

  20. Scepticism and Doubt in Science and Science Education: The Complexity of Global Warming as a Socio-Scientific Issue

    Science.gov (United States)

    Bryce, Tom G. K.; Day, Stephen P.

    2014-01-01

    This article looks critically at the complexity of the debate among climate scientists; the controversies in the science of global temperature measurement; and at the role played by "consensus." It highlights the conflicting perspectives figuring in the mass media concerned with climate change, arguing that science teachers should be…

  1. Using Memes and Memetic Processes to Explain Social and Conceptual Influences on Student Understanding about Complex Socio-Scientific Issues

    Science.gov (United States)

    Yoon, Susan

    2008-01-01

    This study investigated seventh grade learners' decision making about genetic engineering concepts and applications. A social network analyses supported by technology tracked changes in student understanding with a focus on social and conceptual influences. Results indicated that several social and conceptual mechanisms potentially affected how…

  2. SSI on the Dynamic Behaviour of a Historical Masonry Building: Experimental versus Numerical Results

    Directory of Open Access Journals (Sweden)

    Francesca Ceroni

    2014-11-01

    Full Text Available A reliable procedure to identify the dynamic behaviour of existing masonry buildings is described in the paper, referring to a representative case study: a historical masonry palace located in Benevento (Italy. Since the building has been equipped with a permanent dynamic monitoring system by the Department of Civil Protection, some of the recorded data, acquired in various operating conditions, have been analysed with basic instruments of the Operational Modal Analysis in order to identify the main eigenfrequencies and vibration modes of the structure. The obtained experimental results have been compared to the numerical outcomes provided by three detailed Finite Element (FE models of the building. The influence of Soil-Structure Interaction (SSI has been also introduced in the FE model by a sub-structure approach where concentrated springs were placed at the base of the building to simulate the effect of soil and foundation on the global dynamic behaviour of the structure. The obtained results evidence that subsoil cannot a priori be disregarded in identifying the dynamic response of the building.

  3. [Spanish adaptation of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM)].

    Science.gov (United States)

    Escobar Espejo, Milagros; Blanca, María J; Fernández-Baena, F Javier; Trianes Torres, María Victoria

    2011-08-01

    The aim of the present study was to translate into Spanish and to describe the psychometric properties of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM), developed by Fimian, Fastenau, Tashner and Cross to identify the main manifestations of stress in adolescents. The scale was applied to a sample of 1,002 pupils from years one and two of Secondary Education. The paper reports the factor structure, an item analysis, the internal consistency, differences by sex and academic year, external evidence of validity, and norms for scoring the scale. The results reveal a factor structure based on three first-order factors (emotional manifestations, physiological manifestations and behavioural manifestations) and one second-order factor (indicative of stress manifestations). In terms of external validity, there was a positive association with measures of perceived stress, aggressiveness, internalized/externalized symptoms, and a negative association with life satisfaction. The results show that the scale is an adequate tool for evaluating stress manifestations in adolescents.

  4. The Implement of a Multi-layer Frozen Soil Scheme into SSiB3 and its Evaluation over Cold Regions

    Science.gov (United States)

    Li, Q.

    2016-12-01

    The SSiB3 is a biophysics-based model of land-atmosphere interactions and is designed for global and regional studies. It has three soil layers, three snow layers, as well as one vegetation layer. Soil moisture of the three soil layers, interception water store for the canopy, subsurface soil temperature, ground temperature, canopy temperature and snow water equivalent are all predicted based on the water and energy balance at canopy, soil and snow. SSiB3 substantially enhances the model's capability for cold season studies and produces reasonable results compared with observations. However, frozen soil processes are ignored in the SSiB3 and may have effects on the interannual variability of soil temperature and deep soil memory. A multi-layer comprehensive frozen soil scheme (FSM), which is developed for climate study has been implemented into the SSiB3 to describe soil heat transfer and water flow affected by frozen processed in soil. In the coupled SSiB3-FSM, both liquid water and ice content have been taken into account in the frozen soil hydrologic and thermal property parameterization. The maximum soil layer depth could reach 10 meters thick depending on land conditions. To better evaluate the models' performance, the coupled offline SSiB3-FSM and SSiB3 have been driven from 1948 to 1958 by the Princeton global meteorological data set, respectively. For the 10yrs run, the coupled SSiB3-FSM almost captures the features over different regions, especially cold regions. In order to analysis and compare the differences of SSIB3-FSM and SSIB3 in detail, monthly mean surface temperature for different regions are compared with CAMS data. The statistical results of surface skin temperature show that high latitude regions, Africa, Eastern Australia, and North American monsoon regions have been greatly improved in SSIB3-FSM. For the global statistics, the RMSE of the surface temperature simulated by SSiB3-FSM can be improved about 0.6K compared to SSiB3. In this study

  5. Long-term housing subsidies and SSI/SSDI income: Creating health-promoting contexts for families experiencing housing instability with disabilities.

    Science.gov (United States)

    Glendening, Zachary S; McCauley, Erin; Shinn, Marybeth; Brown, Scott R

    2018-04-01

    Though disability and housing instability are discussed separately in public health literature, few studies address families at their intersection. As a result, little is known about families who experience both homelessness and disability, how many receive disability benefits like SSI and SSDI, or the influence of those benefits on health-promoting outcomes like housing stability and self-sufficiency. Moreover, no previous research compares the ability of different housing and service interventions to increase disability benefit access. We examine relationships between disabilities and SSI/SSDI income reported when families enter emergency shelters and later health-promoting outcomes (housing stability and self-sufficiency) and how housing interventions affect SSI/SSDI receipt. Families in the (name removed) Study (N = 1857) were interviewed in emergency shelters, randomly offered of one of three housing interventions or usual care (i.e., no immediate referral to any intervention beyond shelter), and re-interviewed 20 months later. A third of families reported a disability at shelter entry. SSI/SSDI coverage of these families increased nearly 10% points over 20 months but never exceeded 40%. Disabilities predicted greater housing instability, food insecurity, and economic stress and less work and income. Among families reporting disabilities, SSI/SSDI receipt predicted fewer returns to emergency shelter, and more income despite less work. Offers of long-term housing subsidies increased SSI/SSDI receipt. Many families experiencing homelessness have disabilities; those receiving SSI/SSDI benefits have better housing and income outcomes. Providing families experiencing homelessness with long-term housing subsidies and SSI/SSDI could improve public health. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Occupational noise exposure in small scale hand tools manufacturing (forging) industry (SSI) in Northern India.

    Science.gov (United States)

    Singh, Lakhwinder Pal; Bhardwaj, Arvind; Deepak, K K; Bedi, Raman

    2009-08-01

    Occupational noise has been recognized as hazardous for the human beings. A high noise level in forging shops is considered to lower the labour productivity and cause illness however occupational noise is being accepted as an integral part of the job. The present study has been carried out in 5 small scale hand tool forging units (SSI) of different sizes in Northern India in Punjab. Noise levels at various sections were measured. OSHA norms for hearing conservation has been incorporated which includes an exchange rate of 5 dB (A), criterion level at 90 dB (A), criterion time of 8 h, threshold level=80 dB (A), upper limit=140 dB (A) and with F/S response rate. Equivalent sound pressure level (L(eq)) has been measured in various sections of these plants. Noise at various sections like hammer section, cutting presses, punching, grinding and barrelling process was found to be >90 dB (A), which is greater than OSHA norms. A cross-sectional study on the basis of questionnaire has been carried out. The results of which revealed that 68% of the workers are not wearing ear protective equipments out of these 50% were not provided with PPE by the company. About 95% of the workers were suffering speech interference though high noise annoyance was reported by only 20%. It has been established that the maximum noise exposure is being taken by the workers as they are working more than 8h a day for six days per week. More than 90% workers are working 12 to 24 h over time per week which lead to very high noise exposure i.e. 50 to 80% per week higher than exposure time/week in USA or European countries(15, 16)).

  7. International Expert Review of Sr-Can: Safety Assessment Methodology - External review contribution in support of SSI's and SKI's review of SR-Can

    International Nuclear Information System (INIS)

    Sagar, Budhi; Egan, Michael; Roehlig, Klaus-Juergen; Chapman, Neil; Wilmot, Roger

    2008-03-01

    recognising that a long-term safety case needs to provide a broad, integrated view of the various issues that will support the further refinement and development of confidence in post-closure safety performance for the repository (IAEA, 2006; NEA, 2004). Although the focus of the evaluation presented here was on the methodology for safety assessment, it is evident from the review team's terms of reference (not least the reference to SKB's 'strategy for safety demonstration') that SKI's and SSI's interests extend beyond the structure and composition of the assessment itself. By itself, safety assessment is but one thread of the wider strategy for building confidence in implementation of KBS-3 for deep disposal, which also includes ongoing R and D, engineering demonstration, monitoring and inspection, management systems, etc. It is the linkage between such issues and the safety assessment in relation to building an integrated safety case that is perhaps one of the weaker aspects of SR-Can. This underlines the importance of framing the assessment itself, its inputs and outputs, within the wider context of what will be required to support the licence application. In view of the above, and the fact that SKB has acknowledged that some further development work remains to be done, the SAM review team believes that it remains a challenge for SKB to conduct and present a safety case of suitable quality within the currently proposed timescale for delivery of the SR-Can assessment and the 2009 licence application

  8. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64); SSI:s granskning av SKB:s storregionala grundvattenmodellering foer oestra Smaaland (SKB Rapport 06-64)

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjorrn

    2007-09-15

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009.

  9. SKI's and SSI's comments on SKB's RandD/RDandD Programme 1986-2007; SKI:s och SSI:s synpunkter paa SKB:s FoU/Fud-program 1986-2007

    Energy Technology Data Exchange (ETDEWEB)

    Toverud, Oeivind (Bromma Geokonsult (Sweden))

    2010-10-15

    SKB has since 1986 submitted RDandD program every three years to former Nuclear Power Inspectorate (SKI) for review and evaluation. SKI and former Radiation Protection Inst. (SSI) have commented on a large number of issues in connection with the audits. The authorities' goal has been to influence the SKB's design of the RDandD programs, inter alia with a view to future repository applications to fulfill the requirements they are tested against. SKB plans to submit applications for the final repository for spent Fuel first quarter of 2011 and it is therefore important for Radiation Safety Authority (SSM) to follow up on SKB's handling of critical comments on RDandD programs. A starting point for this monitoring is to establish how SKB has dealt with major issues raised by authorities in the audits of the RDandD programs and in consultation process which has been linked to the programs. The follow-up is expected to be an important contribution to the planning and implementation of the examination of applications for nuclear fuel repository

  10. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64)

    International Nuclear Information System (INIS)

    Dverstorp, Bjorrn

    2007-09-01

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009

  11. SSI sensitivity studies and model improvements for the US NRC Seismic Safety Margins Research Program. Rev. 1

    International Nuclear Information System (INIS)

    Johnson, J.J.; Maslenikov, O.R.; Benda, B.J.

    1984-10-01

    The Seismic Safety Margins Research Program (SSMRP) is a US NRC-funded program conducted by Lawrence Livermore National Laboratory. Its goal is to develop a complete fully coupled analysis procedure for estimating the risk of an earthquake-induced radioactive release from a commercial nuclear power plant. In Phase II of the SSMRP, the methodology was applied to the Zion nuclear power plant. Three topics in the SSI analysis of Zion were investigated and reported here - flexible foundation modeling, structure-to-structure interaction, and basemat uplift. The results of these investigations were incorporated in the SSMRP seismic risk analysis. 14 references, 51 figures, 13 tables

  12. Small, simple but useful: the SSI approach to a real-time system for decision making support

    International Nuclear Information System (INIS)

    Baeverstam, U.

    1993-01-01

    In case of a nuclear accident or a threat of a release, the Swedish Radiation Protection Institute (SSI) is responsible for advising and informing the Government, other authorities and the public. The institute's experts are supported by a newly developed, small computerised system. Some components of the system are: a simple model for atmospheric dispersion and dose predictions; databases including maps, nuclides, instruments and facilities to store and handle measured values; on-line connection to nationwide system of automatic measuring stations; a number of data display facilities; and computer based handbooks. Most software for the system is written for the MS Windows environment. (author)

  13. Focusing on SSI's risk and radiation protection criteria. A report based on discussions in focus groups in Oesthammar and Oskarshamn municipalities

    International Nuclear Information System (INIS)

    Drottz-Sjoeberg, Britt-Marie

    2003-11-01

    The project was a result of the authority's continued work on the 1998 regulations on protection of human health and the environment in final disposal of spent nuclear fuel and nuclear waste. The idea behind the project, to involve persons from the municipalities participating in SKB's site selection investigation in focus group discussions, was that the questions and points of views that emerged in the discussions could serve as a basis for the authority's work of producing general guidelines associated with the regulations. The finished report would then be handed over to an expert group at the authority which answered or commented on the issues raised, and made a report on this to the participating municipalities Oskarshamn and Oesthammar. The result of discussions in two focus groups in Oskarshamn municipality and two in Oesthammar municipality in October 2002 is presented here, together with a presentation of the project's purpose and organisation. The results are presented in three main sections. The first concentrates on radiation and radioactivity since the task in the discussion groups was to attempt to clarify the issues and problems observed in this area in order to contribute to the authority's work of developing the general guidelines. The second section, on understanding of concepts, measurement, risk and safety, illustrates that the frequently asked and 'simple' knowledge related questions are only the tip of the iceberg where many of the participants have also thought about the more complex contexts and the fundamental problems in the risk and safety analysis, its validity and use. The third section of the report focuses primarily on content and information aspects. It provides a number of ideas about how information on current problems and important issues can be improved, how knowledge can be deepened in the site selection municipalities and how working methods in the process can be developed. The report mainly consists of a presentation of the

  14. Focusing on SSI's risk and radiation protection criteria. A report based on discussions in focus groups in Oesthammar and Oskarshamn municipalities

    Energy Technology Data Exchange (ETDEWEB)

    Drottz-Sjoeberg, Britt-Marie [BMD Research (Sweden)

    2003-11-01

    The project was a result of the authority's continued work on the 1998 regulations on protection of human health and the environment in final disposal of spent nuclear fuel and nuclear waste. The idea behind the project, to involve persons from the municipalities participating in SKB's site selection investigation in focus group discussions, was that the questions and points of views that emerged in the discussions could serve as a basis for the authority's work of producing general guidelines associated with the regulations. The finished report would then be handed over to an expert group at the authority which answered or commented on the issues raised, and made a report on this to the participating municipalities Oskarshamn and Oesthammar. The result of discussions in two focus groups in Oskarshamn municipality and two in Oesthammar municipality in October 2002 is presented here, together with a presentation of the project's purpose and organisation. The results are presented in three main sections. The first concentrates on radiation and radioactivity since the task in the discussion groups was to attempt to clarify the issues and problems observed in this area in order to contribute to the authority's work of developing the general guidelines. The second section, on understanding of concepts, measurement, risk and safety, illustrates that the frequently asked and 'simple' knowledge related questions are only the tip of the iceberg where many of the participants have also thought about the more complex contexts and the fundamental problems in the risk and safety analysis, its validity and use. The third section of the report focuses primarily on content and information aspects. It provides a number of ideas about how information on current problems and important issues can be improved, how knowledge can be deepened in the site selection municipalities and how working methods in the process can be developed. The report mainly

  15. The SSI and SKI review of the updated Final Safety Report for SFR 1 issued by SKB. Review report; SSI:s och SKI:s granskning av SKB:s uppdaterade Slutlig Saekerhetsrapport foer SFR 1. Granskningsrapport

    Energy Technology Data Exchange (ETDEWEB)

    Avila, Rodolfo; Jensen, Mikael; Larsson, Carl-Magnus; Lund, Ingemar; Loefgren, Tomas; Moberg, Leif; Norden, Maria; Wiebert, Anders [Swedish Radiation Protection Authority, Stockholm (Sweden); Berglund, Thomas; Dverstorp, Bjoern; Hedberg, Bengt; Kautsky, Fritz; Lilja, Christina; Simic, Eva; Stroemberg, Bo; Sundstroem, Benny; Toverud, Oeivind; Wingefors, Stig; Zika, Helmuth [Swedish Nuclear Power Inspectorate, Stockholm (Sweden)

    2003-11-01

    The repository for operational radioactive wastes in Sweden, SFR1, has been the object for a new safety assessment study by SKB (The Swedish Nuclear Fuel and Waste Management Co.). The findings of the review group will form the basis for decisions by the authorities on the provisions for the future operation of the repository.

  16. SKI's and SSI's joint review of SKB's safety assessment report, SR 97. Summary

    International Nuclear Information System (INIS)

    2001-01-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) has a programme for the siting of a repository for spent nuclear fuel in Swedish bedrock. In 1996, the Swedish Government decided that SKB must perform an assessment of the repository's long-term safety before undertaking the next step of the programme which entails drilling in a minimum of two municipalities (site investigations). SKB has presented such a safety assessment in SR 97 Post-closure Safety (henceforth referred to as SR 97). SR 97 is one of the documents in the comprehensive reporting that SKB must provide when it proposes sites for investigation. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) have evaluated SR 97 in terms of its purposes which are to demonstrate a methodology for safety assessment, to show that Swedish bedrock can provide a safe repository using SKB's method, to provide a basis for specifying the factors that are important for site selection and to derive preliminary requirements on the function of the engineered barriers. The authorities have reached the following conclusions: SR 97 does not indicate any conditions that would mean that geological final disposal in accordance with SKB's method would have significant deficiencies in relation to the safety and radiation protection requirements of the authorities. SR 97 contains the elements required for a comprehensive assessment of safety and radiation protection. SKB's safety assessment methodology has improved within several important areas, such as the documentation of processes and properties that can affect repository performance and the development of models for safety assessment calculations. The methodology used in SR 97 has some deficiencies, for example, the specification of future events to be described in the safety assessment. SR 97 has not, to an adequate extent, dealt with unfavourable conditions that can affect the future safety of a repository. SKB states that the

  17. The role of Swedish Radiation Protection Authority in the field of public health; SSI:s roll i folkhaelsoarbetet - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Energy Technology Data Exchange (ETDEWEB)

    Cederlund, Torsten; Finck, Robert; Mjoenes, Lars; Moberg, Leif; Soederman, Ann-Louis; Wiklund, Aasa; Yuen Katarina; Oelander Guer, Hanna

    2004-09-01

    The Swedish Government has requested the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures.

  18. The role of Swedish Radiation Protection Authority in the field of public health 2008; SSI:s roll i folkhaelsoarbetet 2008 - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Energy Technology Data Exchange (ETDEWEB)

    Hyrke, Lena; Almen, Anja; Blixt, Anders; Brewitz, Erica; Mjoenes, Lars; Moberg, Leif; Skeppstroem, Kirlna; Wester, Ulf

    2008-04-15

    The Swedish Government has requested that the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures

  19. First-in-human safety and immunogenicity investigations of three adjuvanted reduced dose inactivated poliovirus vaccines (IPV-Al SSI) compared to full dose IPV Vaccine SSI when given as a booster vaccination to adolescents with a history of IPV vaccination at 3, 5, 12months and 5years of age.

    Science.gov (United States)

    Lindgren, Line M; Tingskov, Pernille N; Justesen, Annette H; Nedergaard, Bettina S; Olsen, Klaus J; Andreasen, Lars V; Kromann, Ingrid; Sørensen, Charlotte; Dietrich, Jes; Thierry-Carstensen, Birgit

    2017-01-23

    There is a demand of affordable IPV in the World. Statens Serum Institut (SSI) has developed three reduced dose IPV formulations adsorbed to aluminium hydroxide; 1/3 IPV-Al, 1/5 IPV-Al and 1/10 IPV-Al SSI, and now report the results of the first investigations in humans. 240 Danish adolescents, aged 10-15years, and childhood vaccinated with IPV were booster vaccinated with 1/3 IPV-Al, 1/5 IPV-Al, 1/10 IPV-Al or IPV Vaccine SSI. The booster effects (GMTRs) of the three IPV-Al SSI were compared to IPV Vaccine SSI, and evaluated for non-inferiority. The pre-vaccination GMTs were similar across the groups; 926 (type 1), 969 (type 2) and 846 (type 3) in the total trial population. The GMTRs by poliovirus type and IPV formulation were: Type 1: 17.0 (1/3 IPV-Al), 13.0 (1/5 IPV-Al), 7.1 (1/10 IPV-Al) and 42.2 (IPV Vaccine SSI). Type 2: 12.5 (1/3 IPV-Al), 13.1 (1/5 IPV-Al), 7.6 (1/10 IPV-Al) and 47.8 (IPV Vaccine SSI). Type 3: 14.5 (1/3 IPV-Al), 16.2 (1/5 IPV-Al), 8.9 (1/10 IPV-Al) and 62.4 (IPV Vaccine SSI) Thus, the three IPV-Al formulations were highly immunogenic, but inferior to IPV Vaccine SSI, in this booster vaccination trial. No SAE and no AE of severe intensity occurred. 59.2% of the subjects reported at least one AE. Injection site pain was the most frequent AE in all groups; from 24.6% to 43.3%. Injection site redness and swelling frequencies were<5% in most and<10% in all groups. The most frequent systemic AEs were fatigue (from 8.2% to 15.0%) and headache (from 15.0% to 28.3%). Most AEs were of mild intensity. In conclusion, the three IPV-Al SSI were safe in adolescents and the booster effects were satisfactory. ClinicalTrials.gov registration number: NCT02280447. Copyright © 2016. Published by Elsevier Ltd.

  20. Perspectives on learning through research on critical issues-based science center exhibitions

    Science.gov (United States)

    Pedretti, Erminia G.

    2004-07-01

    Recently, science centers have created issues-based exhibitions as a way of communicating socioscientific subject matter to the public. Research in the last decade has investigated how critical issues-based installations promote more robust views of science, while creating effective learning environments for teaching and learning about science. The focus of this paper is to explore research conducted over a 10-year period that informs our understanding of the nature of learning through these experiences. Two specific exhibitions - Mine Games and A Question of Truth - provide the context for discussing this research. Findings suggest that critical issues-based installations challenge visitors in different ways - intellectually and emotionally. They provide experiences beyond usual phenomenon-based exhibitions and carry the potential to enhance learning by personalizing subject matter, evoking emotion, stimulating dialogue and debate, and promoting reflexivity. Critical issues-based exhibitions serve as excellent environments in which to explore the nature of learning in these nonschool settings.

  1. Translation, Assessment and Deployment of Stuttering Instruments into Different Languages: Comments Arising from Bakhtiar et al., "Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter" ["J. Fluency Disord." 35 (2010) 87-91

    Science.gov (United States)

    Karimi, Hamid; Nilipour, Reza; Shafiei, Bijan; Howell, Peter

    2011-01-01

    Bakhtiar, Seifpanahi, Ansari, Ghanadzade and Packman (2010) reported high inter-, and intra-judge agreement of a translation of the Stuttering Severity Instrument (SSI-3) for preschool Persian-speaking children who stutter. Translation of SSI-3 into Persian is desirable as there is no standardised stuttering severity test for that language.…

  2. Environmental monitoring at the nuclear power plants and Studsvik 1992-1993. Results from measurements of radionuclide contents of environmental samples, and from random checks by SSI

    International Nuclear Information System (INIS)

    Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.

    1995-09-01

    Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs

  3. The association between Bacillus Calmette-Guérin vaccination (1331 SSI) skin reaction and subsequent scar development in infants

    DEFF Research Database (Denmark)

    Birk, Nina Marie; Nissen, Thomas Nørrelykke; Ladekarl, Monica

    2017-01-01

    BACKGROUND: The Bacillus Calmette-Guérin vaccine (BCG) against tuberculosis is administered intradermally, and vaccination is often followed by a scar at the injection site. Among BCG-vaccinated individuals, having a scar has been associated with lower mortality. We aimed to examine the impact...... of vaccination technique for scarring in a high income setting, by assessing the associations between the post injection reaction, the wheal size, and the probability of developing a scar, and scar size. METHODS: This study was nested within a clinical multicenter study randomizing 4262 infants to either BCG...... vaccination (BCG 1331 SSI) or no intervention. In this substudy, including 492 vaccinated infants, the immediate post BCG vaccination reaction was registered as either wheal (a raised, blanched papule at the injection site), bulge (a palpable element at the injection site), or no reaction. The presence...

  4. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    International Nuclear Information System (INIS)

    2008-03-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  5. SSI's independent consequence calculations in support of the regulatory review of the SR-Can safety assessment

    International Nuclear Information System (INIS)

    Shulan Xu; Dverstorp, Bjoern; Woerman, Anders; Marklund, Lars; Klos, Richard; Shaw, George

    2008-03-01

    With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB investigation

  6. SSI's independent consequence calculations in support of the regulatory review of the SR-Can safety assessment

    Energy Technology Data Exchange (ETDEWEB)

    Shulan Xu; Dverstorp, Bjoern (Swedish Radiation Protection Authority, Stockholm (Sweden)); Woerman, Anders; Marklund, Lars (Royal Institute of Technology (KTH), Stockholm (SE)); Klos, Richard (Aleksandria Sciences, Sheffield (GB)); Shaw, George (Univ. of Nottingham (GB))

    2008-03-15

    With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB

  7. Promoting Scientific Thinking and Conceptual Change about Alternative Explanations of Climate Change and Other Controversial Socio-scientific Topics

    Science.gov (United States)

    Lombardi, D.; Sinatra, G. M.

    2013-12-01

    Critical evaluation and plausibility reappraisal of scientific explanations have been underemphasized in many science classrooms (NRC, 2012). Deep science learning demands that students increase their ability to critically evaluate the quality of scientific knowledge, weigh alternative explanations, and explicitly reappraise their plausibility judgments. Therefore, this lack of instruction about critical evaluation and plausibility reappraisal has, in part, contributed to diminished understanding about complex and controversial topics, such as global climate change. The Model-Evidence Link (MEL) diagram (originally developed by researchers at Rutgers University under an NSF-supported project; Chinn & Buckland, 2012) is an instructional scaffold that promotes students to critically evaluate alternative explanations. We recently developed a climate change MEL and found that the students who used the MEL experienced a significant shift in their plausibility judgments toward the scientifically accepted model of human-induced climate change. Using the MEL for instruction also resulted in conceptual change about the causes of global warming that reflected greater understanding of fundamental scientific principles. Furthermore, students sustained this conceptual change six months after MEL instruction (Lombardi, Sinatra, & Nussbaum, 2013). This presentation will discuss recent educational research that supports use of the MEL to promote critical evaluation, plausibility reappraisal, and conceptual change, and also, how the MEL may be particularly effective for learning about global climate change and other socio-scientific topics. Such instruction to develop these fundamental thinking skills (e.g., critical evaluation and plausibility reappraisal) is demanded by both the Next Generation Science Standards (Achieve, 2013) and the Common Core State Standards for English Language Arts and Mathematics (CCSS Initiative-ELA, 2010; CCSS Initiative-Math, 2010), as well as a

  8. Simulation of boreal Summer Monsoon Rainfall using CFSV2_SSiB model: sensitivity to Land Use Land Cover (LULC)

    Science.gov (United States)

    Chilukoti, N.; Xue, Y.

    2016-12-01

    The land surface play a vital role in determining the surface energy budget, accurate representation of land use and land cover (LULC) is necessary to improve forecast. In this study, we have investigated the influence of surface vegetation maps with different LULC on simulating the boreal summer monsoon rainfall. Using a National Centres for Environmental Prediction (NCEP) Coupled Forecast System version 2(CFSv2) model coupled with Simplified Simple Biosphere (SSiB) model, two experiments were conducted: one with old vegetation map and one with new vegetation map. The significant differences between new and old vegetation map were in semi-arid and arid areas. For example, in old map Tibetan plateau classified as desert, which is not appropriate, while in new map it was classified as grasslands or shrubs with bare soil. Old map classified the Sahara desert as a bare soil and shrubs with bare soil, whereas in new map it was classified as bare ground. In addition to central Asia and the Sahara desert, in new vegetation map, Europe had more cropped area and India's vegetation cover was changed from crops and forests to wooded grassland and small areas of grassland and shrubs. The simulated surface air temperature with new map shows a significant improvement over Asia, South Africa, and northern America by some 1 to 2ºC and 2 to 3ºC over north east China and these are consistent with the reduced rainfall biases over Africa, near Somali coast, north east India, Bangladesh, east China sea, eastern Pacific and northern USA. Over Indian continent and bay of Bengal dry rainfall anomalies that is the only area showing large dry rainfall bias, however, they were unchanged with new map simulation. Overall the CFSv2(coupled with SSiB) model with new vegetation map show a promising result in improving the monsoon forecast by improving the Land -Atmosphere interactions. To compare with the LULC forcing, experiment was conducted using the Global Forecast System (GFS) simulations

  9. ReSSI - Regional strategies for sustainable and inclusive territorial development

    DEFF Research Database (Denmark)

    Ferreira, Carlos; MacNeill, Stewart; Broughton, Kevin

    policy topics in terms of smart growth include, among others, infrastructure projects for delivering free Wi-Fi connectivity in city centres; development of ‘apps’ and interactive technologies which allow citizens and businesses to interact with local and regional government; and producing and collecting...... security through local electricity generation; the development of new economic sectors, including green industries; and greening existing sectors and supply chains assisted by ‘smart procurement’ systems. As for inclusive growth, local and regional authorities mean to take account of issues...... such as demographic change and vulnerability created by aging populations and large-scale migration; development of affordable, sustainable housing, and the provision and distribution of public services to all members of society. All of the afore mentioned has to be achieved in a changing governance context...

  10. SSI 2D/3D soil structure interaction: A program system for the calculation of structure-soil interactions using the boundary element method. Project C1

    International Nuclear Information System (INIS)

    Schmid, G.; Willms, G.; Huh, Y.; Gibhardt, M.

    1988-12-01

    SSI 2D/3D is a computer programm to calculate dynamic stiffness matrices for soil-structure-interaction problems in frequency domain. It is applicable to two- or three-dimensional situations. The present report is a detailed manual for the use of the computer code written in FORTRAN 77. In addition it gives a survey of the possibilities of the Boundary Element Method applied to dynamic problems in infinite domains. (orig.) [de

  11. SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can; SKIs och SSIs gemensamma granskning av SKBs saekerhetsrapport SR-Can

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjoern; Stroemberg, Bo (and others)

    2008-03-15

    This report summarizes SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned license application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be

  12. University Students' Knowledge Structures and Informal Reasoning on the Use of Genetically Modified Foods: Multidimensional Analyses

    Science.gov (United States)

    Wu, Ying-Tien

    2013-10-01

    This study aims to provide insights into the role of learners' knowledge structures about a socio-scientific issue (SSI) in their informal reasoning on the issue. A total of 42 non-science major university students' knowledge structures and informal reasoning were assessed with multidimensional analyses. With both qualitative and quantitative analyses, this study revealed that those students with more extended and better-organized knowledge structures, as well as those who more frequently used higher-order information processing modes, were more oriented towards achieving a higher-level informal reasoning quality. The regression analyses further showed that the "richness" of the students' knowledge structures explained 25 % of the variation in their rebuttal construction, an important indicator of reasoning quality, indicating the significance of the role of students' sophisticated knowledge structure in SSI reasoning. Besides, this study also provides some initial evidence for the significant role of the "core" concept within one's knowledge structure in one's SSI reasoning. The findings in this study suggest that, in SSI-based instruction, science instructors should try to identify students' core concepts within their prior knowledge regarding the SSI, and then they should try to guide students to construct and structure relevant concepts or ideas regarding the SSI based on their core concepts. Thus, students could obtain extended and well-organized knowledge structures, which would then help them achieve better learning transfer in dealing with SSIs.

  13. An Assessment of the SST Simulation Using the Climate Forecast System Coupled to the SSiB Surface Model

    Science.gov (United States)

    Wang, Y.; Xue, Y.; Huang, B.; Lee, J.; De Sales, F.

    2016-12-01

    A long term simulation has been conducted using the Climate Forecast System (CFSv2) coupled to the SSiB-2 land model, which consists of the Global Forecast System atmospheric model (GFS) and the Modular Ocean model - version 4 (MOM4) as the ocean component. This study evaluates the model's performance in simulating sea surface temperature (SST) mean state, trend, and inter-annual and decadal variabilities. The model is able to produce the reasonable spatial distribution of the SST climatology; however, it has prominent large scale biases. In the middle latitude of the Northern Hemisphere, major cold biases is close to the warm side of the large SST gradients, which may be associated with the weaker Kuroshio and Gulf Stream extensions that diffuse the SST gradient. IN addition, warm biases extend along the west coast of the North America continent to the high latitude, which may be related with excessive Ekman down-welling and solar radiation fluxes reaching to the surface due to the lack of cloud there. Warm biases also exist over the tropical cold tough areas in the Pacific and Atlantic. The global SST trend and interannual variations are well captured except for that in the south Hemisphere after year 2000, which is mainly contributed by the bias from the southern Pacific Ocean. Although the model fails to accurately produce ENSO events in proper years, it does reproduce the ENSO frequency well; they are skewed toward more warm events after 1990. The model also shows ability in SST decadal variation, such as the so-called inter-decadal Pacific oscillation (IPO); however, its phases seem to go reversely compared with the observation.

  14. International Expert Review of Sr-Can: Safety Assessment Methodology - External review contribution in support of SSI's and SKI's review of SR-Can

    Energy Technology Data Exchange (ETDEWEB)

    Sagar, Budhi (Center for Nuclear Waste Regulatory Analyses, Southwest Research Inst., San Antonio, TX (US)); Egan, Michael (Quintessa Limited, Henley-on-Thames (GB)); Roehlig, Klaus-Juergen (Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH (DE)); Chapman, Neil (Independent Consultant (XX)); Wilmot, Roger (Galson Sciences Limited, Oakham (GB))

    2008-03-15

    convincing overall safety case. In this context it is worth recognising that a long-term safety case needs to provide a broad, integrated view of the various issues that will support the further refinement and development of confidence in post-closure safety performance for the repository (IAEA, 2006; NEA, 2004). Although the focus of the evaluation presented here was on the methodology for safety assessment, it is evident from the review team's terms of reference (not least the reference to SKB's 'strategy for safety demonstration') that SKI's and SSI's interests extend beyond the structure and composition of the assessment itself. By itself, safety assessment is but one thread of the wider strategy for building confidence in implementation of KBS-3 for deep disposal, which also includes ongoing R and D, engineering demonstration, monitoring and inspection, management systems, etc.

  15. Controversial socio-scientific issues / Controvérsias sociocientíficas: aspectos metodológicos para a aproximação...

    OpenAIRE

    Ralph Levinson; Danilo Seithi Kato

    2016-01-01

    Entrevista com Ralph Levinson coordenada pelo Prof. Dr. Danilo Seithi Kato (UFTM). Ralph Levinson é professor do Instituto de Educação da Universidade de Londres. Ele dirige o mestrado em Educação para Ciências e orienta trabalhos de doutorado. Seus interesses de pesquisa são questões sociocientíficas controversas, ciência e justiça social, educação para ciências e criatividade e pedagogia em ciência. Ele é o autor de “Towards a theoretical framework for teaching controversial socio‐scientifi...

  16. A Perspective on Knowing about Global Warming and a Critical Comment about Schools and Curriculum in Relation to Socio-Scientific Issues

    Science.gov (United States)

    Levinson, Ralph

    2012-01-01

    The focus of this response to Virginie Albe and Marie-Jose Gombert's (2011) article on a research study of students' school science conference on global warming is to develop some thoughts on covert assumptions which underpin any such conference. My comments refer to the politics behind the production of scientific knowledge of climate change and…

  17. Using Social Network Graphs as Visualization Tools to Influence Peer Selection Decision-Making Strategies to Access Information about Complex Socioscientific Issues

    Science.gov (United States)

    Yoon, Susan A.

    2011-01-01

    This study extends previous research that explores how visualization affordances that computational tools provide and social network analyses that account for individual- and group-level dynamic processes can work in conjunction to improve learning outcomes. The study's main hypothesis is that when social network graphs are used in instruction,…

  18. Soil Surface Runoff Scheme for Improving Land-Hydrology and Surface Fluxes in Simple SiB (SSiB)

    Science.gov (United States)

    Sud, Y. C.; Mocko, David M.

    1999-01-01

    Evapotranspiration on land is hard to measure and difficult to simulate. On the scale of a GCM grid, there is large subgrid-scale variability of orography, soil moisture, and vegetation. Our hope is to be able to tune the biophysical constants of vegetation and soil parameters to get the most realistic space-averaged diurnal cycle of evaporation and its climatology. Field experiments such as First ISLSCP Field Experiment (FIFE), Boreal Ecosystem-Atmosphere Study (BOREAS), and LBA help a great deal in improving our evapotranspiration schemes. However, these improvements have to be matched with, and coupled to, consistent improvement in land-hydrology; otherwise, the runoff problems will intrinsically reflect on the soil moisture and evapotranspiration errors. Indeed, a realistic runoff simulation also ensures a reasonable evapotranspiration simulation provided the precipitation forcing is reliable. We have been working on all of the above problems to improve the simulated hydrologic cycle. Through our participation in the evaluation and intercomparison of land-models under the behest of Global Soil Wetness Project (GSWP), we identified a few problems with Simple SiB (SSIB; Xue et al., 1991) hydrology in regions of significant snowmelt. Sud and Mocko (1999) show that inclusion of a separate snowpack model, with its own energy budget and fluxes with the atmosphere aloft and soil beneath, helps to ameliorate some of the deficiencies of delayed snowmelt and excessive spring season runoff. Thus, much more realistic timing of melt water generation was simulated with the new snowpack model in the subsequent GSWP re-evaluations using 2 years of ISLSCP Initiative I forcing data for 1987 and 1988. However, we noted an overcorrection of the low meltwater infiltration of SSiB. While the improvement in snowmelt timing was found everywhere, the snowmelt infiltration has became excessive in some regions, e.g., Lena river basin. This leads to much reduced runoff in many basins as

  19. Family Issues

    Science.gov (United States)

    ... es Autismo? Family Issues Home / Living with Autism / Family Issues Stress Siblings A child’s autism diagnosis affects every member of the family in different ways. Parents/caregivers must now place their ... may put stress on their marriage, other children, work, finances, and ...

  20. Global Issues

    Energy Technology Data Exchange (ETDEWEB)

    Seitz, J.L.

    2001-10-15

    Global Issues is an introduction to the nature and background of some of the central issues - economic, social, political, environmental - of modern times. This new edition of this text has been fully updated throughout and features expanded sections on issues such as global warming, biotechnology, and energy. Fully updated throughout and features expanded sections on issues such as global warming, biotechnology, and energy. An introduction to the nature and background of some of the central issues - economic, social, political, environmental - of modern times. Covers a range of perspectives on a variety of societies, developed and developing. Extensively illustrated with diagrams and photographs, contains guides to further reading, media, and internet resources, and includes suggestions for discussion and studying the material. (author)

  1. Bathyodontus mirus (Andrássy, 1956, first record of a representative of the suborder Bathyodontina (Nematoda, Mononchida in the Iberian fauna

    Directory of Open Access Journals (Sweden)

    Peña-Santiago, R.

    2010-12-01

    Full Text Available Bathyodontus mirus (Andrássy, 1956 Hopper & Cairns, 1956, collected in sand dunes of SW Iberian peninsula, is studied. Description, measurements and illustrations (LM pictures are provided. Iberian specimens are briefly compared to other known populations of the species. And a compendium of Bathyodontus species, including a key to their identification, is also given. This is the first record of a representative of the nematode suborder Bathyodontina in the Iberian-Balearic range and in the Mediterranean region.Se estudia la especie Bathyodontus mirus (Andrássy, 1956 Hopper y Cairns, 1956, recolectada en dunas de arena en el suroeste peninsular. Se presentan una descripción, medidas e ilustraciones (fotografías con microscopía óptica. Los ejemplares ibéricos se comparan brevemente con otras poblaciones conocidas de la misma especie. Y se ofrece un compendio de las especies del género Bathyodontus, incluida una clave para su identification. Se trata de la primera cita de un miembro del suborden Bathyodontina en el ámbito Ibero-balear y en la región Mediterránea.

  2. The impac t of a scientific issue aproac h on the scientific and technological literac y of youth and adults

    Directory of Open Access Journals (Sweden)

    Natalia Katherine García Ramírez

    2015-01-01

    Full Text Available The processes of the scientific and technological literacy (STL developed with communities of youth and adults do not usually emerge beyond the classroom, these are simply compulsory for obtaining a degree. In such a context, this paper presents the results of a research whose purpose was to analyze the impact of the discussion about controversial aspects of a socioscientific issue (SCI on the SLT process of a group of youth and adults who studied a secondary school program by cycles in the town of Chia, Cundinamarca (Colombia. Some SCI-based activities related to the pollution caused by the industrial action in the Rio Frio sub-basin river (Cundinamarca, Colombia were designed and implemented for the analysis. It was found that working with SCI in literacy processes allows the formation of a critical and participatory subject, thus encouraging the learning of science concepts and their relationship with social and technological implications.

  3. Urbanistid ja keskkonnaeksperdid: iga muudatuse eest Reidi tee projektis oleme pidanud võitlema / Helen Sooväli-Sepping, Kristi Grišakov, Mari Jüssi ; intervjueerinud Mari Peegel ; kommenteerinud Taavi Aas

    Index Scriptorium Estoniae

    Sooväli-Sepping, Helen, 1974-

    2016-01-01

    TLÜ keskkonnakorralduse professor ja linnakorralduse õppekava juht Helen Sooväli-Sepping, TTÜ maastikuarhitektuuri õppekava juht ja linnaplaneerija-urbanist Kristi Grišakov ning Stockholmi keskkonnainstituudi Tallinna keskuse liikuvus- ja keskkonnaekspert Mari Jüssi kinnitavad, et Reidi tee projekt ei ole endiselt inimsõbralik

  4. Workforce Issues.

    Science.gov (United States)

    1996

    This document consists of four papers presented during a symposium on work force issues moderated by Jan DeJong at the 1996 conference of the Academy of Human Resource Development (AHRD). "Rethinking the Ties that Bind: An Exploratory Study of Employee Development in Utilities in Canada and the United States" (Michael Aherne, David…

  5. Sanskrit Issue.

    Science.gov (United States)

    Miller, Barbara Stoler, Ed.

    1971-01-01

    This issue of "Mahfil" is devoted to Sanskrit literature and contains a note on Sanskrit pronunciation and selections of Sanskrit literature. It also contains articles analyzing and discussing various aspects of the literature, including "Sanskrit Rhetoric and Poetic,""The Creative Role of the Goddess Vac in the…

  6. Bond Issues.

    Science.gov (United States)

    Pollack, Rachel H.

    2000-01-01

    Notes trends toward increased borrowing by colleges and universities and offers guidelines for institutions that are considering issuing bonds to raise money for capital projects. Discussion covers advantages of using bond financing, how use of bonds impacts on traditional fund raising, other cautions and concerns, and some troubling aspects of…

  7. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    Energy Technology Data Exchange (ETDEWEB)

    2008-03-15

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  8. Adaptive Roles of SSY1 and SIR3 During Cycles of Growth and Starvation in Saccharomyces cerevisiae Populations Enriched for Quiescent or Nonquiescent Cells.

    Science.gov (United States)

    Wloch-Salamon, Dominika M; Tomala, Katarzyna; Aggeli, Dimitra; Dunn, Barbara

    2017-06-07

    Over its evolutionary history, Saccharomyces cerevisiae has evolved to be well-adapted to fluctuating nutrient availability. In the presence of sufficient nutrients, yeast cells continue to proliferate, but upon starvation haploid yeast cells enter stationary phase and differentiate into nonquiescent (NQ) and quiescent (Q) cells. Q cells survive stress better than NQ cells and show greater viability when nutrient-rich conditions are restored. To investigate the genes that may be involved in the differentiation of Q and NQ cells, we serially propagated yeast populations that were enriched for either only Q or only NQ cell types over many repeated growth-starvation cycles. After 30 cycles (equivalent to 300 generations), each enriched population produced a higher proportion of the enriched cell type compared to the starting population, suggestive of adaptive change. We also observed differences in each population's fitness suggesting possible tradeoffs: clones from NQ lines were better adapted to logarithmic growth, while clones from Q lines were better adapted to starvation. Whole-genome sequencing of clones from Q- and NQ-enriched lines revealed mutations in genes involved in the stress response and survival in limiting nutrients ( ECM21 , RSP5 , MSN1 , SIR4 , and IRA2 ) in both Q and NQ lines, but also differences between the two lines: NQ line clones had recurrent independent mutations affecting the Ssy1p-Ptr3p-Ssy5p (SPS) amino acid sensing pathway, while Q line clones had recurrent, independent mutations in SIR3 and FAS1 Our results suggest that both sets of enriched-cell type lines responded to common, as well as distinct, selective pressures. Copyright © 2017 Wloch-Salamon et al.

  9. Theoretical Issues

    Energy Technology Data Exchange (ETDEWEB)

    Marc Vanderhaeghen

    2007-04-01

    The theoretical issues in the interpretation of the precision measurements of the nucleon-to-Delta transition by means of electromagnetic probes are highlighted. The results of these measurements are confronted with the state-of-the-art calculations based on chiral effective-field theories (EFT), lattice QCD, large-Nc relations, perturbative QCD, and QCD-inspired models. The link of the nucleon-to-Delta form factors to generalized parton distributions (GPDs) is also discussed.

  10. Transmission issues

    International Nuclear Information System (INIS)

    Bradford, J.; Wilson, L.; Thon, S.; Millar, N.

    2005-01-01

    This session on transmission issues focused on the role that transmission plays in electricity markets and the importance of getting the market structure right in terms of generation divestiture with buy back contracts, demand side responsive programs, transmission upgrades and long term contracts. The difficulties of distinguishing between market power and scarcity were examined along with some of the complications that ensue if transmission experiences congestion, as exemplified by the August 2003 blackout in eastern North America. The presentations described the best ways to handle transmission issues, and debated whether transmission should be deregulated or follow market forces. Issues of interconnections and reliability of connections were also debated along with the attempt to integrate renewables into the grid. Some presentations identified what new transmission must be built and what must be done to ensure that transmission gets built. The challenges and business opportunities for transmission in Alberta were discussed with reference to plans to invest in new infrastructure, where it is going outside of the province and how it works with other jurisdictions. Manitoba's Conawapa Hydro Project and its 2000 MW tie line to Ontario was also discussed. Some examples of non-optimal use of interconnections in Europe were also discussed in an effort to learn from these mistakes and avoid them in Canada. tabs., figs

  11. Miscellaneous issues

    International Nuclear Information System (INIS)

    2002-01-01

    The New Brunswick Market Design Committee has examined several issues regarding the restructuring of the province's electricity sector. This report presents issues that require guidance for implementation, with particular focus on options available for their resolutions. The issues include: (1) rate principles for stranded offer service (SOS) supply, (2) the ability of contestable customers to return to SOS after having left it, (3) whether loads embedded in distribution systems are eligible to participate in the bilateral contract market, (4) whether generators or suppliers can offer capacity and energy to SOS suppliers in competition with the SOS supplier, and (5) details for the balancing market, including pricing, bidding protocols, settlements and how intermittent power sources can participate in the market. A section on pricing for SOS explains pricing principles, the use of export profits, pricing for SOS capacity, and time of use pricing. The Committee has made recommendations for the electricity system in the province to have an energy imbalance service that can move towards a market in order to develop an efficient and effective service. This report also explains pricing in the balancing market, penalties, and settlements. 7 refs

  12. Sensitive Security Information and Transportation Security: Issues and Congressional Options

    National Research Council Canada - National Science Library

    Sollenberger, Mitchel A

    2004-01-01

    .... TSA's application of the SSI regulations has, however, resulted in some controversies over airport security procedures, employee accountability, passenger screening, and airport secrecy agreements...

  13. Liability Issues

    International Nuclear Information System (INIS)

    O’Donoghue, K.

    2016-01-01

    Nuclear liability conventions try to provide a set of rules to govern third party liability. Not all States are parties to one of the existing liability conventions. There are a number of reasons why individual States may choose not to join one of the existing conventions. These include limits of compensation, jurisdiction issues, complexity, cost and definition of damage among others. This paper looks at the existing conventions and identifies some of the main issues in the existing conventions which prevent some States from signing them. The paper attempts to tease out some of the perceived gaps in the existing conventions and give a brief description of the reasons why non-Contracting Parties have difficulty with the provisions of the conventions. The paper recognizes that there has been work done in this area previously by the International Expert Group on Nuclear Liability (INLEX) and others to try to develop the existing frameworks to enhance global adherence by nuclear and non-nuclear States to an effective nuclear liability regime. (author)

  14. Licensing issues

    International Nuclear Information System (INIS)

    Roberts, J.P.; Desell, L.J.; Birch, M.L.; Berkowitz, L.; Bader, J.F.

    1992-01-01

    To provide guidance for the Department of Energy's (DOE) Civilian Radioactive Waste Management Program, the Nuclear Regulatory Commission (NRC) has issued a draft regulatory guide on the Format and Content for the License Application for the High-Level Waste Repository (FCRG). To facilitate the development of the FCRG, NRC suggested that DOE use the draft guide as the basis for preparing an annotated outline for a license application. DOE is doing so using an iterative process called the Annotated Outline Initiative. DOE;s use of the Initiative will assist in achieving the desired incorporation of actual experience in the FCRG, contribute to the development of shared interpretation and understanding of NRC regulations, and provide other important programmatic benefits described in this paper

  15. Transitional issues

    International Nuclear Information System (INIS)

    1998-01-01

    This discussion paper, the fifth in the series developed at the IPPSO Market Design Conference, addressed the issue of the need to prevent Ontario Hydro from taking unfair advantage of independent producers and other stakeholders through activities and investments in new power generating capacity in the transitional period leading up to deregulation. The need for controls is predicated on the assumption that the short-term actions and investments of Ontario Hydro could seriously compromise the position of independent generators, and that without such controls the level playing field essential to the operation of a competitive market, does not exist. Various actual and potential actions of Ontario Hydro were discussed, all of which point to the need for strict controls over Ontario Hydro exercising its dominant market power in an unfair way. It was recommended that as a minimum, the provincial government should no longer provide guarantees for Ontario Hydro capital projects, and that Ontario Hydro be instructed to defer any investment on new or returning generating capacity until the new market is in place. Limits could also be placed on Ontario Hydro's marketing efforts to enter into contracts during the transition period, and Ontario Hydro and municipal utilities should be required to keep separate accounts of their commercial preparation, and to settle such accounts separate from ratepayer revenue

  16. Key issues

    International Nuclear Information System (INIS)

    Cook, N.G.W.

    1980-01-01

    Successful modeling of the thermo-mechanical and hydrochemical behavior of radioactive waste repositories in hard rock is possible in principle. Because such predictions lie outside the realm of experience, their adequacy depends entirely upon a thorough understanding of three fundamental questions: an understanding of the chemical and physical processess that determine the behavior of rock and all its complexities; accurate and realistic numerical models of the geologic media within which a repository may be built; and sufficient in-situ data covering the entire geologic region affected by, or effecting the behavior of a repository. At present sufficient is known to be able to identify most of those areas which require further attention. These areas extend all the way from a complete understanding of the chemical and physical processes determining the behavior of rock through to the exploration mapping and testing that must be done during the development of any potential repository. Many of the techniques, laboratory equipment, field instrumentation, and numerical methods needed to accomplish this do not exist at present. Therefore it is necessary to accept that a major investment in scientific research is required to generate this information over the next few years. The spectrum of scientific and engineering activities is wide extending from laboratory measurements through the development of numerical models to the measurement of data in-situ, but there is every prospect that sufficient can be done to resolve these key issues. However, to do so requires overt recognition of the many gaps which exist in our knowledge and abilities today, and of the need to bridge these gaps and of the significant costs involved in doing so

  17. Improving snow albedo processes in WRF/SSiB regional climate model to assess impact of dust and black carbon in snow on surface energy balance and hydrology over western U.S.

    OpenAIRE

    Oaida, CM; Xue, Y; Flanner, MG; Skiles, SMK; De Sales, F; Painter, TH

    2015-01-01

    © 2015. American Geophysical Union. All Rights Reserved. Two important factors that control snow albedo are snow grain growth and presence of light-absorbing impurities (aerosols) in snow. However, current regional climate models do not include such processes in a physically based manner in their land surface models. We improve snow albedo calculations in the Simplified Simple Biosphere (SSiB) land surface model coupled with the Weather Research and Forecasting (WRF) regional climate model (R...

  18. Conversion of fracture toughness testing values from small scale three point bending test specimens to small scale yielding state (SSY) by elastic-plastic stress analysis

    International Nuclear Information System (INIS)

    Ikonen, K.

    1993-07-01

    The report describes the work performed for achieving readiness to calculate fracture toughness dependence on dimension effects and loading conditions in fracture test specimens and real structures. In the report two- and three-dimensional computer codes developed and calculational methods applied are described. One of the main goals is to converse fracture toughness from small scale three point bending test specimens to case of a depth crack in plane strain i.e. to small scale yielding state (SSY) by numerical elastic-plastic stress analysis. Thickness effect of a test specimens and effect of a crack depth are separately investigated. Tests of three point bending specimens with and without sidegrooves and curved crack front are numerically simulated and experimental and computed results are compared. J-integral is calculated along crack front and also from force-deflection dependence of the beam. For the analyses the computing system was thoroughly automatized. Measuring capacity of three point bending test specimens was tried to evaluate. (orig.) (7 refs., 54 figs.)

  19. Review of SKB's interim report of SR-Can: SKI's and SSI's evaluation of SKB's up-dated methodology for safety assessment

    International Nuclear Information System (INIS)

    Dverstorp, Bjoern; Moberg, Leif; Wiebert, Anders; Xu Shulan; Stroemberg, Bo; Kautsky, Fritz; Lilja, Christina; Simic, Eva; Sundstroem, Benny; Toverud, Oeivind

    2005-07-01

    This report presents the findings of a review of the Swedish Nuclear Fuel and Waste Management Co.'s (SKB) interim report of the safety assessment SR-Can (SKB TR 04-11), conducted by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). SKB's interim report describes and exemplifies the safety assessment methodology that SKB plans to use in the oncoming licence applications for an encapsulation plant and a final repository for spent nuclear fuel. The authorities' review takes into account the findings of an international peer review of SKB's interim report. The authorities conclude that SKB has improved its safety assessment methodology in several aspects compared to earlier safety reports. Among other things the authorities commend SKB for giving a comprehensive account of relevant regulations and guidance, and for the systematic approach to identification and documentation of features, events and processes that need to be considered in the safety assessment. However, the authorities also conclude that important parts of SKB's method need to be further developed before they are mature enough to be used as a basis for a license application. The authorities' overall assessment is summarised in chapter 8 of this report

  20. SKI and SSI's recommendations to the government concerning long-term responsibility after closure of a repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Paeivioe Jonsson, Josefin

    2008-01-01

    Many activities will cease at the closure of a repository, but not responsibilities. The candidate municipalities in Sweden expressed concern about who will take over after the implementer is released from responsibility for the facility. The government thus commissioned SKI (Swedish Nuclear Power Inspectorate) and SSI (Swedish Radiation Protection Authority) to review the legal obligations of institutional players as laid out today in legislation in Sweden. After closure of the repository in about 100 years there will be post-closure monitoring, possibly for a few hundred years. This will be a part of the conditions on SKB (Swedish Nuclear Fuel and Waste Management Company) which will be set out at the time. Some activities will end at the closure of the facility but monitoring and safeguards obligations may continue. The exact nature of this monitoring and safeguard work needs to be discussed and agreed upon. With the proposed approach most of the liabilities rest with the state in the long term, the waste producers only have liabilities in the short term but their decisions could have big impacts on long term liabilities

  1. Issues of power and control in STEM education: a reading through the postmodern condition

    Science.gov (United States)

    Zouda, Majd

    2018-02-01

    STEM, or the integration of science, technology, engineering and mathematics, has rapidly become a dominant discourse in political, economic and educational spheres. In the U.S., the STEM movement has been boosted by global economic-based competition and associated fears, in terms of STEM graduates, when compared with other nations. However, many critiques question the nature and goals of this competition, as well as, the possibilities to improve STEM talents through the current dominant conceptualizations and practices of STEM education. In addition, the apparent lack of significant and coherent embracement of (and sometimes silence about) socioscientific and socio-political issues and perspectives renders STEM education incapable of preparing learners for active citizenships. Building on these critiques, I argue that these problems are possible consequences of STEM as a construct of power. My arguments are based on Lyotard's conceptions of knowledge in postmodern society (as reported in The postmodern condition: A report on knowledge, University Press, Manchester, 1984), which I use to analyze some aspects of the STEM educational movement. Throughout the paper, I explore the construction of STEM education within competitive frames that place prime value on high performativity. There seem to be two characteristics of current STEM education that support performativity; these are an increased focus on technological and engineering designs, and a tendency for interdisciplinary education. At the same time, the eagerness for performativity and competition seems to drag STEM education into selectiveness, thereby jeopardizing its possible benefits. Recommendations are also discussed.

  2. Addressing issues raised by stakeholders: experiences of eight organisations

    International Nuclear Information System (INIS)

    Vari, Anna

    2004-01-01

    Demand for stakeholder involvement has become imperative in the field of radioactive waste management. Providing for fair and competent stakeholder involvement, however, raises several questions of practice, for example: How to address issues raised by stakeholders? How to take stakeholders' views into consideration if they are divergent or conflicting? This paper reviews eight case studies prepared for the Topical Session on Addressing Issues Raised by Stakeholders, aimed at analysing the impacts of stakeholder involvement on decisions in RWM organisations. The studies outline the experiences of the following organisations: Canadian Nuclear Safety Commission (CNSC); Canadian Nuclear Waste Management Organization (NWMO); Nuclear Waste Management Organisation of Japan (NUMO); Posiva, Finland; Radioactive Waste Repository Authority, Czech Republic (RAWRA); Swedish Radiation Protection Authority (SSI); United Kingdom Environment Agency; United States Environmental Protection Agency (EPA). Case study reports are included in the Annex of this volume. The paper outlines the main trends and lessons learned from the above case studies. The first section focuses on impacts of stakeholder involvement on specific RWM decisions regarding policy and process. Examples presented in the second section illustrate how stakeholders' concerns may influence general decision-making practices and organisational behaviour. In the third section various approaches to handling divergent stakeholder views are introduced. The paper concludes with recommendations extracted and derived from the eight reports. (author)

  3. Research Article Special Issue

    African Journals Online (AJOL)

    2016-05-15

    May 15, 2016 ... Near-fault earthquake issue is almost a new issue in earthquake engineering. ... although those countries had advanced regulations for seismic design of ... allocating the plastic joints according to development guideline and ...

  4. Future accelerators: physics issues

    International Nuclear Information System (INIS)

    Bjorken, J.D.

    1977-11-01

    High energy physics of the future using future accelerators is discussed. The proposed machines and instruments, physics issues and opportunities including brief sketches of outstanding recent results, and the way the proposed machines address these issues are considered. 42 references

  5. Medical Issues: Orthopedics

    Science.gov (United States)

    ... Information Packets Equipment Pool Living With SMA Medical Issues Palliative Breathing Orthopedics Nutrition Equipment Daily Life At ... curesma.org > support & care > living with sma > medical issues > orthopedics Orthopedics In SMA, muscle weakness can cause ...

  6. Medical Issues: Equipment

    Science.gov (United States)

    ... Information Packets Equipment Pool Living With SMA Medical Issues Palliative Breathing Orthopedics Nutrition Equipment Daily Life At ... curesma.org > support & care > living with sma > medical issues > equipment Equipment Individuals with SMA often require a ...

  7. Health Issues and Treatments

    Science.gov (United States)

    ... About Us Information For… Media Policy Makers Health Issues & Treatments Language: English (US) Español (Spanish) Recommend on ... people with spina bifida are exactly alike. Health issues and treatments for people with spina bifida will ...

  8. Medical Issues: Breathing

    Science.gov (United States)

    ... Information Packets Equipment Pool Living With SMA Medical Issues Palliative Breathing Orthopedics Nutrition Equipment Daily Life At ... curesma.org > support & care > living with sma > medical issues > breathing Breathing Breathing problems are the most common ...

  9. Space Station Engineering Design Issues

    Science.gov (United States)

    Mcruer, Duane T.; Boehm, Barry W.; Debra, Daniel B.; Green, C. Cordell; Henry, Richard C.; Maycock, Paul D.; Mcelroy, John H.; Pierce, Chester M.; Stafford, Thomas P.; Young, Laurence R.

    1989-01-01

    Space Station Freedom topics addressed include: general design issues; issues related to utilization and operations; issues related to systems requirements and design; and management issues relevant to design.

  10. Seven Issues, Revisited

    OpenAIRE

    Whitehead, Jim; De Bra, Paul; Grønbæk, Kaj; Larsen, Deena; Legget, John; schraefel, monica m.c.

    2002-01-01

    It has been 15 years since the original presentation by Frank Halasz at Hypertext'87 on seven issues for the next generation of hypertext systems. These issues are: Search and Query Composites Virtual Structures Computation in/over hypertext network Versioning Collaborative Work Extensibility and Tailorability Since that time, these issues have formed the nucleus of multiple research agendas within the Hypertext community. Befitting this direction-setting role, the issues have been revisited ...

  11. Environmental monitoring at the nuclear power plants and Studsvik 1992-1993. Results from measurements of radionuclide contents of environmental samples, and from random checks by SSI; Omgivningskontroll vid kaernkraftverken och Studsvik 1992-1993. Resultat fraan maetning av radionuklidhalter i miljoeprover, samt SSIs stickprovsmaetningar

    Energy Technology Data Exchange (ETDEWEB)

    Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.

    1995-09-01

    Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs.

  12. Uranium and nuclear issues

    International Nuclear Information System (INIS)

    1983-01-01

    This seminar focussed on the major issues affecting the future of the entire nuclear fuel cycle. In particular it covered issues bearing on the formation of public policy in relation to the use of uranium as an energy source: economic risk, industrial risks, health effects, site selection, environmental issues, and public acceptance

  13. Issues in Data Labelling

    NARCIS (Netherlands)

    Cowie, Roddy; Cox, Cate; Martin, Jeam-Claude; Batliner, Anton; Heylen, Dirk K.J.; Karpouzis, Kostas; Cowie, Roddy; Pelachaud, Catherine; Petta, Paolo

    2011-01-01

    Labelling emotion databases is not a purely technical matter. It is bound up with theoretical issues. Different issues affect labelling of emotional content, labelling of the signs that convey emotion, and labelling of the relevant context. Linked to these are representational issues, involving time

  14. Pinatubo Emulation in Multiple Models (POEMs): co-ordinated experiments in the ISA-MIP model intercomparison activity component of the SPARC Stratospheric Sulphur and it's Role in Climate initiative (SSiRC)

    Science.gov (United States)

    Lee, Lindsay; Mann, Graham; Carslaw, Ken; Toohey, Matthew; Aquila, Valentina

    2016-04-01

    The World Climate Research Program's SPARC initiative has a new international activity "Stratospheric Sulphur and its Role in Climate" (SSiRC) to better understand changes in stratospheric aerosol and precursor gaseous sulphur species. One component of SSiRC involves an intercomparison "ISA-MIP" of composition-climate models that simulate the stratospheric aerosol layer interactively. Within PoEMS each modelling group will run a "perturbed physics ensemble" (PPE) of interactive stratospheric aerosol (ISA) simulations of the Pinatubo eruption, varying several uncertain parameters associated with the eruption's SO2 emissions and model processes. A powerful new technique to quantify and attribute sources of uncertainty in complex global models is described by Lee et al. (2011, ACP). The analysis uses Gaussian emulation to derive a probability density function (pdf) of predicted quantities, essentially interpolating the PPE results in multi-dimensional parameter space. Once trained on the ensemble, a Monte Carlo simulation with the fast Gaussian emulator enabling a full variance-based sensitivity analysis. The approach has already been used effectively by Carslaw et al., (2013, Nature) to quantify the uncertainty in the cloud albedo effect forcing from a 3D global aerosol-microphysics model allowing to compare the sensitivy of different predicted quantities to uncertainties in natural and anthropogenic emissions types, and structural parameters in the models. Within ISA-MIP, each group will carry out a PPE of runs, with the subsequent analysis with the emulator assessing the uncertainty in the volcanic forcings predicted by each model. In this poster presentation we will give an outline of the "PoEMS" analysis, describing the uncertain parameters to be varied and the relevance to further understanding differences identified in previous international stratospheric aerosol assessments.

  15. Integration of generic issues

    International Nuclear Information System (INIS)

    Thatcher, D.

    1989-01-01

    The NRC has recognized the need to integrate generic issues (GIs). The GI process includes a number of phases, all of which should recognize the potential for overlap and conflict among related issues. In addition to the issues themselves, other related NRC and industry programs and activities need to be factored into the GI process. Integration has taken place, or is taking place, for a number of GIs. Each case of integration involves a specific set of circumstances and, as a result, the way in which integration proceeds can vary. This paper discusses the integration of issues in the generic issue process and provides a number of examples

  16. Current issues and actions

    Energy Technology Data Exchange (ETDEWEB)

    Black, D.G.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the progress that has been made toward achieving full regulatory compliance at the Hanford Site. Ongoing compliance self-assessments, implementation of the Tri-Party Agreement, and public meetings continue to identify environmental compliance issues. These issues are discussed openly with the regulatory agencies and with the public to ensure that all environmental compliance issues are addressed.

  17. Current issues and actions

    International Nuclear Information System (INIS)

    Black, D.G.

    1995-01-01

    This section of the 1994 Hanford Site Environmental Report summarizes the progress that has been made toward achieving full regulatory compliance at the Hanford Site. Ongoing compliance self-assessments, implementation of the Tri-Party Agreement, and public meetings continue to identify environmental compliance issues. These issues are discussed openly with the regulatory agencies and with the public to ensure that all environmental compliance issues are addressed

  18. Aviation Safety Issues Database

    Science.gov (United States)

    Morello, Samuel A.; Ricks, Wendell R.

    2009-01-01

    The aviation safety issues database was instrumental in the refinement and substantiation of the National Aviation Safety Strategic Plan (NASSP). The issues database is a comprehensive set of issues from an extremely broad base of aviation functions, personnel, and vehicle categories, both nationally and internationally. Several aviation safety stakeholders such as the Commercial Aviation Safety Team (CAST) have already used the database. This broader interest was the genesis to making the database publically accessible and writing this report.

  19. Environmental issues and wastes

    International Nuclear Information System (INIS)

    Mitamura, Hisayoshi; Banba, Tsunetaka; Maeda, Toshikatsu; Ishiyama, Takashi

    1999-08-01

    All countries in the world are concerned about environmental issues because of their global effects. Developed industrial nations are also confronted with waste issues accompanied by mass production, mass consumption, and mass dump. We have reviewed books and reports to obtain a preliminary knowledge and to understand the trend of technology development before we start R and D for 'environmental monitoring, and environmental remediation and protection'. We lay great emphasis on municipal and industrial wastes in environmental issues and summarize the history of the earth, innovative environmental approaches in advanced nations, waste issues in Japan, and examples of technology development for environmental remediation and protection. (author)

  20. Navigating "Thorny" Issues

    Science.gov (United States)

    Hutchinson, Kashema; Gilbert, Aderinsola; Malyukova, Anna

    2016-01-01

    In their article "Mindfulness and discussing 'thorny' issues in the classroom" Konstantinos Alexakos et al. ("Cult Stud Sci Educ," 2016. doi: 10.1007/s11422-015-9718-0) describe "thorny" issues as "difficult topics to discuss because they are more personal to some perhaps even cause pain and violence." As…

  1. Poverty + Hunger = Global Issues.

    Science.gov (United States)

    Schwartz, Richard H.

    1983-01-01

    Geography teachers can use mathematics to teach fourth, fifth, and sixth grade students about critical global issues. Five sample problems concerning population, poverty, waste, the arms race, and hunger are presented. The global issue related to each problem is discussed, and the solution and mathematical skill are provided. (RM)

  2. Nuclear safety - Topical issues

    International Nuclear Information System (INIS)

    1995-01-01

    The following topical issues related to nuclear safety are discussed: steam generators; maintenance strategies; control rod drive nozzle cracks; core shrouds cracks; sump strainer blockage; fire protection; computer software important for safety; safety during shutdown; operational safety experience; external hazards and other site related issues. 5 figs, 5 tabs

  3. 19 (Special Issue)

    African Journals Online (AJOL)

    mwakagugu

    19 (Special Issue). Tanzania Dental Journal 2017. 1. PRESIDENTS SPEECH AT THE OPENING CEREMONY OF THE TANZANIA DENTAL. ASSOCIATION 31ST SCIENTIFIC CONFERENCE AND .... awareness on oral health issues, high tooth decay, gum diseases and predominant tooth extraction as consistently reported ...

  4. Addressing issues raised by stakeholders: impacts on process, content, and behaviour in waste organisations: the Swedish radiation protection authority's view

    International Nuclear Information System (INIS)

    Hedberg, Bjoern

    2004-01-01

    In Sweden, there is a strong involvement for contributing to and for developing the work in the process aimed at building the Swedish repository sites of spent nuclear fuel and nuclear wastes. The discussions in the focus groups showed that: - the participants had substantial comments on the content and the shaping of the guidelines which will be of use to SSI (one of the Swedish authorities) in the current work; - involved participants' needs for knowledge, as well as their comments, reach far beyond the outline of the guidelines. One can find questions on basic concepts and technical details of measurements as well as on issues of legal, health related, organisational and social aspects and consequences, ranging from today and far into the distant future. This will be of use for building an information database that can place radiation protection criteria concerning final disposal into a broader context. SSI plans to put forward a draft of the guidelines to be discussed further in the municipalities, followed by discussions with other actors. The guidelines are planned to be ready at the end of 2004

  5. Volume 8 Issue 2

    Directory of Open Access Journals (Sweden)

    Karen Nelson

    2017-06-01

    Full Text Available This issue is our third Students, Transitions, Achievement, Retention and Success (STARS Conference special issue held in July this year in Adelaide, Australia.   As is customary, this issue of the journal publishes the top research papers selected via a peer review process and the top Emerging Initiatives selected by the Conference Committee.    We are delighted to feature in this special  issue —Reflections on Student Persistence—prepared by Advisory Board member Professor Vincent Tinto, Distinguished University Professor Emeritus at Syracuse University, USA.  Vincent is a long-time friend and supporter of STARS and its predecessor FYHE Conferences and Journal.   In his article, Vincent explores the case for motivation to be considered as a significant aspect of the tertiary student psyche by drawing on theoretical frameworks, research and practical experiences related to the issue.

  6. Special Issue to publish

    OpenAIRE

    Kllogjeri, Pellumb

    2015-01-01

    SciencePG has offered an email poster to help collect papers for our Special Issue and I have uploaded it for you. Please visit http://www.sciencepublishinggroup.com/specialissue/149002  to see our Special Issue announcement. Now, you can do the followings to personally contribute and promote our Special Issue:1. Submit your paper related to the topics of interest 2. Upload it to your personal websites.3. Upload it to the public websites of some universities and academic institutions...

  7. Understanding Pregnancy and Birth Issues

    Science.gov (United States)

    ... Navigation Bar Home Current Issue Past Issues Understanding Pregnancy and Birth Issues Past Issues / Winter 2008 Table ... turn Javascript on. What is a High-Risk Pregnancy? All pregnancies involve a certain degree of risk ...

  8. Special issue: Plasma Conversion

    NARCIS (Netherlands)

    Nozaki, T.; Bogaerts, A.; Tu, X.; van de Sanden, M. C. M.

    2017-01-01

    With growing concern of energy and environmental issues, the combination of plasma and heterogeneous catalysts receives special attention in greenhouse gas conversion, nitrogen fixation and hydrocarbon chemistry. Plasma gas conversion driven by renewable electricity is particularly important for the

  9. Medical Issues: Nutrition

    Science.gov (United States)

    ... support & care > living with sma > medical issues > nutrition Nutrition Good nutrition is essential to health and growth. ... must make decisions based on their own needs. Nutrition Considerations Since we are still waiting for clinical ...

  10. Strategic Issues for Training.

    Science.gov (United States)

    Pollitt, David, Ed.

    1999-01-01

    Contains precis of 18 articles on strategic management issues, including management development, on-the-job training, corporate scholarship, educational technology, coaching, investing in intellectual capital, and knowledge management. (SK)

  11. Pregnancy and Reproductive Issues

    Science.gov (United States)

    ... Health Pregnancy Share this page Facebook Twitter Email Pregnancy and Reproductive Issues Tahirah Diagnosed in 2003 Pregnancy ... in control groups without the disease. Effects of pregnancy on MS Before 1950, most women with MS ...

  12. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-05-16

    May 16, 2018 ... This paper discusses the issues and challenges faced during .... provision of this AELF's office is costly and need permission from the university's management. .... This is to deduct weeks for the assignment and tests because ...

  13. Research Article Special Issue

    African Journals Online (AJOL)

    2017-02-15

    Feb 15, 2017 ... One of the important issues in the field of human education is the method of ... Encouragement and punishment method in Islamic management has been ... Concept of education refers to the cultivating human talent, this.

  14. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-22

    Mar 22, 2018 ... rameter of computation time and convergence rate. The two scheme have shown ... matrix and its inversion repeatedly for every iteration. This issue causes long ..... Some New Findings on Gauss-Seidel. Technique for Load ...

  15. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-02-01

    Feb 1, 2018 ... The main goal of this article is to analyze methodological issues in .... methodology and theory and historiology (theory of historic process) whose goal is to .... internal branches of sociology and interdisciplinary links of ...

  16. Respiratory Issues in OI

    Science.gov (United States)

    Respiratory Issues in Osteogenesis Imperfecta \\ Introduction The respiratory system’s job is to bring oxygen into the body and remove carbon dioxide, the waste product of breathing. Because oxygen is the fuel ...

  17. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-04-16

    Apr 16, 2018 ... The dimensions to business process strategy factors are .... Investigation pains directed at further exploring these issues are very ... relationship management, material flow management, corporate culture in SMEs' Customer.

  18. Common Mental Health Issues

    Science.gov (United States)

    Stock, Susan R.; Levine, Heidi

    2016-01-01

    This chapter provides an overview of common student mental health issues and approaches for student affairs practitioners who are working with students with mental illness, and ways to support the overall mental health of students on campus.

  19. Fusion Canada issue 11

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1990-06-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on operation at Tokamak de Varennes, CRITIC irradiations at AECL, Tritium systems at TFTR, physics contribution at ITER. 4 figs.

  20. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-11-10

    Nov 10, 2017 ... 1Faculty of Sports Science and Coaching, Universiti Pendidikan ... face obesity issues because of several factors such as changes in diet intake, lifestyle, physical ...... and its implications for policy and intervention strategies.

  1. Fusion Canada issue 23

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-01-01

    A short bulletin from the National Fusion Program highlighting in this issue TdeV tokamak updates, fusion research in Korea, CCFM program review, TdeV divertor plasma, and CFFTP program review. 4 figs.

  2. Sleep Issues and Sundowning

    Science.gov (United States)

    ... Caregiving Middle-Stage Caregiving Late-Stage Caregiving Behaviors Aggression & Anger Anxiety & Agitation Depression Hallucinations Memory Loss & Confusion Repetition Sleep Issues & Sundowning Suspicion & Delusions Wandering Abuse Start Here What You Need to Know Online ...

  3. Fusion Canada issue 27

    International Nuclear Information System (INIS)

    1995-03-01

    A short bulletin from the National Fusion Program highlighting in this issue ITER reactor siting, a major upgrade for TdeV tokamak, Ceramic Breeders: new tritium mapping technique and Joint Fusion Symposium. 2 figs

  4. Research Article Special Issue

    African Journals Online (AJOL)

    2017-02-15

    Feb 15, 2017 ... Research Article. Special Issue ... In myriad studies implemented, the quality of life has been defined in different ways among which the .... service and trading users in living area. ... market, bakery, barber shop, restaurant, etc.

  5. Environmental Compliance Issue Coordination

    Science.gov (United States)

    An order to establish the Department of Energy (DOE) requirements for coordination of significant environmental compliance issues to ensure timely development and consistent application of Departmental environmental policy and guidance

  6. Fusion Canada issue 20

    International Nuclear Information System (INIS)

    1993-03-01

    Fusion Canada's publication of the National Fusion Program. Included in this issue is the CFFTP Industrial Impact Study, CCFM/TdeV Update:helium pumping, research funds, and deuterium in beryllium - high temperature behaviour. 3 figs

  7. Issues in Electronic Publishing.

    Science.gov (United States)

    Meadow, Charles T.

    1997-01-01

    Discusses issues related to electronic publishing. Topics include writing; reading; production, distribution, and commerce; copyright and ownership of intellectual property; archival storage; technical obsolescence; control of content; equality of access; and cultural changes. (Author/LRW)

  8. Research Article Special Issue

    African Journals Online (AJOL)

    2016-05-15

    May 15, 2016 ... Assistant professor, Khorasgan Branch, Islamic Azad University, Isfahan, Iran ... Discussing the issue of knowledge leads inevitably to the problem of beliefs because .... the level of definition from truth at the level of examples.

  9. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-22

    Mar 22, 2018 ... Voltage decay is an important issue in the power system community. ... of voltage profile, the total real power loss in the system is also determined to ..... Kumar A. Optimal placement of DG in radial distribution systems based.

  10. Male Fertility Issues

    Science.gov (United States)

    Fertility issues are common in boys and men getting cancer treatment. Fertility preservation options include sperm banking, testicular shielding, testicular sperm extraction (TESE), and testicular tissue freezing. Support and clinical trials are listed.

  11. Fusion Canada issue 23

    International Nuclear Information System (INIS)

    1994-01-01

    A short bulletin from the National Fusion Program highlighting in this issue TdeV tokamak updates, fusion research in Korea, CCFM program review, TdeV divertor plasma, and CFFTP program review. 4 figs

  12. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-02-24

    Feb 24, 2018 ... ABSTRACT. Electronic Records and Information Management (e-RIM) framework is paramount for ..... RIM issues and problems that led to information crisis. On the other .... Malaysia: A case study in one government agency”.

  13. Research Article Special Issue

    African Journals Online (AJOL)

    2016-07-16

    Jul 16, 2016 ... investigated and analyzed from various library and documentary ... It is therefore evident that applied research on issues related to ...... [29] Cutter-SL., Burton-CG., Emrich-CT., Disaster resilience indicators for benchmarking.

  14. Fusion Canada issue 10

    International Nuclear Information System (INIS)

    1990-02-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on Fusion Materials Research, ITER physics research, fusion performance record at JET, and design options for reactor building. 4 figs

  15. Fusion Canada issue 6

    International Nuclear Information System (INIS)

    1989-02-01

    A short bulletin from the National Fusion Program. Included in this issue is a funding report for CFFTP, a technical update for Tokamak de Varennes and a network for university research by the National Fusion Program. 4 figs

  16. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-04-18

    Apr 18, 2018 ... selectivity of possible lead compounds prior to clinical trials and ... These computational algorithms had resolved previous issues and .... In similarity with the spatial space degree of the universe, these descriptors are running ...

  17. Current Issues in Tourism

    OpenAIRE

    Xu, Shi; Martinez, Larry R.; Hubert, Van Hoof; Tews, Michael; Torres, Leonardo; Farfán, Karina

    2015-01-01

    Ram (2015 Ram, Y. (2015). Hostility or hospitality? A review on violence, bullying and sexual harassment in the tourism and hospitality industry. Current Issues in Tourism. doi:10.1080/13683500.2015.1064364 [Taylor & Francis Online], [Google Scholar] . Hostility or hospitality? A review on violence, bullying and sexual harassment in the tourism and hospitality industry. Current Issues in Tourism. doi:10.1080/13683500.2015.1064364) posits that violence and harassment are areas of concern...

  18. Review of SKB's interim report of SR-Can: SKI's and SSI's evaluation of SKB's up-dated methodology for safety assessment

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjoern; Moberg, Leif; Wiebert, Anders; Xu Shulan [Swedish Radiation Protection Authority, Stockholm (Sweden); Stroemberg, Bo; Kautsky, Fritz; Lilja, Christina; Simic, Eva; Sundstroem, Benny; Toverud, Oeivind [Swedish Nuclear Power Inspectorate, Stockholm (Sweden)

    2005-07-01

    This report presents the findings of a review of the Swedish Nuclear Fuel and Waste Management Co.'s (SKB) interim report of the safety assessment SR-Can (SKB TR 04-11), conducted by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). SKB's interim report describes and exemplifies the safety assessment methodology that SKB plans to use in the oncoming licence applications for an encapsulation plant and a final repository for spent nuclear fuel. The authorities' review takes into account the findings of an international peer review of SKB's interim report. The authorities conclude that SKB has improved its safety assessment methodology in several aspects compared to earlier safety reports. Among other things the authorities commend SKB for giving a comprehensive account of relevant regulations and guidance, and for the systematic approach to identification and documentation of features, events and processes that need to be considered in the safety assessment. However, the authorities also conclude that important parts of SKB's method need to be further developed before they are mature enough to be used as a basis for a license application. The authorities' overall assessment is summarised in chapter 8 of this report.

  19. Definition of containment issues

    International Nuclear Information System (INIS)

    Walker, D.H.

    1982-01-01

    Public Law 96-567 Nuclear Safety Research, Development and Demonstration Act of 1980, directed the US Department of Energy (DOE) to provide an accelerated and coordinated program for developing practical generic improvements that would enhance the capability for safe, reliable and economical operation of Light Water Nuclear Reactor Power Stations. The DOE approach to defining such a program will consist of two phases, (1) definition of program requirements and (2) implementation of the program plan. This paper summarizes the results of the program definition phase for the containment integrity function. The definition phase effort was carried out by two groups of knowledgeable technical experts from the nuclear industry, one of which addressed containment integrity. Tabulated in the paper are the issues identified by the working groups and their associated priorities. Also tabulated are those high priority issues for which ongoing programs do not appear to provide sufficient information to resolve the issue. The results of this review show that existing programs to a great extent address existing issues in a manner such that the issues should be resolved by the programs

  20. International Expert Review of SRCan: Site Investigation Aspects. External review contribution in support of SKI's and SSI's review of SR-Can. INSITE/OVERSITE

    International Nuclear Information System (INIS)

    2008-03-01

    As a first evaluation of long-term safety for KBS-3 repositories at Forsmark and Laxemar, the SIG (Site Investigation Group) found SR-Can to be a well-produced and generally well-argued safety assessment. Overall, SKB is to be complimented on this project. Members of of the two groups INSITE and OVERSITE within the SIG had somewhat differing views on how well SKB had made use of the site data available at the end of the SDM 1.2 stage of investigations. This difference is less to do with the extent of site characterisation than of its use and application, reflecting the different levels of maturity of SKB's geosphere and biosphere assessment programmes. The more recent and current work on the sites means that our concerns expressed in this review should, to a large extent, be addressable in or prior to SR-Site, provided SKB is so minded. However, we acknowledge that some of the issues we raise will not be fully resolved until underground rock characterisation from excavations or longer records of surface conditions are available. There are also some key aspects of SKB's methodology still under development that would benefit from review prior to their use in SR-Site. More space in the currently pressing schedule would allow for this review and a consequent increase in confidence. In any case, the authorities should be aware that SKB may face residual programmatic risks, associated principally with the underground design and layout (and their knockon effects into performance), even after SR-Site. An early understanding of some of these relationships would be helped by a plan (at least on an outline level) of the underground characterisation programme. We also note that many engineering matters are still to be confronted, not least the EBS design and its implementation, along with the treatment of high stresses, if Forsmark is selected. However, our views on the nature of the SR-Can analysis and the way in which site data have been utilised in it (our principal remit

  1. The railroad perspective: Issues behind the issues

    International Nuclear Information System (INIS)

    Furber, C.P.; Brobst, W.A.

    1986-01-01

    Rail transportation is a vital segment of DOE's spent fuel program. Most of the shipments from reactors to a repository or to a Monitored Retrievable Storage facility will be by rail, and essentially all of the shipments from an MRS to a repository. Casks must move economically and efficiently, while at the same time providing adequate safety to the public and transport workers, and meeting the legal/institutional constraints. Shippers are faced with the problem of procuring transportation services in a safe manner at a reasonable cost, trying to balance freight charges against cask inventory costs. Carriers are cautious about accepting potentially high hazard materials in routine service, and are worried about uninsured losses in case of accidents. Both shippers and carriers operate under different scheduling and operational criteria. Technical and institutional constraints add to the complexity of the operation. Standardization of shipping casks and rail car design will ease the resolution of the complex problems now existent. This paper discusses the economic, safety, operational, and legal issues surrounding rail transportation

  2. Regulatory and legal issues

    International Nuclear Information System (INIS)

    Raisler, K.M.; Gregory, A.M.

    1999-01-01

    This chapter focuses on the legal issues relating to the derivatives market in the USA, and analyses the Commodity Futures Trading Commission's (CFTCs) information on swaps and hybrid instruments. The law and regulation in the USA is examined and the jurisdictional reach of the Securities and Exchange Commission (SEC), CFTC, and the Commodity Exchange Act (CEA) is described. The forward contract exclusion and the case of Transnor (Bermuda) Ltd. versus BP North America Petroleum, state laws, swap policy statement issues by the CFTC, the Futures Trading Practices Act of 1992, swaps exemptions, the exemption of hybrid instruments from the CEA, and energy contract exemption are discussed. Enforceability, derivatives, and issues before regulators are considered

  3. Year 2000 commercial issues

    Energy Technology Data Exchange (ETDEWEB)

    Kratz, M.P.J.; Booth, R.T. [Bennett Jones, Calgary, AB (Canada)

    1998-12-31

    This presentation focused on commercial aspects of the Y2K including: (1) special communication issues, (2) outsourcing transactions, (3) joint ventures and the significance for the oil and gas industry, and (4) contingency planning. Communication issues involve interaction with suppliers and vendors of critical systems, liability for Y2K communications (misrepresentation, defamation, promissory estoppel, statutory liability), securities disclosure (Canadian and US SEC requirements), protected communications, protection for Year 2000 statements. Outsourcing problems highlighted include resistance of suppliers to assume responsibility for Y2K problem remediation, factors which support and negate supplier responsibility, scope of suppliers` obligation, and warranties in respect of third party software. Regarding joint ventures, questions concerning limitations on liability, supply warranties, stand-by arrangements, stockpiling inventory, indemnities, confidentiality, operator compensation versus operator risk, and insurance were raised and addressed. Among contingency planning issues the questions of Y2K legal audit, and disclosure aspects of contingency planning were the featured concerns. figs.

  4. Energy and environmental issues

    International Nuclear Information System (INIS)

    Skea, Jim

    1993-01-01

    This paper provides an overview of the current energy-environmental issues. Firstly, the environmental problems associated with energy production and use are briefly described. Secondly, the paper reviews the availability of technological solutions to environmental problems, focussing particularly on atmospheric emission control. Finally, it moves on to look at recent policy developments in some parts of the world. Since the paper is written from the perspective of an industrialized country, emerging policy issues in Europe, Japan, and North America receive the greatest attention, with a particular focus on Europe where greenhouse gases and the proposed carbon tax have received a particularly high priority. The paper concludes with a discussion of some of the issues arising from the 1992 UNCED (UN Conference on Environment and Development) and implications for the diffusion of cleaner technologies from North to South. (author). 36 refs

  5. Year 2000 commercial issues

    International Nuclear Information System (INIS)

    Kratz, M.P.J.; Booth, R.T.

    1998-01-01

    This presentation focused on commercial aspects of the Y2K including: (1) special communication issues, (2) outsourcing transactions, (3) joint ventures and the significance for the oil and gas industry, and (4) contingency planning. Communication issues involve interaction with suppliers and vendors of critical systems, liability for Y2K communications (misrepresentation, defamation, promissory estoppel, statutory liability), securities disclosure (Canadian and US SEC requirements), protected communications, protection for Year 2000 statements. Outsourcing problems highlighted include resistance of suppliers to assume responsibility for Y2K problem remediation, factors which support and negate supplier responsibility, scope of suppliers' obligation, and warranties in respect of third party software. Regarding joint ventures, questions concerning limitations on liability, supply warranties, stand-by arrangements, stockpiling inventory, indemnities, confidentiality, operator compensation versus operator risk, and insurance were raised and addressed. Among contingency planning issues the questions of Y2K legal audit, and disclosure aspects of contingency planning were the featured concerns. figs

  6. Volume 5, Issue 1

    Directory of Open Access Journals (Sweden)

    Karen Nelson

    2014-03-01

    Full Text Available The Feature in this issue is a conversation with Richard James, a highly respected Australian academic with extensive experience in research and policy development on the First Year Experience. Richard discusses the inevitability of universal participation in tertiary education and its impact on the style of participation, student diversity, the shifting focus of decision-making on standards and credentialism; and addresses the challenges posed by these and related issues for universities and the First Year Experience, along with possible solutions.

  7. Dips spacecraft integration issues

    International Nuclear Information System (INIS)

    Determan, W.R.; Harty, R.B.

    1988-01-01

    The Department of Energy, in cooperation with the Department of Defense, has recently initiated the dynamic isotope power system (DIPS) demonstration program. DIPS is designed to provide 1 to 10 kW of electrical power for future military spacecraft. One of the near-term missions considered as a potential application for DIPS was the boost surveillance and tracking system (BSTS). A brief review and summary of the reasons behind a selection of DIPS for BSTS-type missions is presented. Many of these are directly related to spacecraft integration issues; these issues will be reviewed in the areas of system safety, operations, survivability, reliability, and autonomy

  8. Legal and institutional issues

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    Leaving aside the natural desire to avoid the difficulties imposed by the enormously complex siting and certification process, a utility might decide to forego adding new capacity because of a variety of legal and institutional disincentives. Some of these are discussed in this chapter. The addition of new lines to support a competitive generating market also raises unique institutional issues. Perhaps the most important of these is the question of who should pay for the necessary capital expenditures. This issue also is discussed in this section

  9. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-02-01

    Feb 1, 2018 ... the Russian philosophical and sociological thought. The thoughts of the Russian scientist ... Research Article. Special Issue. Journal of Fundamental and Applied Sciences is licensed under a Creative Commons Attribution-NonCommercial 4.0. International License. Libraries Resource Directory. We are ...

  10. Research Article Special Issue

    African Journals Online (AJOL)

    2016-05-15

    May 15, 2016 ... Research Article. Special Issue. Journal of Fundamental and Applied Sciences is licensed under a Creative Commons Attribution-NonCommercial 4.0. International License. ... innovation is defined as: accepting ideas or behaviors in the organization that are novel and unfamiliar. Innovation can be in form ...

  11. Fusion Canada issue 18

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-08-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on the ITER agreement signed with the EDA, the robotic maintenance for NET, the CFFTP Fusion Pilot Study, the new IEA joint programs on environment, safety and economic aspects of fusion power, and a review by the CCFM advisory committee. 3 figs.

  12. PKI Scalability Issues

    OpenAIRE

    Slagell, Adam J; Bonilla, Rafael

    2004-01-01

    This report surveys different PKI technologies such as PKIX and SPKI and the issues of PKI that affect scalability. Much focus is spent on certificate revocation methodologies and status verification systems such as CRLs, Delta-CRLs, CRS, Certificate Revocation Trees, Windowed Certificate Revocation, OCSP, SCVP and DVCS.

  13. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-10-17

    Oct 17, 2017 ... Perak, Malaysia was observed under ral waste in powder and xtract generated optimum produce highest length of fectively improved shoot ed faster effect on C. ed positive result for the shed light on how the Z. C. nutans. This study ld application. pagation; Zea mays stem. Research Article. Special Issue ...

  14. Career Issues in Organizations.

    Science.gov (United States)

    1997

    This document contains four papers from a symposium on career issues in organizations. "Learning During Downsizing: Stories from the Survivors" (Sharon J. Confessore) describes a study to demonstrate that survivors of corporate downsizings undertake learning activities and use many resources to accomplish the learning tasks.…

  15. Fusion Canada issue 8

    International Nuclear Information System (INIS)

    1989-08-01

    A short bulletin from the National Fusion Program. Included in this issue are Canada-ITER contributions, NET Fuel Processing Loop, Bilateral Meeting for Canada-Europe, report from Tokamak de Varennes and a report from the University of Toronto on materials research for Fusion Reactors. 3 figs

  16. Fusion Canada issue 7

    International Nuclear Information System (INIS)

    1989-05-01

    A short bulletin from the National Fusion Program. Included in this issue are CFFTP highlights on the Karlsruhe Isotope Separation System, a report on ITER tritium process systems, an experimental update on Tokamak de Varennes and Canada-U.S. bilateral technical collaboration topics. 2 figs

  17. Fusion Canada issue 17

    International Nuclear Information System (INIS)

    1992-05-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on increased funding for the Canadian Fusion Program, news of the compact Toroid fuelling gun, an update on Tokamak de Varennes, the Canada - U.S. fusion meeting, measurements of plasma flow velocity, and replaceable Tokamak divertors. 4 figs

  18. Fusion Canada issue 15

    International Nuclear Information System (INIS)

    1991-10-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on the 1996 IAEA Fusion Conference site, operations at the Tokamak de Varennes including divertor pumping of impurities and pumping of carbon monoxide and methane, a discussion of the CFFTP and it's role. 1 fig

  19. Research Article Special Issue

    African Journals Online (AJOL)

    2018-01-15

    Jan 15, 2018 ... Journal of Fundamental and Applied Scienc. ISSN 1112-9867 ... (0.9623, 0.3857) and (0.9975, ity, temperature, CO, UVB and. 10 concentration. In by using ANN or Fit model. Research Article. Special Issue .... The EM algorithm is a simple computational implementation to find the posterior mode. Fig.

  20. Fusion Canada issue 18

    International Nuclear Information System (INIS)

    1992-08-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on the ITER agreement signed with the EDA, the robotic maintenance for NET, the CFFTP Fusion Pilot Study, the new IEA joint programs on environment, safety and economic aspects of fusion power, and a review by the CCFM advisory committee. 3 figs

  1. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... nology Management and Technopreneurship, Universiti Teknikal Mal .... development of SMEs which are recession, global sourcing, lack of ..... issues act as barriers to export which are product quality, logistics and shipping, ... may influenced on the supply chain of payment and the operation cost itself.

  2. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-10-05

    Oct 5, 2017 ... ources and Food Industry, Universiti Sultan ZainalAbidin, 22200 Besut, ... ty problem has become a major issue in Malaysia for the past two decade ... pollution can be defined as contamination of the indoor or outdoor ...

  3. Research Article Special Issue

    African Journals Online (AJOL)

    2016-05-15

    May 15, 2016 ... twice in Iran (Department of Housing and Urban Development,2008,4). Thus, in recent years, ..... For example study of 1200 schoolchildren from four education regions in Tehran Showed that after ... In this case It is expected that be ... In a communication network issue Hierarchy, access and. Sidewalks are ...

  4. Research Issues in VDSL

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Research Issues in VDSL. How to cancel cross-talk? How to remove alien noise? Alien Noise is the crosstalk typically from non-VDSL users, using the same bundle. How to allocate power across different tones, also called Optimal Spectrum Balancing ...

  5. Introduction: The Transparency Issue

    NARCIS (Netherlands)

    Teurlings, J.; Stauff, M.

    2014-01-01

    Besides giving an overview on the individual contributions, this introduction to the special issue on transparency delineates a conceptual context for a critical analysis of the contemporary discourse on transparency and the media mechanisms related to it. It focuses on three ambivalences inherent

  6. Automated conflict resolution issues

    Science.gov (United States)

    Wike, Jeffrey S.

    1991-01-01

    A discussion is presented of how conflicts for Space Network resources should be resolved in the ATDRSS era. The following topics are presented: a description of how resource conflicts are currently resolved; a description of issues associated with automated conflict resolution; present conflict resolution strategies; and topics for further discussion.

  7. Fusion Canada issue 21

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-08-01

    A short bulletin from the National Fusion Program highlighting in this issue Europe proposes Canada`s participation in ITER, tritium for JET, CCFM/TdeV-Tokamak helium pumping and TdeV update, ITER-related R and D at CFFTP, ITER Deputy Director visits Canada, NFP Director to Chair IFRC, Award for Akira Hirose. 3 figs.

  8. Fusion Canada issue 9

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1989-11-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on availability of Canadian Tritium, an ITER update, a CCFM update on Tokamak and the new team organization, an international report on Fusion in Canada and a Laser Fusion Project at the University of Toronto. 3 figs.

  9. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... in the development of more up-to-date urban space. ... The goal of this paper is to analyze the issues of the organization of urban environment in ... The model of transport less micro-district Nebo (ACADEMIA gallery), the ...

  10. Fusion Canada issue 22

    International Nuclear Information System (INIS)

    1993-10-01

    A short bulletin from the National Fusion Program highlighting in this issue a bi-lateral meeting between Canada and Japan, water and hydrogen detritiation, in-situ tokamak surface analysis, an update of CCFM/TdeV and tritium accounting Industry guidance in Fusion, fast probe for plasma-surface interaction. 4 figs

  11. Fusion Canada issue 15

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1991-10-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on the 1996 IAEA Fusion Conference site, operations at the Tokamak de Varennes including divertor pumping of impurities and pumping of carbon monoxide and methane, a discussion of the CFFTP and it`s role. 1 fig.

  12. Accelerating News Issue 5

    CERN Document Server

    Szeberenyi, A

    2013-01-01

    In this spring issue, we look at developments towards higher luminosity and higher energy colliders. We report on the technology developed for the remote powering of the LHC magnets and studies of diagnostics based on higher order mode port signals. We also inform you about the main outcome of the TIARA survey on market needs for accelerator scientists.

  13. Fusion Canada issue 28

    International Nuclear Information System (INIS)

    1995-06-01

    A short bulletin from the National Fusion Program highlighting in this issue the Canada - US fusion meeting in Montreal, fusion breeder work in Chile, new management at CFFTP, fast electrons in tokamaks: new data from TdeV, a program review of CCFM and Velikhov to address Montreal fusion meeting. 1 fig

  14. Fusion Canada issue 16

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-01-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on Ontario Hydro`s contract for tritium supply from Germany, a CCFM update on plasma biasing, divertor operation, radiofrequency plasma current drive and the plasma heating system for the Tokamak de Varennes, and an agreement for ITER engineering design activities. 5 figs.

  15. Fusion Canada issue 8

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1989-08-01

    A short bulletin from the National Fusion Program. Included in this issue are Canada-ITER contributions, NET Fuel Processing Loop, Bilateral Meeting for Canada-Europe, report from Tokamak de Varennes and a report from the University of Toronto on materials research for Fusion Reactors. 3 figs.

  16. Fusion Canada issue 17

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1992-05-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on increased funding for the Canadian Fusion Program, news of the compact Toroid fuelling gun, an update on Tokamak de Varennes, the Canada - U.S. fusion meeting, measurements of plasma flow velocity, and replaceable Tokamak divertors. 4 figs.

  17. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... technological innovations and the spread of knowledge. ... In this paper, we propose a conceptual model to search relevant scientific ... The digital libraries are becoming a source for discovering new research trends ... Text mining techniques are used to solve some particular business issues, so it is called.

  18. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... ethical issues behind the retrieval of organs (commitment to ... The article reviews the practices of European countries and attitude of the EU citizens to the .... knowledge that the purchase and sale of donor organs is prohibited ...

  19. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-05-01

    May 1, 2018 ... stability is a very good issue of the power systems resilience to the high disturbances. In this paper, a mirror-fuzzy controller scaled by PSO has been proposed ... In many system analysis, the researchers have configured the ...

  20. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-11-24

    Nov 24, 2017 ... you …? and passive form of a verb. In the Tatar language the verb kuru with gerund is used. In English for strengthening the auxiliary verb do, a modal verb must, a modal construction to be to are used. 6. DISCUSSIONS. The issue touched in this research is object of steady and long interest from domestic ...

  1. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-10-05

    Oct 5, 2017 ... Journal of Fundamental and Applied Sciences. ISSN 1112-9867. Available online at http://www.jfas.info. Research Article. Special Issue .... of use. Three critical success factors of e-learning (instructor characteristics, student characteristics .... Total of 95 questionnaires were used for further data analysis.

  2. Research Article Special Issue

    African Journals Online (AJOL)

    2016-05-15

    May 15, 2016 ... Journal of Fundamental and Applied Sciences is licensed under a Creative ... 1. Faculty of Engineering, Civil Engineering Department, Urmia Branch, ..... Table 4. Sections of the main components of 16 stories building ..... International Journal of Engineering Science and Innovative ... Issue 1, January 2013.

  3. Fusion Canada issue 25

    International Nuclear Information System (INIS)

    1994-08-01

    A short bulletin from the National Fusion Program highlighting in this issue an economic impact study of the Canadian site for ITER, Harvey Skarsgard: fusion pioneer retires, NFP: Phillips and Holtslander exchange roles, Europe's fusion funding proposals and an update of CCFM/TdeV. 1 fig

  4. Overview of Special Issue

    NARCIS (Netherlands)

    Hiemstra, Djoerd; Harman, Donna; Allan, James; Kelly, Diane; Belkin, Nicholas J.; Bennet, Paul; Callan, Jamie; Clarke, Charles; Diaz, Fernando; Dumais, Susan; Ferro, Nicola; Harman, Donna; Ruthven, Ian; Sakai, Tetsuya; Smucker, Mark D.; Zobel, Justin

    2017-01-01

    This special issue of SIGIR Forum marks the 40th anniversary of the ACM SIGIR Conference by showcasing papers selected for the ACM SIGIR Test of Time Award from the years 1978-2001. These papers document the history and evolution of IR research and practice, and illustrate the intellectual impact

  5. Special Issue Editorial

    African Journals Online (AJOL)

    While this special issue focuses on work in the South African context, ... practice) with youth addresses the key imperatives of (un)employment, age, ... patterns of male control over sexual encounters and women's sexuality are emergent ... in the paper by Ngabaza, Bojarczuk, Masuku and Roelfse, titled, 'Empowering young.

  6. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... Labor deployment issues play an important role in analyzing their use at the country or regional level .... The growth of employment in the service sector since the 50s, as a result of the rapid ... Hotels and restaurants. 23,0 ..... for the better, its number decreases and the quality of labor resources deteriorates.

  7. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-11-24

    Nov 24, 2017 ... FEDERAL UNIVERSITY (FROM EMOTIONAL EDUCATION TO GLOBAL. THINKING ... ANNOTATION. The article highlights the topical issues of human education of the future humanistic- ... conditions (continuous self-education, updating and integration of educational resources on the basis of the ...

  8. Fusion Canada issue 21

    International Nuclear Information System (INIS)

    1993-08-01

    A short bulletin from the National Fusion Program highlighting in this issue Europe proposes Canada's participation in ITER, tritium for JET, CCFM/TdeV-Tokamak helium pumping and TdeV update, ITER-related R and D at CFFTP, ITER Deputy Director visits Canada, NFP Director to Chair IFRC, Award for Akira Hirose. 3 figs

  9. Fusion Canada issue 7

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1989-05-01

    A short bulletin from the National Fusion Program. Included in this issue are CFFTP highlights on the Karlsruhe Isotope Separation System, a report on ITER tritium process systems, an experimental update on Tokamak de Varennes and Canada-U.S. bilateral technical collaboration topics. 2 figs.

  10. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-10-05

    Oct 5, 2017 ... culture of Mamak frequenting restaurants in Malaysia, several issue has risen in relation to the .... employment of one group quasi experimental design was noted to be lacked in internal ... Food safety and quality division: ... self-reported practices of food service staff regarding food hygiene in Edirne, Turkey ...

  11. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-08-08

    Aug 8, 2017 ... presented in the form of a matrix in which processing of vectors is conducted by a conveyor way. ... The modularity of structure of the product systemand standardization of basic operations allow to create ... Thus, the actual issue of modern CT is the organization and hardware support of parallel production.

  12. Fusion Canada issue 26

    International Nuclear Information System (INIS)

    1994-11-01

    A short bulletin from the National Fusion Program highlighting in this issue tritium supply for Japanese research, Canada to host the 1995 IAEA Conference on Tritium, studies on the tokamak divertor and edge plasma studies, a tritium field release study, erosion studies on plasma facing materials, G. Pacher returns to CCFM and an update on CCFM/TdeV

  13. Fusion Canada issue 4

    International Nuclear Information System (INIS)

    1988-05-01

    A short bulletin from the National Fusion Program. Included in this issue is a technical update on Tokamak de Varennes, a report on the Beatrix II Breeding Materials Test Program, the Tritium glovebox system for UPM, Saudi Arabia, a broad update of the Canadian Fusion Fuels Technology Project is also included. 1 fig

  14. Issues of HRD. Symposium.

    Science.gov (United States)

    2002

    This document contains three papers from a symposium on issues of human resource development (HRD). "The Complex Roots of Human Resource Development" (Monica Lee) discusses the roots of HRD within the framework of the following views of management: (1) classic (the view that managers must be able to create appropriate rules and…

  15. Career Issues in HRD.

    Science.gov (United States)

    1999

    This document contains four symposium papers on career issues in human resource development (HRD). "Are Careers What They Used To Be: A Factor Analysis of Schein's Career Orientations Inventory" (Gerri Mukri, Sharon Confessore) is a statistical analysis of Schein's Career Orientations Inventory that finds the inventory to be a…

  16. Ethical issues in neurogenetics.

    Science.gov (United States)

    Uhlmann, Wendy R; Roberts, J Scott

    2018-01-01

    Many neurogenetic conditions are inherited and therefore diagnosis of a patient will have implications for the patient's relatives and can raise ethical issues. Predictive genetic testing offers asymptomatic relatives the opportunity to determine their risk status for a neurogenetic condition, and professional guidelines emphasize patients' autonomy and informed, voluntary decision making. Beneficence and nonmaleficence both need to be considered when making decisions about disclosure and nondisclosure of genetic information and test results. There can be disclosure concerns and challenges in determining whose autonomy to prioritize when a patient makes a genetic testing decision that can reveal the genetic status of a relative (e.g., testing an adult child when the at-risk parent has not been tested). Ethical issues are prominent when genetic testing for neurogenetic conditions is requested prenatally, on minors, adoptees, adult children at 25% risk, and for individuals with psychiatric issues or cognitive impairment. Neurogenetic conditions can result in cognitive decline which can affect decisional capacity and lead to ethical challenges with decision making, informed consent, and determining the patient's ability to comprehend test results. The ethical implications of genetic testing and emerging issues, including direct-to-consumer genetic testing, disclosure of secondary findings from genomic sequencing, and use of apolipoprotein E testing in clinical and research settings, are also discussed. Resources for information about genetic testing practice guidelines, insurance laws, and directories of genetics clinics are included. Copyright © 2018 Elsevier B.V. All rights reserved.

  17. Fusion Canada issue 12

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1990-10-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on Darlington`s Tritium Removal Facility, work at universities on Deuterium Diffusivity in Beryllium, Fusion Studies, confinement research and the operation of divertors at Tokamak de Varennes. 5 figs.

  18. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-05-01

    May 1, 2018 ... The issues of information placement are considered on the website of the educational ... At present, a considerable attention is paid to the automation of educational ... schedule from any device quickly, since the system is the WEB service, which allows ... the system adaptation for its use on mobile devices.

  19. International Issues in Education

    Science.gov (United States)

    Ruggeri, Kai; Diaz, Carmen; Kelley, Karl; Papousek, Ilona; Dempster, Martin; Hanna, Donncha

    2008-01-01

    Anxiety, negative attitudes, and attrition are all issues presented in the teaching of statistics to undergraduates in research-based degrees regardless of location. Previous works have looked at these obstacles, but none have consolidated a multilingual, multinational effort using a consistent method. Over 400 Spanish-, English-, and…

  20. Ethical issues for librarians

    Directory of Open Access Journals (Sweden)

    Francisca Rasche

    2005-04-01

    Full Text Available It approaches the librarian ethics comprehending the Librarianship constitution from a systemic view. In this way, with the objective to raise issues to discuss professional ethics, it places the librarian in the work world and points approaches between exertion and relation context of the professionals themselves with the human rights and alteration ethics.

  1. Fusion Canada issue 22

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-10-01

    A short bulletin from the National Fusion Program highlighting in this issue a bi-lateral meeting between Canada and Japan, water and hydrogen detritiation, in-situ tokamak surface analysis, an update of CCFM/TdeV and tritium accounting Industry guidance in Fusion, fast probe for plasma-surface interaction. 4 figs.

  2. Fusion Canada issue 4

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1988-05-01

    A short bulletin from the National Fusion Program. Included in this issue is a technical update on Tokamak de Varennes, a report on the Beatrix II Breeding Materials Test Program, the Tritium glovebox system for UPM, Saudi Arabia, a broad update of the Canadian Fusion Fuels Technology Project is also included. 1 fig.

  3. Research Article Special Issue

    African Journals Online (AJOL)

    2016-05-15

    May 15, 2016 ... ABSTRACT. In megacities, exposure to high concentrations of air pollution, as a major concern on public health, is being felt worldwide problem. The issue of particulate matter especially the PM2.5 has become extremely crucial in Tehran, due to industrialization and population growth. Therefore, it.

  4. Fusion Canada issue 19

    International Nuclear Information System (INIS)

    1992-12-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on the IAEA Plasma Biasing Meeting, the new IEA program -Nuclear Technology of Fusion reactors, TFTR tritium purification system, an update by CCFM on machine additions and modifications, and news of a new compact Toroid injector at the University of Saskatchewan. 1 fig

  5. Fusion Canada issue 9

    International Nuclear Information System (INIS)

    1989-11-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on availability of Canadian Tritium, an ITER update, a CCFM update on Tokamak and the new team organization, an international report on Fusion in Canada and a Laser Fusion Project at the University of Toronto. 3 figs

  6. Fusion Canada issue 14

    International Nuclear Information System (INIS)

    1991-05-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on a fusion cooperation agreement between Japan and Canada, an update at Tokamak de Varennes on plasma biasing experiments and boronization tests and a collaboration between Canada and the U.S. on a compact toroid fuelling gun. 4 figs

  7. Fusion Canada issue 12

    International Nuclear Information System (INIS)

    1990-10-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on Darlington's Tritium Removal Facility, work at universities on Deuterium Diffusivity in Beryllium, Fusion Studies, confinement research and the operation of divertors at Tokamak de Varennes. 5 figs

  8. Fusion Canada issue 16

    International Nuclear Information System (INIS)

    1992-01-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on Ontario Hydro's contract for tritium supply from Germany, a CCFM update on plasma biasing, divertor operation, radiofrequency plasma current drive and the plasma heating system for the Tokamak de Varennes, and an agreement for ITER engineering design activities. 5 figs

  9. Fusion Canada issue 24

    International Nuclear Information System (INIS)

    1994-04-01

    A short bulletin from the National Fusion Program highlighting in this issue the opening of the Garching ITER site, a CCFM/TdeV update,a tritium release field test, measuring radial profile of plasma current density on TdeV, power supplies for TdeV, 5th International Tritium Technology conference, and 1994 basic tritium course. 4 figs

  10. Research Article Special Issue

    African Journals Online (AJOL)

    2016-06-05

    Jun 5, 2016 ... because Amir al- Mu'minin's(peace be upon him) name is related to human perfection and. Journal of Fundamental and Applied Sciences. ISSN 1112-9867. Available online at http://www.jfas.info. Research Article. Special Issue. Journal of Fundamental and Applied Sciences is licensed under a Creative ...

  11. Research Article Special Issue

    African Journals Online (AJOL)

    2017-10-05

    Oct 5, 2017 ... We are listed under Research Associations. D THAT USES A ... Clinical Engineering, Toin University of Yokohama, Yokohama, Aoba ... Special Issue ..... advisable to run the prognosis results at least one hundred times with the Euclidean and ... They are some of the topics left for future research. 5.

  12. PREFACE: CEWQO Topical Issue CEWQO Topical Issue

    Science.gov (United States)

    Bozic, Mirjana; Man'ko, Margarita

    2009-09-01

    This topical issue of Physica Scripta collects selected peer-reviewed contributions based on invited and contributed talks and posters presented at the 15th Central European Workshop on Quantum Optics (CEWQO) which took place in Belgrade 29 May-3 June 2008 (http://cewqo08.phy.bg.ac.yu). On behalf of the whole community took place in Belgrade 29 May-3 June 2008 (http://cewqo08.phy.bg.ac.yu, cewqo08.phy.bg.ac.yu). On behalf of the whole community of the workshop, we thank the referees for their careful reading and useful suggestions which helped to improve all of the submitted papers. A brief description of CEWQO The Central European Workshop on Quantum Optics is a series of conferences started informally in Budapest in 1992. Sometimes small events transform into important conferences, as in the case of CEWQO. Professor Jozsef Janszky, from the Research Institute of Solid State Physics and Optics, is the founder of this series. Margarita Man'ko obtained the following information from Jozsef Janszky during her visit to Budapest, within the framework of cooperation between the Russian and Hungarian Academies of Sciences in 2005. He organized a small workshop on quantum optics in Budapest in 1992 with John Klauder as a main speaker. Then, bearing in mind that a year before Janszky himself was invited by Vladimir Buzek to give a seminar on the same topic in Bratislava, he decided to assign the name 'Central European Workshop on Quantum Optics', considering the seminar in Bratislava to be the first workshop and the one in Budapest the second. The third formal workshop took place in Bratislava in 1993 organized by Vladimir Buzek, then in 1994 (Budapest, by Jozsef Janszky), 1995 and 1996 (Budmerice, Slovakia, by Vladimir Buzek), 1997 (Prague, by Igor Jex), 1999 (Olomouc, Czech Republic, by Zdenek Hradil), 2000 (Balatonfüred, Hungary, by Jozsef Janszky ), 2001 (Prague, by Igor Jex), 2002 (Szeged, Hungary, by Mihaly Benedict), 2003 (Rostock,Germany, by Werner Vogel and

  13. Canada's domestic nuclear issues

    International Nuclear Information System (INIS)

    Anon.

    1986-01-01

    The Interfaith Program for Public Awareness of Nuclear Issues (IPPANI) is a committee of representatives of religious groups in Toronto, a group of people concerned about the moral and ethical implications of the operation of Canada's nuclear industry and of its exports to other countries. The faith groups represented are the Anglican Diocese of Toronto, the Baha'i Community of Canada, the Jewish Community of Toronto, the Roman Catholic Archdiocese of Toronto and the United Church of Canada Toronto Conference. Wishing to encourage the Canadian government to enquire into this broad question, the faith groups established IPPANI and assigned to it the task of enhancing their knowledge of the nuclear industry. IPPANI was to develop an effective set of questions to be placed before governments and to promote public discussion so that governments might become more responsive to these issues

  14. Transmission issues in Alberta

    International Nuclear Information System (INIS)

    Levson, D.

    2002-01-01

    This paper outlined the major issues and concerns facing users of the transmission system in Alberta. They include congestion management issues that make investors uncertain about power generation. It is necessary to know the difference between which transmission price signals will be faced by low cost cogeneration at Fort McMurray and Cold Lake coal-fired generation near Edmonton compared to combined cycle gas generation near Calgary. Import and export policy tariffs are another concern. Most new generation opportunities in Alberta require access to export markets, but transmission facilities for export need policy support and appropriate tariffs. It was noted that the past actions of Alberta's Transmission Administrator and balancing pool may be distorting market signals for ancillary service markets, and that loss studies and calculations need upgrading

  15. Drilling contract issues

    International Nuclear Information System (INIS)

    Davison, G.B.; Worden, D.R.; Borbridge, G.K.D.

    1997-01-01

    Some selected issues which are facing both operators and contractors in drilling for oil and gas, such as the allocation of risk by contract and by statute and the implementation of new technologies, were discussed. There are three varieties of written drilling contracts used in Canada: (1) day work and meterage contracts, (2) master drilling agreements, and (3) contracts that are used in construction projects that do not specifically relate to drilling. Issues relevant to the contractual allocation of risk, to implementing new drilling technologies, to reconciling contract and statute liability, and the formation of strategic alliances for mutual benefit, and the factors contributing to the success of such alliances were explored. 12 refs

  16. Teaching nuclear issues

    International Nuclear Information System (INIS)

    Hicks, D.W.

    1986-01-01

    This paper is based on the assumption that the nuclear debate, both globally and within Britain, is one of critical importance in the late twentieth century and that it should therefore, at some juncture, be explored as part of the school curriculum. An essential part of 'good education' in a democratic society is to teach young people how to think about such an issue, but not what to think about it. This paper attempts to set out some of the key issues and dilemmas in relation to what we may call 'nuclear education'. It perhaps asks more questions than it gives answers, but they are all essential questions which teachers must ask themselves if they are to teach sensitively about these matters. Some of these questions are given as examples. (author)

  17. CULTURAL ISSUES IN ECONOMICS

    OpenAIRE

    Maciej Meyer

    2012-01-01

    This article has been written with the purpose of attracting attention to the cultural issues, or rather lack of them, in economics. This topic has not been taken frequently into theoretical considerations due to some difficulties, although its practical implications are of great importance. The meaning of institutions which are a part of cultures has been given more coverage in the literature. The following hypothesis is proposed: culture is an important but underestimated component of the e...

  18. Uruguay; 2011 Selected Issues

    OpenAIRE

    International Monetary Fund

    2011-01-01

    This 2011 Article IV Consultation—Selected Issues paper focuses on estimating potential output and the output gap and spillovers from agriculture in the case of Uruguay. It introduces additional economic information and theory to estimate potential output, shedding some light on the discussion of current monetary and fiscal policies. The objective is to take advantage of economic data to disentangle the most recent economic performance by introducing multivariate techniques. The paper also pr...

  19. Product Category Management Issues

    OpenAIRE

    Żukowska, Joanna

    2011-01-01

    The purpose of the paper is to present the issues related to category management. It includes the overview of category management definitions and the correct process of exercising it. Moreover, attention is paid to the advantages of brand management, the benefits the supplier and retailer may obtain in this way. The risk element related to this topics is also presented herein. Joanna Żukowska

  20. Malaysia; Selected Issues

    OpenAIRE

    International Monetary Fund

    1998-01-01

    This Selected Issues paper on Malaysia highlights quantitative assessment of additional measures required during the medium term to achieve fiscal targets. The authorities aim to lower the budget deficit to about 3 percent of GDP by 2015, down from 4.0 percent in 2013, and to balance the budget by 2020. It suggests that ranking fiscal instruments under different fiscal policy goals can help policymakers identify the composition of fiscal adjustment based on their preferences. By combining ran...

  1. Medico legal issues.

    Science.gov (United States)

    Mackenzie, Geraldine; Carter, Hugh

    2010-01-01

    This chapter gives an educational overview of: * An awareness of the legal issues involved in health informatics * The need for the privacy and security of the patient record * The legal consequences of a breach of the security of the patient record * The concept of privacy law and what precautions ought to be taken to minimize legal liability for a breach of privacy and/or confidentiality.

  2. Nanotechnology and accounting issues

    OpenAIRE

    Abedalqader Rababah

    2017-01-01

    Nanotechnology is a new advanced technology used in the industry. This study conducted an investigation on the literature and highlighted the accounting issues which related to the implement of nanotechnology, especially the change of cost structure and expected solutions for the increasing of indirect costs which need more accurate allocation to the unit of products. Also, this study investigated on the future expected accounting risks for using nanotechnology. Finally, this study will open ...

  3. Introduction to pricing issues

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    This chapter provides an overview of pricing issues the proper pricing of transmission services is essential to efficient operation of the grid. Wheeling rights have little meaning if capacity on existing lines is scarce and there is no incentive to build new lines. Depending on the type of transmission pricing policies FERC adopts, the Commission may be able to encourage more voluntary wheeling service, and to influence decisions to build or upgrade the supply of facilities

  4. Wireless ATM : handover issues

    OpenAIRE

    Jiang, Fan; Käkölä, Timo

    1998-01-01

    Basic aspects of cellular systems and the ATM transmission technology are introduced. Wireless ATM is presented as a combination of radio ATM and mobile ATM. Radio ATM is a wireless extension of an ATM connection while mobile ATM contains the necessary extensions to ATM to support mobility. Because the current ATM technology does not support mobility, handover becomes one of the most important research issues for wireless ATM. Wireless ATM handover requirements are thus analysed. A handover s...

  5. Gender issues in translation

    OpenAIRE

    ERGASHEVA G.I.

    2015-01-01

    The following research is done regarding gender in translation dealing specifically with the issue of the translators’ gender identity and its effect on their translations, as well as on how gender itself is translated and produced. We will try to clarify what gender is, how gender manifests itself in the system of language, and what problems translators encounter when translating or producing gender-related materials

  6. Accelerating News Issue 3

    CERN Document Server

    Kahle, K; Tanguy, C; Wildner, E

    2012-01-01

    This summer saw CERN announce to a worldwide audience the discovery of a Higgs-like boson, so this issue takes a look at the machine behind the discovery, the LHC, as well as future plans for a possible Higgs factory in the form of LEP3. Looking ahead too are European strategies for particle physics and accelerator-based neutrino physics. In addition, taking stock of the work so far, HiLumi LHC and EuCARD showcase their latest results.

  7. JPRS Report, Environmental Issues.

    Science.gov (United States)

    1990-12-06

    Fusion Technology Applied in Pollution Control [XINHUA 15 NovJ 27 Pollution-Free Chemical Fertilizer Enterprise Built [XINHUA 19 NovJ 27 EAST...INTER-AMERICAN AFFAIRS Nicaraguans Discover Illegal Lumbering by Costa Rican Companies [Managua LA PRENSA 31 Oct] 44 ARGENTINA Rally Protests...Nov] 74 New Rules for Operating Nuclear Plants Issued [Moscow Radio 14 Nov] 74 Expansion, Saftey of Bilibino Nuclear Power Station Discussed

  8. New Zealand; Selected Issues

    OpenAIRE

    International Monetary Fund

    2009-01-01

    This Selected Issues paper conducts a comparative analysis of the main determinants of GDP per capita growth in New Zealand and in other OECD countries to assess the relative importance of macroeconomic factors, institutional settings, and geographical location in New Zealand’s growth performance during the last 30 years. The estimation results find strong support for the view that geographical isolation has significantly hampered growth in New Zealand. The paper also reviews the internationa...

  9. Norway; Selected Issues

    OpenAIRE

    International Monetary Fund

    2005-01-01

    This Selected Issues paper analyzes inflation in Norway with a view to shedding light on this surprising development and the possible near-term course of inflation, using statistical and econometric analyses. The paper reviews recent developments of monetary policy and inflation in Norway, applies statistical and econometric tools to identify factors influencing inflation, and describes the implications of the analysis for policymaking. Using data for six advanced small open economies explici...

  10. Fusion Canada issue 13

    International Nuclear Information System (INIS)

    1991-01-01

    A short bulletin from the National Fusion Program. Included in this issue is a report on Canada's plans to participate in the Engineering Design Activities (EDA), bilateral meetings with Canada and the U.S., committee meeting with Canada-Europe, an update at Tokamak de Varennes on Plasma Biasing experiments and boronized graphite tests, fusion materials research at the University of Toronto using a dual beam accelerator and a review of the CFFTP and the CCFM. 2 figs

  11. Issues in waste combustion

    Energy Technology Data Exchange (ETDEWEB)

    Gustavsson, Lennart; Robertson, Kerstin; Tullin, Claes [Swedish National Testing and Research Inst., Boraas (Sweden); Sundquist, Lena; Wrangensten, Lars [AaF-Energikonsult AB, Stockholm (Sweden); Blom, Elisabet [AaF-Processdesign AB, Stockholm (Sweden)

    2003-05-01

    The main purpose of this review is to provide an overview of the state-of-the-art on research and development issues related to waste combustion with relevance for Swedish conditions. The review focuses on co-combustion in grate and fluidised bed furnaces. It is primarily literature searches in relevant databases of scientific publications with to material published after 1995. As a complement, findings published in different report series, have also been included. Since the area covered by this report is very wide, we do not claim to cover the issues included completely and it has not been possitile to evaluate the referred studies in depth. Basic knowledge about combustion issues is not included since such information can be found elsewhere in the literature. Rather, this review should be viewed as an overview of research and development in the waste-to-energy area and as such we hope that it will inspire scientists and others to further work in relevant areas.

  12. Using High Resolution Simulations with WRF/SSiB Regional Climate Model Constrained by In Situ Observations to Assess the Impacts of Dust in Snow in the Upper Colorado River Basin

    Science.gov (United States)

    Oaida, C. M.; Skiles, M.; Painter, T. H.; Xue, Y.

    2015-12-01

    The mountain snowpack is an essential resource for both the environment as well as society. Observational and energy balance modeling work have shown that dust on snow (DOS) in western U.S. (WUS) is a major contributor to snow processes, including snowmelt timing and runoff amount in regions like the Upper Colorado River Basin (UCRB). In order to accurately estimate the impact of DOS to the hydrologic cycle and water resources, now and under a changing climate, we need to be able to (1) adequately simulate the snowpack (accumulation), and (2) realistically represent DOS processes in models. Energy balance models do not capture the impact on a broader local or regional scale, nor the land-atmosphere feedbacks, while GCM studies cannot resolve orographic-related precipitation processes, and therefore snowpack accumulation, owing to coarse spatial resolution and smoother terrain. All this implies the impacts of dust on snow on the mountain snowpack and other hydrologic processes are likely not well captured in current modeling studies. Recent increase in computing power allows for RCMs to be used at higher spatial resolutions, while recent in situ observations of dust in snow properties can help constrain modeling simulations. Therefore, in the work presented here, we take advantage of these latest resources to address the some of the challenges outlined above. We employ the newly enhanced WRF/SSiB regional climate model at 4 km horizontal resolution. This scale has been shown by others to be adequate in capturing orographic processes over WUS. We also constrain the magnitude of dust deposition provided by a global chemistry and transport model, with in situ measurements taken at sites in the UCRB. Furthermore, we adjust the dust absorptive properties based on observed values at these sites, as opposed to generic global ones. This study aims to improve simulation of the impact of dust in snow on the hydrologic cycle and related water resources.

  13. Independent Calculations for the SR Can Assessment. External review contribution in support of SKI's and SSI's review of SR-Can

    Energy Technology Data Exchange (ETDEWEB)

    Maul, Philip; Robinson, Peter; Bond, Alex; Benbow, Steven (Quintessa Limited, Henley-on-Thames (GB))

    2008-03-15

    consideration to the coupled processes that will operate before the system reaches a new equilibrium. 4. The calculations of thermal evolution suggest that some canisters may reach temperatures close to the maximum criterion of 100 deg C. It was not possible to reproduce fully the calculations presented by SKB because of uncertainties over the way that the repository layout was specified. 5. SKB's repository resaturation calculations are not definitive. The resaturation timescales obtained in the QPAC-EBS calculations are generally consistent with the relatively short timescales obtained by SKB, but timescales of much greater than 200 years have been obtained with some combinations of modelling assumptions. Further independent calculations will be undertaken, including consideration of bentonite resaturation. 6. Radionuclide transport calculations using the AMBER code have produced very similar results to those reported by SKB. However, this required a considerable amount of effort because of the need to check a large number of areas with SKB where the information provided in the SR-Can documentation was either incorrect or missing. 7. Insufficient deterministic calculations are given by SKB to enable the reader to understand the key issues presented and to facilitate the reproduction of SKB's calculations by a third party. It is suggested that for each set of probabilistic calculations undertaken in support of comparisons with regulatory criteria, a deterministic case should be documented to illustrate the key points. Further insight into the important features of probabilistic calculations can be obtained by analysing the high consequence runs: this has been undertaken for the Quintessa calculations but was not considered by SKB in SR-Can. 8. The calculated risks may be more sensitive to the choice of parameter probability density functions (PDFs) than implied by SKB. For example, the choice between a triangular and log-triangular PDF for the fuel dissolution rate

  14. Editorial, Volume 5, Issue 1

    Directory of Open Access Journals (Sweden)

    Kristy L. Archuleta

    2014-08-01

    Full Text Available Welcome to Volume 5, Issue 1 of the Journal of Financial Therapy! In this issue, four scholarly papers are presented along with two profiles and a book review. These four papers address very important issues, such as mental health therapists’ competency in working with financial issues, financial stress of college students, parental messages about money, and financial advice media.

  15. In This Issue

    Science.gov (United States)

    1996-08-01

    Coda This issue of the Journal, the last to be produced by the editorial staff in Austin, is remarkable only in the sense that each issue of this Journal is remarkable. In it teachers of chemistry share information, advice, and ideas that encompass a range as wide as chemistry itself. The Journal has always been a venue where the only important thread of commonalty was the goal of helping teachers--providing a "living textbook of chemistry", as it was dubbed by its founders. This textbook is different, however--it is written by its own readers and it has a new "edition" each month. This month's edition typifies the range of topics and issues found important by our readers (and authors): information about new ideas and research advances, new ways to look at and present the information we have, experiments and demonstrations to give students a first-hand exposure to chemistry, computer exercises to introduce those things that cannot be (or are too dangerous to be) presented first-hand, and ideas for better teaching techniques and classroom organization. With such a purview, it is no wonder that the articles in this issue range from the second law of thermodynamics (Frohlich, page 716) to building a Tesla coil from a car coil (Hall and Battino, page 817) and touch on such consequential topics as mimicking nature (Dennison and Harrowven, page 697) and the search for a silicon-based LED (Swisher, Richmond, and Sercel, page 738). New information about research is represented by part III of the series on electrospray ionization mass spectrometry (Hop and Bakhtiar, page A162). Senozan and Devore (page 767) look at data already long known about carbon monoxide poisoning and present a more subtle and complex explanation of the process than is usually seen in introductory texts. A really new way of looking at what we already know is the unique approach that Ginebreda (page 708) takes to waste recovery, applying the formalisms of thermodynamics to economic considerations

  16. The World energy issue

    International Nuclear Information System (INIS)

    Nifenecker, Herve

    2011-01-01

    This Power Point document proposes figures and data about the current world energy consumption, the various energy sources, the share of primary energy consumption by different sectors, and the levels of energy reserves. It addresses the issue of global warming (evolution of temperature, regional anomalies, the challenge of limitation of temperature, the greenhouse gas emissions), the strategic role of electricity (energy mix, heat production with electricity), energy savings, electricity production (key data on solar, wind, solar and biomass energy, possibilities of carbon capture, nuclear energy, costs of these different energies)

  17. Reliability issues in PACS

    Science.gov (United States)

    Taira, Ricky K.; Chan, Kelby K.; Stewart, Brent K.; Weinberg, Wolfram S.

    1991-07-01

    Reliability is an increasing concern when moving PACS from the experimental laboratory to the clinical environment. Any system downtime may seriously affect patient care. The authors report on the several classes of errors encountered during the pre-clinical release of the PACS during the past several months and present the solutions implemented to handle them. The reliability issues discussed include: (1) environmental precautions, (2) database backups, (3) monitor routines of critical resources and processes, (4) hardware redundancy (networks, archives), and (5) development of a PACS quality control program.

  18. Saudi Arabia; Selected Issues

    OpenAIRE

    International Monetary Fund

    2012-01-01

    This Selected Issues paper on Saudi Arabia assesses Saudi Arabia’s role in the oil market and global economy. Saudi Arabia, the world’s largest producer and exporter of oil, has long played a systemically important role in the global oil market. Short-term fluctuations in Saudi Arabia’s oil production have partially reflected attempts to stabilize the global oil market. Saudi Arabia has on several occasions used its systemic role to raise production to fill global demand gaps created by large...

  19. Vacuum systems - thermal issues

    International Nuclear Information System (INIS)

    Howell, J.W.

    1992-01-01

    The new high-energy synchrotron light sources currently under construction and the B-factories that are still in the planning stage present new challenges in the management of synchrotron radiation thermal loading. With particle energies from 6 to 9 GeV and currents from 0.3 to 2.5 mA, the total power and the power density of the resulting synchrotron radiation each present unique problems. The design issues involved in managing these new power levels are presented, as well as a survey of some of the proposed design solutions

  20. The money issue.

    Science.gov (United States)

    Carpenter, Dave; Haugh, Richard

    2003-06-01

    Volume is rising at a healthy pact. Technology is improving patient care. Many organizations have, out of necessity, strengthened business fundamentals, controlled costs and refined their focus. Yet not-for-profit hospitals are squeezed by a cash crunch that has balance sheets under pressure and credit downgrades outpacing upgrades--the result of shrinking investment income, rising pension obligations, low government reimbursement and other threats to operational stability. N&HN looks at the challenges, including recent fallout from the most pressing issues, how some systems have responded, and the pros and cons of borrowing now.

  1. Authoring Issues beyond Tools

    Science.gov (United States)

    Spierling, Ulrike; Szilas, Nicolas

    Authoring is still considered a bottleneck in successful Interactive Storytelling and Drama. The claim for intuitive authoring tools is high, especially for tools that allow storytellers and artists to define dynamic content that can be run with an AI-based story engine. We explored two concrete authoring processes in depth, using various Interactive Storytelling prototypes, and have provided feedback from the practical steps. The result is a presentation of general issues in authoring Interactive Storytelling, rather than of particular problems with a specific system that could be overcome by 'simply' designing the right interface. Priorities for future developments are also outlined.

  2. Turbine Replacement Issue

    Science.gov (United States)

    This document may be of assistance in applying the New Source Review (NSR) air permitting regulations including the Prevention of Significant Deterioration (PSD) requirements. This document is part of the NSR Policy and Guidance Database. Some documents in the database are a scanned or retyped version of a paper photocopy of the original. Although we have taken considerable effort to quality assure the documents, some may contain typographical errors. Contact the office that issued the document if you need a copy of the original.

  3. Maintenance simulation: Software issues

    Energy Technology Data Exchange (ETDEWEB)

    Luk, C.H.; Jette, M.A.

    1995-07-01

    The maintenance of a distributed software system in a production environment involves: (1) maintaining software integrity, (2) maintaining and database integrity, (3) adding new features, and (4) adding new systems. These issues will be discussed in general: what they are and how they are handled. This paper will present our experience with a distributed resource management system that accounts for resources consumed, in real-time, on a network of heterogenous computers. The simulated environments to maintain this system will be presented relate to the four maintenance areas.

  4. Environmental issues in China

    Energy Technology Data Exchange (ETDEWEB)

    Travis, P.S.

    1991-10-01

    Global concern about the environment is increasing, and the People's Republic of China (PRC) is not immune from such concerns. The Chinese face issues similar to those of many other developing nations. The US Department of Energy is particularly interested in national and world pollution issues, especially those that may infringe on other countries' economic growth and development. The DOE is also interested in any opportunities that might exist for US technical assistance and equipment in combating environmental problems. Our studies of articles in the China Daily, and English-language daily newspaper published by the Chinese government, show that population, pollution, and energy are major concerns of the Chinese Communist Party. Thus this report emphasizes the official Chinese government view. Supporting data were also obtained from other sources. Regardless of the severity of their various environmental problems, the Chinese will only try to remedy those problems with the greatest negative effects on its developing economy. They will be looking for foreign assistance, financial and informational, to help implement solutions. With the Chinese government seeking assistance, the United States has an opportunity to export basic technical information, especially in the areas of pollution control and monitoring, oil exploration methods, oil drilling technology, water and sewage treatment procedures, hazardous waste and nuclear waste handling techniques, and nuclear power plant safety procedures. In those areas the US has expertise and extensive technical experience, and by exporting the technologies the US would benefit both economically and politically. 59 refs., 3 figs.

  5. CLOUD COMPUTING SECURITY ISSUES

    Directory of Open Access Journals (Sweden)

    Florin OGIGAU-NEAMTIU

    2012-01-01

    Full Text Available The term “cloud computing” has been in the spotlights of IT specialists the last years because of its potential to transform this industry. The promised benefits have determined companies to invest great sums of money in researching and developing this domain and great steps have been made towards implementing this technology. Managers have traditionally viewed IT as difficult and expensive and the promise of cloud computing leads many to think that IT will now be easy and cheap. The reality is that cloud computing has simplified some technical aspects of building computer systems, but the myriad challenges facing IT environment still remain. Organizations which consider adopting cloud based services must also understand the many major problems of information policy, including issues of privacy, security, reliability, access, and regulation. The goal of this article is to identify the main security issues and to draw the attention of both decision makers and users to the potential risks of moving data into “the cloud”.

  6. Ethics issues in retrievability

    International Nuclear Information System (INIS)

    Jensen, M.; Larsson, C.M.; Norden, M.

    2000-01-01

    We can isolate some issues, which should not be unresolved for a longer period of time. Disputes over well-defined waste management options fall in this category. The concept of retrievability has a possibility to invoke a series of questions in the minds of both specialists and non-specialists. It is intrinsically vague, in that it may refer to different phases in the repository's life, and to both open and closed repositories in the long time frame. Requirements for retrievability opens a series of issues, including open-ended philosophical question, which may give the impressions that things are not properly taken care of, since the experts differ in opinion. If such disputes cannot be resolved by consulting the existing legal framework, efforts should be made to put them to trial in the proper forum, i.e. parliament and national or local government or authorities, depending on the problem. In contrast, the value of institutional controls can easily be seen as an ethical value, whether included in the regulation of not. It has the potential to deter human intrusion and to allow remedial action by carrying information about a repository. (author)

  7. Energy issues in Africa

    International Nuclear Information System (INIS)

    Farhandi, M.

    1991-01-01

    The topic of the energy sector-and the petroleum sector in particular-in sub-Saharan Africa might well be considered an insignificant issue compared with many of the energy concerns which now command international attention. However, the World Bank believes that it is important for all those in international energy not to forget about the crucial problems facing Africa. They should become informed and concerned about these problems, and, hopefully, work together to bring about a satisfactory solution for an ongoing development dilemma. Simply put, the cost of imported energy to the African economy is exorbitantly high, sapping the resources needed to produce economic growth and social progress. This paper reports that, to address this issue, the World Bank is about to undertake a major initiative-two ground-breaking studies in the field of energy for sub-Saharan Africa. Both of these proposed studies are designed to find ways to reduce the burden of the cost of energy imports, mainly petroleum products, to this continent. One study will examine the design (and, subsequently, the implementation) of a rationalization scheme for the supply and distribution of petroleum products throughout sub-Saharan Africa. The other will consider the feasibility of transporting Nigeria's natural gas to neighbors to the west, all of which presently are importers of energy

  8. Technical issues for WIPP

    International Nuclear Information System (INIS)

    Hunter, T.O.

    1979-01-01

    Emplacement of wastes in the WIPP will include experiments on various waste types which will provide essential data on waste-rock interaction and repository response. These experiments will include evolution of the synergistic effects of both heat production, radiation, and actual waste forms. While these studies will provide essential data on the validity of waste isolation in bedded salt, they will be preceded by a broad-based experimental program which will resolve many of the current technical issues providing not only an assessment of the safety of performing such experiments but also the technical basis for assurance that the appropriate experiments are performed. Data and predictive modeling techniques, which are currently available, can bound the consequences associated with these technical issues. Predictions of the impact on public safety based on these analyses indicate that safe waste disposal in WIPP salt beds is achievable; however, a major use of WIPP will be to conduct realistic experiments with HLW forms to address some of the unresolved details of these waste/salt interactions

  9. Bituminous sands : tax issues

    International Nuclear Information System (INIS)

    Patel, B.

    2004-01-01

    This paper examined some of the tax issues associated with the production of bitumen or synthetic crude oil from oil sands. The oil sands deposits in Alberta are gaining more attention as the supplies of conventional oil in Canada decline. The oil sands reserves located in the Athabasca, Cold Lake and Peace River areas contain about 2.5 trillion barrels of highly viscous hydrocarbons called bitumen, of which nearly 315 billion barrels are recoverable with current technology. The extraction method varies for each geographic area, and even within zones and reservoirs. The two most common extraction methods are surface mining and in-situ extraction such as cyclic steam stimulation (CSS); low pressure steam flood; pressure cycle steam drive; steam assisted gravity drainage (SAGD); hot water flooding; and, fire flood. This paper also discussed the following general tax issues: bituminous sands definition; bituminous sands leases and Canadian development expense versus Canadian oil and gas property expense (COGPE); Canadian exploration expense (CEE) for surface mining versus in-situ methods; additional capital cost allowance; and, scientific research and experimental development (SR and ED). 15 refs

  10. Ethical issues in neuroscience.

    Science.gov (United States)

    Fuchs, Thomas

    2006-11-01

    The study gives an overview of ethical questions raised by the progress of neuroscience in identifying and intervening in neural correlates of the mind. Ethical problems resulting from brain research have induced the emergence of a new discipline termed neuroethics. Critical questions concern issues, such as prediction of disease, psychopharmacological enhancement of attention, memory or mood, and technologies such as psychosurgery, deep-brain stimulation or brain implants. Such techniques are capable of affecting the individual's sense of privacy, autonomy and identity. Moreover, reductionist interpretations of neuroscientific results challenge notions of free will, responsibility, personhood and the self which are essential for western culture and society. They may also gradually change psychiatric concepts of mental health and illness. These tendencies call for thorough, philosophically informed analyses of research findings and critical evaluation of their underlying conceptions of humans. Advances in neuroscience raise ethical, social and legal issues in relation to the human person and the brain. Potential benefits of applying neuroimaging, psychopharmacology and neurotechnology to mentally ill and healthy persons have to be carefully weighed against their potential harm. Questions concerning underlying concepts of humans should be actively dealt with by interdisciplinary and public debate.

  11. Environmental issues in China

    International Nuclear Information System (INIS)

    Travis, P.S.

    1991-10-01

    Global concern about the environment is increasing, and the People's Republic of China (PRC) is not immune from such concerns. The Chinese face issues similar to those of many other developing nations. The US Department of Energy is particularly interested in national and world pollution issues, especially those that may infringe on other countries' economic growth and development. The DOE is also interested in any opportunities that might exist for US technical assistance and equipment in combating environmental problems. Our studies of articles in the China Daily, and English-language daily newspaper published by the Chinese government, show that population, pollution, and energy are major concerns of the Chinese Communist Party. Thus this report emphasizes the official Chinese government view. Supporting data were also obtained from other sources. Regardless of the severity of their various environmental problems, the Chinese will only try to remedy those problems with the greatest negative effects on its developing economy. They will be looking for foreign assistance, financial and informational, to help implement solutions. With the Chinese government seeking assistance, the United States has an opportunity to export basic technical information, especially in the areas of pollution control and monitoring, oil exploration methods, oil drilling technology, water and sewage treatment procedures, hazardous waste and nuclear waste handling techniques, and nuclear power plant safety procedures. In those areas the US has expertise and extensive technical experience, and by exporting the technologies the US would benefit both economically and politically. 59 refs., 3 figs

  12. Broadband network selection issues

    Science.gov (United States)

    Leimer, Michael E.

    1996-01-01

    Selecting the best network for a given cable or telephone company provider is not as obvious as it appears. The cost and performance trades between Hybrid Fiber Coax (HFC), Fiber to the Curb (FTTC) and Asymmetric Digital Subscriber Line networks lead to very different choices based on the existing plant and the expected interactive subscriber usage model. This paper presents some of the issues and trades that drive network selection. The majority of the Interactive Television trials currently underway or planned are based on HFC networks. As a throw away market trial or a short term strategic incursion into a cable market, HFC may make sense. In the long run, if interactive services see high demand, HFC costs per node and an ever shrinking neighborhood node size to service large numbers of subscribers make FTTC appear attractive. For example, thirty-three 64-QAM modulators are required to fill the 550 MHz to 750 MHz spectrum with compressed video streams in 6 MHz channels. This large amount of hardware at each node drives not only initial build-out costs, but operations and maintenance costs as well. FTTC, with its potential for digitally switching large amounts of bandwidth to an given home, offers the potential to grow with the interactive subscriber base with less downstream cost. Integrated telephony on these networks is an issue that appears to be an afterthought for most of the networks being selected at the present time. The major players seem to be videocentric and include telephony as a simple add-on later. This may be a reasonable view point for the telephone companies that plan to leave their existing phone networks untouched. However, a phone company planning a network upgrade or a cable company jumping into the telephony business needs to carefully weigh the cost and performance issues of the various network choices. Each network type provides varying capability in both upstream and downstream bandwidth for voice channels. The noise characteristics

  13. Hydrogen peroxide safety issues

    International Nuclear Information System (INIS)

    Conner, W.V.

    1993-01-01

    A literature survey was conducted to review the safety issues involved in handling hydrogen peroxide solutions. Most of the information found in the literature is not directly applicable to conditions at the Rocky Flats Plant, but one report describes experimental work conducted previously at Rocky Flats to determine decomposition reaction-rate constants for hydrogen peroxide solutions. Data from this report were used to calculate decomposition half-life times for hydrogen peroxide in solutions containing several decomposition catalysts. The information developed from this survey indicates that hydrogen peroxide will undergo both homogeneous and heterogeneous decomposition. The rate of decomposition is affected by temperature and the presence of catalytic agents. Decomposition of hydrogen peroxide is catalyzed by alkalies, strong acids, platinum group and transition metals, and dissolved salts of transition metals. Depending upon conditions, the consequence of a hydrogen peroxide decomposition can range from slow evolution of oxygen gas to a vapor, phase detonation of hydrogen peroxide vapors

  14. Current issues in asteroseismology

    Energy Technology Data Exchange (ETDEWEB)

    Bazot, Michael; Monteiro, Mario J P F G; Straka, Christian W [Centro de Astrofisica da Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal)

    2008-10-15

    In this contribution we briefly review some of the current issues and promises for the future by asteroseismology. We are entering a new phase in this field driven by the wealth of data that has been collected and data that will soon be available for asteroseismology across the HR Diagram. Major difficulties in the descriptions of stellar interiors that arose in the second half of the 20th century may now be in part addressed and solved (this is the expectation{exclamation_point}) by asteroseismology with unprecedented precision. In this contribution we list some of the key open questions in stellar physics, the seismic data we expect to collect in the near future, and some techniques that will provide the tools to connect data and models.

  15. Nuclear fusion: The issues

    International Nuclear Information System (INIS)

    Griffin, R.D.

    1993-01-01

    The taming of fusion energy, has proved one of the most elusive quests of modern science. For four decades, the United States has doggedly pursued energy's holy grail, pumping more than $9 billion into research and reactor prototypes. This year, the federal government is slated to spend $339 million on fusion, more than the combined amount the government will spend for research on oil, natural gas, solar power, wind power, geothermal energy, biofuels and conservation. This article summarizes the technical, political in terms of international cooperation, economic, planning, etc. issues surrounding the continued development of fusion as a possible power source for the next century. Brief descriptions of how fusion works and of the design of a tokamak fusion machine are included

  16. Emotion, philosophical issues about.

    Science.gov (United States)

    Deonna, Julien; Tappolet, Christine; Teroni, Fabrice

    2015-01-01

    We start this overview by discussing the place of emotions within the broader affective domain-how different are emotions from moods, sensations, and affective dispositions? Next, we examine the way emotions relate to their objects, emphasizing in the process their intimate relations to values. We move from this inquiry into the nature of emotion to an inquiry into their epistemology. Do they provide reasons for evaluative judgments and, more generally, do they contribute to our knowledge of values? We then address the question of the social dimension of emotions, explaining how the traditional nature versus nurture contrast applies to them. We finish by exploring the relations between emotions, motivation and action, concluding this overview with a more specific focus on how these relations bear on some central ethical issues. © 2015 John Wiley & Sons, Ltd.

  17. Utility customer issues

    International Nuclear Information System (INIS)

    Downey, W.H.

    1997-01-01

    Customer issues affected by the restructuring of the $250 billion US electric power industry were discussed. In the past the industry's vertically integrated utilities conducted their business in protected geographic markets. With deregulation and greater competition, that industry structure will change. This presentation highlighted the strategies that Unicom is using to react to the restructuring of the electric power industry. The underlying principle is for the utility to reinvent itself to change its market orientation and focus on customer services, such as reliability, responsiveness, custom tailored solutions, and guaranteed savings over time. Attempting to become total energy providers and delivering integrated solutions to meet the needs of large industrial and commercial consumers, intensive market research, improved service and installation, and sophisticated customer retention initiatives will also have to be high on the agenda

  18. Feminist issues in development.

    Science.gov (United States)

    Antrobus, P

    1987-01-01

    The United Nations Decade for the Advancement of Women, from 1975 to 1985, leaves a legacy of a deeper understanding of the issues, and the emergence of new networks with the experience and commitment to work for further changes. However, the role and status of women did not improve. There is a new commitment to struggle for the ending of all oppression, injustice and violence of all kinds at all levels. Feminism is a consciousness of all forms of women's oppression and a commitment to work against them. Feminist critiques illuminate the larger structures that oppress both women and men. New development theories embracing feminism are necessary to understand how patriarchy and economic systems propogate oppression. The production-oriented approach to rural development is flawed n failing to address women's lack of access to land, credit, training and new technologies. Overwhelming household tasks, cultural norms, and traditional attitudes limit women's involvement in training programs and other development activities. The basic needs approach to rural development provides access to vital services to meet a family's basic needs for nutrition, housing and clothing, and allows people's participation in decision making. However, women have little actual role in decision making so their needs, concerns and perspectives are not taken into account. Women are treated as instruments to achieve goals without appreciating their perspective. Project-based approached emphasize short term goals rather than laying the foundation for longterm changes. Few projects address structural issues or empower women. Projects must include education to increase personal growth and self reliance. Development planning can be enormously enhanced by taking gender differences into account and recognizing that people, specially poor women, can promote their own devleopment. Longterm strategies that challenge existing structures, address the existing economic order, and, most of all, recognize

  19. Issues in energy finance

    Science.gov (United States)

    Khokher, Zeigham Islam

    As opposed to the well developed and understood equity markets, the energy markets are still in their infancy. The explosion of contracts, of both the primary and derivative types, are testament both to the existing size and the untapped growth potential of this exciting industry. However, because of its relative youth many basic issues in the energy markets remain unresolved. This thesis introduces some interesting questions and provides insights into these issues. Thematically, the chapters of this thesis are linked by an emphasis on valuation and risk management decisions. A contribution of this thesis is to show that subtle differences between the endogenous price process in our general equilibrium setting and the exogenous processes considered in earlier papers can generate significant differences in both financial and real option values. In addition to these valuation concerns there has been much debate about the corporate risk management function. Finance theory suggests that a value maximizing corporation should either be indifferent to hedging or, in the presence of certain imperfections, it should completely hedge all exposures. Both these extremes contradict empirical evidence. We show that existing corporate hedging behaviour is best explained in light of both physical market imperfections and directional predictions on future prices. While these speculative motives may arise from corporate hubris or genuine informational advantages, we argue that it would be difficult to implement private information in the absence of noise traders. Related to the risk management decision is the existence of futures risk premia. These premia have been thought to be cause by covariance with priced factors or due to the hedging demands of consumers and producers. This thesis argues that inventories serve as a signal of available quantity, which coupled with consumers fears regarding stockouts can induce a positive relationship between premia and inventories. In

  20. Drug Abuse on College Campuses: Emerging Issues. Issues in Prevention

    Science.gov (United States)

    Higher Education Center for Alcohol, Drug Abuse, and Violence Prevention, 2012

    2012-01-01

    This "Issues in Prevention" focuses on emerging issues concerning drug abuse on college campuses. This issue contains the following articles: (1) Drug Abuse Trends; (2) Q&A With Jim Lange; (3) Bath Salts; (4) Refuse to Abuse; (5) Related Federal Resource; and (6) Higher Education Center Resources.