Group 4 Metal Complexes of Chelating Cyclopentadienyl-ketimide Ligands

Czech Academy of Sciences Publication Activity Database

Večeřa, M.; Varga, Vojtěch; Císařová, I.; Pinkas, Jiří; Kucharczyk, P.; Sedlařík, V.; Lamač, Martin

2016-01-01

Roč. 35, č. 5 (2016), s. 785-798 ISSN 0276-7333 R&D Projects: GA ČR(CZ) GA14-08531S; GA MŠk(CZ) LO1504 Institutional support: RVO:61388955 Keywords : group 4 metal complexes * cyclopentadienyl-ketimide ligands * metallocenes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.862, year: 2016

NCBI nr-aa BLAST: CBRC-GACU-18-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-18-0037 ref|XP_001563383.1| hypothetical repeat protein [Leishmania brazil...iensis] emb|CAM37564.1| hypothetical repeat protein [Leishmania braziliensis] XP_001563383.1 3e-79 39% ...

NCBI nr-aa BLAST: CBRC-OSAT-04-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OSAT-04-0037 ref|XP_001215089.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU33672.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001215089.1 0.019 28% ...

NCBI nr-aa BLAST: CBRC-CFAM-06-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-06-0037 ref|NP_001041562.1| prostaglandin F receptor (FP) [Canis lupus fa...miliaris] gb|AAZ53353.1| prostaglandin F2-alpha receptor [Canis lupus familiaris] NP_001041562.1 0.0 100% ...

NCBI nr-aa BLAST: CBRC-RMAC-03-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-03-0037 ref|ZP_02020913.1| alpha/beta hydrolase fold [Methylobacterium extorque...ns PA1] gb|EDN52425.1| alpha/beta hydrolase fold [Methylobacterium extorquens PA1] ZP_02020913.1 0.36 51% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0037 ref|ZP_05092125.1| hypothetical protein CDSM653_1779 [Carboxydibrachium pacificum DSM... 12653] gb|EEB76026.1| hypothetical protein CDSM653_1779 [Carboxydibrachium pacificum DSM 12653] ZP_05092125.1 0.012 29% ...

NCBI nr-aa BLAST: CBRC-HSAP-10-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-10-0037 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 100% ...

NCBI nr-aa BLAST: CBRC-PABE-09-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-09-0037 ref|YP_890142.1| hypothetical protein MSMEG_5916 [Mycobacterium sme...gmatis str. MC2 155] gb|ABK71889.1| hypothetical protein MSMEG_5916 [Mycobacterium smegmatis str. MC2 155] YP_890142.1 0.033 36% ...

NCBI nr-aa BLAST: CBRC-CELE-06-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CELE-06-0037 ref|NP_001011594.1| G-protein coupled receptor [Apis mellifera] e...mb|CAB76374.1| G-protein coupled receptor [Apis mellifera] gb|ABI94393.1| tyramine receptor [Apis mellifera]... gb|ABI94394.1| tyramine receptor [Apis mellifera] NP_001011594.1 2e-38 29% ...

NCBI nr-aa BLAST: CBRC-RMAC-07-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-07-0037 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-171 97% ...

Use of [SbF.sub.6./sub.] .sup.-./sup. to isolate cationic copper and silver adducts with more than one ethylene on the metal center

Czech Academy of Sciences Publication Activity Database

Fianchini, M.; Campana, C.F.; Chilukuri, B.; Cundari, T.R.; Petříček, Václav; Dias, H.V.

2013-01-01

Roč. 32, č. 10 (2013), s. 3034-3041 ISSN 0276-7333 Institutional support: RVO:68378271 Keywords : organometallic compounds * X-ray structure analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.253, year: 2013

Oxidative Addition of Diphenyldichalcogenides PhEEPh (E = S, Se, Te) to Low-Valent CN- and NCN-Chelated Organoantimony and Organobismuth Compounds

Czech Academy of Sciences Publication Activity Database

Šimon, Petr; Jambor, R.; Růžička, A.; Dostál, I.

2013-01-01

Roč. 32, č. 1 (2013), s. 239-248 ISSN 0276-7333 Institutional support: RVO:61388971 Keywords : MAIN-GROUP ELEMENTS * BOND COVALENT RADII * CRYSTAL-STRUCTURES Subject RIV: CA - Inorganic Chemistry Impact factor: 4.253, year: 2013

Synthesis of Heavy Fluorous Ruthenium Metathesis Catalysts Using the Stereoselective Addition of Polyfluoroalkyllithium to Sterically Hindered Diimines

Czech Academy of Sciences Publication Activity Database

Hošek, J.; Rybáčková, M.; Čejka, J.; Cvačka, Josef; Kvíčala, J.

2015-01-01

Roč. 34, č. 13 (2015), s. 3327 -3334 ISSN 0276-7333 Institutional support: RVO:61388963 Keywords : ring-closing metathesis * form tetrasubstituted olefins * N-heterocyclic carbene Subject RIV: CC - Organic Chemistry Impact factor: 4.186, year: 2015

Reactivity of Tin(II) Guanidinate with 1,2- and 1,3-Diones: Oxidative Cycloaddition or Ligand Substitution ?

Czech Academy of Sciences Publication Activity Database

Chlupatý, T.; Růžičková, Z.; Horáček, Michal; Merna, J.; Alonso, M.; de Proft, F.; Růžička, A.

2015-01-01

Roč. 34, č. 11 (2015), s. 2202-2211 ISSN 0276-7333 Institutional support: RVO:61388955 Keywords : DENSITY-FUNCTIONAL THEORY * CRYSTAL-STRUCTURE * ADDITION- REACTION S Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.186, year: 2015

Electrochemical Evidence for Hemilabile Coordination of 1,3-Dimethyllumazine to [1,1 '-Bis(diorganophosphino)ferrocene]copper(I)

Czech Academy of Sciences Publication Activity Database

Jana, R.; Sarkar, B.; Strobel, S.; Mobin, S. M.; Kaim, W.; Fiedler, Jan

2014-01-01

Roč. 33, č. 18 (2014), s. 4784-4791 ISSN 0276-7333 R&D Projects: GA MŠk LD14129 Institutional support: RVO:61388955 Keywords : electrochemistry * metal complexes * crystal structure Subject RIV: CG - Electrochemistry Impact factor: 4.126, year: 2014

A Ligand-Bridged Heterotetranuclear (Fe2Cu2) Redox System with Fc/Fc(+) and Radical Ion Intermediates

Czech Academy of Sciences Publication Activity Database

Jana, R.; Lissner, F.; Schwederski, B.; Fiedler, Jan; Kaim, W.

2013-01-01

Roč. 32, č. 20 (2013), s. 5879-5886 ISSN 0276-7333 R&D Projects: GA ČR GA203/09/0705 Institutional support: RVO:61388955 Keywords : CHARGE-TRANSFER * COMPLEXES * ELECTRON Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013

Carbosilane Metallodendrimers with Titanocene Dichloride end Groups

Czech Academy of Sciences Publication Activity Database

Strašák, Tomáš; Čermák, Jan; Sýkora, Jan; Horský, Jiří; Walterová, Zuzana; Jaroschik, F.; Harakat, D.

2012-01-01

Roč. 31, č. 19 (2012), s. 6779-6786 ISSN 0276-7333 R&D Projects: GA MŠk(CZ) LC06070 Institutional support: RVO:67985858 ; RVO:61389013 Keywords : dendrimers * titanocene * hydrosilylation Subject RIV: CC - Organic Chemistry Impact factor: 4.145, year: 2012

Observation of Binuclear Palladium Clusters Upon ESI-MS Monitoring of the Suzuki-Miyaura Cross-Coupling Catalyzed by a Dichloro-bis(aminophosphine) Complex of Palladium

Czech Academy of Sciences Publication Activity Database

Agrawal, Divya; Schröder, Detlef; Frech, C. M.

2011-01-01

Roč. 30, č. 13 (2011), s. 3579-3587 ISSN 0276-7333 Institutional research plan: CEZ:AV0Z40550506 Keywords : catalysis * C-C coupling * electrospray ionization * palladium * Suzuki-Miyaura coupling Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.963, year: 2011

Ruthenium Styryl Complexes with Ligands Derived from 2-Hydroxy- and 2-Mercaptopyridine and 2-Hydroxy- and 2-Mercaptoquinoline

Czech Academy of Sciences Publication Activity Database

Abdel-Rahman, O. S.; Maurer, J.; Záliš, Stanislav; Winter, R. F.

2015-01-01

Roč. 34, č. 14 (2015), s. 3611-3628 ISSN 0276-7333 R&D Projects: GA MŠk LD14129 Institutional support: RVO:61388955 Keywords : BRIDGED DIRUTHENIUM COMPLEXES * AB-INITIO PSEUDOPOTENTIALS * IRON SIGMA-ACETYLIDES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.186, year: 2015

Stereoselective Oxidation of Thiacalix[4]arenes with the NaNO3/CF3COOH System

Czech Academy of Sciences Publication Activity Database

Lhoták, P.; Morávek, J.; Šmejkal, T.; Stibor, I.; Sýkora, Jan

2003-01-01

Roč. 44, č. 39 (2003), s. 7333-7336 ISSN 0040-4039 R&D Projects: GA ČR GA203/03/0926 Institutional research plan: CEZ:AV0Z4072921 Keywords : selective oxidation * metal-ions * upper rim Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.326, year: 2003

Synthesis and Catalytic Activity of [Cp′Co(COD)] Complexes Bearing Pendant N-Containing Groups

Czech Academy of Sciences Publication Activity Database

Thiel, I.; Lamač, Martin; Jiao, H.; Spannenberg, A.; Hapke, M.

2013-01-01

Roč. 32, č. 11 (2013), s. 3415-3418 ISSN 0276-7333 R&D Projects: GA ČR GPP207/10/P200 Institutional support: RVO:61388955 Keywords : FUNCTIONALIZED CYCLOPENTADIENYL LIGANDS * SANDWICH COBALT COMPLEXES * METALLOCENE COMPLEXES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013

Synthesis and Structure of Titanocene Complexes with .eta. 2 -Coordinated Internal Ferrocenylacetylenes

Czech Academy of Sciences Publication Activity Database

Štěpnička, P.; Gyepes, R.; Císařová, I.; Varga, Vojtěch; Polášek, Miroslav; Mach, Karel

1999-01-01

Roč. 18, č. 4 (1999), s. 627-633 ISSN 0276-7333 R&D Projects: GA ČR GA203/96/0948; GA ČR GA203/97/0242; GA ČR GA203/96/0111 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.215, year: 1999

Asymmetric Transfer Hydrogenation of Acetophenone N-Benzylimine Using [(RuCl)-Cl-II((S,S)-TsDPEN)(eta(6)-p-cymene)]: A DFT Study

Czech Academy of Sciences Publication Activity Database

Šot, P.; Kuzma, Marek; Václavík, J.; Pecháček, J.; Přech, J.; Januščák, J.; Kačer, P.

2012-01-01

Roč. 31, č. 17 (2012), s. 6496-6499 ISSN 0276-7333 R&D Projects: GA ČR GA104/09/1497; GA ČR GAP106/12/1276 Institutional support: RVO:61388971 Keywords : CARBONYL-COMPOUNDS * KETONES * IMINES Subject RIV: CA - Inorganic Chemistry Impact factor: 4.145, year: 2012

Theoretical Predictions of Redox Potentials of Fischer-Type Chromium Anninocarbene Complexes

Czech Academy of Sciences Publication Activity Database

Kvapilová, Hana; Hoskovcová, Irena; Ludvík, Jiří; Záliš, Stanislav

2014-01-01

Roč. 33, č. 18 (2014), s. 4964-4972 ISSN 0276-7333 R&D Projects: GA MŠk LD14129; GA ČR GA13-04630S Institutional support: RVO:61388955 Keywords : standard hydrogen electrode * density functional theory * metal carbene complexes Subject RIV: CG - Electrochemistry Impact factor: 4.126, year: 2014

Insertion of internal alkynes and ethene into permethylated single tucked-in titanocene

Czech Academy of Sciences Publication Activity Database

Pinkas, Jiří; Císařová, I.; Gyepes, R.; Horáček, Michal; Kubišta, Jiří; Čejka, Jiří; Gómez-Ruiz, S.; Hey-Hawkins, E.; Mach, Karel

2008-01-01

Roč. 27, č. 21 (2008), s. 5532-5547 ISSN 0276-7333 R&D Projects: GA AV ČR IAA400400708; GA MŠk(CZ) LC06070 Institutional research plan: CEZ:AV0Z40400503 Keywords : alkynes * titanocene * ethene Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.815, year: 2008

Synthesis and structure of organoantimony(III) compounds containing antimony−selenium and −tellurium terminal bonds

Czech Academy of Sciences Publication Activity Database

Dostál, L.; Jambor, R.; Růžička, A.; Lyčka, A.; Brus, Jiří; de Proft, F.

2008-01-01

Roč. 27, č. 23 (2008), s. 6059-6062 ISSN 0276-7333 Grant - others:GA ČR(CZ) GP203/07/P094; GA MŠk(CZ) LC523 Program:LC Institutional research plan: CEZ:AV0Z40500505 Keywords : organometallic compounds Subject RIV: CA - Inorganic Chemistry Impact factor: 3.815, year: 2008

Ethene Complexes of Bulky Titanocenes, Their Thermolysis, and Their Reactivity toward 2-Butyne

Czech Academy of Sciences Publication Activity Database

Pinkas, Jiří; Císařová, I.; Gyepes, Robert; Kubišta, Jiří; Horáček, Michal; Mach, Karel

2012-01-01

Roč. 31, č. 15 (2012), s. 5478-5493 ISSN 0276-7333 R&D Projects: GA ČR(CZ) GAP207/12/2368; GA ČR GP203/09/P276 Institutional support: RVO:61388955 Keywords : titanocenes * ethene complexes * thermolysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.145, year: 2012

Separation of Metal Binding and Electron Transfer Sites as a Strategy To Stabilize the Ligand-Reduced and Metal-Oxidized Form of [Mo(CO)4L

Czech Academy of Sciences Publication Activity Database

Bulak, E.; Varnali, T.; Schwederski, B.; Bubrin, D.; Fiedler, Jan; Kaim, W.

2011-01-01

Roč. 30, č. 23 (2011), s. 6441-6445 ISSN 0276-7333 R&D Projects: GA ČR GA203/09/0705 Institutional research plan: CEZ:AV0Z40400503 Keywords : Electron Transfer Sites * [Mo(CO)4L] * metal carbonyl complexes Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.963, year: 2011

Steric Effects in Reactions of Decamethyltitanocene Hydride with Internal Alkynes, Conjugated Diynes, and Conjugated Dienes

Czech Academy of Sciences Publication Activity Database

Pinkas, Jiří; Gyepes, Robert; Císařová, I.; Kubišta, Jiří; Horáček, Michal; Mach, Karel

2014-01-01

Roč. 33, č. 13 (2014), s. 3399-3413 ISSN 0276-7333 R&D Projects: GA ČR(CZ) GAP207/12/2368; GA ČR GP203/09/P276 Institutional support: RVO:61388955 Keywords : atoms * complexation * Electron spin resonance spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.126, year: 2014

Solvent-controlled ring size in double C,N-chelated stannoxane

Czech Academy of Sciences Publication Activity Database

Padělková, Z.; Nechaev, M.; Černošek, Z.; Brus, Jiří; Růžička, A.

2008-01-01

Roč. 27, č. 20 (2008), s. 5303-5308 ISSN 0276-7333 Grant - others:GA ČR(CZ) GA203/07/0468; GA AV ČR(CZ) KJB401550802 Institutional research plan: CEZ:AV0Z40500505 Keywords : compact effective potentials * molecular diorganotin oxide Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.815, year: 2008

Structures and Redox Properties of Metal Complexes of the Electron-Deficient Diphosphine Chelate Ligand R,R-QuinoxP

Czech Academy of Sciences Publication Activity Database

Das, A. K.; Bulak, E.; Sarkar, B.; Lissner, F.; Schleid, T.; Niemeyer, M.; Fiedler, Jan; Kaim, W.

2008-01-01

Roč. 27, č. 2 (2008), s. 218-223 ISSN 0276-7333 R&D Projects: GA MŠk OC 139; GA MŠk OC 140 Institutional research plan: CEZ:AV0Z40400503 Keywords : 2,3-bis(tert-butylmethylphosphino)quinoxaline * radical complexes * phosphine ligand Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.815, year: 2008

Role of the Bridging Arylethynyl Ligand in Bi- and Trinuclear Ruthenium and Iron Complexes

Czech Academy of Sciences Publication Activity Database

Klein, A.; Lavastre, O.; Fiedler, Jan

2006-01-01

Roč. 25, č. 3 (2006), s. 635-643 ISSN 0276-7333 R&D Projects: GA MŠk 1P05OC068; GA MŠk LC510 Institutional research plan: CEZ:AV0Z40400503 Keywords : X-ray crystal * nonlinear optical properties * sigma-acetylide complexes Subject RIV: CG - Electrochemistry Impact factor: 3.632, year: 2006

Reduction-Induced Exclusive Activation of the ansa-1,2-Bis(dimethylsilylene)ethane Chain in ansa-Permethyltitanocene Compounds

Czech Academy of Sciences Publication Activity Database

Pinkas, Jiří; Lukešová, Lenka; Gyepes, R.; Císařová, I.; Kubišta, Jiří; Horáček, Michal; Mach, Karel

2010-01-01

Roč. 29, č. 21 (2010), s. 5199-5208 ISSN 0276-7333 R&D Projects: GA AV ČR IAA400400708; GA MŠk(CZ) LC06070 Institutional research plan: CEZ:AV0Z40400503 Keywords : ansa-1,2-bis(dimethylsilylene) ethane * ansa-permethyltitanocene * titanium Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.888, year: 2010

Synthesis and Structure of Titanium(III) Bis(decamethyltitanocene) Oxide

Czech Academy of Sciences Publication Activity Database

Pinkas, Jiří; Císařová, I.; Gyepes, Robert; Kubišta, Jiří; Horáček, Michal; Mach, Karel

2013-01-01

Roč. 32, č. 21 (2013), s. 6306-6314 ISSN 0276-7333 R&D Projects: GA ČR(CZ) GAP207/12/2368; GA ČR GP203/09/P276 Institutional support: RVO:61388955 Keywords : BINUCLEAR DICYCLOPENTADIENYLTITANIUM(III) COMPLEXES * DICARBOXYLIC-ACID DIANIONS * X-RAY STRUCTURE Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013

Figura moderní melancholie a její inventář: intermediální interpretace jednoho Jiráskova obrazu

Czech Academy of Sciences Publication Activity Database

Fedrová, Stanislava

2014-01-01

Roč. 61, č. 5 (2014), s. 410-428 ISSN 0037-6973 R&D Projects: GA ČR GAP406/12/1711 Institutional support: RVO:68378068 Keywords : melancholy * intermediality * description * atmosphere Subject RIV: AJ - Letters, Mass-media, Audiovision

EVALUASI KEPUASAN PELANGGAN PADA JASA PERPUSTAKAAN DAN ISSN PDII-LIPI

Directory of Open Access Journals (Sweden)

Wahid Nashihuddin

2016-03-01

Full Text Available The purposes of this study are: (a determine the level of customer satisfaction in library and ISSN services; (b determine customers feedback in improving the quality of library and ISSN services. Type of data this study is quantitative. Data were collected by distributing Survei Kepuasan Masyarakat (SKM questionnaires. There are nine indicators in SKM: (1 compliance with the service requirements; (2 easy of servicing procedures; (3 the timeliness of service; (4 the suitability of the service charge; (5 product assurance services; (6 the competence of service personnel; (7 the behavior of the service personnel; (8 clear intimation of service; and (9 the handling of complaints, suggestions, and feedback of services. SKM questionnaire distributed to 60 respondents who have received services from the concierge of library and ISSN service. The data are interpreted with a frequency distribution table. Each indicator item in SKM has processed by the value/score of the class interval system. Results of this study indicated that the information service on library and ISSN are satisfactory of customer. The results based on customer survey uses nine indicators of SKM. Most respondents who become customers of the library and ISSN feel satisfied, the number of 43 respondents (71,7% said they were satisfied and 11 respondents (18,3% expressed great satisfaction with the services. If viewed from the service unit, there are 25 respondents (83,33% as a subscribers of library services and 18 respondents (60% as a ISSN customers whose are satisfied with the those services. However, despite on the results of SKM had been satisfaction, the institution must be to improve the quality system of services ongoing basis. This is done to reduce or eliminate various forms of complaints from customers.

Vzdělanostní mecenát Jiřího II. Lehnicko-Břežského, gymnázium v Břehu a šlechta z českých zemí v 16. a raném 17. století

Czech Academy of Sciences Publication Activity Database

Holý, Martin

2015-01-01

Roč. 70, č. 1 (2015), s. 5-19 ISSN 0037-7511 R&D Projects: GA ČR GPP405/12/P422 Institutional support: RVO:67985963 Keywords : educational patronage * Silesia * Brieg * Early Modern Period Subject RIV: AB - History

Dědictví první světové války: reprezentace a reinterpretace. Sarajevo, 5.-8. října 2016

Czech Academy of Sciences Publication Activity Database

Šístek, František

2017-01-01

Roč. 103, č. 1 (2017), s. 235-239 ISSN 0037-6922 Institutional research plan: CEZ:AV0Z8015903 Institutional support: RVO:67985963 Keywords : First World War * Representations and Reinterpretations * South Eastern Europe Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

Porovnávací obraz lexikálnej zásoby slovenčiny a češtiny v doterajšom lingvistickom spracovaní. I. Začiatky lexikálnej komparácie

Czech Academy of Sciences Publication Activity Database

Nábělková, Mira

2015-01-01

Roč. 80, 5/6 (2015), s. 276-306 ISSN 0037-6981 R&D Projects: GA ČR GAP406/11/2304 Institutional support: RVO:68378092 Keywords : Czech-Slovak lexical comparison * reduplication * footnote lexical explanation * dictionary * lexicography Subject RIV: AI - Linguistics http://www.juls.savba.sk/ediela/sr/2015/5-6/sr15-5-6.pdf

Reactions of Substituted Zirconocene-Bis(trimethylsilyl)ethyne Complexes with Terminal Alkynes

Czech Academy of Sciences Publication Activity Database

Horáček, Michal; Štěpnička, P.; Kubišta, Jiří; Gyepes, R.; Mach, Karel

2004-01-01

Roč. 23, č. 14 (2004), s. 3388-3397 ISSN 0276-7333 R&D Projects: GA ČR GA203/02/0436; GA ČR GA203/00/D037; GA ČR GA203/99/M037 Institutional research plan: CEZ:AV0Z4040901 Keywords : zirconocene complexes * titanocene * crystal structures Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.196, year: 2004

Synthesis, Structures, and Electrochemistry of Group 6 Aminocarbenes with a P -Chelating 1''-(Diphenylphosphino)ferrocenyl Substituent

Czech Academy of Sciences Publication Activity Database

Meca, L.; Dvořák, D.; Ludvík, Jiří; Císařová, I.; Štěpnička, P.

2004-01-01

Roč. 23, č. 10 (2004), s. 2541-2551 ISSN 0276-7333 R&D Projects: GA ČR GA203/04/0487; GA ČR GA203/99/M037; GA ČR GP203/01/P002 Institutional research plan: CEZ:AV0Z4040901 Keywords : synthesis * electrochemistry of group 6 * chelating Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.196, year: 2004

Disputable non-double-couple mechanisms of several strong earthquakes: second-degree moment approach

Czech Academy of Sciences Publication Activity Database

Adamová, Petra; Šílený, Jan

2013-01-01

Roč. 103, č. 5 (2013), s. 2836-2849 ISSN 0037-1106 R&D Projects: GA ČR GAP210/10/0296 Institutional support: RVO:67985530 Keywords : Izmit Turkey earthquake * 1995 Kobe earthquake * rupture processes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.964, year: 2013

Divinylphenylene-bridged diruthenium complexes bearing Ru(CO)Cl((PiPr3Pr)2 entities

Czech Academy of Sciences Publication Activity Database

Maurer, J.; Sarkar, B.; Schwederski, B.; Kaim, W.; Winter, R. F.; Záliš, Stanislav

2006-01-01

Roč. 25, č. 15 (2006), s. 3701-3712 ISSN 0276-7333 R&D Projects: GA AV ČR 1ET400400413; GA MŠk OC 139 Grant - others:Deutsche Forschungsgemeinschaft(DE) Wi 1262/7-1; Deutsche Forschungsgemeinschaft(DE) 436 TSE 113/45/0-1 Institutional research plan: CEZ:AV0Z40400503 Keywords : order regular approximation * mixed -valence complexe * Ray-crystal structure Subject RIV: CG - Electrochemistry Impact factor: 3.632, year: 2006

Epigenetic switch from posttranscriptional to transcriptional silencing is correlated with promoter hypermethylation

Czech Academy of Sciences Publication Activity Database

Fojtová, Miloslava; Van Houdt, H.; Depicker, A.; Kovařík, Aleš

2003-01-01

Roč. 133, č. 3 (2003), s. 1240-1250 ISSN 0032-0889 R&D Projects: GA ČR GA521/01/0037; GA ČR GP521/01/P042 Institutional research plan: CEZ:AV0Z5004920 Keywords : tobacco * gene silencing * transgenic plant Subject RIV: BO - Biophysics Impact factor: 5.634, year: 2003

Survey on the Contemporary Management of Intraoperative Urethral Injuries During Penile Prosthesis Implantation.

Science.gov (United States)

Sexton, Stephanie J; Granieri, Michael A; Lentz, Aaron C

2018-04-01

Intraoperative urethral injury is an uncommon event during the placement of a penile prosthesis, and alternative management strategies have been proposed with continuation of implantation after urethral injury. To evaluate surgeon practices in the management of intraoperative urethral injury. An online survey was sent to the society listservs of the Genitourinary Reconstructive Surgeons (GURS) and the Sexual Medicine Society of North America (SMSNA). Physicians were queried on their fellowship training, experience with penile prosthesis implantation, and management of urethral injuries during prosthesis placement. The response data were analyzed using SAS 9.4 (SAS Institute, Cary, NC, USA). The χ 2 test and Fisher exact test were used to determine associations between variables. Survey responses. 131 survey responses were analyzed. Of the responders, 41.2% were GURS fellowship trained, 19.1% were SMSNA trained, 30.5% were non-fellowship trained, and 9.2% were trained in other fellowships. 25.4% of participants performed more than 50 implantations per year, 37.7% performed 20 to 50 per year, and 36.9% performed fewer than 20 per year. Urethral injury during prosthesis implantation was uncommon, with 26.2% reporting 0 injury, 58.5% reporting 1 to 3 injuries, and 15.4% reporting more than 3 career injuries. Injuries were most commonly encountered during corporal dilation (71.1%) compared with corporal exposure (12.5%) or penile straightening maneuvers (7.0%). There was no statistically significant difference with aborting or continuing implantation among GURS-trained, SMSNA-trained, other fellowship-trained, and non-fellowship-trained surgeons. Of all responders, 55% would abort the procedure after distal urethral injury, whereas 45% would continue the procedure with unilateral or bilateral insertion of cylinders. Patient factors that increased likelihood of terminating the procedure in the case of urethral injury included immunosuppression, spinal cord injury, and

Long-period pulses in broadband records of near earthquakes

Czech Academy of Sciences Publication Activity Database

Zahradník, J.; Plešinger, Axel

2005-01-01

Roč. 95, č. 5 (2005), s. 1928-1939 ISSN 0037-1106 R&D Projects: GA ČR GA205/02/0381; GA ČR GA205/03/1047 Grant - others:EC(XE) EVG3-CT-2002-80006 ( MAGMA ) Institutional research plan: CEZ:AV0Z30120515 Keywords : broadband records * near earthquakes * seismic signal Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.772, year: 2005

"Nenaplněný příslib". Hodnotící strategie české normalizační kritiky

Czech Academy of Sciences Publication Activity Database

Fialová, Alena

2011-01-01

Roč. 58, č. 5 (2011), s. 442-448 ISSN 0037-6973. [Minulosť kritiky a možnosti jej dejinnej konceptualizácie (Podoby, premeny a historická reflexia kritického písania). Bratislava, 16.07.2011-16.07.2011] Institutional research plan: CEZ:AV0Z90560517 Keywords : literary criticism * ideology * normalization * social novel Subject RIV: AJ - Letters, Mass-media, Audiovision

Literární kritika jako RPG

Czech Academy of Sciences Publication Activity Database

Janoušek, Pavel

2011-01-01

Roč. 58, č. 5 (2011), s. 417-424 ISSN 0037-6973. [Minulosť kritiky a možnosti jej dejinnej konceptualizácie (Podoby, premeny a historická reflexia kritického písania). Bratislava, 16.07.2011-16.07.2011] Institutional research plan: CEZ:AV0Z90560517 Keywords : literature * literary criticism * game * game theory * social communication Subject RIV: AJ - Letters, Mass-media, Audiovision

(5), October, 2009 ISSN 1994-9057 (Print) ISSN 2070-0083

African Journals Online (AJOL)

Nekky Umera

The study investigated the feeding habit and problems of the aged people in ... sample comprised of 150 elderly men and women from various occupational groups. ... accumulated wealth and so in poor position to maintain their standard of ... between 65-70 years. Twelve percent of them were between 71-75 years. The.

Purification, crystallization and preliminary X-ray crystallographic analysis of the archaeal phosphoglycerate mutase PH0037 from Pyrococcus horikoshii OT3

Energy Technology Data Exchange (ETDEWEB)

Lokanath, Neratur K.; Kunishima, Naoki, E-mail: kunisima@spring8.or.jp [Advanced Protein Crystallography Research Group, RIKEN SPring-8 Center, Harima Institute, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5148 (Japan)

2006-08-01

The archaeal phosphoglycerate mutase PH0037 from P. horikoshii OT3 has been crystallized in space group R32, with unit-cell parameters a = 155.62, c = 230.35 Å. A 2.2 Å resolution data was collected at SPring-8 beamline BL26B1. Phosphoglycerate mutases catalyze the interconversion of 2-phosphoglycerate and 3-phosphoglycerate in glycolysis and gluconeogenesis pathways. The archaeal phosphoglycerate mutase PH0037 from Pyrococcus horikoshii OT3 has been overexpressed in Escherichia coli and purified. Crystals were obtained using the oil-microbatch method at 291 K. A native data set extending to a resolution of 2.2 Å has been collected and processed in space group R32. Assuming the presence of a dimer in the asymmetric unit, the V{sub M} value is calculated to be 3.0 Å{sup 3} Da{sup −1}, consistent with the dynamic light-scattering experiment result, which shows a dimeric state of the protein in solution. Molecular-replacement trials using the crystal structure of Bacilllus stearothermophilus phosphoglycerate mutase as a search model did not provide a satisfactory solution, indicating substantially different structures of these two phophoglycerate mutases.

On Square-Increasing Ordered Monoids and Idempotent Semirings

Czech Academy of Sciences Publication Activity Database

Horčík, Rostislav

2017-01-01

Roč. 94, č. 2 (2017), s. 297-313 ISSN 0037-1912 R&D Projects: GA ČR GAP202/11/1632 Institutional support: RVO:67985807 Keywords : idempotent semiring * ordered monoid * universal theory * finite embeddability property * decidability Subject RIV: BA - General Mathematics OBOR OECD: Computer science s, information science , bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 0.526, year: 2016

Effect of ZnO-B{sub 2}O{sub 3} addition on the dielectric and the piezoelectric properties of lead-free (Na{sub 0.525}K{sub 0.443}Li{sub 0.037})(Nb{sub 0.883}Sb{sub 0.08}Ta{sub 0.037})O{sub 3} ceramics

Energy Technology Data Exchange (ETDEWEB)

Kim, You-Seok; Yoo, Ju-Hyun [Semyung University, Jecheon (Korea, Republic of)

2014-12-15

(Na{sub 0.525}K{sub 0.443}Li{sub 0.037})(Nb{sub 0.883}Sb{sub 0.08}Ta{sub 0.037})O{sub 3} + x wt% ZnO-B{sub 2}O{sub 3} (NKLNST + x ZnO-B{sub 2}O{sub 3}) lead-free piezoelectric ceramics were prepared via a conventional solid-state reaction for various values of x = 0, 0.3, 0.6, 0.9, 1.2; then, the dielectric and the piezoelectric properties of these ceramics were investigated. A pure perovskite structure and a small secondary phase were observed in the X-ray diffraction patterns. For the 0.3-wt% ZnO-B{sub 2}O{sub 3} specimen, a density of ρ = 4.537 g/cm{sup 3}, an electromechanical coupling factor of k{sub P} = 0.432, a mechanical quality factor of Q{sub m} = 96, and piezoelectric constant of d{sub 33} = 209 pC/N were found to be optimal. These results indicate that the material with this composition is a promising candidate for use in a lead-free piezoelectric device.

ISSN exercise & sport nutrition review: research & recommendations

Science.gov (United States)

2010-01-01

Sports nutrition is a constantly evolving field with hundreds of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper is a five year update of the sports nutrition review article published as the lead paper to launch the JISSN in 2004 and presents a well-referenced overview of the current state of the science related to how to optimize training and athletic performance through nutrition. More specifically, this paper provides an overview of: 1.) The definitional category of ergogenic aids and dietary supplements; 2.) How dietary supplements are legally regulated; 3.) How to evaluate the scientific merit of nutritional supplements; 4.) General nutritional strategies to optimize performance and enhance recovery; and, 5.) An overview of our current understanding of the ergogenic value of nutrition and dietary supplementation in regards to weight gain, weight loss, and performance enhancement. Our hope is that ISSN members and individuals interested in sports nutrition find this review useful in their daily practice and consultation with their clients.

ISSN exercise & sport nutrition review: research & recommendations

Directory of Open Access Journals (Sweden)

Mendel Ron

2010-02-01

Full Text Available Abstract Sports nutrition is a constantly evolving field with hundreds of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper is a five year update of the sports nutrition review article published as the lead paper to launch the JISSN in 2004 and presents a well-referenced overview of the current state of the science related to how to optimize training and athletic performance through nutrition. More specifically, this paper provides an overview of: 1. The definitional category of ergogenic aids and dietary supplements; 2. How dietary supplements are legally regulated; 3. How to evaluate the scientific merit of nutritional supplements; 4. General nutritional strategies to optimize performance and enhance recovery; and, 5. An overview of our current understanding of the ergogenic value of nutrition and dietary supplementation in regards to weight gain, weight loss, and performance enhancement. Our hope is that ISSN members and individuals interested in sports nutrition find this review useful in their daily practice and consultation with their clients.

Setkání bulharistů - Třetí mezinárodní kongres bulharistiky

Czech Academy of Sciences Publication Activity Database

Havlíková, Lubomíra

2014-01-01

Roč. 100, č. 1 (2014), s. 219-221 ISSN 0037-6922 Institutional support: RVO:68378017 Keywords : Bulgarian studies * International Congresses * history * philology * Cyrillo-Methodian studies Subject RIV: AB - History

Počátky spolupráce Československa a Polska při repatriaci svých občanů po druhé světové válce (do uzavření repatriační smlouvy)

Czech Academy of Sciences Publication Activity Database

Friedl, Jiří

2013-01-01

Roč. 99, 3-4 (2013), s. 297-321 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : history * repatriation * Second World War * Czechoslovakia * Poland * mutual help Subject RIV: AB - History

O przekładach powieści Górnołużyczan na język polski

Czech Academy of Sciences Publication Activity Database

Derlatka, Tomasz

2014-01-01

Roč. 83, č. 4 (2014), s. 410-422 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Upper Sorbian Novel * Polish reception * translation Subject RIV: AJ - Letters, Mass-media, Audiovision

Realizacje bilingwizmu w literaturze kaszubskiej.

Czech Academy of Sciences Publication Activity Database

Derlatka, Tomasz

2015-01-01

Roč. 84, č. 2 (2015), s. 186-202 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Kashubian Literature * Bilingualism * Polyphony * Narrative works Subject RIV: AJ - Letters, Mass-media, Audiovision

Slovanský přehled a jeho přínos k interpretaci dějin Sovětského svazu. Proměny výzkumu od konce 50. let do nástupu normalizace

Czech Academy of Sciences Publication Activity Database

Voráček, Emil

2015-01-01

Roč. 101, č. 3 (2015), s. 529-559 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : Slavonic Review * sovietology * history of the Soviet Union * deideologization * stalinism Subject RIV: AB - History

10 Jahre Germanoslavica (1994-2003). Zahlen - Fakten - Hintergründe

Czech Academy of Sciences Publication Activity Database

Ulbrecht, Siegfried

2004-01-01

Roč. 73, č. 3 (2004), s. 305-308 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z9092920 Keywords : periodical * Germanoslavica * jubilee Subject RIV: AF - Documentation, Librarianship, Information Studies

Koleda jako folklorní žánr křesťanského Západu a Východu: k biblickým a apokryfním námětům v západoslovanském folkloru

Czech Academy of Sciences Publication Activity Database

Frolcová, Věra

2013-01-01

Roč. 82, 1-2 (2013), 112-124 ISSN 0037-6736 Institutional support: RVO:68378076 Keywords : carol and Christianity * Slavia Romana * ethnomusicology * studies of Slavic folklore Subject RIV: AC - Archeology, Anthropology, Ethnology

Podzelená: pozoruhodný lexém z prostředí českožidovské komunity

Czech Academy of Sciences Publication Activity Database

Bartoň, Josef

2005-01-01

Roč. 74, 2-3 (2005), s. 303-312 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90090514 Keywords : Czech language * Jewish sociolect * religious expressions Subject RIV: AA - Philosophy ; Religion

Workshop o výzkumu vícejazyčnosti v Dubrovníku

Czech Academy of Sciences Publication Activity Database

Özörencik, Helena

2014-01-01

Roč. 75, č. 4 (2014), s. 366-368 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : plurilingualism * multilingualism * research * sociolinguistics * LINEE+ Subject RIV: AI - Linguistics Impact factor: 0.375, year: 2014

Pražskij lingvističeskij kružok i jevrazijstika

Czech Academy of Sciences Publication Activity Database

Savický, Nikolaj

2011-01-01

Roč. 80, 2/3 (2011), s. 171-173 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90920516 Keywords : linguistic geography * physical geograpfy * language union * interdisciplinarity Subject RIV: AI - Linguistics

Výročí narození zakladatele brněnské balkanistiky prof. dr. Josefa Kabrdy

Czech Academy of Sciences Publication Activity Database

Hladký, Ladislav

2016-01-01

Roč. 102, č. 1 (2016), s. 159-161 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : Historian Josef Kabrda (1906–1968) * Balkan studies, history of Ottoman Empire Subject RIV: AB - History

Ke stavu pravopisné a výslovnostní kodifikace bulharštiny po roce 2000

Czech Academy of Sciences Publication Activity Database

Uhlířová, Ludmila

ročník 75, č. 1 (2006), s. 51-67 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90610518 Keywords : Bulgarian * codification * pronunciation * orthographic dictionaries Subject RIV: AI - Linguistics

Politická opozice v Království SHS ( Jugoslávii)

Czech Academy of Sciences Publication Activity Database

Škerlová, Jana

2014-01-01

Roč. 100, č. 3 (2014), s. 593-628 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : Kingdom of Serbs * Croats and Slovenes (Yugoslavia) * Czechoslovakia * political opposition * royal dictatorship Subject RIV: AB - History

Tradiční technologie výroby potaše

Czech Academy of Sciences Publication Activity Database

Woitsch, Jiří

2002-01-01

Roč. 52, 1/2 (2002), s. 11-19 ISSN 0037-637X Institutional research plan: CEZ:AV0Z9058907 Keywords : potash * chemical technology * economic history Subject RIV: AC - Archeology, Anthropology, Ethnology

Zpívej, kovboji. Sny, představy (a skutečnost) o Divokém západu

Czech Academy of Sciences Publication Activity Database

Jareš, Michal

2013-01-01

Roč. 60, č. 6 (2013), s. 455-461 ISSN 0037-6973 Institutional support: RVO:68378068 Keywords : western (genre) * Hurikán, Bob * poetism * Tarantino, Quentin Subject RIV: AJ - Letters, Mass-media, Audiovision

Increased presence of the thermophilic mosquitoes and potential vectors Anopheles hyrcanus (Pallas, 1771) and Culex modestus Ficalbi 1889 in Central Europe’s lower Dyje River basin (South Moravia, Czech Republic)

Czech Academy of Sciences Publication Activity Database

Šebesta, O.; Gelbič, Ivan

2015-01-01

Roč. 51, č. 3 (2015), s. 272-280 ISSN 0037-9271 Institutional support: RVO:60077344 Keywords : Anopheles hyrcanus * Culex modestus * vector Subject RIV: EH - Ecology, Behaviour Impact factor: 0.575, year: 2015

Der Aufstand der Dinge im russischen Futurismus (am Beispiel Vladimir Majakovskijs)

Czech Academy of Sciences Publication Activity Database

Ulbrecht, Siegfried

2010-01-01

Roč. 79, 3/4 (2010), s. 357-365 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90920516 Keywords : Mayakovsky, Vladimir * Russian literature * Cultural research Subject RIV: AJ - Letters, Mass-media, Audiovision

Přehled historického vývoje česko-makedonských vztahů

Czech Academy of Sciences Publication Activity Database

Hladký, Ladislav; Stehlík, P.

2009-01-01

Roč. 95, č. 3 (2009), s. 365-380 ISSN 0037-6922 Institutional research plan: CEZ:AV0Z80150510 Keywords : Czech-Macedonian relations * Macedonian question * Macedonian studies * Mecedonian diaspora Subject RIV: AB - History

Když cenzura produkuje: Na příkladu Zakázaných próz Vladimíra Mináče

Czech Academy of Sciences Publication Activity Database

Šámal, Petr

2016-01-01

Roč. 63, č. 6 (2016), s. 479-484 ISSN 0037-6973 Institutional support: RVO:68378068 Keywords : censorship * Mináč, Vladimír * fetishism * new censorship Subject RIV: AJ - Letters, Mass-media, Audiovision

Identification of important VO spectral services benefiting from deployment on the Grid

Czech Academy of Sciences Publication Activity Database

Škoda, Petr

2009-01-01

Roč. 2, č. 80 (2009), s. 484-492 ISSN 0037-8720 Institutional research plan: CEZ:AV0Z10030501 Keywords : virtual observatory * GRID computing * web services Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Bydlení, bytová otázka a bytové poměry v Baťově Zlíně v letech 1918- 1938

Czech Academy of Sciences Publication Activity Database

Ševeček, Ondřej

2006-01-01

Roč. 104, č. 1 (2006), s. 18-48 ISSN 0037-6833 Institutional research plan: CEZ:AV0Z90090514 Keywords : Urbanization * industrial housing * company town Zlin * Bata company Subject RIV: AA - Philosophy ; Religion

Chudá holka. Serializovaný román pro ženy a dívky v počátcích české populární žurnalistiky

Czech Academy of Sciences Publication Activity Database

Hemelíková, Blanka

2016-01-01

Roč. 63, č. 2 (2016), s. 104-113 ISSN 0037-6973 Institutional support: RVO:68378068 Keywords : romance * popular literature * Čech, Václav * the 1890s Subject RIV: AJ - Letters, Mass-media, Audiovision

II. mezinárodní konference Etnolingvistika – onomastika – etimologija

Czech Academy of Sciences Publication Activity Database

Janyšková, Ilona

2012-01-01

Roč. 81, č. 4 (2012), s. 496-499 ISSN 0037-6736 R&D Projects: GA ČR GAP406/10/1346 Institutional support: RVO:68378092 Keywords : ethnolinguistics * onomastics * etymology Subject RIV: AI - Linguistics

Sergej A. Esenins Gedichtzyklus Ljubov' chuligana (1923). Beispiel einer Strukturanalyse

Czech Academy of Sciences Publication Activity Database

Ulbrecht, Siegfried

2007-01-01

Roč. 76, č. 1 (2007), s. 13-19 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90920516 Keywords : Esenin Sergej * lyric cycle * Russian poetry Subject RIV: AJ - Letters, Mass-media, Audiovision

Československo-jugoslávské vztahy v přelomovém roce 1929

Czech Academy of Sciences Publication Activity Database

Škerlová, Jana

2014-01-01

Roč. 100, č. 2 (2014), s. 271-296 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : political relations * Czechoslovakia * Kingdom of Serbs * Croats and Slovenes * Kingdom of Yugoslavia * Royal Dictatorship Subject RIV: AB - History

Panoptikon ruské literatury. Nad románem Andreje Bitova Puškinův dům

Czech Academy of Sciences Publication Activity Database

Olšovský, Miroslav

2017-01-01

Roč. 86, č. 1 (2017), s. 15-24 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : postmodern literature * Russian novel * museum * imperialism * Panopticon Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

Brachystomatidae, Empididae and Hybotidae (Diptera) of Uzh River Basin, with additions to checklists of Ukraine

Czech Academy of Sciences Publication Activity Database

van der Weele, R.; Hrivniak, Ľuboš; Kappert, J.; Manko, P.; Shamshev, I.; Oboňa, J.

2017-01-01

Roč. 53, č. 2 (2017), s. 92-98 ISSN 0037-9271 Institutional support: RVO:60077344 Keywords : faunistics * dance flies * new record Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.513, year: 2016

Politická opozice v Jugoslávii po vydání oktrojované ústavy 1931 a postoj Československa.

Czech Academy of Sciences Publication Activity Database

Škerlová, Jana

2016-01-01

Roč. 102, č. 1 (2016), s. 9-32 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : Czechoslovakia * Kingdom of Yugoslavia * political opposition * octroyed constitution * parliamentary elections * political and diplomatic relations Subject RIV: AB - History

Ze zlaté Prahy až do Chorvatska 19. století

Czech Academy of Sciences Publication Activity Database

Černý, Marcel

2012-01-01

Roč. 81, č. 4 (2012), s. 476-481 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Czech literature * Croatian-Czech literary relations * Croatian literary journals * literary reception Subject RIV: AJ - Letters, Mass-media, Audiovision

Češskaja kul'tura sreda i russkije chudožniki-emigranty

Czech Academy of Sciences Publication Activity Database

Jančárková, Julie

2011-01-01

Roč. 80, 2-3 (2011), s. 289-302 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90920516 Keywords : Russian fine art * Russian emigration * Russian art Subject RIV: AL - Art, Architecture, Cultural Heritage

Devonian/Carboniferous boundary glacioeustatic fluctuations in a platform-to-basin direction: A geochemical approach of sequence stratigraphy in pelagic settings

Czech Academy of Sciences Publication Activity Database

Bábek, O.; Kumpan, T.; Kalvoda, J.; Matys Grygar, Tomáš

2016-01-01

Roč. 337, MAY (2016), s. 81-99 ISSN 0037-0738 Institutional support: RVO:61388980 Keywords : Element geochemistry * Hangenberg event * Glacioeustasy * Devonian/Carboniferous boundary * Sedimentation rate Subject RIV: DD - Geochemistry Impact factor: 2.373, year: 2016

Co je nářeční syntax?

Czech Academy of Sciences Publication Activity Database

Šipková, Milena

2013-01-01

Roč. 82, 1-2 (2013), s. 220-224 ISSN 0037-6736 R&D Projects: GA ČR GAP406/11/1786 Keywords : Czech dialect ology * dialect syntax * common language * spontaneous speech Subject RIV: AI - Linguistics

Slovensko-česká a česko-slovenská dvojjazyčná lexikografia. Vývinový prehľad od 19. storočia po súčasnosť. Časť 2

Czech Academy of Sciences Publication Activity Database

Gajdošová, Katarína

2015-01-01

Roč. 80, 1/2 (2015), s. 37-72 ISSN 0037-6981 R&D Projects: GA ČR GAP406/11/2304 Institutional support: RVO:68378092 Keywords : dictionary * lexicography * bilingual * Slovak * Czech Subject RIV: AI - Linguistics

Masarykʼs Correspondence with the South Slavs: A Collection of Letters from Milan Pribićević to T. G. Masaryk

Czech Academy of Sciences Publication Activity Database

Hladký, Ladislav; Škerlová, Jana; Cibulka, Pavel

2016-01-01

Roč. 102, č. 3 (2016), s. 393-422 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : T. G. Masaryk * South Slavs * correspondence * Milan Pribićević * Czech-South Slavs relations Subject RIV: AB - History

Sémantické slapy v textových strukturách

Czech Academy of Sciences Publication Activity Database

Hřebíček, Luděk

2007-01-01

Roč. 68, č. 2 (2007), 83-90 ISSN 0037-7031 Institutional research plan: CEZ:AV0Z90210515 Keywords : semantic (contextual) weight of lexical units * Menzerath-Altmann´s law * text theory Subject RIV: AI - Linguistics

Zpracování keramického středověkého souboru z Lažan u Skutče

Czech Academy of Sciences Publication Activity Database

Kloužková, A.; Svobodová, Ljuba; Zemenová, P.

2012-01-01

Roč. 62, 13-14 (2012), s. 362-367 ISSN 0037-637X Institutional research plan: CEZ:AV0Z80020508 Institutional support: RVO:67985912 Keywords : archaeological ceramics * medieval pottery * restoration Subject RIV: AC - Archeology, Anthropology, Ethnology

Ideologická opozice „Východ-Západ“ v ruské literatuře a její postupné překonávání

Czech Academy of Sciences Publication Activity Database

Ulbrechtová, Helena

2010-01-01

Roč. 79, 3/4 (2010), s. 379-395 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90920516 Keywords : Cold War * East-West * Voznesenkiy, And rey * literary studies Subject RIV: AJ - Letters, Mass-media, Audiovision

Mikrostruktura a restaurování pravěkých nádob z Běchovic

Czech Academy of Sciences Publication Activity Database

Zemenová, P.; Svobodová, Ljuba; Kloužková, A.; Alblová, D.

2012-01-01

Roč. 62, 13-14 (2012), s. 357-361 ISSN 0037-637X Institutional research plan: CEZ:AV0Z80020508 Institutional support: RVO:67985912 Keywords : archaeological ceramics * prehistoric pottery * restoration Subject RIV: AC - Archeology, Anthropology, Ethnology

Protetické v- mezi statistikou a rétorikou: K článku Vliv jazykových faktorů na užívání protetického v- v pražské mluvě

Czech Academy of Sciences Publication Activity Database

Homoláč, Jiří; Mrázková, Kamila; Veroňková, J.

2016-01-01

Roč. 77, č. 2 (2016), s. 143-154 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : variationist sociolinguistics * prothetic v- * apparent time hypothesis * gender * Prague vernacular Subject RIV: AI - Linguistics Impact factor: 0.625, year: 2016

Polské ultimatum Litvě v březnu 1938: mezinárodní aspekty zapomenuté krize předválečné Evropy

Czech Academy of Sciences Publication Activity Database

Dejmek, Jindřich

Roč. 94, č. 2 ( 2008 ), s. 209-220 ISSN 0037-6922 Institutional research plan: CEZ:AV0Z80150510 Keywords : History of Czechoslovak Foreign Policy * History of Diplomacy * History of International Relations Subject RIV: AB - History

Ivan Pavlov (1. 1. 1944 – 4. 9. 2005)

Czech Academy of Sciences Publication Activity Database

Černý, Marcel

2006-01-01

Roč. 75, č. 1 (2006), s. 120-122 ISSN 0037-6736 Institutional research plan: CEZ:AV0Z90920516 Keywords : Czech studies in the world * Bulgarian-Czech cultural relations Subject RIV: AJ - Letters, Mass-media, Audiovision

Jazyk i tvorčestvo

Czech Academy of Sciences Publication Activity Database

Savický, Nikolaj

2011-01-01

Roč. 80, č. 4 (2011), s. 399-403 ISSN 0037-6736 R&D Projects: GA AV ČR IAA900920703 Institutional research plan: CEZ:AV0Z90920516 Keywords : language * history of language Subject RIV: AI - Linguistics

Opavané jako vychovatelé šlechty z českých zemí na prahu novověku (1550-1620)

Czech Academy of Sciences Publication Activity Database

Holý, Martin

2009-01-01

Roč. 107, č. 4 (2009), s. 241-255 ISSN 0037-6833 R&D Projects: GA AV ČR KJB800150801 Institutional research plan: CEZ:AV0Z80150510 Keywords : nobility * preceptors * private education Subject RIV: AB - History

Znovuuvedení kritické analýzy diskurzu do českého prostředí

Czech Academy of Sciences Publication Activity Database

Homoláč, Jiří; Mrázková, Kamila

2017-01-01

Roč. 78, č. 3 (2017), s. 237-253 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : critical discourse analysis * discourse-historical approach * discursive strategies * topos Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

Biblické citáty v apokryfních Otázkách Bartolomějových

Czech Academy of Sciences Publication Activity Database

Chromá, Martina

2016-01-01

Roč. 85, 3-4 (2016), s. 287-302 ISSN 0037-6736 R&D Projects: GA MK DG16P02H024 Keywords : Questions of Bartholomew * Apocrypha * Old Church Slavonic Subject RIV: AI - Linguistics OBOR OECD: Specific languages

Reflexe politické linie Kominterny na přelomu 20. - 30. let v materiálech německé sociální demokracie. Archiv der deutschen sozialen Demokratie, Friedrich Ebert Stiftung, Bonn

Czech Academy of Sciences Publication Activity Database

Voráček, Emil

2007-01-01

Roč. 93, č. 4 (2007), s. 580-583 ISSN 0037-6922 R&D Projects: GA AV ČR(CZ) IAA800150603 Institutional research plan: CEZ:AV0Z80150510 Keywords : history * Comintern * communist movement Subject RIV: AB - History

Transduction as an alternative to intertextuality in the realm of fictional worlds

Czech Academy of Sciences Publication Activity Database

Fořt, Bohumil

2012-01-01

Roč. 73, č. 4 (2012), s. 366-373 ISSN 0037-7031 Institutional support: RVO:68378068 Keywords : intertextuality * fictional worlds * Doležel, Lubomír Subject RIV: AJ - Letters, Mass-media, Audiovision Impact factor: 0.233, year: 2012

Obraz v příběhu - ekfráze ve vyprávění. Předběžné návrhy k rozlišení popisnosti a vizuality

Czech Academy of Sciences Publication Activity Database

Jedličková, Alice; Fedrová, Stanislava

2010-01-01

Roč. 57, č. 1 (2010), s. 29-59 ISSN 0037-6973 Institutional research plan: CEZ:AV0Z90560517 Keywords : narrative * ekphrasis * visuality * descriptivity * intermedia studies * Urban, Miloš * Arbes, Jakub Subject RIV: AJ - Letters, Mass-media, Audiovision

Kritická analýza současného politického diskursu: Nový jazyk britských labouristů

Czech Academy of Sciences Publication Activity Database

Karhanová, Kamila

2002-01-01

Roč. 63, č. 2 (2002), s. 111-117 ISSN 0037-7031 R&D Projects: GA MŠk LN00A023 Institutional research plan: CEZ:AV0Z9061902 Keywords : English * analysis * political discourse Subject RIV: AI - Linguistics

Trendy v elektronické diachronní lexikografii a jejich využitelnost ve slavistice

Czech Academy of Sciences Publication Activity Database

Knoll, Vladislav

2017-01-01

Roč. 86, 2-3 (2017), s. 301-334 ISSN 0037-6736 R&D Projects: GA MK DG16P02H024 Keywords : diachronic lexicography * electronic lexicography * Slavonic lexicography Subject RIV: AI - Linguistics OBOR OECD: General language studies

Červená knihovna proti červené knihovně. Žánrové stereotypy a jejich variace

Czech Academy of Sciences Publication Activity Database

Holanová, Markéta

2016-01-01

Roč. 63, č. 2 (2016), s. 114-125 ISSN 0037-6973 Institutional support: RVO:68378068 Keywords : romance novels * Jabůrková, Jožka * Tippmannová, Marie * genre stereotypes * publishing context Subject RIV: AJ - Letters, Mass-media, Audiovision

Přechylování příjmení v češtině jako případ jazykového managementu

Czech Academy of Sciences Publication Activity Database

Kopecký, Jakub

2014-01-01

Roč. 75, č. 4 (2014), s. 271-293 ISSN 0037-7031 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : language management * feminine * derivation * surname Subject RIV: AI - Linguistics Impact factor: 0.375, year: 2014

Pojem významu ve světle pražské poetiky a estetiky

Czech Academy of Sciences Publication Activity Database

Kubínová, Marie

2005-01-01

Roč. 66, č. 2 (2005), s. 98-102 ISSN 0037-7031 R&D Projects: GA ČR GA405/03/0416 Institutional research plan: CEZ:AV0Z90560517 Keywords : semiotics * structuralism Subject RIV: AJ - Letters, Mass-media, Audiovision

K roztržení plynule lité bramy (18 t) a prasknutí opěrného válce (32 t)

Czech Academy of Sciences Publication Activity Database

Stránský, K.; Kavička, F.; Rek, Antonín; Masarik, M.

2014-01-01

Roč. 62, 1-2 (2014), s. 26-29 ISSN 0037-6825 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : continually cast * slab * rupture * idle roll * breaking * co-effect * hydrogen Subject RIV: JG - Metallurgy

Problém repatriace dětských utečenců z Řecka v politice československého komunistického režimu let 1948-1954

Czech Academy of Sciences Publication Activity Database

Hradečný, Pavel

2004-01-01

Roč. 90, č. 2 (2004), s. 275-294 ISSN 0037-6922 R&D Projects: GA ČR GA409/03/0138 Institutional research plan: CEZ:AV0Z8015903 Keywords : history * greek-czechoslovak relations * repatriation Subject RIV: AB - History

Charakterizace a restaurování glazovaných historických pánviček

Czech Academy of Sciences Publication Activity Database

Jonášová, Šárka; Kloužková, A.; Svobodová, Ljuba

2012-01-01

Roč. 62, 13/14 (2012), s. 368-373 ISSN 0037-637X R&D Projects: GA TA ČR TA01010844 Institutional support: RVO:67985891 ; RVO:67985912 Keywords : ceramic pelvis * chemical composition * glaze Subject RIV: AC - Archeology, Anthropology, Ethnology

Dva dokumenty k otázce prodloužení dvouleté lhůty dodatkového protokolu československo-polské smlouvy z roku 1947

Czech Academy of Sciences Publication Activity Database

Friedl, Jiří

2009-01-01

Roč. 95, č. 4 (2009), s. 483-489 ISSN 0037-6922 R&D Projects: GA ČR GA409/09/0951 Institutional research plan: CEZ:AV0Z80150510 Keywords : Czechoslovakia * Poland * relations * treaty of alliance Subject RIV: AB - History

Fueling QSOs: the relevance of mergers

Czech Academy of Sciences Publication Activity Database

Bennert, N.; Canalizo, G.; Jungwiert, Bruno; Stockton, A.; Schweizer, F.; Peng, Ch.; Lacy, M.

2008-01-01

Roč. 79, č. 4 (2008), s. 1247-1250 ISSN 0037-8720 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : galaxy mergers * quasars * photometry Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

XIII. mezinárodní sjezd slavistů - Lublaň 2003. Sociolingvistika

Czech Academy of Sciences Publication Activity Database

Gladkova, Hana

2004-01-01

Roč. 73, č. 2 (2004), s. 227-230 ISSN 0037-6736. [Mezinárodní kongres slavistů /13./. Ljubljana, 15.08.2003-21.08.2003] Institutional research plan: CEZ:AV0Z9092920 Keywords : sociolinguistics Subject RIV: AI - Linguistics

Příprava a vlastnosti kovových nízkoemisivních vrstev na sklech

Czech Academy of Sciences Publication Activity Database

Petrýdes, D.; Brožek, Vlastimil

2007-01-01

Roč. 57, č. 9 (2007), s. 221-225 ISSN 0037-637X Institutional research plan: CEZ:AV0Z20430508 Keywords : Metalic filters * magnetron sputtering * low-emissivity systems * barier layers Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

Výskyt osteoporózy u pacientů s roztroušenou sklerózou v závislosti na míře kortikoterapie a stupni hybného postižení

Czech Academy of Sciences Publication Activity Database

Havrdová, E.; Týblová, M.; Štěpán, J.; Horáková, D.; Tichá, V.; Nováková, I.; Zelená, L.; Zikán, V.; Hlásenská, Jana

67/100, č. 4 (2004), s. 234-240 ISSN 1210-7859 Institutional research plan: CEZ:AV0Z1030915 Keywords : multiple sclerosis * osteoporosis * glucocorticoids * immobility * D vitamin * calcium Subject RIV: FP - Other Medical Disciplines Impact factor: 0.037, year: 2004

Normapolles. Comparaison entre l´Europe centrale et du Sud-Est pendant le Cénomanien et le Turonien: évolution de la biodiversité et paléoenvironment

Czech Academy of Sciences Publication Activity Database

Méon, H.; Guignard, G.; Pacltová, B.; Svobodová, Marcela

2004-01-01

Roč. 175, č. 6 (2004), s. 579-593 ISSN 0037-9409 R&D Projects: GA ČR(CZ) GA205/01/1582 Keywords : angiosperm pollen * biodiversity * Cenomanian-Turonian Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.670, year: 2004

The Silk od Lepidoptera

Czech Academy of Sciences Publication Activity Database

Fedič, Robert; Žurovec, Michal; Sehnal, František

2002-01-01

Roč. 7, - (2002), s. 1-15 ISSN 0037-2455 R&D Projects: GA ČR GA204/00/0019; GA MŠk ME 204 Institutional research plan: CEZ:AV0Z5007907 Keywords : Bombyx * Antheraea * Galleria Subject RIV: CE - Biochemistry

Zkoumání ruské filosofie v českém prostředí po roce 1990

Czech Academy of Sciences Publication Activity Database

Nykl, Hanuš

2017-01-01

Roč. 103, č. 3 (2017), s. 621-642 ISSN 0037-6922 Institutional support: RVO:68378017 Keywords : Russian Philosophy * Historiography * Czech scholars * history of science Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy , History and Philosophy of science and technology

Za pragmatikou do Toruně

Czech Academy of Sciences Publication Activity Database

Vajdlová, Miloslava; Voleková, Kateřina

2012-01-01

Roč. 73, č. 1 (2012), s. 76-78 ISSN 0037-7031 R&D Projects: GA ČR GAP406/10/1153 Institutional support: RVO:68378092 Keywords : pragmatics * historical pragmatics Subject RIV: AI - Linguistics Impact factor: 0.233, year: 2012

Emauzský hlaholský nápis - příspěvek k hlaholské epigrafice

Czech Academy of Sciences Publication Activity Database

Čermák, Václav

2005-01-01

Roč. 74, 2-3 (2005), s. 343-358 ISSN 0037-6736 R&D Projects: GA AV ČR IAA9092403 Institutional research plan: CEZ:AV0Z90920516 Keywords : Glagolitic Graffito * Emaus Monastery in Prague Subject RIV: AI - Linguistics

Po naší civilizaci zbudou stopy v genomech - stabilita transgenní DNA a obranné mechanizmy genomu

Czech Academy of Sciences Publication Activity Database

Kovařík, Aleš

2004-01-01

Roč. 83, č. 12 (2004), s. 696-699 E-ISSN 1214-4029 R&D Projects: GA ČR GA521/01/0037 Institutional research plan: CEZ:AV0Z5004920 Keywords : GMO * epigenetics * transgene expression Subject RIV: BO - Biophysics

Kognitivní věda - literatura, teorie literatury, hermeneutika

Czech Academy of Sciences Publication Activity Database

Trávníček, Jiří

2004-01-01

Roč. 51, č. 6 (2004), s. 454-459 ISSN 0037-6973 R&D Projects: GA ČR(CZ) GA405/04/1095 Institutional research plan: CEZ:AV0Z9056905 Keywords : literary theory Subject RIV: AJ - Letters, Mass-media, Audiovision

Dialogy s Olgou Müllerovou

Czech Academy of Sciences Publication Activity Database

Hoffmannová, Jana

2017-01-01

Roč. 78, č. 1 (2017), s. 89-93 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : Olga Müllerová * dialogue analysis * spoken communication * syntax of spoken Czech Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

Tutorial on earthquake rotational effects: historical examples

Czech Academy of Sciences Publication Activity Database

Kozák, Jan

2009-01-01

Roč. 99, 2B (2009), s. 998-1010 ISSN 0037-1106 Institutional research plan: CEZ:AV0Z30120515 Keywords : rotational seismic models * earthquake rotational effects * historical earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.860, year: 2009

The broad band spectral properties of SgrA* . The fate of the dusty object approaching the center

Czech Academy of Sciences Publication Activity Database

Eckart, A.; Muzic, K.; Yazici, S.; Sabha, N.; Shahzamanian, B.; Witzel, G.; Moser, L.; García-Marín, M.; Valencia-S, M.; Jalali, B.; Bremer, M.; Straubmeier, C.; Rauch, C.; Buchholz, R. M.; Kunneriath, Devaky; Moultaka, J.

2013-01-01

Roč. 84, č. 3 (2013), s. 618-621 ISSN 0037-8720. [X-ray astronomy: towards the next 50 years!. Milano, 01.10.2012-05.10.2012] Institutional support: RVO:67985815 Keywords : galaxy center * infrared stars Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Developments in new fluid rotational seismometers: instrument performance and future directions

Czech Academy of Sciences Publication Activity Database

Evans, J. R.; Kozák, Jan; Jedlička, Petr; Jedlička, Z.

2016-01-01

Roč. 106, č. 6 (2016), s. 2865-2876 ISSN 0037-1106 R&D Projects: GA MŠk(CZ) ME10008 Institutional support: RVO:67985530 Keywords : ground motions * sensors * seismology Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.146, year: 2016

Odlévání turbínových kol turbodmychadel ze slitin TiAl technologií přesného lití

Czech Academy of Sciences Publication Activity Database

Zemčík, L.; Dlouhý, Antonín; Umshaus, J.

2008-01-01

Roč. 56, č. 9-10 (2008), s. 417-421 ISSN 0037-6825 R&D Projects: GA ČR GA106/07/0762 Institutional research plan: CEZ:AV0Z20410507 Keywords : TiAl alloys * investment casting * turbocharger Subject RIV: JG - Metallurgy

Dějiny jihovýchodní Evropy (Balkánu) na stránkách časopisu Slovanský přehled

Czech Academy of Sciences Publication Activity Database

Hladký, Ladislav

2015-01-01

Roč. 101, č. 3 (2015), s. 575-592 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : Slavonic Review journal * historiography of Southeast Europe * history of Yugoslavia * history of Bulgaria * history of Romania * history of Albania * history of Greece Subject RIV: AB - History

Latinský ablativ absolutní v staroslověnském překladu

Czech Academy of Sciences Publication Activity Database

Konzal, Václav

2012-01-01

Roč. 81, č. 2 (2012), s. 190-204 ISSN 0037-6736 R&D Projects: GA ČR(CZ) GAP406/12/1790 Institutional support: RVO:68378017 Keywords : Church Slavonic in Bohemia * ablativus absolutus * translations techniques * parcipital constructions Subject RIV: AI - Linguistics

V hlavní roli pragma(lingvis)tika

Czech Academy of Sciences Publication Activity Database

Nejedlý, Petr

2011-01-01

Roč. 80, č. 4 (2011), s. 490-492 ISSN 0037-6736 R&D Projects: GA ČR GAP406/10/1165; GA MŠk(CZ) LC546 Institutional research plan: CEZ:AV0Z90610518 Keywords : pragmalinguistics * conference Subject RIV: AI - Linguistics

4th International Language Management Symposium

Czech Academy of Sciences Publication Activity Database

Prošek, Martin

2016-01-01

Roč. 77, č. 3 (2016), s. 233-240 ISSN 0037-7031. [international language management symposium] Institutional support: RVO:68378092 Keywords : language management theory * international language symposium * language management Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

Vejdu do pokoje svých synů a ptám se šeptem "Spíš?": K možnostem výzkumu šeptání v běžné komunikaci

Czech Academy of Sciences Publication Activity Database

Jílková, Lucie

2015-01-01

Roč. 76, č. 1 (2015), s. 39-58 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : whispering * communicative aim * systematic self-observation Subject RIV: AI - Linguistics Impact factor: 0.679, year: 2015

Groteskno Haškových cestovních povídek

Czech Academy of Sciences Publication Activity Database

Hrbata, Zdeněk

2014-01-01

Roč. 61, č. 3 (2014), s. 181-198 ISSN 0037-6973 R&D Projects: GA ČR GA13-29985S Institutional support: RVO:68378068 Keywords : travel ogues * grotesqueness * parody * Hašek, Jaroslav Subject RIV: AJ - Letters, Mass-media, Audiovision

Pozdrav v indoevropském areálu (původ, motivace, funkce)

Czech Academy of Sciences Publication Activity Database

Karlíková, Helena

2016-01-01

Roč. 77, č. 4 (2016), s. 337-353 ISSN 0037-7031 R&D Projects: GA ČR(CZ) GA13-17435S Institutional support: RVO:68378092 Keywords : Indo-European * greetings * etymology * semantics Subject RIV: AI - Linguistics Impact factor: 0.625, year: 2016

Rukopisná zachování církevněslovanské legendy o svaté Anastázii

Czech Academy of Sciences Publication Activity Database

Čajka, František

2008-01-01

Roč. 77, 1-3 (2008), s. 17-28 ISSN 0037-6736 R&D Projects: GA AV ČR(CZ) KJB915270801 Institutional research plan: CEZ:AV0Z90920516 Keywords : manuscript * Old Church Slavonic * Church Slavonic * hagiography Subject RIV: AI - Linguistics

Pojetí výslovnosti v českých výkladových slovnících (výzva k diskusi)

Czech Academy of Sciences Publication Activity Database

Štěpánová, Veronika

2013-01-01

Roč. 74, č. 4 (2013), s. 279-297 ISSN 0037-7031 R&D Projects: GA ČR(CZ) GA13-00372S Institutional support: RVO:68378092 Keywords : pronunciation * Czech monolingual dictionaries * phonetic transcription * lexicography Subject RIV: AI - Linguistics Impact factor: 0.133, year: 2013

Ke konceptu minimální intervence

Czech Academy of Sciences Publication Activity Database

Beneš, Martin; Prošek, Martin

2011-01-01

Roč. 72, č. 1 (2011), s. 39-55 ISSN 0037-7031 Institutional research plan: CEZ:AV0Z90610518 Keywords : language cultivation * language counselling * codification * Concept of Minimal Intervention * language norm * literary language Subject RIV: AI - Linguistics Impact factor: 0.158, year: 2011

Italský přehled slovanského literárního písemnictví

Czech Academy of Sciences Publication Activity Database

Bláhová, Emilie

2010-01-01

Roč. 79, 3-4 (2010), s. 422-432 ISSN 0037-6736 R&D Projects: GA AV ČR IAA900920901 Institutional research plan: CEZ:AV0Z90920516 Keywords : Slavonic literature * Medieval * Slavia orthodoxa * Slavia romana Subject RIV: AJ - Letters, Mass-media, Audiovision

Sociolingvistické sympozium v Berlíně

Czech Academy of Sciences Publication Activity Database

Kaderka, Petr; Sloboda, M.; Sherman, T.; Mrázková, Kamila; Dovalil, V.; Havlík, Martin

2013-01-01

Roč. 74, č. 3 (2013), s. 227-236 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : sociolinguistics * language and the city * super-diversity Subject RIV: AI - Linguistics Impact factor: 0.133, year: 2013

Německé podnikání Baťova koncernu. Studie k hospodářským a sociálním dějinám hornoslezského továrního města Ottmuth (Otmęt)

Czech Academy of Sciences Publication Activity Database

Jemelka, M.; Ševeček, Ondřej

2013-01-01

Roč. 111, č. 1 (2013), s. 61-86 ISSN 0037-6833 R&D Projects: GA ČR(CZ) GAP410/10/1995 Institutional support: RVO:67985955 Keywords : Baťa concern * Upper Silesia, * Ottmuth (Otmęt) * Zlín Subject RIV: AB - History

Matija Murko - druhý předseda Slovanského ústavu

Czech Academy of Sciences Publication Activity Database

Špirudová, Jana

2003-01-01

Roč. 72, č. 1 (2003), s. 71-79 ISSN 0037-6736. [Mezinárodní symposium Matija Murko: Osobnost a dílo. Praha, 26.03.2002] Institutional research plan: CEZ:AV0Z9092920 Keywords : Slavic Studies * Murko Matija Subject RIV: AI - Linguistics

Německé podnikání Baťova koncernu. Studie k hospodářským a sociálním dějinám hornoslezského továrního města Ottmuth (Otmęt)

Czech Academy of Sciences Publication Activity Database

Jemelka, M.; Ševeček, Ondřej

2013-01-01

Roč. 111, č. 2 (2013), s. 237-274 ISSN 0037-6833 R&D Projects: GA ČR(CZ) GAP410/10/1995 Institutional support: RVO:67985955 Keywords : Baťa concern * Upper Silesia * Ottmuth (Otmęt) * shoe Industry Subject RIV: AB - History

Intertextualita a její podíl na vyjednávání pozic účastníků talk show

Czech Academy of Sciences Publication Activity Database

Čmejrková, Světla; Hoffmannová, Jana

2012-01-01

Roč. 73, č. 4 (2012), s. 263-284 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : political discourse * intertextuality * talk shaw * polyphony * irony * parody Subject RIV: AI - Linguistics Impact factor: 0.233, year: 2012

Similarities and differences in the ilia of Late Cretaceous anurans and urodeles

Czech Academy of Sciences Publication Activity Database

Roček, Zbyněk; Gardner, J. D.; Eaton, J. G.; Přikryl, Tomáš

2012-01-01

Roč. 183, č. 6 (2012), s. 529-535 ISSN 0037-9409 R&D Projects: GA MŠk ME08066 Institutional support: RVO:67985831 Keywords : Anura * Cretaceous * Ilium * North America * Postcranial skeleton * Urodela Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.182, year: 2012

On morphology and distribution of Neurohelea luteitarsis (Waltl) (Diptera: Ceratopogonidae) in Europe

Czech Academy of Sciences Publication Activity Database

Tóthová, A.; Knoz, J.; Gelbič, Ivan

2009-01-01

Roč. 45, č. 3 (2009), s. 297-301 ISSN 0037-9271 R&D Projects: GA AV ČR(CZ) IBS6022201 Institutional research plan: CEZ:AV0Z50070508 Keywords : phylogeny * eversible sacs * spermatheca Subject RIV: EG - Zoology Impact factor: 0.600, year: 2009

Reassessment of the 1892 Laguna Salada Earthquake: Fault Kinematics and Rupture Patterns

Czech Academy of Sciences Publication Activity Database

Rockwell, T.K.; Fletcher, J.M.; Teran, O.J.; Hernandez, A.P.; Mueller, K.J.; Salisbury, J.B.; Akciz, S.O.; Štěpančíková, Petra

2015-01-01

Roč. 105, č. 6 (2015), s. 2885-2893 ISSN 0037-1106 R&D Projects: GA MŠk LH12078 Institutional support: RVO:67985891 Keywords : paleoseismology * earthquake s * fault kinematics * Laguna Salada * Mexico Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.311, year: 2015

ISSN Exercise & Sport Nutrition Review: Research & Recommendations

Directory of Open Access Journals (Sweden)

Mendel Ron

2004-05-01

Full Text Available Abstract Sport nutrition is a constantly evolving field with literally thousands of research papers published annually. For this reason, keeping up to date with the literature is often difficult. This paper presents a well-referenced overview of the current state of the science related to how to optimize training through nutrition. More specifically, this article discusses: 1. how to evaluate the scientific merit of nutritional supplements; 2. general nutritional strategies to optimize performance and enhance recovery; and, 3. our current understanding of the available science behind weight gain, weight loss, and performance enhancement supplements. Our hope is that ISSN members find this review useful in their daily practice and consultation with their clients.

Mezinárodní vědecké konference v Bělehradu a Sarajevu ke 100. výročí vzniku první světové války

Czech Academy of Sciences Publication Activity Database

Hladký, Ladislav

2014-01-01

Roč. 100, č. 2 (2014), s. 439-451 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : First World War * history * the hundredth anniversary of the beginning of the First World War in 1914 * international science conferences * Belgrade * Sarajevo * Czech-South Slavic relations Subject RIV: AB - History

Depositional record of an avulsive fluvial system controlled by peat compaction (Neogene, Most Basin, Czech Republic)

Czech Academy of Sciences Publication Activity Database

Rajchl, M.; Uličný, David

2005-01-01

Roč. 52, č. 3 (2005), s. 601-625 ISSN 0037-0746 R&D Projects: GA ČR GA205/01/0629 Institutional research plan: CEZ:AV0Z30120515 Keywords : avulsion * Eger Graben * fluvial channels Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.876, year: 2005

Adolf Černý jako první český překladatel novodobé běloruské literatury

Czech Academy of Sciences Publication Activity Database

Černý, Marcel

2013-01-01

Roč. 82, 1-2 (2013), s. 69-111 ISSN 0037-6736. [Mezinárodní sjezd slavistů /15./. Minsk, 20.08.2013-27.08.2013] Institutional support: RVO:68378017 Keywords : Czech-Belarusian literary relations * Belarusian literatur * reception * translatology Subject RIV: AJ - Letters, Mass-media, Audiovision

Detrital zircon fission-track thermochronology and magnetic fabric of the Amaga Formation (Colombia): Intracontinental deformation and exhumation events in the northwestern Andes

Czech Academy of Sciences Publication Activity Database

Piedrahita, V. A.; Bernet, M.; Chadima, Martin; Sierra, G. M.; Marín-Cerón, M. I.; Toro, G. E.

2017-01-01

Roč. 356, JUL 1 2017 (2017), s. 26-42 ISSN 0037-0738 Institutional support: RVO:67985831 Keywords : Panama-Choco Block * Northern Andean Block * Amaga Formation * zircon fission track * anisotropy of magnetic susceptibility Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 2.373, year: 2016

Sea-level and environmental changes around the Devonian-Carboniferous boundary in the Namur-Dinant Basin (S Belgium, NE France): A multi-proxy stratigraphic analysis of carbonate ramp archives and its use in regional and interregional correlations

Czech Academy of Sciences Publication Activity Database

Kumpan, T.; Bábek, O.; Kalvoda, J.; Matys Grygar, Tomáš; Frýda, J.

2014-01-01

Roč. 311, AUG (2014), s. 43-59 ISSN 0037-0738 R&D Projects: GA ČR(CZ) GAP210/11/1891 Institutional support: RVO:61388980 Keywords : Hangenberg event * Sequence stratigraphy * Foraminifer biostratigraphy * Gamma-ray spectrometry Subject RIV: DD - Geochemistry Impact factor: 2.665, year: 2014

Výzkum syntaxe mluvené češtiny: inventarizace problémů

Czech Academy of Sciences Publication Activity Database

Hoffmannová, Jana; Zeman, Jiří

2017-01-01

Roč. 78, č. 1 (2017), s. 45-66 ISSN 0037-7031 R&D Projects: GA ČR GA15-01116S Institutional support: RVO:68378092 Keywords : spoken Czech * syntax * hypersyntax * conversation * utterance * turn Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

K významu substantiv s převahou plurálových tvarů

Czech Academy of Sciences Publication Activity Database

Michalec, Vít; Veselý, Vojtěch

2016-01-01

Roč. 77, č. 3 (2016), s. 163-184 ISSN 0037-7031 R&D Projects: GA MK DF13P01OVV011 Keywords : mass noun * plural form of a noun * collective meaning * quantifier * measure phrase Subject RIV: AI - Linguistics Impact factor: 0.625, year: 2016

Diskurzní praktiky křesťanských kazatelů při konstituování relačního páru „my“ – „oni“

Czech Academy of Sciences Publication Activity Database

Havlík, Martin

2009-01-01

Roč. 70, č. 2 (2009), s. 83-99 ISSN 0037-7031 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : standardized relational pair, „us“, „them“ * membership categorization analysis * sermons Subject RIV: AI - Linguistics

L'ADN mitochondrial des Peuls nomades, témoin de leur origine en Afrique de l’Ouest

Czech Academy of Sciences Publication Activity Database

Černý, Viktor; Bromová, Markéta; Čmejla, R.; Diallo, I.; Brůžek, J.; Brdička, R.; Hájek, Martin

2005-01-01

Roč. 16, 3/4 (2005), s. 227-228 ISSN 0037-8984. [1830e reunion scientifique de la Société d'Anthropologie de Paris. 19.01.2005-21.01.2005, Paříž] Keywords : nomads * West Africa Subject RIV: AC - Archeology, Anthropology, Ethnology

Provenance of Neoproterozoic to upper Cretaceous sedimentary rocks, eastern Greenland: Implications for recognizing the sources of sediments in the Norwegian Sea

Czech Academy of Sciences Publication Activity Database

Sláma, Jiří; Walderhaug, O.; Fonneland, H.; Kosler, J.; Pederson, R. B.

2011-01-01

Roč. 238, 3/4 (2011), s. 254-267 ISSN 0037-0738 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentary * Eastern Greenland * provenance * U-Pb and Lu-Hf * zircon * Jan Mayen Island * North Atlantic Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.537, year: 2011

Výzkum výslovnosti v České televizi: slovanská antroponyma

Czech Academy of Sciences Publication Activity Database

Jílková, Lucie

2016-01-01

Roč. 85, č. 2 (2016), s. 217-223 ISSN 0037-6736 R&D Projects: GA ČR(CZ) GA13-00372S Institutional support: RVO:68378092 Keywords : pronunciation * Slavic proper names * principles of phonological adaptation of loanwords * semi-structured interview * Czech Television Subject RIV: AI - Linguistics

Enantiosémie jako výsledek slovotvorných procesů

Czech Academy of Sciences Publication Activity Database

Nejedlý, Petr

2014-01-01

Roč. 75, č. 3 (2014), s. 181-192 ISSN 0037-7031 R&D Projects: GA ČR GAP406/10/1153 Institutional support: RVO:68378092 Keywords : enantiosemy * etymology * semantics * lexicon * word-formation * lexicology * language development Subject RIV: AI - Linguistics Impact factor: 0.375, year: 2014

A Paleoseismic Record of Earthquakes for the Dead Sea Transform Fault between the First and Seventh Centuries C.E.: Nonperiodic Behavior of a Plate Boundary Fault

Czech Academy of Sciences Publication Activity Database

Wechsler, N.; Rockwell, T.K.; Klinger, Y.; Štěpančíková, Petra; Kanari, M.; Marco, S.; Agnon, A.

2014-01-01

Roč. 104, č. 3 (2014), s. 1329-1347 ISSN 0037-1106 R&D Projects: GA ČR GAP210/12/0573 Institutional support: RVO:67985891 Keywords : active tectonics * paleoseismology * paleoearthquake * Dead Sea Transform fault * Jordan Gorge fault Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.322, year: 2014

Sedmé mezinárodní balkanistické sympozium v Brně

Czech Academy of Sciences Publication Activity Database

Hladký, Ladislav

2017-01-01

Roč. 103, č. 1 (2017), s. 221-223 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : international symposium * Balkan studies * Brno Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

Photometric analysis of Ellerman bombs

Czech Academy of Sciences Publication Activity Database

Heinzel, Petr; Berlicki, Arkadiusz; Avrett, E.H.

2010-01-01

Roč. 81, č. 2 (2010), s. 646-652 ISSN 0037-8720. [Chromospheric structure and dynamics: From old wisdom to new insights. Sunspot,, 31.08.2009-4.09.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : line formation * Sun * chromosphere Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Invisible Religion in a "Non-believing" Country: The Case of the Czech Republic

Czech Academy of Sciences Publication Activity Database

Hamplová, Dana; Nešpor, Zdeněk

2009-01-01

Roč. 56, č. 4 (2009), s. 581-597 ISSN 0037-7686 R&D Projects: GA ČR GA403/08/0720 Institutional research plan: CEZ:AV0Z70280505 Keywords : economic behavior * money management marriage * cohabitation Subject RIV: AO - Sociology, Demography Impact factor: 0.254, year: 2009

Integrierung von Präpositionalphrasen in komplexe Verben im Obersorbischen

Czech Academy of Sciences Publication Activity Database

Brankatschk, Katja

2011-01-01

Roč. 80, č. 4 (2011), s. 376-398 ISSN 0037-6736 R&D Projects: GA ČR(CZ) GPP406/11/P424 Institutional research plan: CEZ:AV0Z90920516 Keywords : Upper Sorbian * particle verbs * model coinage in word formation * language contact Subject RIV: AI - Linguistics

Konference Prusko-rakouská válka 1866 v optice politických, vojenských, sociálních, hospodářských a kulturních dějin (Hradec Králové 29. 6. - 1. 7. 2016)

Czech Academy of Sciences Publication Activity Database

Kessler, Vojtěch

2016-01-01

Roč. 114, č. 1 (2016), s. 164-165 ISSN 0037-6833 Institutional support: RVO:67985963 Keywords : conference * military * austro-prussian war Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

Tavení skla a jeho inovační potenciál: Využití tavicího prostoru

Czech Academy of Sciences Publication Activity Database

Němec, Lubomír; Cincibusová, P.

2010-01-01

Roč. 60, 1-2 (2010), s. 1-10 ISSN 0037-637X R&D Projects: GA MPO 2A-1TP1/063 Institutional research plan: CEZ:AV0Z40320502 Keywords : glass * melting space * space utilization * flow Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

K etymologii praslovanského *s7t7 ‘plástev, plást medu’

Czech Academy of Sciences Publication Activity Database

Boček, Vít

2011-01-01

Roč. 46, č. 1 (2011), s. 36-39 ISSN 0037-6787 R&D Projects: GA ČR GAP406/10/1346; GA ČR GPP406/11/P670 Institutional research plan: CEZ:AV0Z90610518 Keywords : Slavistics * Common-Slavonic, * etymology * honeycomb Subject RIV: AI - Linguistics

Management výslovnosti pravopisně neintegrovaného lexika v Českém rozhlase

Czech Academy of Sciences Publication Activity Database

Havlík, Martin; Jílková, Lucie; Štěpánová, Veronika

2015-01-01

Roč. 76, č. 2 (2015), s. 107-128 ISSN 0037-7031 R&D Projects: GA ČR(CZ) GA13-00372S Institutional support: RVO:68378092 Keywords : pronunciation * loanwords and foreign proper names * pre-broadcast management * Czech Radio Subject RIV: AI - Linguistics Impact factor: 0.679, year: 2015

K otázce tzv. akuzativního se v češtině: pohled (nejen) diachronní

Czech Academy of Sciences Publication Activity Database

Pergler, Jiří

2016-01-01

Roč. 77, č. 2 (2016), s. 102-122 ISSN 0037-7031 R&D Projects: GA ČR(CZ) GA15-00987S Institutional support: RVO:68378092 Keywords : reflexive form * pronoun * morpheme * particle * categorization * diachrony * grammaticalization * Old Czech Subject RIV: AI - Linguistics Impact factor: 0.625, year: 2016

Reduced cephalic labial glands in the male bumblebees of the subgenus Rhodobombus Dalla Torre (Hymenoptera: Apidae: Bombus Latreille)

Czech Academy of Sciences Publication Activity Database

Terzo, M.; Coppens, P.; Valterová, Irena; Toubeau, G.; Rasmont, P.

2007-01-01

Roč. 43, č. 4 (2007), s. 497-503 ISSN 0037-9271 R&D Projects: GA AV ČR IAA4055403 Institutional research plan: CEZ:AV0Z40550506 Keywords : Bombus mesomelas * Bombus terrestris * ultrastructure * sexual pheromones Subject RIV: CC - Organic Chemistry Impact factor: 0.823, year: 2007

Lessons learned from ESA INTEGRAL: cataclysmic variables and blazars

Czech Academy of Sciences Publication Activity Database

Hudec, René; Gális, R.; Kocka, Matúš

2010-01-01

Roč. 81, č. 1 (2010), s. 320-325 ISSN 0037-8720. [Multifrequency behaviour of high energy cosmic sources. Vulcano, 25.05.2009-30.05. 2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : high-energy sources * cataclysmic variables * INTEGRAL Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

K stylistickému hodnocení jazykových prostředků, zvláště lexikálních

Czech Academy of Sciences Publication Activity Database

Homoláč, Jiří; Mrázková, Kamila

2014-01-01

Roč. 75, č. 1 (2014), s. 3-38 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : usage labels * lexicography * monolingual dictionary * stylistics * communicative domain * Czech language situation Subject RIV: AI - Linguistics Impact factor: 0.375, year: 2014

Nové koncepce v tavicím procesu skel, blízká realita

Czech Academy of Sciences Publication Activity Database

Němec, Lubomír; Kloužek, Jaroslav; Vernerová, Miroslava; Cincibusová, P.; Jebavá, Marcela; Tonarová, V.

2010-01-01

Roč. 60, 3-4 (2010), s. 67-72 ISSN 0037-637X R&D Projects: GA MPO 2A-1TP1/063 Institutional research plan: CEZ:AV0Z40320502 Keywords : glass * bubble removal * new conceptions * centrifuge * space utilization Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

Semantika metra v poezii Miroslava Červenky

Czech Academy of Sciences Publication Activity Database

Ibrahim, Robert

2014-01-01

Roč. 83, č. 1 (2014), s. 57-68 ISSN 0037-6736 R&D Projects: GA ČR GAP406/11/1825 Institutional support: RVO:68378068 Keywords : Czech poetry of the 20th-Century * semantics of metre * theory of verse * Červenka, Miroslav Subject RIV: AJ - Letters, Mass-media, Audiovision

Současný vývoj české historické balkanistiky. Bilance knižní produkce za léta 2005-2016

Czech Academy of Sciences Publication Activity Database

Hladký, Ladislav

2017-01-01

Roč. 103, č. 2 (2017), s. 455-468 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : Balkan studies * historiography * monographs * Czech republic * 2005-2016 Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

Jiří Vacek: Slovanská knihovna – můj osud. Mozaika vzpomínek. Národní knihovna\

Czech Academy of Sciences Publication Activity Database

Hašková, Dana

2017-01-01

Roč. 86, č. 4 (2017), s. 523-525 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Vacek, Jiří * The Slavonic Library * Memories Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

FERO (Finding Extreme Relativistic Objects): statistics of relativistic broad Fe Kalpha lines in AGN

Czech Academy of Sciences Publication Activity Database

Longinotti, A. L.; de La Calle, I.; Bianchi, S.; Guainazzi, M.; Dovčiak, Michal

2008-01-01

Roč. 79, č. 1 (2008), s. 259-261 ISSN 0037-8720. [ Simbol -X: The hard X-ray Universe in focus. Bologna, 14.05.2007-16.05.2007] Institutional research plan: CEZ:AV0Z10030501 Keywords : active galaxies * X-raylLines-iron Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Změny koncentračního pole uhlíku, manganu a mědi v eutektické buňce tvárné litiny

Czech Academy of Sciences Publication Activity Database

Musilová, I.; Šenberger, J.; Stránský, K.; Levíček, P.; Doležal, P.; Million, Bořivoj

2004-01-01

Roč. 52, č. 9 (2004), s. 366-368 ISSN 0037-6825 R&D Projects: GA ČR GA106/04/1006; GA ČR GA106/04/0949 Institutional research plan: CEZ:AV0Z2041904 Keywords : spheroidal graphite cast iron * C, Mn, Cu * thermodynamic model Subject RIV: JG - Metallurgy

Effect of coppicing, thinning and throughfall reduction on soil water content and soil CO2 efflux in a sessile oak forest

Czech Academy of Sciences Publication Activity Database

Dařenová, Eva; Crabbe, Richard A.; Knott, R.; Uherková, B.; Kadavý, J.

2018-01-01

Roč. 52, č. 2 (2018), č. článku 9927. ISSN 0037-5330 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:86652079 Keywords : coppice * precipitation * Quercus petraea * soil respiration * soil moisture Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 1.495, year: 2016

Místo kontaminace v etymologických výkladech

Czech Academy of Sciences Publication Activity Database

Janyšková, Ilona

2013-01-01

Roč. 82, č. 1/2 (2013), s. 149-157 ISSN 0037-6736. [Mezinárodní sjezd slavistů /15./. Minsk, 20.08.2013-27.08.2013] R&D Projects: GA ČR GAP406/10/1346 Institutional support: RVO:68378092 Keywords : Slavonic languages * etymology * contamination Subject RIV: AI - Linguistics

K historii pojmu Východ-Západ a k možnostem jeho dalšího využití ve slavistické literární a kulturní vědě

Czech Academy of Sciences Publication Activity Database

Ulbrechtová, Helena

2008-01-01

Roč. 77, 1-3 (2008), s. 307-323 ISSN 0037-6736. [Mezinárodní sjezd slavistů /14./. Ochrid, 10.09.2008-16.09.2008] Institutional research plan: CEZ:AV0Z90920516 Keywords : Slavic Studies * interdisciplinary comparative studies * culturology * East-West Subject RIV: AJ - Letters, Mass-media, Audiovision

The role of beetle and host volatiles in host colonization in the European oak bark beetle, Scolytus intricatus (Ratzeburg) (Col., Scolytidae)

Czech Academy of Sciences Publication Activity Database

Hovorka, Oldřich; Kindl, Jiří; Kalinová, Blanka; Knížek, M.; Vrkočová, Pavlína; Koutek, Bohumír

2005-01-01

Roč. 129, č. 4 (2005), 221-226 ISSN 0931-2048 R&D Projects: GA ČR(CZ) GA203/97/0037; GA MZe(CZ) QD0332 Institutional research plan: CEZ:AV0Z4055905 Keywords : bark beetles * host colonization * pheromones Subject RIV: CC - Organic Chemistry Impact factor: 0.703, year: 2005

Distribuce předpon v českém sylabotónickém trocheji

Czech Academy of Sciences Publication Activity Database

Plecháč, Petr; Kolár, Robert; Hlaváčová, J.; Merthová, K.

2017-01-01

Roč. 78, č. 4 (2017), s. 322-332 ISSN 0037-7031 R&D Projects: GA ČR(CZ) GA14-31160S Institutional support: RVO:68378068 Keywords : metrics and prosody * morphology * corpus linguistics * trochee * prefixes Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures Impact factor: 0.625, year: 2016

Rapid evolution of parental rDNA in a synthetic tobacco allotetraploid line

Czech Academy of Sciences Publication Activity Database

Skalická, Kamila; Lim, K. Y.; Matyášek, Roman; Koukalová, Blažena; Leitch, A. R.; Kovařík, Aleš

2003-01-01

Roč. 90, č. 7 (2003), s. 988-996 ISSN 0002-9122 R&D Projects: GA ČR GA204/01/0313; GA ČR GA521/01/0037 Institutional research plan: CEZ:AV0Z5004920 Keywords : evolution * gene conversion * Nicotiana Subject RIV: BO - Biophysics Impact factor: 2.373, year: 2003

Svět akademií. Rodina Jirečkova, Josef Hlávka a organizace české vědy (K 100. výročí úmrtí J. Hlávky)

Czech Academy of Sciences Publication Activity Database

Havlíková, Lubomíra

2008-01-01

Roč. 94, č. 4 (2008), s. 645-656 ISSN 0037-6922 Institutional research plan: CEZ:AV0Z90920516 Keywords : history of science * Hlávka, Josef (1831-1908) * Jireček, Hermenegild (1827-1909) * Jireček, Josef (1825-1888) * Jireček, Konstantin (1854-1918) * academy Subject RIV: AB - History

Modelling tidal current-induced bed shear stress and palaeocirculation in an epicontinental seaway: the Bohemian Cretaceous Basin, Central Europe

Czech Academy of Sciences Publication Activity Database

Mitchell, A. J.; Uličný, David; Hampson, G. J.; Allison, P. A.; Gorman, G. J.; Piggott, M. D.; Wells, M. R.; Pain, C. C.

2010-01-01

Roč. 57, č. 2 (2010), s. 359-388 ISSN 0037-0746 R&D Projects: GA AV ČR(CZ) IAA300120609 Institutional research plan: CEZ:AV0Z30120515 Keywords : bed shear stress * Bohemian Cretaceous Basin * epicontinental sea * tidal circulation * Turonian Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.229, year: 2010

Molitva o izbavlenii ot bluda v církevněslovanských rukopisech Trojicko-sergijevské lávry

Czech Academy of Sciences Publication Activity Database

Čajka, František

2013-01-01

Roč. 82, 1-2 (2013), s. 43-52 ISSN 0037-6736 R&D Projects: GA ČR(CZ) GAP406/12/1790 Institutional support: RVO:68378017 Keywords : Old Church Slavonic * Church Slavonic * prayer * the Trinity Lavra of St. Sergius * manuscripts * Forty Gospel Homilies by Pope Gregory the Great Subject RIV: AI - Linguistics

Why did distinct types of dual-earner models in Czech, Slovak and East German societies develop and persist?

Czech Academy of Sciences Publication Activity Database

Hašková, Hana; Klenner, Ch.

2010-01-01

Roč. 22, č. 3 (2010), s. 266-288 ISSN 1437-2940 R&D Projects: GA AV ČR IAA700280901; GA ČR GAP404/10/0021 Institutional research plan: CEZ:AV0Z70280505 Keywords : dual earner model * Central and Eastern Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.037, year: 2010

Radost z vícejazyčnosti

Czech Academy of Sciences Publication Activity Database

Hoffmannová, Jana

2013-01-01

Roč. 74, č. 3 (2013), s. 211-220 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : multilingualism * language autobiography * biographic method * literary multilingualism * semantic and compositional text structure * textual heterogeneity * aesthetic function * language humor Subject RIV: AI - Linguistics Impact factor: 0.133, year: 2013

Quantitative allochem compositional analysis of Lochkovian-Pragian boundary sections in the Prague Basin (Czech Republic)

Czech Academy of Sciences Publication Activity Database

Weinerová, Hedvika; Hron, K.; Bábek, O.; Šimíček, D.; Hladil, Jindřich

2017-01-01

Roč. 354, JUN 1 (2017), s. 43-59 ISSN 0037-0738 R&D Projects: GA ČR GA14-18183S Institutional support: RVO:67985831 Keywords : compositional analysis * carbonate petrography * multivariate statistics * log-ratio coordinates * Prague Basin * Lower Devonian Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 2.373, year: 2016

K finální podobě Řecko-staroslověnského slovníku-indexu

Czech Academy of Sciences Publication Activity Database

Čermák, Václav

2007-01-01

Roč. 76, č. 1 (2007), s. 39-46 ISSN 0037-6736. [Církevněslovanská lexikografie 2006. Praha, 26.10.2006-27.10.2006] R&D Projects: GA AV ČR IAA9092403 Institutional research plan: CEZ:AV0Z90920516 Keywords : Dictionary * Old Church Slavonic * Old Greek Subject RIV: AI - Linguistics

Inversion for the composite moment tensor

Czech Academy of Sciences Publication Activity Database

Vavryčuk, Václav

2015-01-01

Roč. 105, č. 6 (2015), s. 3024-3035 ISSN 0037-1106 R&D Projects: GA ČR(CZ) GAP210/12/1491; GA ČR GA13-08971S Institutional support: RVO:67985530 Keywords : double-couple earthquakes * West Bohemia * focal mechanisms Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.311, year: 2015

Toward understanding subtle instrumentation effects associated with weak seismic events in the near field

Czech Academy of Sciences Publication Activity Database

Zahradník, J.; Plešinger, Axel

2010-01-01

Roč. 100, č. 1 (2010), s. 59-73 ISSN 0037-1106 R&D Projects: GA AV ČR IAA300120911 Grant - others:GA ČR(CZ) GA205/07/0502 Institutional research plan: CEZ:AV0Z30120515 Keywords : instrumentation effects * broadband seismology * weak earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.027, year: 2010

Germanismy v české textilní terminologii (etymologie a sémantika)

Czech Academy of Sciences Publication Activity Database

Villnow Komárková, Jana

2013-01-01

Roč. 82, č. 1/2 (2013), s. 251-258 ISSN 0037-6736. [Mezinárodní sjezd slavistů /15./. Minsk, 20.08.2013-27.08.2013] R&D Projects: GA ČR GAP406/10/1346 Institutional support: RVO:68378092 Keywords : Czech textile terminology * Germanisms in Czech * etymology * language contact Subject RIV: AI - Linguistics

„Sešli jsme se jako křesťané“: Počátky lidového spiritismu ve Slezsku do jeho institucionalizace v letech 1914–1919

Czech Academy of Sciences Publication Activity Database

Jemelka, Martin

2016-01-01

Roč. 114, č. 2 (2016), s. 27-45 ISSN 0037-6833 R&D Projects: GA ČR GA16-04364S Institutional support: RVO:67985921 Keywords : Silesia * folk religion * Spiritism Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

Poznámky k lexikálním výpůjčkám ve staroslověnštině a jejich reflexe v češtině a ostatních slovanských jazycích (sémanticko-etymologická analýza)

Czech Academy of Sciences Publication Activity Database

Karlíková, Helena

2013-01-01

Roč. 82, č. 1/2 (2013), s. 158-168 ISSN 0037-6736. [Mezinárodní sjezd slavistů /15./. Minsk, 20.08.2013-27.08.2013] R&D Projects: GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : Old Church Slavonic * lexical loan-words * etymology * Slavonic languages Subject RIV: AI - Linguistics

Úloha principu sémantických paralel v etymologickém výzkumu

Czech Academy of Sciences Publication Activity Database

Karlíková, Helena

2008-01-01

Roč. 77, 1-3 (2008), s. 85-92 ISSN 0037-6736. [Mezinárodní sjezd slavistů /14./. Ochrid, 10.09.2008-16.09.2008] R&D Projects: GA ČR GA405/07/1092; GA AV ČR IAA900610501 Institutional research plan: CEZ:AV0Z90610518 Keywords : etymology Subject RIV: AI - Linguistics

Umělecké ztvárnění války u Nikolaje Gumiljova ("Zapiski kavalerista" a válečné básně) a Ernsta Jüngera ( "In Stahlgewittern"): srovnávací analýza

Czech Academy of Sciences Publication Activity Database

Ulbrecht, Siegfried

2008-01-01

Roč. 77, 1-3 (2008), s. 293-306 ISSN 0037-6736. [Mezinárodní sjezd slavistů /14./. Ochrid, 10.09.2008-16.09.2008] Institutional research plan: CEZ:AV0Z90920516 Keywords : literary comparatistics * Jünger, Ernst, 1895-1998 * Gumilev, Nikolai, 1886-1921 * Russian literature * German literature Subject RIV: AJ - Letters, Mass-media, Audiovision

Controls on clastic sequence geometries in a shallow-marine, transtensional basin: the Bohemian Cretaceous Basin, Czech Republic

Czech Academy of Sciences Publication Activity Database

Uličný, David; Laurin, Jiří; Čech, S.

2009-01-01

Roč. 56, č. 4 (2009), s. 1077-1114 ISSN 0037-0746 R&D Projects: GA ČR GA205/01/0629; GA AV ČR(CZ) IAA300120609 Institutional research plan: CEZ:AV0Z30120515 Keywords : Coarse-grained delta * Coniacian * sea-level * subsidence * tidal current * Turonian Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.114, year: 2009

Česká hovorovost a hovorová čeština (v kontextu dalších slovanských jazyků

Czech Academy of Sciences Publication Activity Database

Hoffmannová, Jana

2013-01-01

Roč. 82, 1/2 (2013), s. 125-136 ISSN 0037-6736. [Mezinárodní sjezd slavistů /15./. Minsk, 20.08.2013-27.08.2013] R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : colloquiality * colloquial style * Colloquial Czech * Literary Czech * Common Czech * spoken Czech Subject RIV: AI - Linguistics

Impact of climate change on growth dynamics of Norway spruce in south-eastern Norway

Czech Academy of Sciences Publication Activity Database

Čermák, P.; Rybníček, Michal; Žid, T.; Andreassen, K.; Borja, I.; Kolář, Tomáš

2017-01-01

Roč. 51, č. 2 (2017), č. článku 1781. ISSN 0037-5330 R&D Projects: GA MŠk(CZ) LO1415; GA ČR GA13-04291S Institutional support: RVO:67179843 Keywords : crown condition * decline * Picea abies * tree-ring width * precipitation * Oslofjord Subject RIV: GK - Forestry OBOR OECD: Forestry Impact factor: 1.495, year: 2016

Bojan Penev a jeho kontakty s Čechami a českou kulturou

Czech Academy of Sciences Publication Activity Database

Černý, Marcel; Hronková, D.

2016-01-01

Roč. 85, č. 1 (2016), s. 86-121 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Penev, Bojan * Czech-Bulgarian cultural relations * comparative literature studies * scientific correspondences * Novák, Arne * Tichý, František Rut (ps. Zdeněk Broman) * Murko, Matija * Černý, Adolf * Páta, Josef Subject RIV: AJ - Letters, Mass-media, Audiovision

Praslovanština, jazykový kontakt a kontaktová lingvistika

Czech Academy of Sciences Publication Activity Database

Boček, Vít

2013-01-01

Roč. 82, č. 1/2 (2013), s. 15-34 ISSN 0037-6736. [Mezinárodní sjezd slavistů /15./. Minsk, 20.08.2013-27.08.2013] R&D Projects: GA ČR GPP406/11/P670 Institutional support: RVO:68378092 Keywords : Proto-Slavic * language contact * language change * contact linguistics * Iranian Subject RIV: AI - Linguistics

Seismic network calibration for retrieving accurate moment tensors

Czech Academy of Sciences Publication Activity Database

Davi, Rosalia; Vavryčuk, Václav

2012-01-01

Roč. 102, č. 6 (2012), s. 2491-2506 ISSN 0037-1106 R&D Projects: GA AV ČR IAA300120801; GA ČR(CZ) GAP210/12/1491; GA MŠk LM2010008 Institutional research plan: CEZ:AV0Z30120515 Keywords : earthquake source parameters * West Bohemia swarm * inversion Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.940, year: 2012

Stratigraphic significance and resolution of spectral reflectance logs in Lower Devonian carbonates of the Barrandian area, Czech Republic; a correlation with magnetic susceptibility and gamma-ray logs

Czech Academy of Sciences Publication Activity Database

Koptíková, Leona; Bábek, O.; Hladil, Jindřich; Kalvoda, J.; Slavík, Ladislav

2010-01-01

Roč. 225, 3/4 (2010), s. 83-98 ISSN 0037-0738 R&D Projects: GA AV ČR IAAX00130702; GA ČR GA205/08/0767 Institutional research plan: CEZ:AV0Z30130516 Keywords : VIS spectral reflectance * cyclostratigraphy * sea -level changes * Lower Devonian * red pelagic carbonates * diagenesis Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.685, year: 2010

Astrophysics of cataclysmic variables by ESA Gaia and low dispersion spectroscopy

Czech Academy of Sciences Publication Activity Database

Hudec, René; Šimon, Vojtěch; Hudec, L.; Hudcová, Věra

2012-01-01

Roč. 83, č. 2 (2012), s. 849-853 ISSN 0037-8720. [Workshop on the golden age of cataclysmic variables and related objects /2./. Palermo, 09.09.2013-14.09.2013] R&D Projects: GA ČR GA205/08/1207 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * variable stars * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

ESA Gaia & the multifrequency behavior of high-energy sources with ultra-low dispersion spectroscopy

Czech Academy of Sciences Publication Activity Database

Hudec, René; Šimon, Vojtěch; Hudec, L.; Hudcová, Věra

2012-01-01

Roč. 83, č. 1 (2012), s. 342-346 ISSN 0037-8720. [Workshop on multifrequency behaviour of high energy cosmic sources. Vulcano, 23.05.2011-28.05.2011] R&D Projects: GA ČR GA205/08/1207 Institutional research plan: CEZ:AV0Z10030501 Keywords : X-rays * high-energy sources * satellites Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Starozákonní lekce v hlaholské části Remešského evangeliáře. Příspěvek k církevněslovanskému písemnictví středověkých Čech

Czech Academy of Sciences Publication Activity Database

Čermák, Václav

2016-01-01

Roč. 85, 3-4 (2016), s. 303-320 ISSN 0037-6736 R&D Projects: GA ČR GA16-22085S Institutional support: RVO:68378017 Keywords : the Glagolitic section of the Reims Gospel * Lectionary * Croatian Church Slavonic * Old Testament * Missale * textology * Croatian Glagolitic texts * Slavonic Monastery in Prague Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific languages

Konference o mírových iniciativách za první světové války na papežské koleji Santa Maria dell'Anima v Římě

Czech Academy of Sciences Publication Activity Database

Šístek, František

2017-01-01

Roč. 103, č. 1 (2017), s. 231-235 ISSN 0037-6922 Institutional research plan: CEZ:AV0Z8015903 Institutional support: RVO:67985963 Keywords : First World War * Peace Initiatives * Charles I of Austria Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

Observing cataclysmic variables and related objects with different techniques

Czech Academy of Sciences Publication Activity Database

Šimon, Vojtěch

2012-01-01

Roč. 83, č. 2 (2012), s. 675-682 ISSN 0037-8720. [Workshop on the golden age of cataclysmic variables and related objects /2./. Palermo , 09.09.2013-14.09.2013] R&D Projects: GA ČR GA205/08/1207 Institutional research plan: CEZ:AV0Z10030501 Keywords : X-rays * binaries * circumstellar matter Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Golden Era of Cataclysmic Variables and Related Objects: concluding remarks

Czech Academy of Sciences Publication Activity Database

Hudec, René

2012-01-01

Roč. 83, č. 2 (2012), s. 883-890 ISSN 0037-8720. [Workshop on the golden age of cataclysmic variables and related objects /2./. Palermo , 09.09.2013-14.09.2013] R&D Projects: GA ČR GA205/08/1207 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * variable stars * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Investigations of cataclysmic variables by ESA INTEGRAL

Czech Academy of Sciences Publication Activity Database

Hudec, René; Blažek, Martin

2012-01-01

Roč. 83, č. 2 (2012), s. 659-664 ISSN 0037-8720. [Workshop on the golden age of cataclysmic variables and related objects /2./. Palermo , 09.09.2013-14.09.2013] R&D Projects: GA ČR GA205/08/1207 Institutional research plan: CEZ:AV0Z10030501 Keywords : stars * high-energy sources * cataclysmic variables Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Jak rozumíme kategorii gramatického rodu? Kdy je Češka Čech?

Czech Academy of Sciences Publication Activity Database

Čmejrková, Světla

2008-01-01

Roč. 77, 1/3 (2008), s. 41-54 ISSN 0037-6736. [Mezinárodní sjezd slavistů /14./. Ochrid, 10.09.2008-16.09.2008] R&D Projects: GA ČR GA405/06/1468; GA ČR GA405/06/1057 Institutional research plan: CEZ:AV0Z90610518 Keywords : gender linguistics * grammatical categories * generic masculine Subject RIV: AI - Linguistics

Areopraon chaitophori n.sp. (Hymenoptera: Braconidae: Aphidiinae) associated with Chaitophorus leucomelas Koch on poplars, with a key for European Areopraon Mackauer species

Czech Academy of Sciences Publication Activity Database

Tomanović, Ž.; Petrović, A.; Kavallieratos, N. G.; Starý, Petr; Toševski, I.; Bogdanović, A. M.

2009-01-01

Roč. 45, č. 2 (2009), s. 187-192 ISSN 0037-9271 R&D Projects: GA AV ČR IBS5007102 Grant - others:The Ministry of Science of the Republic of Serbia(CS) 143006B Institutional research plan: CEZ:AV0Z50070508 Keywords : Areopraon chaitophori n.sp. * Chaitophorus leucomelas * poplars Subject RIV: EG - Zoology Impact factor: 0.600, year: 2009

Pragmatika situace

Czech Academy of Sciences Publication Activity Database

Kaderka, Petr

2013-01-01

Roč. 74, č. 1 (2013), s. 13-40 ISSN 0037-7031 Grant - others:ESF(CZ) CZ.1.07/2.2.00/15.0275 Source of funding: O - operačné programy Keywords : human action * situation * communicative situation * scientific situation * intersubjectivity * semiotic multimodality * social interaction * communicative patterns * communicative genres Subject RIV: AI - Linguistics Impact factor: 0.133, year: 2013

Crystallographic characterization of divalent organosamarium compound (C5H5)2Sm(THF)2

International Nuclear Information System (INIS)

Jagannatha Swamy, S.

2002-01-01

The single pot reaction between SmX 2 (X = Cl - , I - ) and BuLi in THF at -40 degC, followed by the addition of C 5 H 5 - Na + results in a dark red solution. Leaving the concentrated reaction mixture at -25 degC for two days in a deep freezer results in the formation of the crystals of the compound, (C 5 H 5 ) 2 ; Sm(THF) 2 . The compound is insoluble in any solvent and it has been characterized by conventional methods. The crystals are monoclinic with space group C2/c, and a = 13.416(1), b = 9.644(1), c = 14.129(2) pm, β109.873(9) 0 and z = 4 for ρcalcd = 1.64 g cm -3 . Least squares refinement on the basis of 1804 observed reflections has led to a final R value of 0.037 and R w = 0.054. (author)

Non-double-couple earthquake mechanism as an artifact of the point-source approach applied to a finite-extent focus

Czech Academy of Sciences Publication Activity Database

Adamová, Petra; Šílený, Jan

2010-01-01

Roč. 100, č. 2 (2010), s. 447-457 ISSN 0037-1106 R&D Projects: GA ČR GA205/09/0724 Grant - others:GA MŠk(CZ) specifický-výzkum Institutional research plan: CEZ:AV0Z30120515 Keywords : non-double-couple earthquake mechanism * moment tensor * finite-extent focus Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.027, year: 2010

Význam Slovanského přehledu pro českou (zejména literárněvědnou) bulharistiku

Czech Academy of Sciences Publication Activity Database

Černý, Marcel

2015-01-01

Roč. 101, č. 3 (2015), s. 627-671 ISSN 0037-6922 Institutional support: RVO:68378017 Keywords : Bulgarian literary studies * Czech-Bulgarian cultural relations * literary reception * Balkans * historiography * Šak, V * Tichý, František R. * Páta, Josef * Krăstev,Krăstjo * Veličkov, Konstantin * Penev, Bojan * Amort, Čestmír * Dimitrov, Georgi Subject RIV: AJ - Letters, Mass-media, Audiovision

Search of Large Super-Fast Rotator between NEAs

Czech Academy of Sciences Publication Activity Database

Carbognani, A.; Pravec, Petr; Kušnirák, Peter; Hornoch, Kamil; Galád, Adrián; Monte, S.; Bertaina, M.

2016-01-01

Roč. 87, č. 1 (2016), s. 66-71 ISSN 0037-8720. [Italian national workshop of planetary sciences /12./. Bormio, 02.02.2015-06.02.2015] R&D Projects: GA ČR GAP209/12/0229 Institutional support: RVO:67985815 Keywords : minor planets * near Earth asteroids * rotation periods Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics http://sait.oat.ts.astro.it/MmSAI/87/PDF/66.pdf

Povjestvovanije iz onogo mira. Sjuzan Taubes: Divorcing i Marija Rybakova: Anna Grom i jeje prizrak

Czech Academy of Sciences Publication Activity Database

Ulbrechtová, Helena

2013-01-01

Roč. 82, 1/2 (2013), s. 225-234 ISSN 0037-6736. [Mezinárodní sjezd slavistů /15./. Minsk, 20.08.2013-27.08.2013] Grant - others:program interní podpory projektů mezinárodní spolupráce AV ČR(CZ) M300921201 Institutional support: RVO:68378017 Keywords : literature * gnosticism * Taubes, Susan * Rybakova, Maria Subject RIV: AJ - Letters, Mass-media, Audiovision

Současné možnosti a trendy popisu mluvené češtiny (se zaměřením na kolokvializaci a konverzacionalizaci)

Czech Academy of Sciences Publication Activity Database

Hoffmannová, Jana

2008-01-01

Roč. 77, 1/3 (2008), s. 63-75 ISSN 0037-6736. [Mezinárodní sjezd slavistů /14./. Ochrid, 10.09.2008-16.09.2008] R&D Projects: GA ČR GA405/06/1468; GA ČR GA405/06/1057 Institutional research plan: CEZ:AV0Z90610518 Keywords : spoken Czech * colloquialization * converzationalization * intimate style * genre * diglossia * pragmatics Subject RIV: AI - Linguistics

Origin of red pelagic carbonates as an interplay of global climate and local basin factors: Insight from the Lower Devonian of the Prague Basin, Czech Republic

Czech Academy of Sciences Publication Activity Database

Bábek, O.; Faměra, Martin; Hladil, Jindřich; Kapusta, J.; Weinerová, Hedvika; Šimíček, D.; Slavík, Ladislav; Ďurišová, Jana

2018-01-01

Roč. 364, FEB (2018), s. 71-88 ISSN 0037-0738 R&D Projects: GA ČR(CZ) GA14-18183S Institutional support: RVO:61388980 ; RVO:67985831 Keywords : Bottom redox conditions * Geochemistry * Palaeoceanography * Spectral reflectance * Pragian stage * Red pelagic carbonates * Trophic levels Subject RIV: DD - Geochemistry; DB - Geology ; Mineralogy (GLU-S) OBOR OECD: Geology; Mineralogy (GLU-S) Impact factor: 2.373, year: 2016

Pharmacy (ISSN 2226-4787) — A Journal of Pharmacy Education and Practice

OpenAIRE

Keith A. Wilson; Yvonne Perrie

2013-01-01

Pharmacy (ISSN 2226-4787) — A journal of pharmacy education and practice is an international scientific open access journal on pharmacy education and practice, and is published by MDPI online quarterly. The practice of pharmacy is changing at an unprecedented rate as the profession moves from a focus upon preparation and supply of medicines to a clinical patient-facing role. While an understanding of the science related to medicines remains core to pharmacy education, the changes in practice ...

Solar quiescent prominences. Filamentary structure and energetics

Czech Academy of Sciences Publication Activity Database

Heinzel, Petr; Anzer, U.; Gunár, Stanislav

2010-01-01

Roč. 81, č. 2 (2010), s. 654-661 ISSN 0037-8720. [Chromospheric structure and dynamics: From old wisdom to new insights. Sunspot,, 31.08.2009-4.09.2009] R&D Projects: GA ČR GA205/09/1705; GA ČR GP205/09/P554 Institutional research plan: CEZ:AV0Z10030501 Keywords : line formation * line profiles * radiative transfer Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Response of the leaf phenology and tree-ring width of European beech to climate variability

Czech Academy of Sciences Publication Activity Database

Kolář, Tomáš; Giagli, K.; Trnka, Miroslav; Bednářová, E.; Vavrčík, H.; Rybníček, Michal

2016-01-01

Roč. 50, č. 2 (2016), č. článku 1520. ISSN 0037-5330 R&D Projects: GA MŠk(CZ) LO1415; GA ČR GA13-04291S Grant - others:EHP(CZ) EHP-CZ02-OV-1-014-2014 Program:CZ02 Institutional support: RVO:67179843 Keywords : dendroclimatology * Fagus sylvatica * temperature * radial increment * soil moisture Subject RIV: EH - Ecology, Behaviour Impact factor: 1.495, year: 2016

Color-color analysis of the optical counterparts of high energy sources

Czech Academy of Sciences Publication Activity Database

Šimon, Vojtěch; Hudec, René; Pizzichini, G.

2010-01-01

Roč. 81, č. 1 (2010), s. 356-361 ISSN 0037-8720. [Multifrequency behaviour of high energy cosmic sources. Vulcano, 25.05.2009-30.05. 2009] R&D Projects: GA ČR GA205/08/1207 Grant - others:ESA(XE) ESA- PECS project No. 98058 Institutional research plan: CEZ:AV0Z10030501 Keywords : X-rays binaries * gamma rays * accretion, accretion disks Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

High trait aggression in men is associated with low 5-HT levels, as indexed by 5-HT4 receptor binding

DEFF Research Database (Denmark)

da Cunha-Bang, Sofi; Mc Mahon, Brenda; Fisher, Patrick MacDonald

2016-01-01

of 5-HT, we here test the hypothesis in healthy men and women that brain 5-HT levels, as indexed by cerebral 5-HT4R, are inversely correlated with trait aggression and impulsivity. Sixty-one individuals (47 men) underwent positron emission tomography scanning with the radioligand [(11)C]SB207145......Impulsive aggression has commonly been associated with a dysfunction of the serotonin (5-HT) system: many, but not all, studies point to an inverse relationship between 5-HT and aggression. As cerebral 5-HT4 receptor (5-HT4R) binding has recently been recognized as a proxy for stable brain levels...... for quantification of brain 5-HT4R binding. The Buss-Perry Aggression Questionnaire (BPAQ) and the Barratt Impulsiveness Scale were used for assessment of trait aggression and trait impulsivity. Among male subjects, there was a positive correlation between global 5-HT4R and BPAQ total score (P = 0.037) as well...

ISSN 1727-3781

African Journals Online (AJOL)

esfourie

To meet this challenge it is necessary to instill skills that ... This article discusses the teaching of first-generation students and how to overcome the existing ... 2.1 Student profile ... higher education, or a student who has a sibling at university. 5.

10 CFR 733.3 - Definitions.

Science.gov (United States)

2010-01-01

... practices of the relevant research community and that it be knowingly, intentionally, or recklessly..., medicine, psychology, social sciences, statistics, and research involving human subjects or animals...

ISSN 1727-3781

African Journals Online (AJOL)

US

Chapter 2 Constitution of the Republic of South Africa, 1996. 5 ... tional democracy. But even in ... These factors are, first, the court's exercise of constitu- .... A subsidiary constitutional statute may, in the third place, "extend protection beyond ... public involvement in the legislative and other processes of the Assembly and its.

2'-deoxy-5,6-dihydro-5-azacytidine-a less toxic alternative of 2'-deoxy-5-azacytidine. A comparative study of hypomethylating potential

Czech Academy of Sciences Publication Activity Database

Matoušová, Marika; Votruba, Ivan; Otmar, Miroslav; Tloušťová, Eva; Günterová, Jana; Mertlíková-Kaiserová, Helena

2011-01-01

Roč. 6, č. 6 (2011), s. 769-776 ISSN 1559-2294 R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : epigenetic therapy * nucleoside analogs * DNA methylation * 2'-deoxy-5-azacytidine * 2'-deoxy-5,6-dihydro-5-azacytidine Subject RIV: CE - Biochemistry Impact factor: 4.318, year: 2011

Balancing the Stability-Activity Trade-Off by Fine-Tuning Dehalogenase Access Tunnels

Czech Academy of Sciences Publication Activity Database

Liskova, V.; Bednář, D.; Prudníková, T.; Řezáčová, Pavlína; Koudeláková, T.; Šebestová, E.; Smatanová, I.K.; Brezovský, J.; Chaloupková, R.

2015-01-01

Roč. 7, č. 4 (2015), s. 648-659 ISSN 1867-3880 Grant - others:GA ČR(CZ) GAP207/12/0775; GA MŠk(CZ) LO1214; GA MŠk(CZ) LH14027; European Social Fund(XE) CZ.1.07/2.3.00/30.0037 Program:GA Institutional support: RVO:68378050 Keywords : alkanes * halogenation * molecular dynamics * enzyme catalysis * protein engineering Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.724, year: 2015

Změny koncentračního pole uhlíku, manganu a mědi v eutektické buňce litiny s kuličkovým grafitem

Czech Academy of Sciences Publication Activity Database

Musilová, I.; Šenberger, J.; Stránský, K.; Levíček, P.; Doležal, P.; Million, Bořivoj

2005-01-01

Roč. 53, 7-8 (2005), s. 313-318 ISSN 0037-6825 R&D Projects: GA ČR(CZ) GA106/05/0446; GA ČR(CZ) GA106/04/1006; GA ČR(CZ) GA106/04/0949; GA ČR(CZ) GA106/05/0446 Institutional research plan: CEZ:AV0Z20410507 Keywords : spheroidal graphite cast iron * effect of other elements on the iron * thermodynamics Subject RIV: JG - Metallurgy

Aphid parasitoid (Hymenoptera:Braconidae: Aphidiinae) in wetland habitats in western Palearctic: key and associated aphid parasitoid guilds

Czech Academy of Sciences Publication Activity Database

Tomanović, Ž.; Starý, Petr; Kavallieratos, N. G.; Gagić, V.; Plećaš, M.; Janković, M.; Rakhshani, E.; Ćetković, A.; Petrović, A.

2012-01-01

Roč. 48, 1-2 (2012), s. 189-198 ISSN 0037-9271 Grant - others:The Ministry of Science and Technological Development of the Republic of Serbia(RS) 043001 Institutional research plan: CEZ:AV0Z50070508 Keywords : aphid parasitoids * tritrophic interactions * wetlands Subject RIV: EH - Ecology, Behaviour Impact factor: 0.529, year: 2012 http://zoologie.umh.ac.be/asef/pdf/2012_48_01_02/full/Tomanovic_et_al_2012_ASEF_48_1_2_189_198_full.pdf

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

2005-04-29

Apr 29, 2005 ... Urinary tract infection was also common, being present in 58.9% of ... vesicostomy (42.9%), initial valve ablation (51.8%) and urethral catheterization 5.3%. ... 10% of the cases and included poor stream, gross haematuria and.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

Prof Kakande

A case admitted in the emergency department with pain lower abdomen and anal region following ... are only limited by the capacity of their rectum, not their imagination5. A total of ... which is important in planning of the extraction program7.

Design and Development of a 5,000 Barrel Collapsible Fabric Petroleum Fuel Tank Assembly.

Science.gov (United States)

1981-08-01

Compounds 4 Characteristics of Coated Fabric 24 5 Caracteristics of Bonded Fittings 26 6 Characteristics of Seams 27 v LIST OF APPENDICES PAGE APPENDIX "A...Foot Hose, 6 Feet CP24-0061 Elastofab Ground Cloth, Polyethlene CP92-0037 Read Plastics 1/2-Inch Rising Stem Gate Valve CP24-0018 Speakman 6-Inch...Distributing Company Easton Steel 83 North Main Street P. 0. Box 599 Yardley PA 19067 Easton MD 21601 SAS Gasket and Supply Co. Bronze & Plastic Specialties

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.

African Journals Online (AJOL)

Hp 630 Dual Core

Oesophageal FB poses a management challenge to the Otorhinolaryngologist and its management modalities depends ... mucosa after FB extraction, outcome of intervention, duration of hospital stay after surgical intervention, and ..... Ann Afr Med 2006; 5:52 5. 21. Muir AD, White J, McGuigan JA,McManus KG, Graham AN.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

Prof Kakande

Table 2. Therapeutic Procedures and Postoperative Recommendations of Patients who Underwent URS for ureteric stone. Procedure. Frequency. Percent. Post-operative recommendation. Frequency. Percent. None. 6. 15.8. Discharge. 24. 63.2. Only J stenting. 9. 23.7. Repeat URS. 2. 5.3. Stone extraction 19. 50. ESWL. 4.

Gene expression of circulating tumour cells in breast cancer patients

Directory of Open Access Journals (Sweden)

Bölke E

2009-09-01

Full Text Available Abstract Background The diagnostic tools to predict the prognosis in patients suffering from breast cancer (BC need further improvements. New technological achievements like the gene profiling of circulating tumour cells (CTC could help identify new prognostic markers in the clinical setting. Furthermore, gene expression patterns of CTC might provide important informations on the mechanisms of tumour cell metastasation. Materials and methods We performed realtime-PCR and multiplex-PCR analyses following immunomagnetic separation of CTC. Peripheral blood (PB samples of 63 patients with breast cancer of various stages were analyzed and compared to a control group of 14 healthy individuals. After reverse-transcription, we performed multiplex PCR using primers for the genes ga733.3, muc-1 and c-erbB2. Mammaglobin1, spdef and c-erbB2 were analyzed applying realtime-PCR. Results ga733.2 overexpression was found in 12.7% of breast cancer cases, muc-1 in 15.9%, mgb1 in 9.1% and spdef in 12.1%. In this study, c-erbB2 did not show any significant correlation to BC, possibly due to a highly ambient expression. Besides single gene analyses, gene profiles were additionally evaluated. Highly significant correlations to BC were found in single gene analyses of ga733.2 and muc-1 and in gene profile analyses of ga733.3*muc-1 and GA7 ga733.3*muc-1*mgb1*spdef. Conclusion Our study reveals that the single genes ga733.3, muc-1 and the gene profiles ga733.3*muc-1 and ga733.3*3muc-1*mgb1*spdef can serve as markers for the detection of CTC in BC. The multigene analyses found highly positive levels in BC patients. Our study indicates that not single gene analyses but subtle patterns of multiple genes lead to rising accuracy and low loss of specificity in detection of breast cancer cases.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

Improper mastication from poorly fitting dentures is present in up to 50% of cases; in fact edentulous patients may be at risk due to inadequate mastication resulting in large boluses of food entering the stomach5,6. Another key element in the development of phytobezoar is gastric stasis induced by gastric surgery2,3.

Allele mining across DREB1A and DREB1B in diverse rice ...

Indian Academy of Sciences (India)

1. Kba lum. UR8. Landrace. Upland. Meghalaya. 0.13. 9. 0.91. 15. 73.33. 2 khonorullo 1. UR9. Landrace. Upland. Nagaland. 0.05. 2. 0.78. 13. 80.00. 3. Nagaland. UR10. Landrace. Upland. Nagaland. 0.15. 11. 1.84. 24. 40.00 special. 4. Kba thang. UR11. Landrace. Upland. Meghalaya. 0.06. 3. 0.64. 7. 46.67 maw. 5.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...

African Journals Online (AJOL)

DELL

embryonal tumour of the kidney that may contain the 3 germ cells: the stroma cells, the .... renal pelvis anatomy is distorted, the renal vessels could be obscured and ... Sembulingam M.: Cardiac output, in Essentials of Medical physiology, ed 5.

ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.

African Journals Online (AJOL)

DELL

One hundred and eighty-seven final year medical students completed the seven final ... best chance of survival. Health ... Ever bled. 41 subjects. Bleed - last 12 months. 27 subjects. No of times within the last 12 months 2-5 times. Nature of ...

ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.

African Journals Online (AJOL)

DELL

aspiration Fine Needle Techniques in Cytodiagnosis of ... Kobusingye5 found a high incidence of cancer of 19.6% of nodules from histopathology reports at Mulago. ... from the surgical and medical Endocrine units as well as Breast unit. ..... was made in 48.8% of the patients while with ultrasonography it was 82.2%. Other.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...

African Journals Online (AJOL)

DELL

results of aberrant vessels angiogenesis during embryogenesis (i.e. arterial, venous, capillary, lymphatic or mixed)3. They are classified clinically by their blood flow characteristics and can be described as “high flow” or “low flow” lesions4,5. Low flow lesions are more prevalent and consist of capillary, venous, lymphatic and.

Prevalence of low physical activity level among preschool children. DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n4p390

Directory of Open Access Journals (Sweden)

Mauro Virgilio Gomes Barros

2012-07-01

Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n4p390Physical activity (PA in children has a decisive role in motor development and prevention of childhood obesity. The available evidence suggests that there is high preva­lence of low levels of PA in children, but little is known about the level of PA in preschool children. The objective of this study was to identify the prevalence and the factors associated with low levels of PA in preschool children. This was a cross-sectional study performed in private schools in the municipality of Olinda (state of Pernambuco, with data collection through parent’s face-to-face interviews. The study included 265 children (54.3% girls with mean age of 4.9 years (SD=0.8. Children who did not perform at least 60 minutes/day of outdoors physical activities were considered exposed to low levels of PA. Data analysis was performed by logistic regression considering low level of PA as the outcome. The results showed that 65.3% (95%CI: 9.4-70.8 of children were classified as exposed to ‘low level of PA’. Analysis showed that higher parental education (OR=2.41; 95%CI: 1.13-5.10, lack of space for playing at home (OR=2.36; 95%CI: 1.17- 4.78, and attending school in the afternoon (OR=2.92, 95%CI 1.55-5.49 or full-time (OR=57.1, 95%CI 6.57-496.2 were associated with low levels of PA. Preschoolers from families with higher number of children had lower likelihood of low level of PA (OR=0.49; 95%CI 0.26-0.93. It can be concluded that the proportion of children exposed to low levels of PA is high compared to the results of similar studies and that parental and environmental factors are associated with physical activity level in preschool-aged children.

Investigation of high-energy sources in optical light by ESA Gaia

Czech Academy of Sciences Publication Activity Database

Hudec, R.; Šimon, Vojtěch; Hudec, L.; Hudcová, Věra

2010-01-01

Roč. 81, č. 1 (2010), s. 476-481 ISSN 0037-8720. [Multifrequency behaviour of high energy cosmic sources. Vulcano, 25.05.2009-30.05. 2009] R&D Projects: GA ČR GA205/08/1207 Grant - others:ESA(XE) ESA- PECS project No. 98058; GA ČR(CZ) GA102/09/0997; GA MŠk(CZ) ME09027; ESA(XE) ESA- PECS project No. 98023 Institutional research plan: CEZ:AV0Z10030501 Keywords : high-energy sources * cataclysmic variables * low-dispersion spectra Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Spectroscopic Properties of Benzene at the Air-Ice Interface: A Combined Experimental-Computational Approach

Czech Academy of Sciences Publication Activity Database

Kania, R.; Malongwe, J. K.; Nachtigallová, Dana; Krousko, J.; Gladich, I.; Roeselová, Martina; Heger, D.; Klán, P.

2014-01-01

Roč. 118, č. 35 (2014), s. 7535-7547 ISSN 1089-5639 R&D Projects: GA ČR GAP208/12/1318; GA ČR(CZ) GAP208/10/1724; GA MŠk(CZ) LH11021 Grant - others:GA ČR(CZ) GAP503/10/0947; GA MŠk(CZ) LO1214; European Social Fund(XE) CZ.1.07/2.3.00/30.0037 Institutional support: RVO:61388963 Keywords : density functional theory * polycyclic aromatic hydrocarbons * atmospheric air/ice interfaces Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.693, year: 2014

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.

African Journals Online (AJOL)

Hp 630 Dual Core

required yielding perhaps the better native muscle function, the pin is easily removed in ... fixation in children offered guidance in observing our series of adult patients 5, 6. ... Many tibia fractures are treated by manipulation and plaster cast.

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J.

African Journals Online (AJOL)

Hp 630 Dual Core

(after prostate and lung cancer in males and breast and lung cancer in females)5. ... lymph nodes for localized disease and the procedure results in cure in .... Forty seven patients received palliative treatments in the form of .... Health education.

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.

African Journals Online (AJOL)

Hp 630 Dual Core

severe Mitral Valve Regurgitation and severe mixed Mitral Valve Disease. 1,2,3 ... syndrome which has been attributed to the loss of annulo ventricular continuity 4,5,6,7. ..... Rozich JD, Carabello BA, Usher BW, Kratz JM, Bell AE, Zile MR.

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...

African Journals Online (AJOL)

Hp 630 Dual Core

respiratory tract infection (RTI) following endotracheal intubation relates to clinical or radiographic ... In Africa, hospital wide HAI prevalence varies between 2.5% and 14.8% in Algeria, Burkina. Faso, Senegal and ... in children in Mulago National referral hospital to be 20.7% with an associated phlebitis rate of. 17.4% on the ...

Effects of water salinity on hatching of egg, growth and survival of larvae and fingerlings of snake head fish, Channa striatus

Directory of Open Access Journals (Sweden)

Thumronk Amornsakun

2017-04-01

Full Text Available A study on the effect of water salinity ranging from 0-30 ppt on hatching success of snake head fish, Channa striatus was conducted in a 15-liter glass aquarium (water volume 10 liters containing 500 eggs for various levels of water salinity. Fertilization rates at 0, 5, 10, 11, 12, 13 and 14 ppt were 69.33, 72.67, 71.33, 72.67, 82.00, 73.33 and 10.67%, respectively. The fertilization rate at 12-13 ppt salinity was significantly (P0.05 among 0, 5 and 10 ppt.

Optimization of catalyst-solvent system for preparation of alpha-5,6-dihydro-5-aza-2'-deoxy-[6-3H]-cytidine

Czech Academy of Sciences Publication Activity Database

Elbert, Tomáš

2011-01-01

Roč. 54, č. 5 (2011), s. 285-285 ISSN 0362-4803. [Workshop of the International Isotope Society - Central European Division. The Synthesis and Applications of Isotopes and Isotopically Labelled Compounds /17./. 23.09.2010-24.09.2010, Bad Soden] Institutional research plan: CEZ:AV0Z40550506 Keywords : tritium * labelled compounds * alfa-5,6-dihydro-5-aza-2'-deoxy-cytidine Subject RIV: CC - Organic Chemistry

N-{4-[4-(4-Fluorophenyl-1-(2-methoxyethyl-2-methylsulfanyl-1H-imidazol-5-yl]-2-pyridyl}-2-methyl-3-phenylpropionamide

Directory of Open Access Journals (Sweden)

Stefan Laufer

2009-12-01

Full Text Available In the crystal structure of the title compound, C28H29FN4O2S, the imidazole ring makes dihedral angles of 11.85 (7, 73.33 (7 and 22.83 (8° with the 4-fluorophenyl, pyridine and phenyl rings, respectively. The 4-fluorophenyl ring makes dihedral angles of 77.91 (7 and 26.93 (8° with the pyridine and phenyl rings, respectively. The phenyl and pyridine rings are nearly perpendicular, making a dihedral angle of 86.47 (9°. The crystal packing shows an intermolecular N—H...O hydrogen-bonding interaction between the N—H and carbonyl groups of the amide functions.

Porcine ubiquitin-like 5 (UBL5) gene: genomic organization, polymorphisms, mRNA cloning, splicing variants and association study

Czech Academy of Sciences Publication Activity Database

Masopust, Martin; Weisz, Filip; Bartenschlager, H.; Knoll, A.; Vykoukalová, Z.; Geldermann, H.; Čepica, Stanislav

2014-01-01

Roč. 41, č. 4 (2014), s. 2353-2362 ISSN 0301-4851 R&D Projects: GA ČR GAP502/10/1216 Institutional support: RVO:67985904 Keywords : pig * UBL5 * PCR cloning Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.024, year: 2014

Determination of 5-nitroindazole using silver solid amalgam electrode

Czech Academy of Sciences Publication Activity Database

Nováková, Kateřina; Hrdlička, V.; Navrátil, Tomáš; Vyskočil, V.; Barek, J.

2015-01-01

Roč. 146, č. 5 (2015), s. 761-769 ISSN 0026-9247 R&D Projects: GA ČR(CZ) GAP208/12/1645 Institutional support: RVO:61388955 Keywords : 5-nitroindazole * hanging mercury drop electrode * silver sold amalgam electrode Subject RIV: CG - Electrochemistry Impact factor: 1.131, year: 2015

Calorimetric and FTIR Studies of Acetonitrile on H-[Fe]ZSM-5 and H-[Al]ZSM-5

Czech Academy of Sciences Publication Activity Database

Kotrla, Josef; Kubelková, Ludmila; Lee, C. C.; Gorte, R. J.

1998-01-01

Roč. 102, č. 8 (1998), s. 1437-1443 ISSN 1089-5647 R&D Projects: GA MŠk OC D5.10 Institutional research plan: CEZ:A54/98:Z4-040-9-ii Keywords : adsorption of acetonitrile * neutral surface complex Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.385, year: 1998

Dr Jekyll and Mr Hyde: a strange case of 5-ethynyl-2 '-deoxyuridine and 5-ethynyl-2 '- deoxycytidine

Czech Academy of Sciences Publication Activity Database

Ligasová, A.; Liboska, Radek; Friedecký, D.; Mičová, K.; Adam, T.; Oždian, T.; Rosenberg, Ivan; Koberna, K.

2016-01-01

Roč. 6, č. 1 (2016), č. článku 150172. ISSN 2046-2441 R&D Projects: GA MZd NV15-31604A Institutional support: RVO:61388963 Keywords : cytidine deaminase * dCMP deaminase * 5-ethynyl-2 '-deoxyuridine * 5-ethynyl-2 '-deoxycytidine * DNA replication Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.481, year: 2016 http://rsob.royalsocietypublishing.org/content/6/1/150172

Preparation of alpha-5-aza-2'-deoxy-[6-3H]cytidine

Czech Academy of Sciences Publication Activity Database

Elbert, Tomáš; Černý, B.

2008-01-01

Roč. 73, č. 5 (2008), s. 701-704 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z40550506 Keywords : alfa-5aza-2'-deoxy-cytidine Subject RIV: CC - Organic Chemistry Impact factor: 0.784, year: 2008

Adsorption of 5-halouracils on Au(111)

Czech Academy of Sciences Publication Activity Database

Plekan, O.; Feyer, V.; Tsud, N.; Vondráček, Martin; Cháb, Vladimír; Matolín, V.; Prince, K. C.

2012-01-01

Roč. 606, 3-4 (2012), s. 435-443 ISSN 0039-6028 R&D Projects: GA MŠk(CZ) LC06058 Institutional support: RVO:68378271 Keywords : 5-halouracils * gold * chemisorption * XPS * NEXAFS Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.838, year: 2012

Tunable Push-Pull Interactions in 5-Nitrosopyrimidines

Czech Academy of Sciences Publication Activity Database

Procházková, Eliška; Čechová, Lucie; Tarábek, Ján; Janeba, Zlatko; Dračínský, Martin

2016-01-01

Roč. 81, č. 9 (2016), s. 3780-3789 ISSN 0022-3263 R&D Projects: GA ČR GA15-11223S Institutional support: RVO:61388963 Keywords : polysubstituted 5-nitrosopyrimidines * molecular dynamics * NMR spectroscopy Subject RIV: CC - Organic Chemistry Impact factor: 4.849, year: 2016

Stimulant Reduction Intervention using Dosed Exercise (STRIDE - CTN 0037: Study protocol for a randomized controlled trial

Directory of Open Access Journals (Sweden)

Morris David W

2011-09-01

Full Text Available Abstract Background There is a need for novel approaches to the treatment of stimulant abuse and dependence. Clinical data examining the use of exercise as a treatment for the abuse of nicotine, alcohol, and other substances suggest that exercise may be a beneficial treatment for stimulant abuse, with direct effects on decreased use and craving. In addition, exercise has the potential to improve other health domains that may be adversely affected by stimulant use or its treatment, such as sleep disturbance, cognitive function, mood, weight gain, quality of life, and anhedonia, since it has been shown to improve many of these domains in a number of other clinical disorders. Furthermore, neurobiological evidence provides plausible mechanisms by which exercise could positively affect treatment outcomes. The current manuscript presents the rationale, design considerations, and study design of the National Institute on Drug Abuse (NIDA Clinical Trials Network (CTN CTN-0037 Stimulant Reduction Intervention using Dosed Exercise (STRIDE study. Methods/Design STRIDE is a multisite randomized clinical trial that compares exercise to health education as potential treatments for stimulant abuse or dependence. This study will evaluate individuals diagnosed with stimulant abuse or dependence who are receiving treatment in a residential setting. Three hundred and thirty eligible and interested participants who provide informed consent will be randomized to one of two treatment arms: Vigorous Intensity High Dose Exercise Augmentation (DEI or Health Education Intervention Augmentation (HEI. Both groups will receive TAU (i.e., usual care. The treatment arms are structured such that the quantity of visits is similar to allow for equivalent contact between groups. In both arms, participants will begin with supervised sessions 3 times per week during the 12-week acute phase of the study. Supervised sessions will be conducted as one-on-one (i.e., individual sessions

High trait aggression in men is associated with low 5-HT levels, as indexed by 5-HT4 receptor binding

Science.gov (United States)

Mc Mahon, Brenda; MacDonald Fisher, Patrick; Jensen, Peter Steen; Svarer, Claus; Moos Knudsen, Gitte

2016-01-01

Impulsive aggression has commonly been associated with a dysfunction of the serotonin (5-HT) system: many, but not all, studies point to an inverse relationship between 5-HT and aggression. As cerebral 5-HT4 receptor (5-HT4R) binding has recently been recognized as a proxy for stable brain levels of 5-HT, we here test the hypothesis in healthy men and women that brain 5-HT levels, as indexed by cerebral 5-HT4R, are inversely correlated with trait aggression and impulsivity. Sixty-one individuals (47 men) underwent positron emission tomography scanning with the radioligand [11C]SB207145 for quantification of brain 5-HT4R binding. The Buss–Perry Aggression Questionnaire (BPAQ) and the Barratt Impulsiveness Scale were used for assessment of trait aggression and trait impulsivity. Among male subjects, there was a positive correlation between global 5-HT4R and BPAQ total score (P = 0.037) as well as BPAQ physical aggression (P = 0.025). No main effect of global 5-HT4R on trait aggression or impulsivity was found in the mixed gender sample, but there was evidence for sex interaction effects in the relationship between global 5-HT4R and BPAQ physical aggression. In conclusion we found that low cerebral 5-HT levels, as indexed by 5-HT4R binding were associated with high trait aggression in males, but not in females. PMID:26772668

Vibrational spectra and thermodynamics of biomolecule: 5-chlorocytosine

Czech Academy of Sciences Publication Activity Database

Rastori, V. K.; Palafox, M. A.; Lang, Kamil; Singhal, S.K.; Soni, R.K.; Sharma, R.

2006-01-01

Roč. 44, č. 9 (2006), s. 653-660 ISSN 0019-5596 Institutional research plan: CEZ:AV0Z40320502 Keywords : vibrational spectra * 5-chlorocytosine * laser Raman spectra Subject RIV: CA - Inorganic Chemistry Impact factor: 0.380, year: 2006

Direct synthesis of carbon-templating mesoporous ZSM-5 using microwave heating

Czech Academy of Sciences Publication Activity Database

Koo, J.-B.; Jiang, N.; Saravanamurugan, S.; Voláková, Martina; Musilová, Zuzana; Čejka, Jiří; Park, S.-E.

2010-01-01

Roč. 276, č. 2 (2010), s. 327-334 ISSN 0021-9517 Institutional research plan: CEZ:AV0Z40400503 Keywords : mesoporous ZSM-5 * template * microwave irradiation * carbon Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.415, year: 2010

ISSN 2073 ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg.

African Journals Online (AJOL)

DELL

A 12 years old girl, first in birth order was brou right clavicular area. The swelling had been not in size gradually as the patient grew up with ag medical, surgical or family history of significa injury. On examination, the patient was of avera middle of right clavicle. The skin over the lum increased with abduction of the right.

Bidimensional ZSM-5 zeolites probed as catalysts for polyethylene cracking

Czech Academy of Sciences Publication Activity Database

Peral, A.; Escola, J. M.; Serrano, D. P.; Přech, Jan; Ochoa-Hernández, Cristina; Čejka, Jiří

2016-01-01

Roč. 6, č. 8 (2016), s. 2754-2765 ISSN 2044-4753 R&D Projects: GA ČR(CZ) GAP106/12/0189 Institutional support: RVO:61388955 Keywords : PILLARED MOLECULAR -SIEVE * NANOCRYSTALLINE ZSM-5 * PROTOZEOLITIC UNITS Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.773, year: 2016

5-Azacytosine compounds in medicinal chemistry: current stage and future perspectives

Czech Academy of Sciences Publication Activity Database

Krečmerová, Marcela; Otmar, Miroslav

2012-01-01

Roč. 4, č. 8 (2012), s. 991-1005 ISSN 1756-8919 R&D Projects: GA MPO FR-TI4/625 Institutional support: RVO:61388963 Keywords : 5-azacytidine * 2´-deoxy-5-azacytidine * hypomethylation * DAC * epigenetics * DNA methylation * acyclic nucleoside phosphonates * 5-azacytosine * HPMP-5-azacytosine * prodrugs Subject RIV: CC - Organic Chemistry Impact factor: 3.310, year: 2012

Aromatic Transformations Over Mesoporous ZSM-5: Advantages and Disadvantages

Czech Academy of Sciences Publication Activity Database

Musilová, Zuzana; Žilková, Naděžda; Park, S.-E.; Čejka, Jiří

2010-01-01

Roč. 53, 19-20 (2010), s. 1457-1469 ISSN 1022-5528 Institutional research plan: CEZ:AV0Z40400503 Keywords : mesoporous ZSM-5 * alkylation * disproportionation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.359, year: 2010

Apoptosis inhibitor 5 (API-5; AAC-11; FIF) is upregulated in human carcinomas in vivo

Czech Academy of Sciences Publication Activity Database

Kočí, Lenka; Chlebová, K.; Hýžďalová, Martina; Hofmanová, Jiřina; Jíra, M.; Kysela, P.; Kozubík, Alois; Kala, Z.; Krejčí, Pavel

2012-01-01

Roč. 3, č. 4 (2012), s. 913-916 ISSN 1792-1074 R&D Projects: GA ČR(CZ) GA305/09/1526; GA ČR(CZ) GD303/09/H048; GA ČR(CZ) GAP301/11/1730 Institutional research plan: CEZ:AV0Z50040702 Keywords : apoptosis inhibitor 5 * apoptosis * human carcinoma Subject RIV: BO - Biophysics Impact factor: 0.237, year: 2012

High trait aggression in men is associated with low 5-HT levels, as indexed by 5-HT4 receptor binding.

Science.gov (United States)

da Cunha-Bang, Sofi; Mc Mahon, Brenda; Fisher, Patrick MacDonald; Jensen, Peter Steen; Svarer, Claus; Knudsen, Gitte Moos

2016-04-01

Impulsive aggression has commonly been associated with a dysfunction of the serotonin (5-HT) system: many, but not all, studies point to an inverse relationship between 5-HT and aggression. As cerebral 5-HT4 receptor (5-HT4R) binding has recently been recognized as a proxy for stable brain levels of 5-HT, we here test the hypothesis in healthy men and women that brain 5-HT levels, as indexed by cerebral 5-HT4R, are inversely correlated with trait aggression and impulsivity. Sixty-one individuals (47 men) underwent positron emission tomography scanning with the radioligand [(11)C]SB207145 for quantification of brain 5-HT4R binding. The Buss-Perry Aggression Questionnaire (BPAQ) and the Barratt Impulsiveness Scale were used for assessment of trait aggression and trait impulsivity. Among male subjects, there was a positive correlation between global 5-HT4R and BPAQ total score (P = 0.037) as well as BPAQ physical aggression (P = 0.025). No main effect of global 5-HT4R on trait aggression or impulsivity was found in the mixed gender sample, but there was evidence for sex interaction effects in the relationship between global 5-HT4R and BPAQ physical aggression. In conclusion we found that low cerebral 5-HT levels, as indexed by 5-HT4R binding were associated with high trait aggression in males, but not in females. © The Author (2016). Published by Oxford University Press. For Permissions, please email: journals.permissions@oup.com.

Characterization of the lasing properties of a 5%Yb doped Lu.sub.2./sub.SiO.sub.5./sub. crystal along its three optical axes

Czech Academy of Sciences Publication Activity Database

Toci, G.; Pirri, A.; Beitlerová, Alena; Shoji, Y.; Yoshikawa, A.; Hybler, Jiří; Nikl, Martin; Vannini, M.

2015-01-01

Roč. 23, č. 10 (2015), s. 13210-13221 ISSN 1094-4087 Institutional support: RVO:68378271 Keywords : Lu 2 SiO 5 * Yb-doped * laser Subject RIV: BH - Optics, Masers, Lasers Impact factor: 3.148, year: 2015

Photoluminescence and scintillation of LGS (La.sub.3./sub.Ga.sub.5./sub.SiO.sub.14./sub.), LNGA (La.sub.3./sub.Nb.sub.0.5./sub.Ga.sub.5.3./sub.Al.sub.0.2./sub.O.sub.14./sub.) and LTGA (La.sub.3./sub.Tb.sub.0.5./sub.Ga.sub.5.3./sub.Al.sub.0.2./sub.O.sub.14./sub.) single crystals

Czech Academy of Sciences Publication Activity Database

Futami, Y.; Yanagida, T.; Fujimoto, Y.; Jarý, Vítězslav; Pejchal, Jan; Yokota, Y.; Kikuchi, M.; Nikl, Martin; Yoshikawa, A.

2012-01-01

Roč. 34, č. 9 (2012), s. 1513-1516 ISSN 0925-3467 Grant - others:AV ČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : La 3 Ga 5 SiO 14 * La 3 Nb 0.5 Ga 5.3 Al 0.2 O 14 * La 3 Tb 0.5 Ga 5.3 Al 0.2 O 14 * α-ray * photoluminescence * scintillation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.918, year: 2012

ISSN 2073 East Cent. Afr. j. surg.

African Journals Online (AJOL)

DELL

Bilateral spontaneous rupture of the patella tendon is an uncommon injury. However ... knees flexed and contracts the quadriceps violently against the body weight in an effort to prevent a fall 4, 5. ... and inability to lift the leg straight 5, 6.

Linkage and QTL mapping for Sus scrofa chromosome 5

Czech Academy of Sciences Publication Activity Database

Lee, S. S.; Chen, Y.; Moran, C.; Stratil, Antonín; Reiner, G.; Bartenschlager, H.; Moser, G.; Geldermann, H.

2003-01-01

Roč. 120, č. 1 (2003), s. 38-44 ISSN 0931-2668 R&D Projects: GA ČR GA523/97/1305 Institutional research plan: CEZ:AV0Z5045916 Keywords : chromosome 5 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.634, year: 2003

The Association between Intermodal (PM1-2.5) and PM1, PM2.5, Coarse Fraction and Meteorological Parameters in Various Environments in Central Europe.

Czech Academy of Sciences Publication Activity Database

Kozáková, Jana; Pokorná, P.; Černíková, A.; Hovorka, J.; Braniš, M.; Moravec, Pavel; Schwarz, Jaroslav

2017-01-01

Roč. 17, č. 5 (2017), s. 1234-1243 ISSN 1680-8584 R&D Projects: GA ČR(CZ) GBP503/12/G147 Institutional support: RVO:67985858 Keywords : intermodal fraction * personal cascade impactor sampler * PMx Subject RIV: DI - Air Pollution ; Quality OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 2.606, year: 2016

The extracellular domain of Lrp5/6 inhibits noncanonical Wnt signaling in vivo

Czech Academy of Sciences Publication Activity Database

Bryja, Vítězslav; Andersson, E.R.; Schambony, A.; Esner, M.; Bryjová, Lenka; Biris, K.K.; Hall, A.C.; Kraft, B.; Čajánek, L.; Yamaguchi, T.P.; Buckingham, M.; Arenas, E.

2009-01-01

Roč. 20, č. 3 (2009), s. 924-936 ISSN 1059-1524 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : non-canonical Wnt signaling * Lrp5/6 * mouse Subject RIV: BO - Biophysics Impact factor: 5.979, year: 2009

Control of the colossal magnetoresistance by strain effect in Nd.sub.0.5./sub.Ca.sub.0.5./sub.MnO.sub.3./sub. thin films

Czech Academy of Sciences Publication Activity Database

Buzin, R. E.; Prellier, W.; Simon, Ch.; Mercone, S.; Mercey, B.; Raveau, B.; Šebek, Josef; Hejtmánek, Jiří

2001-01-01

Roč. 79, č. 5 (2001), s. 647-649 ISSN 0003-6951 Institutional research plan: CEZ:AV0Z1010914 Keywords : manganite thin films * colossal magnetoresistance Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.849, year: 2001

Determination of the antioxidative activity of substituted 5-aminopyrimidines

Czech Academy of Sciences Publication Activity Database

Procházková, Eliška; Jansa, Petr; Dračínský, Martin; Holý, Antonín; Mertlíková-Kaiserová, Helena

2012-01-01

Roč. 46, č. 1 (2012), s. 61-67 ISSN 1071-5762 R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : 5-aminopyrimidines * TEAC * lipid peroxidation * HepG2 Subject RIV: CC - Organic Chemistry Impact factor: 3.279, year: 2012

Magnetism in multiferroic Pb.sub.5./sub.Cr.sub.3./sub.F.sub.19./sub..

Czech Academy of Sciences Publication Activity Database

Blinc, R.; Cevc, P.; Tavčar, G.; Žemva, B.; Laguta, Valentyn; Trontelj, Z.; Jagodič, M.; Pajič, D.; Balcytis, A.; Scott, J.F.

2012-01-01

Roč. 85, č. 5 (2012), "054419-1"-"054419-5" ISSN 1098-0121 Institutional research plan: CEZ:AV0Z10100521 Keywords : multiferroic * magnetism * ferroelectricity * magnetic resonance * Pb 5 Cr 3 F 19 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.767, year: 2012

Excitonic condensation of strongly correlated electrons: the case of Pr.sub.0.5./sub. Ca.sub.0.5./sub. CoO.sub.3./sub..

Czech Academy of Sciences Publication Activity Database

Kuneš, Jan; Augustinský, Pavel

2014-01-01

Roč. 90, č. 23 (2014), "235112-1"-"235112-5" ISSN 1098-0121 R&D Projects: GA ČR GA13-25251S Institutional support: RVO:68378271 Keywords : excitonic condensation * strongly correlated electrons * cobaltites Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.736, year: 2014

Crystal structures of (Z-5-[2-(benzo[b]thiophen-2-yl-1-(3,5-dimethoxyphenylethenyl]-1H-tetrazole and (Z-5-[2-(benzo[b]thiophen-3-yl-1-(3,4,5-trimethoxyphenylethenyl]-1H-tetrazole

Directory of Open Access Journals (Sweden)

Narsimha Reddy Penthala

2016-05-01

Full Text Available (Z-5-[2-(Benzo[b]thiophen-2-yl-1-(3,5-dimethoxyphenylethenyl]-1H-tetrazole methanol monosolvate, C19H16N4O2S·CH3OH, (I, was prepared by the reaction of (Z-3-(benzo[b]thiophen-2-yl-2-(3,5-dimethoxyphenylacrylonitrile with tributyltin azide via a [3 + 2]cycloaddition azide condensation reaction. The structurally related compound (Z-5-[2-(benzo[b]thiophen-3-yl-1-(3,4,5-trimethoxyphenylethenyl]-1H-tetrazole, C20H18N4O3S, (II, was prepared by the reaction of (Z-3-(benzo[b]thiophen-3-yl-2-(3,4,5-trimethoxyphenylacrylonitrile with tributyltin azide. Crystals of (I have two molecules in the asymmetric unit (Z′ = 2, whereas crystals of (II have Z′ = 1. The benzothiophene rings in (I and (II are almost planar, with r.m.s deviations from the mean plane of 0.0084 and 0.0037 Å in (I and 0.0084 Å in (II. The tetrazole rings of (I and (II make dihedral angles with the mean planes of the benzothiophene rings of 88.81 (13 and 88.92 (13° in (I, and 60.94 (6° in (II. The dimethoxyphenyl and trimethoxyphenyl rings make dihedral angles with the benzothiophene rings of 23.91 (8 and 24.99 (8° in (I and 84.47 (3° in (II. In both structures, molecules are linked into hydrogen-bonded chains. In (I, these chains involve both tetrazole and methanol, and are parallel to the b axis. In (II, molecules are linked into chains parallel to the a axis by N—H...N hydrogen bonds between adjacent tetrazole rings.

Dynamic alterations of bone marrow cytokine landscape of myelodysplastic syndromes patients treated with 5-azacytidine

Czech Academy of Sciences Publication Activity Database

Moudra, A.; Hubackova, Sona; Machalova, V.; Vančurová, M.; Bartek, J.; Reinis, M.; Hodny, Z.; Jonasova, A.

2016-01-01

Roč. 5, č. 10 (2016), č. článku e1183860. ISSN 2162-402X Institutional support: RVO:86652036 Keywords : 5-azacytidine * DNA damage * cytokines * bone marrow plasma Subject RIV: FD - Oncology ; Hematology Impact factor: 7.719, year: 2016

Synthesis of Nucleosides through Direct Glycosylation of Nucleobases with 5-O-Monoprotected or 5-Modified Ribose: Improved Protocol, Scope, and Mechanism

Czech Academy of Sciences Publication Activity Database

Downey, Alan Michael; Pohl, Radek; Roithová, J.; Hocek, Michal

2017-01-01

Roč. 23, č. 16 (2017), s. 3910-3917 ISSN 0947-6539 R&D Projects: GA TA ČR(CZ) TE01020028; GA ČR(CZ) GA16-00178S Institutional support: RVO:61388963 Keywords : epoxides * glycosylation * nucleosides * riboses * synthesis design Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 5.317, year: 2016

Low-temperature magnetic properties of NpNi.sub.5./sub..

Czech Academy of Sciences Publication Activity Database

Hen, A.; Colineau, E.; Eloirdi, R.; Griveau, J.C.; Magnani, N.; Wilhelm, F.; Rogalev, A.; Sanchez, J.-P.; Shick, Alexander; Halevy, I.; Orion, I.; Caciuffo, R.

2014-01-01

Roč. 89, č. 5 (2014), "054480-1"-"054480-11" ISSN 1098-0121 R&D Projects: GA ČR(CZ) GAP204/10/0330 Institutional support: RVO:68378271 Keywords : magnetism * Mossbauer spectra * XMCD Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.736, year: 2014

Oxidative polymerization of anilinium 5-sulfosalicylate with peroxydisulfate in water

Czech Academy of Sciences Publication Activity Database

Marjanovic, B.; Juranic, I.; Mentus, S.; Ciric-Marjanovic, G.; Holler, Petr

2010-01-01

Roč. 64, č. 6 (2010), s. 783-790 ISSN 0366-6352 R&D Projects: GA AV ČR IAA400500905 Institutional research plan: CEZ:AV0Z40500505 Keywords : anilinium 5-sulfosalicylate * peroxydisulfate * oxidative polymerization Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.754, year: 2010

Hematopoiesis in 5-Fluorouracil-Treated Adenosine A(3) Receptor Knock-Out Mice

Czech Academy of Sciences Publication Activity Database

Hofer, Michal; Pospíšil, Milan; Dušek, L.; Hoferová, Zuzana; Komůrková, Denisa

2015-01-01

Roč. 64, č. 2 (2015), s. 255-262 ISSN 0862-8408 Institutional support: RVO:68081707 Keywords : Adenosine A(3) receptor knock-out mice * Hematopoiesis * 5-fluorouracil-induced hematotoxicity Subject RIV: BO - Biophysics Impact factor: 1.643, year: 2015

Apolipoprotein a5 and hypertriglyceridemia in prague hypertriglyceridemic rats

Czech Academy of Sciences Publication Activity Database

Kadlecová, Michaela; Hojná, Silvie; Bohuslavová, R.; Hubáček, J. A.; Zicha, Josef; Kuneš, Jaroslav

2006-01-01

Roč. 55, č. 4 (2006), s. 373-379 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) 1M0510; GA ČR(CZ) GA305/03/0769 Institutional research plan: CEZ:AV0Z50110509 Keywords : metabolic syndrome * apolipoprotein A5 * rat Subject RIV: ED - Physiology Impact factor: 2.093, year: 2006

Wnt-mediated down-regulation of Sp1 target genes by a transcriptional repressor Sp5

Czech Academy of Sciences Publication Activity Database

Fujimura, Naoko; Vacík, Tomáš; Machoň, Ondřej; Vlček, Čestmír; Scalabrin, S.; Speth, M.; Diep, D.; Krauss, S.; Kozmik, Zbyněk

2007-01-01

Roč. 282, č. 2 (2007), s. 1225-1237 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z50520514 Keywords : Wnt -mediated signaling * Sp5 transcription factor * Sp1 target genes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.581, year: 2007

Insights into the Structure of Intrastrand Cross-Link DNA Lesion-Containing Oligonucleotides: G[8-5m]T and G[8-5]C from Molecular Dynamics Simulations

Czech Academy of Sciences Publication Activity Database

Dumont, E.; Dršata, Tomáš; Guerra, C. F.; Lankaš, Filip

2015-01-01

Roč. 54, č. 5 (2015), s. 1259-1267 ISSN 0006-2960 R&D Projects: GA ČR(CZ) GA14-21893S Institutional support: RVO:61388963 Keywords : hydrogen bonds * abasic sites * duplex DNA Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.876, year: 2015

Crystal structure and transport properties of Pd5HgSe

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Vymazalová, A.; Drábek, M.; Navrátil, Jiří; Plecháček, T.; Drahokoupil, Jan

2012-01-01

Roč. 14, č. 10 (2012), s. 1476-1479 ISSN 1293-2558 R&D Projects: GA ČR GAP108/10/1315 Institutional support: RVO:61389013 ; RVO:68378271 Keywords : Pd5HgSe * Pd-Hg-Se system * crystal structure Subject RIV: CA - Inorganic Chemistry Impact factor: 1.671, year: 2012

Response of 45S5 Bioglasss foams to tensile loading

Czech Academy of Sciences Publication Activity Database

Řehořek, Lukáš; Chlup, Zdeněk; Meng, D.; Yunos, D. M.; Boccaccini, A. R.; Dlouhý, Ivo

2013-01-01

Roč. 39, č. 7 (2013), s. 8015-8020 ISSN 0272-8842 R&D Projects: GA ČR GA101/09/1821 Institutional support: RVO:68081723 Keywords : 45S5 Bioglasss * Scaffolds * Foams * Openporosity * Tensilestrength Subject RIV: JH - Ceramic s, Fire-Resistant Materials and Glass Impact factor: 2.086, year: 2013

Developmental assessment and performance analysis of vertical jump in schoolchildren. DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n4p460

Directory of Open Access Journals (Sweden)

Dalker Roberto Walter

2012-07-01

Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n4p460The vertical jump involves different levels of skill complexity and offers the individual a wide range of motor experiences. This study aimed to determine which movements in the developmental sequence performed by schoolchildren are associated with age and vertical jump performance. The sample consisted of 137 elementary school children of both sexes, aged 7-10y, with height of 1.19-1.63 m, and weight of 20-60 kg. All children were selected from first- to fourth-grade classrooms of a public school of the city of Maringá, state of Pa- raná, Brazil. A Gallahue & Ozmun matrix and a jumping platform were used as research instruments. During the experiment, each child performed three jumps. Simultaneous and coordinated upward arm lift was observed in 7-year-old children. In 9-year-old children, inconsistent preparatory crouch and lack of coordination between limb movements and trunk were observed. A prevalence of upper limb motor acts was observed when considering the significant associations found between elements of the developmental sequence and vertical jump performance. In children aged 7-10y, age group and jumping performance are associated with elements of the developmental sequence of the human body as a whole, especially with regard to the upper limbs.

Synthesis and biological activity of benzo-fused 7-deazaadenosine analogues. 5-and 6-substituted 4-amino- or 4-alkylpyrimido [4,5-b]indole ribonucleosides

Czech Academy of Sciences Publication Activity Database

Tichý, Michal; Pohl, Radek; Tloušťová, Eva; Weber, Jan; Bahador, G.; Lee, Y. J.; Hocek, Michal

2013-01-01

Roč. 21, č. 17 (2013), s. 5362-5372 ISSN 0968-0896 R&D Projects: GA ČR GAP207/11/0344 Institutional support: RVO:61388963 Keywords : nucleosides * pyrimido[4,5-b]indoles * Suzuki and Stille cross - coupling * anti-dengue virus activity Subject RIV: CC - Organic Chemistry Impact factor: 2.951, year: 2013

Functional characterization of ecto-5'-nucleotidases and apyrases in Drosophila melanogaster

Czech Academy of Sciences Publication Activity Database

Fencková, M.; Hobizalová, R.; Faltýnek Fric, Zdeněk; Doležal, T.

2011-01-01

Roč. 41, č. 12 (2011), s. 956-967 ISSN 0965-1748 Grant - others:GA ČR(CZ) GA204/09/1463 Institutional research plan: CEZ:AV0Z50070508 Keywords : Drosophila * ecto-5'-nucleotidase * apyrase Subject RIV: CE - Biochemistry Impact factor: 3.246, year: 2011

Genetic interaction between Lrp6 and Wnt5a during mouse development

Czech Academy of Sciences Publication Activity Database

Andersson, E.; Bryjová, Lenka; Biris, K.; Yamaguchi, T.P.; Arenas, E.; Bryja, Vítězslav

2010-01-01

Roč. 239, č. 1 (2010), s. 237-245 ISSN 1058-8388 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Wnt 5a * Lrp6 * somitogenesis Subject RIV: BO - Biophysics Impact factor: 2.864, year: 2010

Overexpression of Pax5 is not sufficient for neoplastic transformation of mouse neuroectoderm

Czech Academy of Sciences Publication Activity Database

Steinbach, P. J.; Kozmik, Zbyněk; Pfeffer, P.; Aguzzi, A.

2001-01-01

Roč. 93, č. 4 (2001), s. 459-467 ISSN 0020-7136 Institutional research plan: CEZ:AV0Z5052915 Keywords : Pax5 * retrovirus * transgenic mice Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.233, year: 2001

GLOBAL JOURNAL OF AGRICULTURAL SCIENCES ISSN 1596-2903

African Journals Online (AJOL)

Ada Global

Measurements of temperature, red, far red wavelength of light and the ratio red to far red were made ... Plant species within 2.5 X 2.5m2 quadrats were enumerated every two months. ... the manufacture of food for it's growth and maintenance.

Two-dimensional condensation of 5-fluorocytosine at the mercury electrode

Czech Academy of Sciences Publication Activity Database

Fojt, Lukáš; Doneux, T.; Vetterl, Vladimír

2012-01-01

Roč. 73, SI (2012), s. 141-144 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GAP205/10/2378; GA MŠk(CZ) LC06035 Institutional support: RVO:68081707 Keywords : 2D condensation * Hanging mercury drop electrode * 5-Fluorocytosine Subject RIV: BO - Biophysics Impact factor: 3.777, year: 2012

Synthetic adenosine receptor agonists modulate murine haematopoiesis: a study employing the cytotoxic action of 5-fluorouracil

Czech Academy of Sciences Publication Activity Database

Hofer, Michal; Pospíšil, Milan; Vacek, Antonín; Znojil, V.; Pipalová, I.

2004-01-01

Roč. 5, Suppl. 2 (2004), s. S65 ISSN 1466-4860. [Congress of the European Hematology Association /9./. 10.06.2004-13.06.2004, Geneva] R&D Projects: GA ČR GA305/02/0423 Keywords : 5-fluorouracil * haematopoiesis * adenosine Subject RIV: BO - Biophysics

Electrochemical properties of spinel Li4Ti5O12 nanoparticles\

Czech Academy of Sciences Publication Activity Database

Senna, M.; Fabián, M.; Kavan, Ladislav; Zukalová, Markéta; Briančin, J.; Turianicová, E.; Bottke, P.; Wilkening, M.; Šepelák, V.

2016-01-01

Roč. 20, č. 10 (2016), s. 2673-2683 ISSN 1432-8488 R&D Projects: GA ČR GA15-06511S Institutional support: RVO:61388955 Keywords : Li4Ti5O12 * reactive precursor * Li-ion battery Subject RIV: CG - Electrochemistry Impact factor: 2.316, year: 2016

Research Paper ISSN 0189-6016©2008

African Journals Online (AJOL)

African J. TradCAM

Training designed to improve circumcision knowledge, attitude and practice was delivered over 5 days to ... Application of Health Standards in Traditional Circumcision Act No. .... The questionnaire was administered in a face-to-face interview.

Chemical oxidative polymerization of dianilinium 5-sulfosalicylate

Czech Academy of Sciences Publication Activity Database

Ciric-Marjanovic, G.; Janoševic, A.; Marjanovic, B.; Trchová, Miroslava; Stejskal, Jaroslav; Holler, Petr

2007-01-01

Roč. 81, č. 9 (2007), s. 1418-1424 ISSN 0036-0244. [International Conference on Fundamental and Applied Aspects of Physical Chemistry /8./. Belgrade, 26.09.2006-29.09.2006] R&D Projects: GA AV ČR IAA4050313; GA AV ČR IAA400500504 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline 5-sulfosalicylate * nanorods * conductivity * FTIR spectroscopy * Raman spectroscopy Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.477, year: 2007

Apolipoprotein A5 in health and disease

Czech Academy of Sciences Publication Activity Database

Hubáček, J. A.; Adámková, V.; Vrablík, M.; Kadlecová, Michaela; Zicha, Josef; Kuneš, Jaroslav; Piťha, J.; Suchánek, P.; Poledne, R.

2009-01-01

Roč. 58, Suppl.2 (2009), S101-S109 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) 1M0510 Grant - others:IKEM(CZ) 00023001; GA MŠk(CZ) MEB060808; GA MZd(CZ) NR8895; GAMZd(CZ) NR9393 Institutional research plan: CEZ:AV0Z50110509 Keywords : apolipoprotein A5 * plasma triglycerides * myocardial infarction Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 1.430, year: 2009

Molecular profile of 5-fluorouracil pathway genes in colorectal carcinoma

Czech Academy of Sciences Publication Activity Database

Kunická, T.; Procházka, Pavel; Krus, I.; Bendová, Petra; Protivová, M.; Susová, S.; Hlaváč, V.; Liška, V.; Novák, P.; Schneiderová, M.; Pitule, P.; Bruha, J.; Vyčítal, O.; Vodička, Pavel; Souček, P.

2017-01-01

Roč. 16, oct (2017), s. 795 ISSN 1471-2407 R&D Projects: GA MZd(CZ) NT14329; GA ČR(CZ) GAP304/12/1585 Institutional support: RVO:68378041 Keywords : colorectal carcinoma * 5-fluorouracil * methylation Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 3.288, year: 2016

ISSN 2073-9990 East Cent. Afr. J. surg

African Journals Online (AJOL)

Hp 630 Dual Core

epileptic functionally which persisted till the time of writing this manuscript. ... 21mg/kg in children as loading doses, and 300mg/day for adult and 5m/kg/day for ... three parameters: best motor response (1-6), best verbal response (1-5), and best eye ..... protein and fat, improved immune competence, promoted neurological ...

Origin of slow low-temperature luminescence in undoped and Ce-doped Y.sub.2./sub.SiO.sub.5./sub. and Lu.sub.2./sub.SiO.sub.5./sub. single crystals

Czech Academy of Sciences Publication Activity Database

Jarý, Vítězslav; Krasnikov, A.; Nikl, Martin; Zazubovich, S.

2015-01-01

Roč. 252, č. 2 (2015), s. 274-281 ISSN 0370-1972 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : decay kinetics * luminescence * Lu 2 SiO 5 * time-resolved spectra * Y 2 SiO 5 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.522, year: 2015

ISSN 2073-9990 East Cent. Afr. J. surg

African Journals Online (AJOL)

Valued eMachines Customer

especially between 5 and 7years because fusion of the distal humeral physis peaks at age six.3 There are two major types of supracondylar humerus fractures extension (95% of cases) and flexion (5% of cases)1,2. While different ..... P.J. Walmsley, H.B. Kelly, J.E. Robb, I.H. Annan, D.E. Porter. Delay increases the need for.

Research Paper ISSN: 2006-0165©2008

African Journals Online (AJOL)

AJTCAM

School of Pharmacy, Masterskill University, College of Health Sciences, Batu 9, 43200 Cheras, ... treatment at the Master skill Clinic, Malaysia. ... attached to the skin on the opposite sides of the wound at a distance of 0.5 cm away from the ...

October, 2009 ISSN 1994-9057 (Print) ISSN 2070-0083

African Journals Online (AJOL)

Nekky Umera

Biology, Chemistry and Economics in 2004, 2005, 2006 and 2007 were obtained. ... questions across the levels of the cognitive domain is concerned, WAEC and. NECO are ... in the process of collecting and packaging of the answer scripts. Following ... in this study, Olatunji used her own model of the levels of the cognitive.

January, 2010 ISSN 1994-9057 (Print) ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

and Occupation. The issues raised, amongst others were promotion of non- ..... refer to social pressures that steer girls and young women towards career in traditionally ... productive resources and inadequate sharing of family responsibilities,.

January, 2010 ISSN 1994-9057 (Print) ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

Technical and Vocational Education for a Future World of. Work (Pp ... The Nigeria's educational system during the colonial era was literal in nature and ..... Teachers at the primary school level should use the activity approach to provide for the ...

Over-expression of SOB5 suggests the involvement of a novel plant protein in cytokinin-mediated development

Czech Academy of Sciences Publication Activity Database

Zhang, J.; Wrage, E.L.; Vaňková, Radomíra; Malbeck, Jiří; Neff, M. M.

2006-01-01

Roč. 46, č. 5 (2006), s. 834-848 ISSN 0960-7412 R&D Projects: GA ČR GA522/04/0549 Institutional research plan: CEZ:AV0Z50380511 Keywords : SOB5 * SOFL * cytokinin Subject RIV: ED - Physiology Impact factor: 6.565, year: 2006

Age-dependent suppression of hippocampal epileptic afterdischarges by metabotropic glutamate receptor 5 antagonist MTEP

Czech Academy of Sciences Publication Activity Database

Zavala-Tecuapetla, Cecília; Kubová, Hana; Otáhal, Jakub; Tsenov, Grygoriy; Mareš, Pavel

2014-01-01

Roč. 66, č. 5 (2014), s. 927-930 ISSN 1734-1140 R&D Projects: GA ČR(CZ) GA305/09/0846; GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : epileptic afterdischarge * hippocampus * rat * ontogeny * metabotropic glutamate receptor 5 Subject RIV: FH - Neurology Impact factor: 1.928, year: 2014

Theoretical investigation of electronic structure, electric field gradients, and photoemission of PuCoGa.sub.5./sub. and PuRhGa.sub.5./sub. superconductors

Czech Academy of Sciences Publication Activity Database

Shick, Alexander; Rusz, Ján; Kolorenč, Jindřich; Oppeneer, P.M.; Havela, L.

2011-01-01

Roč. 83, č. 15 (2011), "155105-1"-"155105-7" ISSN 1098-0121 R&D Projects: GA ČR(CZ) GAP204/10/0330; GA AV ČR IAA100100912 Institutional research plan: CEZ:AV0Z10100520 Keywords : magnetism * superconductivity * PuCoGa 5 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.691, year: 2011

Dynamic alterations of bone marrow cytokine landscape of myelodysplastic syndromes patients treated with 5-azacytidine

Czech Academy of Sciences Publication Activity Database

Moudrá, Alena; Hubáčková, Soňa; Machalová, Veronika; Vančurová, Markéta; Bartek, Jiří; Reiniš, Milan; Hodný, Zdeněk; Jonasova, A.

2016-01-01

Roč. 5, č. 10 (2016), č. článku e1183860. ISSN 2162-402X R&D Projects: GA MZd NT14174 Institutional support: RVO:68378050 Keywords : 5-azacyatidine * bone marrow plasma * cytokines * DNA damage * inflammation * myelodysplastic syndromes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.719, year: 2016

Effects of 5-azacytidine and trichostatin a on dendritic cell maturation

Czech Academy of Sciences Publication Activity Database

Štěpánek, Ivan; Indrová, Marie; Bieblová, Jana; Fučíková, J.; Spíšek, R.; Bubeník, Jan; Reiniš, Milan

2011-01-01

Roč. 25, č. 30 (2011), s. 519-531 ISSN 0393-974X R&D Projects: GA ČR GAP301/10/2174; GA ČR GA301/09/1024; GA AV ČR IAA500520605 Grant - others:EU-FP6(XE) LSHB-CT-2006-018933 Institutional research plan: CEZ:AV0Z50520514 Keywords : 5-azacytidine * MHC class I downregulation * tumour chemoimmunotherapy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.183, year: 2011

Macropolyhedral boron-containing cluster chemistry. The unique nido-five-vertex-< B-2 >-nido-ten-vertex conjuncto structure of [(eta(5)-C5Me5)(2)Rh2B11H15] via an unexpected cluster-dismantling

Czech Academy of Sciences Publication Activity Database

Carr, MJ.; Perera, SD.; Jelínek, Tomáš; Štíbr, Bohumil; Clegg, W.; Kilner, C. A.; Kennedy, D. J.

2007-01-01

Roč. 34, - (2007), s. 3559-3561 ISSN 1359-7345 R&D Projects: GA ČR GA203/05/2646; GA AV ČR(CZ) IAA400320601 Grant - others:EPSRC(GB) J/56929; EPSRC(GB) GR/L/49505; EPSRC(GB) R/61949 Institutional research plan: CEZ:AV0Z40320502 Keywords : nuclear magnetic resonance Subject RIV: CA - Inorganic Chemistry Impact factor: 5.141, year: 2007

Relationship between running kinematic changes and time limit at vVO2max. DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n4p428

Directory of Open Access Journals (Sweden)

Sebastião Iberes Lopes Melo

2012-07-01

Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n4p428Exhaustive running at maximal oxygen uptake velocity (vVO2max can alter running kinematic parameters and increase energy cost along the time. The aims of the present study were to compare characteristics of ankle and knee kinematics during running at vVO2max and to verify the relationship between changes in kinematic variables and time limit (Tlim. Eleven male volunteers, recreational players of team sports, performed an incremental running test until volitional exhaustion to determine vVO2max and a constant velocity test at vVO2max. Subjects were filmed continuously from the left sagittal plane at 210 Hz for further kinematic analysis. The maximal plantar flexion during swing (p<0.01 was the only variable that increased significantly from beginning to end of the run. Increase in ankle angle at contact was the only variable related to Tlim (r=0.64; p=0.035 and explained 34% of the performance in the test. These findings suggest that the individuals under study maintained a stable running style at vVO2max and that increase in plantar flexion explained the performance in this test when it was applied in non-runners.

Synthesis and catalytic properties of titanium containing extra-large pore zeolite CIT-5

Czech Academy of Sciences Publication Activity Database

Přech, Jan; Kubů, Martin; Čejka, Jiří

2014-01-01

Roč. 227, MAY 2014 (2014), s. 80-86 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : zeolite CIT-5 * titanosilicate * epoxidation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

Research Paper ISSN 0189-6016©2009

African Journals Online (AJOL)

Rats were housed in individual cages at a 12 hr light/dark cycle and received food ... MgSO4 1.3, KH2PO4 1.2, NaH2CO3 25, CaCl2 2.5, glucose 7). .... peripheral neurons similar to amphetamine (Kalix, 1992) increases in blood pressure and ...

Molecular organization and comparative analysis of chromosome 5B of the wild wheat ancestor Triticum dicoccoides

Czech Academy of Sciences Publication Activity Database

Akpinar, B.A.; Yuce, M.; Lucas, S.; Vrána, Jan; Burešová, Veronika; Doležel, Jaroslav; Budak, H.

2015-01-01

Roč. 5, JUN 18 (2015) ISSN 2045-2322 R&D Projects: GA ČR GBP501/12/G090; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : TURGIDUM VAR. DICOCCOIDES * MARKER DEVELOPMENT * GENOME SEQUENCE Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.228, year: 2015

Research Paper ISSN 0189-6016©2009

African Journals Online (AJOL)

AJTCAM

They were randomized into six groups of six rats each. Food was withdrawn 24 hrs and water 2hr before the commencement of experiment (Alphin and Ward, 1967). Group 1 (control) received only indomethacin (Sigma, 60mg/kg p.o. dissolved in 5% Na2Co3); Groups 2- 4 were pretreated with Lasianthera africana extract ...

Point-contact properties of cubic YbCu .sub.5./sub. prepared by melt spinning technique

Czech Academy of Sciences Publication Activity Database

Reiffers, M.; Idzikowski, B.; Ilkovič, S.; Zorkovská, A.; Šebek, Josef; Müller, K. H.

272-276, - (2004), s. 209-210 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z1010914 Keywords : heavy-fermion * pont-contact * YbCu 5 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.031, year: 2004

Evolution of cyclizing 5-aminolevulinate synthases in the biosynthesis of actinomycete secondary metabolites: outcomes for genetic screening techniques

Czech Academy of Sciences Publication Activity Database

Petříčková, Kateřina; Chroňáková, Alica; Zelenka, Tomáš; Chrudimský, Tomáš; Pospíšil, Stanislav; Petříček, Miroslav; Krištůfek, Václav

2015-01-01

Roč. 6, AUG 2015 (2015) ISSN 1664-302X R&D Projects: GA MŠk LH12191 Institutional support: RVO:61388971 ; RVO:60077344 Keywords : 5-aminolevulinate synthase * C5N unit * Streptomyces Subject RIV: EE - Microbiology, Virology Impact factor: 4.165, year: 2015

Fundamental Roles of the Golgi-Associated Toxoplasma Aspartyl Protease, ASP5, at the Host-Parasite Interface

Czech Academy of Sciences Publication Activity Database

Hammoudi, P.-M.; Jacot, D.; Mueller, C.; Di Cristina, M.; Dogga, S.K.; Marq, J.-B.; Romano, J.; Tosetti, N.; Dubrot, J.; Emre, Y.; Lunghi, M.; Coppens, I.; Yamamoto, M.; Sojka, Daniel; Pino, P.; Soldati-Favre, D.

2015-01-01

Roč. 11, č. 10 (2015), e1005211 E-ISSN 1553-7374 Institutional support: RVO:60077344 Keywords : Toxoplasma gondii * Plasmodium proteins * ASP5 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.003, year: 2015

CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells

Czech Academy of Sciences Publication Activity Database

Andersson, T.; Södersten, E.; Duckworth, J.K.; Cascante, A.; Fritz, N.; Sacchetti, P.; Červenka, I.; Bryja, Vítězslav; Hermanson, O.

2008-01-01

Roč. 284, č. 6 (2008), s. 3672-3681 ISSN 0021-9258 Grant - others:GA AV ČR(CZ) KJB501630801 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Wnt signaling * CXXC5 * neural stem cells Subject RIV: BO - Biophysics Impact factor: 5.520, year: 2008

4,5-Disubstituted N,N’-Di-tert-alkyl Imidazolium Salts: New Synthesis and Structural Features

Czech Academy of Sciences Publication Activity Database

Grishina, Anastasia; Polyakova, Svetlana; Kunetskiy, Roman Alexejevič; Císařová, I.; Lyapkalo, Ilya

2011-01-01

Roč. 17, č. 1 (2011), s. 96-100 ISSN 0947-6539 Institutional research plan: CEZ:AV0Z40550506 Keywords : basicity * carbenes * imidazolium cations * steric hindrance * synthetic methods Subject RIV: CC - Organic Chemistry Impact factor: 5.925, year: 2011

MRE11 complex links RECQ5 helicase to sites of DNA damage

Czech Academy of Sciences Publication Activity Database

Zheng, L.; Kanagaraj, R.; Mihaljevic, B.; Schwendener, S.; Sartori, A.A.; Gerrits, B.; Shevelev, Igor; Janščák, Pavel

2009-01-01

Roč. 37, č. 8 (2009), s. 2645-2657 ISSN 0305-1048 R&D Projects: GA ČR GA204/09/0565 Institutional research plan: CEZ:AV0Z50520514 Keywords : homologous recombination, * RECQ5 helicase * MRE11 * DNA repair Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.479, year: 2009

First evidence of independent pseudogenization of Toll-like receptor 5 in passerine birds

Czech Academy of Sciences Publication Activity Database

Bainová, H.; Králová, Tereza; Bryjová, Anna; Albrecht, Tomáš; Bryja, Josef; Vinkler, M.

2014-01-01

Roč. 45, č. 1 (2014), s. 151-155 ISSN 0145-305X R&D Projects: GA ČR GAP505/10/1871 Institutional support: RVO:68081766 Keywords : Birds * Expression * Innate immunity * Toll-like receptor 5 * Pseudogene * Flagellin Subject RIV: EG - Zoology Impact factor: 2.815, year: 2014

Location of Framework Al Atoms in the Channels of ZSM-5: Effect of the (Hydrothermal) Synthesis

Czech Academy of Sciences Publication Activity Database

Pashková, Veronika; Sklenák, Štěpán; Klein, Petr; Urbanová, Martina; Dědeček, Jiří

2016-01-01

Roč. 22, č. 12 (2016), s. 3937-3941 ISSN 1521-3765 R&D Projects: GA ČR GA15-13876S Institutional support: RVO:61388955 Keywords : ZSM-5 * synthesis * zeolites Subject RIV: CF - Physical ; Theoretical Chemistry

Cytotoxicity, Total Phenolic Contents and Antioxidant Activity of the ...

African Journals Online (AJOL)

The leaves of Annona muricata were extracted using ethanol and the extracts were evaluated for cytotoxicity using Brine Shrimp Lethality Assay, total phenolic content (TPC) and antioxidant activity using DPPH radical scavenging assay. The crude extract showed 73.33 % mortality at 1000 μg/mL concentration and its ...

Structure-based design of a bisphosphonate 5 '(3 ')-deoxyribonucleotidase inhibitor

Czech Academy of Sciences Publication Activity Database

Pachl, Petr; Šimák, Ondřej; Řezáčová, Pavlína; Fábry, Milan; Buděšínský, Miloš; Rosenberg, Ivan; Brynda, Jiří

2015-01-01

Roč. 6, č. 9 (2015), s. 1635-1638 ISSN 2040-2503 R&D Projects: GA ČR GA203/09/0820; GA ČR GA13-26526S; GA ČR GA13-24880S Institutional support: RVO:61388963 ; RVO:68378050 Keywords : mitochondrial deoxyribonucleotidase * crystal structures * 5'-nucleotidases Subject RIV: CE - Biochemistry; EB - Genetics ; Molecular Biology (UMG-J) Impact factor: 2.319, year: 2015

Phase-pure Nanocrystalline Li4Ti5O12 for Lithium ion Battery

Czech Academy of Sciences Publication Activity Database

Kalbáč, Martin; Zukalová, Markéta; Kavan, Ladislav

2003-01-01

Roč. 8, č. 1 (2003), s. 2-6 ISSN 1432-8488 R&D Projects: GA MŠk OC D14.10 Institutional research plan: CEZ:AV0Z4040901 Keywords : phase purity * Li4Ti5O12 * nanocrystalline materials Subject RIV: CG - Electrochemistry Impact factor: 1.195, year: 2003

On the use of dynamical diffraction theory to refine crystal structure from electron diffraction data: application to KLa.sub.5./sub.O.sub.5./sub.(VO.sub.4./sub.).sub.2./sub., a material with promising luminescent properties

Czech Academy of Sciences Publication Activity Database

Colmont, M.; Palatinus, Lukáš; Huvé, M.; Kabbour, H.; Saitzek, S.; Dielal, N.; Roussel, P.

2016-01-01

Roč. 55, č. 5 (2016), s. 2252-2260 ISSN 0020-1669 Institutional support: RVO:68378271 Keywords : electron difraction tomography * oxychloride * luminiscence * dynamical diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.857, year: 2016

Solid-phase extraction of 4(5)-methylimidazole (4Mel) and 2-acetyl-4(5)-(1,2,3,4-tetrahydroxybutyl)-imidazole (THI) from foods and beverages with subsequent liquid chromatographic-electrospray mass spectrometric quantification

Czech Academy of Sciences Publication Activity Database

Klejdus, B.; Moravcová, J.; Lojková, L.; Vacek, Jan; Kubáň, V.

2006-01-01

Roč. 29, č. 3 (2006), s. 378-384 ISSN 1615-9306 Grant - others:GA ČR(CZ) GA521/02/1367 Institutional research plan: CEZ:AV0Z50040507 Keywords : 4(5)-Methylimidazole * beer * beverages Subject RIV: BO - Biophysics Impact factor: 2.535, year: 2006

The novel mouse Polo-like kinase 5 responds to DNA damage and localizes in the nucleolus

Czech Academy of Sciences Publication Activity Database

Andrysík, Zdeněk; Bernstein, W.Z.; Deng, L.; Myer, D.L.; Li, Y.-Q.; Tischfield, J.A.; Stambrook, P.J.; Bahassi, E.M.

2010-01-01

Roč. 38, č. 9 (2010), s. 2931-2943 ISSN 0305-1048 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Polo * DNA damage * Plk5 Subject RIV: BO - Biophysics Impact factor: 7.836, year: 2010

Rwanda Journal ISSN 2305-2678 (Print); ISSN 2305- 5944 (Online ...

African Journals Online (AJOL)

Education

Rwanda Journal, Series B: Social Sciences, Volume 4 No 1, 2017 33. Rwanda Journal .... The print media, the political parties manifestos, the official reports ..... and of psychological alienation from taboos by which it was surrounded by the ...

Rwanda Journal ISSN 2305-2678 (Print); ISSN 2305- 5944 (Online ...

African Journals Online (AJOL)

Education

emotional organizational commitment and the job satisfaction and that association is stronger with ..... refers to the motivational aspect of the human resource management, i.e. with the release of a latent energy or the activation of a potential.

Rwanda Journal ISSN 2305-2678 (Print); ISSN 2305- 5944 (Online ...

African Journals Online (AJOL)

Education

Rwanda Journal, Series B: Social Sciences, Volume 4 No 1, 2017 62. Rwanda Journal ... constitution of men is different from that of women and that men are unable to ... share the same biological disposition driving sexual behaviors, then all could be ... gender roles (Brannon 1985; Brannon & Juni 1984), negative attitudes ...

The physical map of wheat chromosome 5DS revealed gene duplications and small rearrangements

Czech Academy of Sciences Publication Activity Database

Akpinar, B.A.; Magni, F.; Yuce, M.; Lucas, S. J.; Šimková, Hana; Šafář, Jan; Vautrin, S.; Berges, H.; Cattonaro, F.; Doležel, Jaroslav; Budak, H.

2015-01-01

Roč. 16, JUN 13 (2015) ISSN 1471-2164 R&D Projects: GA ČR GBP501/12/G090; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Triticum aestivum * 5DS * Hexaploid wheat Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.867, year: 2015

Thermochromic Fluorescence from B18H20(NC5H5)(2): An Inorganic-Organic Composite Luminescent Compound with an Unusual Molecular Geometry

Czech Academy of Sciences Publication Activity Database

Londesborough, Michael Geoffrey Stephen; Dolanský, Jiří; Cerdán, L.; Lang, Kamil; Jelínek, Tomáš; Oliva, J. M.; Hnyk, Drahomír; Roca-Sanjuan, D.; Frances-Monerris, A.; Martinčík, Jiří; Nikl, Martin; Kennedy, John David

2017-01-01

Roč. 5, č. 6 (2017), č. článku UNSP 1600694. ISSN 2195-1071 R&D Projects: GA ČR(CZ) GA13-09876S Institutional support: RVO:61388980 ; RVO:68378271 Keywords : boranes * energy transfer * fluorescence * solar concentrators * thermochromicity Subject RIV: CA - Inorganic Chemistry ; BH - Optics, Masers, Lasers (FZU-D) OBOR OECD: Inorganic and nuclear chemistry ; Optics (including laser optics and quantum optics) (FZU-D) Impact factor: 6.875, year: 2016

ISSN 2073-9990 East Cent. Afr. J. surg

African Journals Online (AJOL)

Hp 630 Dual Core

5Islamic University in Uganda, Habib Medical School, Anatomy Department, ... 9University of Duzce, School of Medicine, Physiology Department, Turkey ... 3 Anesthesiologists, (two from DWW-Turkey and one from Uganda), 2 nurses and.

Charge conjugation symmetry in proton--antiproton interactions at 5.4 GeV energy

International Nuclear Information System (INIS)

Whittaker, J.D.

1977-10-01

The charge conjugation symmetry of the reaction anti pp- → π/sup +-/ + X was checked at radical s = 5.4 GeV. The measurement was made with a double arm spectrometer, with each arm triggered independently. Each spectrometer arm had an acceptance of 15 millisteradians and subtended an angular range of 16 to 20 0 in the lab, 77 to 91 0 in the pion center of mass system (CMS). The asymmetry (N + - N - )/(N + + N - ) was determined at 90 0 CMS over a P/sub t/ range of .5 to 2.7 GeV/c. Corrections were made for target empty, for pions in the incident beam, and for particle misidentification in the spectrometer. The resulting symmetry was .0084 +- .0090; consistent with zero. The asymmetry introduced by differential pion absorption in the spectrometer was estimated to be .0021. In the P/sub t/ regions of .48 to .67 to 1.00 and 1.00 to 2.7 GeV/c, the asymmetries were .0037 +- .0115, .0178 +- .0145, and -.0025 +- .0311, respectively. The corresponding limits on the amplitude ratio V = Re (C-nonconserving amplitude)/(C-conserving amplitude) are one half of the asymmetry limits

ISSN 2073-9990 East Cent. Afr. J. surg

African Journals Online (AJOL)

Hp 630 Dual Core

Africa1. In the developed world, sigmoid volvulus is uncommon accounting for about 5% of all cases of ..... retrospective nature of this study pose limitations in determining the proportion of bowel obstructions .... to pursue my surgical career.

Effect of aluminium distribution in the framework of ZSM-5 on hydrocarbon transformation. Cracking of 1-butene

Czech Academy of Sciences Publication Activity Database

Sazama, Petr; Dědeček, Jiří; Gábová, Vendula; Wichterlová, Blanka; Spoto, G.; Bordiga, S.

2008-01-01

Roč. 254, č. 2 (2008), s. 180-189 ISSN 0021-9517 R&D Projects: GA AV ČR IAA4040308; GA AV ČR KAN100400702 Institutional research plan: CEZ:AV0Z40400503 Keywords : H-ZSM-5 * Al destribution * catalytic cracking * zeolite acidity Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.167, year: 2008

ISSN 2073-9990 East Cent Afr J Surg

African Journals Online (AJOL)

were conducted with the children's caretakers by 2 paediatric surgery ... paediatrician at the Eduardo Mondlane Medical School in Maputo, with the aid of nursing ..... Epilepsy. 1/9. 11%. Other. 5/9. 56%. Discussion. Our findings are consistent ...

Limited Energy Study, EEAP - DACA01-94-D-0037, for Fort Monmouth. Book 1.

Science.gov (United States)

1997-03-01

0200 21002 2 5 2 01. 200 30,3 -63 30 ¶12 73 3 07Io, Io.? 0 140 1221 25 7 5 3 73 7 4 225 l8e 20 0.7i 6,252 625 5 10 00 2O ISO 15 20’ 30 10877 0 2 10 1...70 t27 1723 0i 7-re3 r 7r~3 EdpaocUntn4tl tnrarr f ISO 134. 173 Dyolr 20- 2 3 1-merltrlona ~rro~rr. 2 .. 2 3 155 17 1 5 -rOolotdo 5 1____ 1 5 U0 5...1993 RECURRING mOP.OAD EXIHUST 1111TILATORS IMY CENTER, ELDG 27001 UNIT SWITCH LOCATION FAN LOCATION MOTOR HP EV t1 FNS LATRINE (47H FLOOR) STRAGLER 2

Novel mechanism for Fc epsilon RI-mediated signal transducer and activator of transcription 5 (STAT5) tyrosine phosphorylation and the selective influence of STAT5B over mast cell cytokine production

Czech Academy of Sciences Publication Activity Database

Pullen, N.A.; Barnstein, B.O.; Falanga, Y.T.; Wang, Z.Q.; Suzuki, R.; Tamang, T.D.L.; Khurana, M.C.; Harry, E.A.; Dráber, Petr; Bunting, K.D.; Mizuno, K.; Wilson, B.S.; Ryan, J.J.

2012-01-01

Roč. 287, č. 3 (2012), s. 2045-2054 ISSN 0021-9258 R&D Projects: GA MŠk 1M0506; GA ČR GAP302/10/1759; GA ČR GA301/09/1826 Grant - others:NIH(US) 1R01AI59638; NIH(US) R01DK059380; NIH(US) AI051575; NIH(US) GM065794; VCU(US) U19A1077435 Institutional support: RVO:68378050 Keywords : cytokine induction * STAT transcription factor * mast cell * Fyn kinase * STAT5 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.651, year: 2012

Lambda hyperon production and polarization in collisions of p(3.5 GeV)+Nb

Czech Academy of Sciences Publication Activity Database

Agakishiev, G.; Arnold, O.; Balanda, A.; Belver, D.; Belyaev, A. V.; Berger-Chen, J. C.; Blanco, A.; Böhmer, M.; Boyard, J. L.; Cabanelas, P.; Chernenko, S.; Dybczak, A.; Epple, E.; Fabbietti, L.; Krása, Antonín; Křížek, Filip; Kugler, Andrej; Sobolev, Yuri, G.; Tlustý, Pavel; Wagner, Vladimír

2014-01-01

Roč. 50, č. 5 (2014), s. 81 ISSN 1434-6001 R&D Projects: GA ČR GA13-06759S; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : heavy ion collisions * HADES * spectrometer Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.736, year: 2014

ISSN 2073-9990 East Cent. Afr. J. surg

African Journals Online (AJOL)

Valued eMachines Customer

3Department of Pathology, University of Ibadan and the University College ... osteomyelitis2 skin graft donor site3 injection sites 4,5 venous ulcers 6 scar tissue ... Lichen planus is a chronic mucocutaneous disease which presents as an itchy ...

ISSN 2073-9990 East Cent. Afr. J. surg

African Journals Online (AJOL)

Hp 630 Dual Core

2015-11-30

Nov 30, 2015 ... haematomas are associated with a skull fracture in adults but the figure is notably .... with severe disability (GOS 2) and one had a good recovery (GOS 5). .... skull fracture which is significantly lower compared to studies which.

Thermochemical properties of copper forms of zeolite ZSM5 containing dimethylethylenediamine

Czech Academy of Sciences Publication Activity Database

Čuvanová, S.; Reháková, M.; Finocchiaro, P.; Pollicino, A.; Bastl, Zdeněk; Nagyová, S.; Fajnor, V. Š.

2007-01-01

Roč. 452, č. 1 (2007), s. 13-19 ISSN 0040-6031 R&D Projects: GA AV ČR 1ET400400413 Grant - others:GA SR(SK) 1/1385/04; GA SR(SK) 1/1373/04 Institutional research plan: CEZ:AV0Z40400503 Keywords : ZSM-5 * dimethylethylenediamine * copper * thermal analysis * XPS Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.562, year: 2007

UJI ORGANOLEPTIK FORMULASI BISKUIT FUNGSIONAL BERBASIS TEPUNG IKAN GABUS (Ophiocephalus striatus (The Organoleptic Functional Biscuit Formulation Based on Snakehead Fish (Ophiocephalus striata Flour

Directory of Open Access Journals (Sweden)

Dewi Kartika Sari

2014-07-01

15% TI sebesar 73,33% dan rasa tertinggi pada 10% TI sebesar 58,33%. Penerimaan panelis menunjukkan bahwa perlakuan tepung ikan gabus berpengaruh nyata (p0,05 terhadap aroma, rasa, warna dan keseluruhan biskuit. Berdasarkan pertimbangan penerimaan panelis maka terpilih formula biskuit dengan substitusi 15% tepung ikan gabus. Kata kunci: Biskuit fungsional, subtitusi, fortifikasi

Aberrant DR5 transport through disruption of lysosomal function suggests a novel mechanism for receptor activation

Czech Academy of Sciences Publication Activity Database

Akpinar, B.; Šafaříková, Barbora; Lauková, Jarmila; Debnath, S.; Vaculová, Alena; Zhivotovsky, B.; Olsson, M.

2016-01-01

Roč. 7, č. 36 (2016), s. 58286-58301 ISSN 1949-2553 R&D Projects: GA ČR GA15-06650S Institutional support: RVO:68081707 Keywords : death ligand trail * dependent apoptosis * cancer-cells * autophagy Subject RIV: BO - Biophysics Impact factor: 5.168, year: 2016

5-Fluorouracil-induced RNA stress engages a TRAIL-DISC-dependent apoptosis axis facilitated by p53

Czech Academy of Sciences Publication Activity Database

Akpinar, B.; Bracht, E.V.; Reijnders, D.; Šafaříková, Barbora; Jelínková, Iva; Grandien, A.; Vaculová, Alena; Zhivotovsky, B.; Olsson, M.

2015-01-01

Roč. 6, č. 41 (2015), s. 43679-43697 ISSN 1949-2553 R&D Projects: GA ČR GA15-06650S Institutional support: RVO:68081707 Keywords : colon-cancer cells * carcinoma-cells * dna-damage Subject RIV: BO - Biophysics Impact factor: 5.008, year: 2015

Production of the Hf-178m2 isomer using a 4.5-GeV electron accelerator

Czech Academy of Sciences Publication Activity Database

Karamian, S. A.; Carroll, J. J.; Adam, Jindřich; Demekhina, NA.

2004-01-01

Roč. 530, č. 3 (2004), s. 463-472 ISSN 0168-9002 R&D Projects: GA AV ČR KSK1048102 Keywords : electron beam * bremsstrahlung * 4,5 GeV Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.349, year: 2004

Activation of p53 pathway by Nutlin-3a inhibits the expression of the therapeutic target alpha 5 integrin in colon cancer cells

Czech Academy of Sciences Publication Activity Database

Janoušková, Hana; Ray, A.M.; Noulet, F.; Lelong-Rebel, I.; Choulier, L.; Schaffner, F.; Lehmann, M.; Martin, S.; Teisinger, Jan; Dontenwill, M.

2013-01-01

Roč. 336, č. 2 (2013), s. 307-318 ISSN 0304-3835 Institutional support: RVO:67985823 Keywords : colon cancer * integrin alpha 5 beta 1 * p53 * Nutlin-3a Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.016, year: 2013

Neuromuscular adaptations to strength and concurrent training in elderly men. DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n4p483

Directory of Open Access Journals (Sweden)

Luiz Fernando Martins Kruel

2012-07-01

Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n4p483This paper aimed to review the results of studies on neuromuscular adaptations to strength training (ST and concurrent training (CT in elderly men. A literature search was conducted using PubMed, Scopus, and SciELO. The search was limited to studies published from 1980 to 2012. A total of 3,390 articles were retrieved. After reading their titles, 127 studies were further evaluated by reading their abstracts. This resulted in 92 papers that were read in full; 25 of these were selected and their results were described in the present review. Several studies showed that, in elderly subjects, ST can produce increases in muscle strength, power, activation and mass. ST-induced strength gain may be explained by neural and morphological adaptations. The main neural adaptations to ST included increased recruitment of motor units and increased motor unit firing rate. Morphological adaptations included increases in the physiological cross-sectional area (CSA of the muscle, in muscle thickness, in muscle fiber pennation angle, and changes in muscle myosin heavy-chain isoforms, resulting in the conversion of muscle fiber from subtype IIx to IIa. The inclusion of moderate-to-high inten- sity (60-85% of maximum strength ST in the routine of this population is recommended to improve neuromuscular function. CT can promote significant neuromuscular adaptations, but these gains may be of a lower magnitude than those obtained with ST. Although CT has an interference effect on neuromuscular adaptations, it also promotes improvement in cardiovascular function and is therefore the most frequently recommended intervention for health promotion in the elderly.

Adsorption and two-dimensional condensation of 5-methylcytosine

Czech Academy of Sciences Publication Activity Database

Fojt, Lukáš; Vetterl, Vladimír; Doneux, T.

2009-01-01

Roč. 75, č. 2 (2009), s. 89-94 ISSN 1567-5394 R&D Projects: GA AV ČR(CZ) KAN200040651; GA MŠk(CZ) LC06035; GA ČR(CZ) GA202/08/1688 Grant - others:GA MŠk(CZ) 1M0528; GA ČR(CZ) GP310/07/P480 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : hanging mercury drop electrode * 5-methylcytosine * 2D condensation Subject RIV: BO - Biophysics Impact factor: 2.652, year: 2009

Plantago lagopus B Chromosome Is Enriched in 5S rDNA-Derived Satellite DNA

Czech Academy of Sciences Publication Activity Database

Kumke, K.; Macas, Jiří; Fuchs, J.; Altschmied, L.; Kour, J.; Dhar, M.K.; Houben, A.

2016-01-01

Roč. 148, č. 1 (2016), s. 68-73 ISSN 1424-8581 R&D Projects: GA ČR GBP501/12/G090 Institutional support: RVO:60077344 Keywords : Polymorhpic A chromosome segment * Satellite repeat * Supernumerary chromosome * 5S rDNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.354, year: 2016

Centrality dependence of charged jet production in p–Pb collisions at root s(NN)=5.02 TeV

Czech Academy of Sciences Publication Activity Database

Adam, J.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Čepila, J.; Contreras, J. G.; Eyyubova, G.; Ferencei, Jozef; Horák, D.; Křížek, Filip; Kučera, Vít; Mareš, Jiří A.; Petráček, V.; Pospíšil, Jan; Schulc, M.; Špaček, M.; Šumbera, Michal; Vaňát, Tomáš; Závada, Petr

2016-01-01

Roč. 76, č. 5 (2016), s. 271 ISSN 1434-6044 R&D Projects: GA MŠk(CZ) LG15052 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : ALICE collaboration * heavy ion collisions * production Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) Impact factor: 5.331, year: 2016

A new adsorption isotherm for C5 hydrocarbons on metal–organic framework Cu3(BTC)2

Czech Academy of Sciences Publication Activity Database

Zukal, Arnošt; Kubů, Martin

2015-01-01

Roč. 21, 1-2 (2015), s. 99-105 ISSN 0929-5607 R&D Projects: GA ČR GA14-07101S Institutional support: RVO:61388955 Keywords : Cu3(BTC)2 * adsorption * C5 hydrocarbons Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.870, year: 2015

Single crystal X-ray structural features of aromatic compounds having a pentafluorosulfuranyl (SF5) functional group

Czech Academy of Sciences Publication Activity Database

Du, J.; Hua, G.; Beier, Petr; Slawin, A. M. Z.; Woollins, J. D.

2017-01-01

Roč. 28, č. 3 (2017), s. 723-733 ISSN 1040-0400 Institutional support: RVO:61388963 Keywords : pentafluorosulfuranyl (SF5) group * aromatic compounds * single crystal X-ray structure * intramolecular interactions * intermolecular interactions Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 1.582, year: 2016

5. Beethoven-Studienkolleg: Beethoven edieren. Einführung in die Editionstechnik, 27.– 29. srpna 2012

Czech Academy of Sciences Publication Activity Database

Kolátorová, Petra

2012-01-01

Roč. 49, č. 4 (2012), s. 432-433 ISSN 0018-7003. [5. Beethoven-Studienkolleg: Beethoven edieren. Einführung in die Editionstechnik,. Bonn, 27.08.2012-29.08.2012] Institutional support: RVO:68378076 Keywords : Beethoven * editorial work * music scores Subject RIV: AL - Art, Architecture, Cultural Heritage

Development of Soft Tissue Sarcomas in Ribosomal Proteins L5 and S24 Heterozygous Mice

Czech Academy of Sciences Publication Activity Database

Kazerounian, S.; Ciarlini, P.D.S.C.; Yuan, D.; Ghazvinian, R.; Alberich-Jorda, Meritxell; Joshi, M.; Zhang, H.; Beggs, A.H.; Gazda, H.T.

2016-01-01

Roč. 7, č. 1 (2016), s. 32-36 ISSN 1837-9664 R&D Projects: GA MŠk LK21307 Institutional support: RVO:68378050 Keywords : Ribosomal proteins RPL5 and RPS24 * Diamond-Blackfan anemia * Soft tissue sarcoma Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.916, year: 2016

Involvement of phosphatidylinositol 4,5-bisphosphate in RNA polymerase I transcription

Czech Academy of Sciences Publication Activity Database

Yildirim, Sukriye; Castano, Enrique; Sobol, Margaryta; Philimonenko, Vlada; Dzijak, Rastislav; Venit, Tomáš; Hozák, Pavel

2013-01-01

Roč. 126, č. 12 (2013), s. 2730-2739 ISSN 0021-9533 R&D Projects: GA ČR GAP305/11/2232; GA ČR(CZ) GD204/09/H084; GA MŠk LC545; GA MŠk(CZ) LC06063 Grant - others:CONACYT(MX) 176598 Institutional support: RVO:68378050 Keywords : nucleolus * transcription * PIP2 * UBF * fibrillarin Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.325, year: 2013

Photoswitchable Intramolecular Hydrogen Bonds in 5-Phenylazopyrimidines Revealed By In Situ Irradiation NMR Spectroscopy

Czech Academy of Sciences Publication Activity Database

Procházková, Eliška; Čechová, Lucie; Kind, J.; Janeba, Zlatko; Thiele, C. M.; Dračínský, Martin

2018-01-01

Roč. 24, č. 2 (2018), s. 492-498 ISSN 0947-6539 R&D Projects: GA ČR GA15-11223S Institutional support: RVO:61388963 Keywords : azopyrimidines * heterocycles * hydrogen bonds * NMR spectroscopy * UV/Vis in situ irradiation Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 5.317, year: 2016

Direct One-Pot Synthesis of Nucleosides from Unprotected or 5-O-Monoprotected D-Ribose

Czech Academy of Sciences Publication Activity Database

Downey, Alan Michael; Richter, C.; Pohl, Radek; Mahrwald, R.; Hocek, Michal

2015-01-01

Roč. 17, č. 18 (2015), s. 4604-4607 ISSN 1523-7060 R&D Projects: GA ČR GAP207/11/0344 Institutional support: RVO:61388963 Keywords : nucleosides * cytostatics * biological activity Subject RIV: CC - Organic Chemistry Impact factor: 6.732, year: 2015 http://pubs.acs.org/doi/pdf/10.1021/acs.orglett.5b02332

Birds and influenza H5N1 virus movement to and within North America

Czech Academy of Sciences Publication Activity Database

Rappole, J. H.; Hubálek, Zdeněk

2006-01-01

Roč. 12, č. 10 (2006), s. 1486-1492 ISSN 1080-6040 Institutional research plan: CEZ:AV0Z60930519 Keywords : West Nile virus * Avian influenza * waterfowl Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 5.094, year: 2006 http://www.cdc.gov/ncidod/EID/vol12no10/05-1577.htm

Selective Monoacylation of Ferrocene with Bulky Acylating Agents over Mesoporous Sieve AlKIT-5

Czech Academy of Sciences Publication Activity Database

Vitvarová, Dana; Voláková, Martina; Vlk, Josef; Vinu, A.; Štěpnička, P.; Čejka, Jiří

2010-01-01

Roč. 16, č. 26 (2010), s. 7773-7780 ISSN 0947-6539 R&D Projects: GA ČR GA104/07/0383; GA ČR GD203/08/H032 Institutional research plan: CEZ:AV0Z40400503 Keywords : acylation * aluminum * ferrocene Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.476, year: 2010

Design and synthesis of brain-targeted prodrugs of the glutamine antagonist 6-Diazo-5-oxo-L-norleucine

Czech Academy of Sciences Publication Activity Database

Tenora, Lukáš; Novotná, Kateřina; Monincová, Lenka; Jančařík, Andrej; Nedelcovych, M.; Alt, J.; Rais, R.; Slusher, B. S.; Majer, Pavel

2017-01-01

Roč. 284, Suppl 1 (2017), s. 344 ISSN 1742-464X. [FEBS Congress /42./ From Molecules to Cells and Back. 10.09.2017-14.09.2017, Jerusalem] Institutional support: RVO:61388963 Keywords : 6-Diazo-5-oxo-L-norleucine * prodrugs Subject RIV: CE - Biochemistry

Design and synthesis of brain-targeted prodrugs of the glutamine antagonist 6-Diazo-5-oxo-L-norleucine

Czech Academy of Sciences Publication Activity Database

Tenora, Lukáš; Novotná, Kateřina; Monincová, Lenka; Jančařík, Andrej; Gadiano, A. J.; Dash, R.; Rais, R.; Alt, J.; Slusher, B. S.; Majer, Pavel

2017-01-01

Roč. 284, Suppl 1 (2017), s. 345 ISSN 1742-464X. [FEBS Congress /42./ From Molecules to Cells and Back. 10.09.2017-14.09.2017, Jerusalem] Institutional support: RVO:61388963 Keywords : 6-Diazo-5-oxo-L-norleucine * prodrugs Subject RIV: CE - Biochemistry

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

Obekpa (2001) view child abuse as any condition injurious to physical or emotional health that has been ... defines it as a non-accidental injury inflicted on a child by a parent or guardian. ... potential for or has actually caused serious emotional cognitive, mental or behavioral .... Child abuse and parenting styles in. Nigerian ...

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

status on voting among Americans by formally modeling the effect of partisan government on ... incentives in deciding who and what party to vote for in any general elections. ... take care of the three lower level needs before making an attempt to meet these needs. .... Priming at the polls: Can polling place location influence ...

ISSN 1727-3781

African Journals Online (AJOL)

Administrator

core business and primary function of universities. Secondly, HEIs make a .... There is a traditional, liberal theory of the state which argues for a clear ..... interest in the matter to cloud his judgment, or if he is the same person who has reported a ...

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

GSM: +2348035629290. Folarin, N. A. – Department of banking & Finance, Olabisi Onabanjo ... (1959), argue that the propagation of inflation is the result of incompatible .... The quantitative impact of monetary expansion and exchange rate.

ISSN 1727-3781

African Journals Online (AJOL)

user

2010-06-10

Jun 10, 2010 ... THE LABOUR APPEAL COURT: COMMENTS ON KYLIE V CCMA 2010 4 SA 383 (LAC). 2011 VOLUME .... In the light of the fact that the employee was a sex worker, the CCMA Commissioner ruled that she did ..... workers are particularly vulnerable and are exposed to exploitation and vicious abuse,. 73.

ISSN 1727-3781

African Journals Online (AJOL)

allyd

This contribution is based on research undertaken by the author in partial fulfilment of the ... Senior Lecturer, Department of Law, Faculty of. Humanities ..... approach in R v Big M Drug Mart Ltd 1985 50 CCC (3d) 1 (SCC) which was followed by.

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

Okereke, Chinwe - Faculty of Education, Imo State University, Owerri. E-mail: ... students towards discovered eating. A sample of 300 ... disordered eating; they know little about the effects of disordered eating. There is a .... not eat when ill. Item 2 had a low ... consuming fast foods and trying unconventional diets. Their friends.

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

Indexed African Journals Online: www.ajol.info. An International ... The roles the classroom teachers would play and the challenges they would have to face in using ... implementation of computer education programme in Nigerian secondary schools. .... Computer has specially designed languages for operations. These are.

ISSN 1727-3781

African Journals Online (AJOL)

HP4510s

4th UN Conference on LDCs Energy Services″ (Background Paper ..... Human Health, Natural Resources and Ecosystems Centre for International Sustainable ..... The adoption of the NFSD was the first step in mapping out the South African.

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

neighbourhood, facilities for the restoration of declining areas as well as the recreation of ... beautification of monuments and structures, and city conservation among others. .... market, convention facility and convention hotels.Zone 2 will ...

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

within and amongst the institutions for productivity and effectiveness. Keywords: ... a project to link all federal tertiary institutions in a countrywide electronic network named ... full-time, part-time, off-campus and distance education students. ... facilities, substantial online learning resources, inadequate funds and facilities ...

ISSN 1727-3781

African Journals Online (AJOL)

commission of gross human rights violations resulted in a gradual ... with the growth in prominence of the Zimbabwe Congress of Trade Unions (ZCTU) ...... electronic broadcasting, radio and television that in a modern society the right to.

ISSN 1727-3781

African Journals Online (AJOL)

UNISA

The Southern African Development Community trade legal instruments compliance .... Cottier and Foltea 'Constitutional Functions of the WTO and Regional Trade ..... a prima facie case that NAFTA met the definition of an FTA under Article ...

ISSN 1727-3781

African Journals Online (AJOL)

allyd

DETERMINING THE EFFECT (THE SOCIAL COSTS) OF EXCLUSION UNDER THE. SOUTH AFRICAN ... THE SOUTH AFRICAN EXCLUSIONARY RULE: SHOULD FACTUAL GUILT TILT ..... However, in the decision of Thint (Pty) Ltd v National Director of .... Even though the concept of "detriment" involves the making.

ISSN 1727-3781

African Journals Online (AJOL)

HP4510s

Fissse en Bucy, sien Du Toit en Pienaar PER 2011 44-57. 9. Artikel 12.1(1) Criminal Code Act 1995. 10. Artikel 12.1(2) Criminal Code Act 1995. 11. Artikel 12.2 Criminal Code Act 1995. 12. Clough en Mulhern Prosecution of Corporations 139; Woolf 1997 Crim LJ 259-261; Wilkinson. 2003 Canterbury Law Review 173.

ISSN 1727-3781

African Journals Online (AJOL)

A J Hamman

Because of the high level of credence it enjoys, an attorney's ... attorney's trust account as a bank account into which to deposit criminal proceeds for .... of encompassing attorneys, who head the list of accountable institutions in Schedule 1. For.

ISSN 1727-3781

African Journals Online (AJOL)

University of the Witwatersrand

will be done by distinguishing the legal position relating to trust law from the law relating to .... imposes upon its bearer a duty to act in the best interest of the person or persons to whom the duty is owed. ..... Register of Internet sources. Cheadle ...

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

The GSM subscribers on their part also face many problems, major of which is ... GSM revolution, mobile operators forced by fierce competition and market forces .... Many managers regard customers who complain in a negative light. In fact,.

ISSN 1727-3781

African Journals Online (AJOL)

ecoetzee

change that was brought about when the sentencing court considered Section ..... the duty of the state towards children, places a powerful obligation on the state to act. .... rights of the parents in order to protect the rights of the children. 3.2 .... time of the hearing, was convicted of fraud committed over a period of two years. 80.

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

fundamental principles of Art and Design, the intellectual content of art is brought to bear on the .... The year 1915 to 1920 was a landmark in the history ..... Omotayo Aiyegbusi (b.1921-) who trained as a graphic artist in the USA and. Britain in ...

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

pipe home water, electricity, medical services, regular transportation systems, among others. ... understand his position in the universe and his environment. For instance ... Control of Disease and Maintenance of Good Health: Science and ... may be prevented through early warning signals of troop or aircraft movement, air ...

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

In this paper, both approaches (the aesthetic and the ethnological) are ... But, African sculptures became known in Europe only from about the end of the .... body', 'arts of the surrounding', and 'autonomous figurative arts'. It is in keeping ... The cultural diversity of the people of Africa inevitably stimulated to a diversity of art ...

ISSN 1727-3781

African Journals Online (AJOL)

Farhana

... SA 721 (CC). 3 See for example Cullinan 2006 www.health-e.org.za. ... staff at the health care facilities, both in terms of their number and the appropriate .... tools required for efficient service delivery (personal protective equipment and ... also revealed that many clinics 'did not even have such basic supplies as soap'. 53.

ISSN 1727-3781

African Journals Online (AJOL)

Administrator

The design of standards and the administration of discipline in general often involve an exercise .... administrative action, in order to qualify as just, must satisfy the requirements of ... with enabling legislation and with the rules of common law.

ISSN 1727-3781

African Journals Online (AJOL)

macuser

intervened in private landlord-tenant relationships in a number of jurisdictions, ... private rental market in order to restrict rent increases and provide security of tenure. ..... 44 In 1914 only one per cent of the housing stock in Britain was council ...

ISSN 1727-3781

African Journals Online (AJOL)

Petra

achieved through the accommodation of diversities of all kinds, granting ..... illiteracy rates through increased and renewed adult education, an increase of TVET ... budget. Table 2 shows a constant increase of education's share of the overall.

ISSN 1727-3781

African Journals Online (AJOL)

sauroa

statement of intent and resolve to overcome the burden of history but also an .... consolidated version of the Treaty and all its amendments can be accessed on ...... Financial Support for the Translation of the Content of the SADC Website into.

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

The GSM subscribers on their part also face many problems, major of which is ... The primary source includes questionnaire and personal interaction. The secondary source ... Consumer/Subscriber Complaints-Implication and Consequences. Keaveney ... customs unpredictable clearance process and bad network of roads.

ISSN 2070-0083

African Journals Online (AJOL)

Nekky Umera

study employs data from primary and secondary sources and use facility model and ... ports and foot paths); Storage facilities (Silos, Warehouse, cribs, open air .... Hospital, Ado, Dental Headquarters, Ado and Hospital Management Board.

ISSN 1727-3781

African Journals Online (AJOL)

Camilla Pickles

(as a non-legal subject) on the one hand, and women (as legal subjects) exercising their rights to ... rights, and affect the right to terminate a pregnancy in South Africa. This is reflected ..... to working conditions, detention or armed conflict.

ISSN 1727-3781

African Journals Online (AJOL)

Ntlamn

transformation it has brought to the development and building of a united South ... leadership in reinforcing the right to gender equality, it has done nothing more than .... left in respect of which the individual could exercise associational rights.

ISSN 1727-3781

African Journals Online (AJOL)

mnyenti

2012-03-13

Mar 13, 2012 ... protect the rights of those likely to be affected. 4 .... geared towards the promotion of adequate social protection in the region. ..... management of SADC programmes, the implementation of decisions of SADC policy organs and .... services generally purchase a private health insurance policy or contribute ...

ISSN 1727-3781

African Journals Online (AJOL)

Mark

4 See s A(3) of the Securities Regulation Code in Takeovers and Mergers for a .... relevance, if any, of the solvency and liquidity of the company embarking on a ..... The board must compare the value and the price with the consideration.

ISSN 1727-3781

African Journals Online (AJOL)

m

the consideration of issues of race, gender and disability will no longer be required of ... racial spoils system" and to result in reverse discrimination. 4 ... inequalities but also to deal with existing inequalities within society - and having a.

ISSN 1727-3781

African Journals Online (AJOL)

HP4510s

place the question is addressed how a monist or dualist approach regarding the ... humanitarian law, customary international law, and the law and practice of States. ... Law 171 et seq; Boothby 2006 Intervention 244-259; Cohn 1991 IJRL 100-111; ...... as victims because of their emotional, mental and intellectual immaturity.

ISSN 1727-3781

African Journals Online (AJOL)

New Win User

However, the proposed commercial treatment of traditional knowledge may also have legal consequences for the parties whose transactions have to do with traditional knowledge. One of the legal consequences that always merits attention in the commercial world is the tax liability of such parties, which may be affected by ...

ISSN 1727-3781

African Journals Online (AJOL)

hmos

paper: Prof Elizabeth Cooke (Law Commission and University of Reading, UK), who facilitated .... hastily signed into force in 2004, an election year, amidst severe criticism. 13. Given its ... Good governance in the private (corporate) and public ..... because of our country's peculiar colonial past, South Africa has a registration.

ISSN 1727-3781

African Journals Online (AJOL)

Brimer

the context of which is a large body of jurisprudence, standard philosophy ... tension, slip, slide, perish,/Decay with imprecision, will not stay in place,/Will not stay ... fond of the dead language, Latin) and is very obviously still with us today, as is.

ISSN 1727-3781

African Journals Online (AJOL)

UFS Campus

cellphone or Internet chatrooms, the purpose being to persuade the victim gradually ... information as a form of pressure to obtain an advantage which is not legally due to ... through false promises or other forms of deception and not by forceful ...

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

evaluation feedback have on the students' performance of cognitive learning tasks in block .... re-examines his achievement in government. To evaluate ... that a student should be graded both in comparison with his own ability and in relation ...

ISSN 1727-3781

African Journals Online (AJOL)

Louis Harms

DEMYSTIFICATION OF THE INQUISITORIAL SYSTEM ... beloved preconceptions as to how cases should be managed and trials run. Sometimes the police ... into a river. If she floats, it means that the Devil kept her floating and is on her side.

ISSN 2070-0083

African Journals Online (AJOL)

FIRST LADY

perceptual realists. It must be ... indigenous materials to forge ahead with the creative process. There is also a .... The human figure is often treated in a stylized or .... into series of lines and mass area while using textured ground. This is.

Co2+ Ions as Probes of Al Distribution in the Framework of Zeolites. ZSM-5 Study

Czech Academy of Sciences Publication Activity Database

Dědeček, Jiří; Kaucký, Dalibor; Wichterlová, Blanka; Gonsiorová, O.

2002-01-01

Roč. 4, - (2002), s. 5406-5413 ISSN 1463-9076 R&D Projects: GA MŠk OC D15.20 Institutional research plan: CEZ:AV0Z4040901 Keywords : Al distribution in zeolites * ZSM-5 * Vis spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.838, year: 2002

Electron Paramagnetic Resonance and Spectroscopic Characteristics of Electrogenerated Mixed-Valent Systems [(.eta..sup.5./sup.-C.sub.5./sub.Me.sub.5./sub.)M(.mu.-L)M(.eta..sup.5./sup.-C.sub.5./sub.Me.sub.5./sub.)].sup.+./sup. (M=Rh, Ir; L=2,5-diiminopyrazines) in Relation to the Radicals [(.eta..sup.5./sup.-C.sub.5./sub.Me.sub.5./sub.)CIM

Czech Academy of Sciences Publication Activity Database

Berger, S.; Klein, A.; Wanner, M.; Kaim, W.; Fiedler, Jan

2000-01-01

Roč. 39, č. 12 (2000), s. 2516-2521 ISSN 0020-1669 R&D Projects: GA MŠk OC D15.10 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 2.712, year: 2000

Coating of adenovirus type 5 with polymers containing quaternary amines prevents binding to blood components

Czech Academy of Sciences Publication Activity Database

Šubr, Vladimír; Kostka, Libor; Selby-Milic, T.; Fisher, K.; Ulbrich, Karel; Seymour, W.; Carlisle, R. C.

2009-01-01

Roč. 135, č. 2 (2009), s. 152-158 ISSN 0168-3659 R&D Projects: GA AV ČR KJB400500803 EU Projects: European Commission(XE) 512087 - GIANT Institutional research plan: CEZ:AV0Z40500505 Keywords : quaternary ammonium * HPMA * adenovirus Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.949, year: 2009

Proton Pump for O-2 Reduction Catalyzed by 5,10,15,20-Tetraphenylporphyrinatocobalt(II)

Czech Academy of Sciences Publication Activity Database

Partovi-Nia, R.; Su, B.; Li, F.; Gros, C. P.; Barbe, J.-M.; Samec, Zdeněk; Girault, H. H.

2009-01-01

Roč. 15, č. 10 (2009), s. 2335-2340 ISSN 0947-6539 R&D Projects: GA MŠk OC 177; GA ČR(CZ) GA203/07/1257 Institutional research plan: CEZ:AV0Z40400503 Keywords : cobalt * ferrocenes * hydrogen peroxide * oxygen reduction * proton pump Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.382, year: 2009

Physical interaction of RECQ5 helicase with RAD51 facilitates its anti-recombinase activity

Czech Academy of Sciences Publication Activity Database

Schwendener, S.; Raynard, S.; Paliwal, S.; Cheng, A.; Kanagaraj, R.; Shevelev, Igor; Stark, J.M.; Sung, P.; Janscak, P.

2010-01-01

Roč. 285, č. 21 (2010), s. 15739-15745 ISSN 0021-9258 Grant - others:NIH(US) R01CA120954; NIH(US) ES015632; SNSF(CH) 3100A0-116008 Institutional research plan: CEZ:AV0Z50520514 Keywords : DNA helicase * double-strand breaks * homologous recombination Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.328, year: 2010

Gene : CBRC-MMUS-05-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available 205) /gb=AB034730 /gi=7209718 /ug=Mm.329131 /len=3320 9e-14 24% MLLMCSMTMLLMRSAITLLICSATMLFMHSATM...LLMCSVNMLFMCSATMLFMGSATTLLMGSATMLLMGSANLLFMGSGTKLFKGSATMLFMGSATMLLMGSATMLLIGSATMLFKGSTNMLLMCSATMVFMGSGIMLFKGSATM...LFMHSSTMLHMGSGTKLFIGSATMLLMGSATMLFKGSATMLSMHSVTMLHMGSATMSFMGSATMLFNGSAAMSFMGSATMLRIPWRLGVEESLERLKEFSLTDLFSSGFMQG ...

Wnt5a regulates ventral midbrain morphogenesis and the development of A9-A10 dopaminergic cells in vivo

Czech Academy of Sciences Publication Activity Database

Andersson, E.R.; Prakash, N.; Čajánek, L.; Minina, E.; Bryja, Vítězslav; Bryjová, Lenka; Yamaguchi, T.P.; Hall, A.C.; Wurst, W.; Arenas, E.

2008-01-01

Roč. 3, č. 10 (2008), s. 1-14 E-ISSN 1932-6203 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Wnt 5a deficient mouse * ventral midbrain * planar cell polarity Subject RIV: BO - Biophysics

Evolution of the solar wind proton temperature anisotropy from 0.3 to 2.5 AU

Czech Academy of Sciences Publication Activity Database

Matteini, L.; Landi, S.; Hellinger, Petr; Pantellini, F.; Maksimovic, M.; Velli, M.; Goldstein, B. E.; Marsch, E.

2007-01-01

Roč. 34, č. 20 (2007), L20105/1-L20105/5 ISSN 0094-8276 Grant - others:ASI(IT) I/015/07/0 Institutional research plan: CEZ:AV0Z30420517 Keywords : Proton temperature anisotropy * solar wind * radial evolution * observations Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.744, year: 2007

Kinetic and structural characterization of an alternatively spliced variant of human mitochondrial 5'(3')-deoxyribonucleotidase

Czech Academy of Sciences Publication Activity Database

Pachl, Petr; Fábry, Milan; Veverka, Václav; Brynda, Jiří; Řezáčová, Pavlína

2015-01-01

Roč. 30, č. 1 (2015), 63-68 ISSN 1475-6366 R&D Projects: GA ČR GA203/09/0820; GA MŠk(CZ) LK11205 Institutional support: RVO:61388963 ; RVO:68378050 Keywords : 5'(3')-deoxyribonucleotidase * alternative splicing * crystal structure * hydrolase * mitochondria Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.428, year: 2015

From laboratory catalysts to a new prototype: a novel real candidate for the isomerization of C5–C6 paraffins

Czech Academy of Sciences Publication Activity Database

Hidalgo, J. M.; Kaucký, Dalibor; Bortnovsky, O.; Černý, R.; Sobalík, Zdeněk

2015-01-01

Roč. 5, JUN 2015 (2015), s. 56625-56628 ISSN 2046-2069 R&D Projects: GA MPO FR-TI3/316 Institutional support: RVO:61388955 Keywords : C5-C6 paraffins * isomeration * Pt/WO3–ZrO2 materials Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.289, year: 2015

Psychological skills of veteran athletes. DOI: 10.5007/1980-0037.2011v13n5p404

Directory of Open Access Journals (Sweden)

Sanderson Soares Silva

2011-08-01

Full Text Available At the beginning of the study of veteran athletes, most investigations involving this population have focused on the physiological aspects of performance and their relationship with the aging process. With respect to sport psychology, there are few studies on the use of psychological skills by veteran athletes. In view of this gap, further studies are needed to increase the understanding of psychological skills used by veteran athletes. In this respect, our point of view shows that veteran athletes use a set of psychological skills to enhance their competitive performance and to overcome obstacles during the competition. In addition, the study of these psychological skills provides relevant information regarding the cognitive processes that occur in older adults, since a series of cognitive changes have been reported to occur as a result of the aging process.

Electrical resistivity, susceptibility and heat capacity of cubic Kondo compound YbCu.sub.5./sub. prepared by melt-spinning technique

Czech Academy of Sciences Publication Activity Database

Reiffers, M.; Idzikowski, B.; Šebek, Josef; Šantavá, Eva; Ilkovič, S.; Pristáš, G.

378-380, - (2006), s. 738-739 ISSN 0921-4526 Institutional research plan: CEZ:AV0Z10100520 Keywords : YbCu 5 * susceptibility * electrical resistivity * melt spinning Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.872, year: 2006

Characterization of organic compounds in the PM2.5 aerosols in winter in an industrial urban area

Czech Academy of Sciences Publication Activity Database

Mikuška, Pavel; Křůmal, Kamil; Večeřa, Zbyněk

2015-01-01

Roč. 105, March (2015), s. 97-108 ISSN 1352-2310 R&D Projects: GA ČR(CZ) GBP503/12/G147 Institutional support: RVO:68081715 Keywords : PM2.5 aerosol * organic compounds * emission sources Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.459, year: 2015

Effect of storage materials on viability and proximate composition of ...

African Journals Online (AJOL)

Viability of the G. kola seeds stored in polyethylene bag (PB) was highest (100%) followed by that of the seeds stored in fresh plantain leaf (FPL) (86.67 ± 13.33%); cement bag paper (CBP) (73.33 ± 17.64%); dry plantain leaf (DPL) (60.00%) and the control which was exposed to the ambient temperature in the laboratory ...

Anatomical study of serotonergic innervation and 5-HT(1A) receptor in the human spinal cord

Czech Academy of Sciences Publication Activity Database

Perrin, F. E.; Gerber, Y. N.; Teigell, M.; Lonjon, N.; Boniface, G.; Bauchet, L.; Rodríguez Arellano, Jose Julio; Hugnot, J. P.; Privat, A. M.

2011-01-01

Roč. 2, - (2011), e218 ISSN 2041-4889 R&D Projects: GA ČR GA309/09/1696; GA ČR(CZ) GAP304/11/0184 Institutional research plan: CEZ:AV0Z50390703 Keywords : genito-urinary tract * locomotion * nociceptive pathway Subject RIV: FH - Neurology Impact factor: 5.333, year: 2011

The T. brucei TRM5 methyltransferase plays an essential role in mitochondrial protein synthesis and function

Czech Academy of Sciences Publication Activity Database

Paris, Z.; Horáková, Eva; Rubio, M.A.T.; Sample, P.; Fleming, I.M.C.; Armocida, S.; Lukeš, Julius; Alfonzo, J. D.

2013-01-01

Roč. 19, č. 5 (2013), s. 649-658 ISSN 1355-8382 R&D Projects: GA ČR(CZ) GAP305/11/2179; GA MŠk LH12104 Institutional support: RVO:60077344 Keywords : Trypanosoma * tRNA * methylation * tRNA import * mitochondrion Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.622, year: 2013

Inclusive dielectron spectra in p plus p collisions at 3.5 GeV kinetic beam energy

Czech Academy of Sciences Publication Activity Database

Agakishiev, G.; Balanda, A.; Belyaev, A.; Finocchiaro, P.; Guber, F.; Karavicheva, T.; Krása, Antonín; Křížek, Filip; Kugler, Andrej; Lapidus, K.; Markert, J.; Michel, J.; Pechenova, O.; Rustamov, A.; Sobolev, Yuri, G.; Strobele, H.; Tarantola, A.; Teilab, K.; Tlustý, Pavel; Wagner, Vladimír

2012-01-01

Roč. 48, č. 5 (2012), s. 1-11 ISSN 1434-6001 R&D Projects: GA MŠk LC07050; GA AV ČR IAA100480803 Institutional support: RVO:61389005 Keywords : relativistic collisions * nuclear matter * dielectron spectra * HADES Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.043, year: 2012

Behaviour of the hip joint endoprosthesis ceramic head with manufacturing inaccuracies under ISO 7206-5 loading

Czech Academy of Sciences Publication Activity Database

Fuis, Vladimír; Janíček, P.

2003-01-01

Roč. 10, č. 5 (2003), s. 399-411 ISSN 1210-2717 R&D Projects: GA ČR GP101/01/P039 Institutional research plan: CEZ:AV0Z2076919 Keywords : micro-unevenness modelling * stress and failure probability analyses * Weibull weakest link theory Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

Occurence of eugenol, coniferyl alcohol and 3,4,5- trimethoxyphenol in common buckwheat (Fagopyrum esculentum Moench) and their biological activity

Czech Academy of Sciences Publication Activity Database

Kalinová, J.; Tříska, Jan; Vrchotová, Naděžda

2011-01-01

Roč. 33, č. 5 (2011), s. 1679-1685 ISSN 0137-5881 Institutional research plan: CEZ:AV0Z60870520 Keywords : Allelopathy * Fagopyrum esculentum * Phenolic compound * Weed * GC-MS analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 1.639, year: 2011

The Role of TPA I/D and PAI-1 4G/5G Polymorphisms in Multiple Sclerosis

Science.gov (United States)

Živković, Maja; Starčević Čizmarević, Nada; Lovrečić, Luca; Klupka-Sarić, Inge; Stanković, Aleksandra; Gašparović, Iva; Dinčić, Evica; Stojković, Ljiljana; Rudolf, Gorazd; Šega Jazbec, Saša; Perković, Olivio; Sinanović, Osman; Sepčić, Juraj; Kapović, Miljenko; Peterlin, Borut

2014-01-01

Background. Previous studies have shown impaired fibrinolysis in multiple sclerosis (MS) and implicated extracellular proteolytic enzymes as important factors in demyelinating neuroinflammatory disorders. Tissue-type plasminogen activator (t-PA) and its inhibitor (PAI-1) are key molecules in both fibrinolysis and extracellular proteolysis. In the present study, an association of the TPA Alu I/D and PAI-1 4G/5G polymorphisms with MS was analyzed within the Genomic Network for Multiple Sclerosis (GENoMS). Methods. The GENoMS includes four populations (Croatian, Slovenian, Serbian, and Bosnian and Herzegovinian) sharing the same geographic location and a similar ethnic background. A total of 885 patients and 656 ethnically matched healthy blood donors with no history of MS in their families were genotyped using PCR-RFLP. Results. TPA DD homozygosity was protective (OR = 0.79, 95% CI 0.63–0.99, P = 0.037) and PAI 5G5G was a risk factor for MS (OR = 1.30, 95% CI 1.01–1.66, P = 0.038). A significant effect of the genotype/carrier combination was detected in 5G5G/I carriers (OR = 1.39 95% CI 1.06–1.82, P = 0.017). Conclusions. We found a significantly harmful effect of the combination of the PAI-1 5G/5G genotype and TPA I allele on MS susceptibility, which indicates the importance of gene-gene interactions in complex diseases such as MS. PMID:24825926

Fragmentation of pure and hydrated clusters of 5Br-uracil by low energy carbon ions: observation of hydrated fragments

Czech Academy of Sciences Publication Activity Database

Castrovilli, M. C.; Markush, P.; Bolognesi, P.; Rousseau, P.; Maclot, S.; Cartoni, A.; Delaunay, R.; Domaracka, A.; Kočišek, Jaroslav; Huber, B. A.; Avaldi, L.

2017-01-01

Roč. 19, č. 30 (2017), s. 19807-19814 ISSN 1463-9076 Institutional support: RVO:61388955 Keywords : fragmentation * nano-hydrated 5BrU clusters * low energy carbon ions Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.123, year: 2016

MULTICOMPONENT AND REGIOSELECTIVE SYNTHESIS OF DIHYDROPYRAZOLO[1,5-a]PYRIMIDINES FROM AROMATIC ALDEHYDES, MELDRUM'S ACID AND AMINOPYRAZOLE CAN508

Czech Academy of Sciences Publication Activity Database

Jedinák, L.; Kryštof, Vladimír; Trávníček, Z.; Cankař, P.

2014-01-01

Roč. 89, č. 8 (2014), s. 1892-1904 ISSN 0385-5414 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Pyrazolo[1,5-a]pyrimidine * Cyclization * Multicomponent Reaction Subject RIV: CC - Organic Chemistry Impact factor: 1.079, year: 2014

Myrica rubra leaves as a potential source of a dual 5-LOX/COX inhibitor

Czech Academy of Sciences Publication Activity Database

Langhansová, Lenka; Landa, Přemysl; Kutil, Zsófia; Tauchen, Jan; Maršík, Petr; Rezek, Jan; Lou, J.D.; Yun, Z.L.; Vaněk, Tomáš

2017-01-01

Roč. 28, č. 2 (2017), s. 343-353 ISSN 0954-0105 R&D Projects: GA MŠk LH12165; GA ČR(CZ) GA16-07193S Grant - others:OPPK(CZ) CZ.2.16/3.1.00/24014 Institutional support: RVO:61389030 Keywords : in-vitro * antiinflammatory activity * zucc. leaves * 5-lipoxygenase * sieb. * cyclooxygenase * constituents * antioxidants * myricitrin * metabolism * Myrica rubra * anti-inflammatory * cyclooxygenase 1 * cyclooxygenase 2 * 5-lipoxygenase Subject RIV: FR - Pharmacology ; Medidal Chemistry OBOR OECD: Medicinal chemistry Impact factor: 1.392, year: 2016

Fullerene recognition by 5-nitro-11,17,23,29-tetramethylcalix[5]arene

Czech Academy of Sciences Publication Activity Database

Flídrová, K.; Liška, Alan; Ludvík, Jiří; Eigner, V.; Lhoták, P.

2015-01-01

Roč. 56, č. 12 (2015), s. 1535-1538 ISSN 0040-4039 R&D Projects: GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : calixarene * fullerene * complexation Subject RIV: CG - Electrochemistry Impact factor: 2.347, year: 2015

DNA demethylating agent 5-azacytidine inhibits myeloid-derived suppressor cells induced by tumor growth and cyclophosphamide treatment

Czech Academy of Sciences Publication Activity Database

Mikyšková, Romana; Indrová, Marie; Vlková, Veronika; Bieblová, Jana; Šímová, Jana; Paračková, Zuzana; Pajtasz-Piasecka, E.; Rossowska, J.; Reiniš, Milan

2014-01-01

Roč. 95, č. 5 (2014), s. 743-753 ISSN 0741-5400 R&D Projects: GA ČR(CZ) GPP301/11/P220; GA ČR GAP301/10/2174 Institutional support: RVO:68378050 Keywords : arginase-1 * immunosuppression * microenvironment Subject RIV: EB - Gene tics ; Molecular Biology Impact factor: 4.289, year: 2014

DNA demethylating agent 5-azacytidine inhibits myeloid-derived suppressor cells induced by tumor growth and cyclophosphamide treatment

Czech Academy of Sciences Publication Activity Database

Mikyšková, Romana; Indrová, Marie; Vlková, Veronika; Bieblová, Jana; Šímová, Jana; Paračková, Zuzana; Pajtasz-Piasecka, E.; Rossowska, J.; Reiniš, Milan

2014-01-01

Roč. 95, č. 5 (2014), s. 743-753 ISSN 0741-5400 R&D Projects: GA ČR(CZ) GPP301/11/P220; GA ČR GAP301/10/2174 Institutional support: RVO:68378050 Keywords : arginase-1 * immunosuppression * microenvironment Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.289, year: 2014

Combination of Drugs Elevating Extracellular Adenosine with Granulocyte Colony-Stimulating Factor Promotes Granulopoietic Recovery in the Murine Bone Marrow after 5-Fluorouracil Treatment

Czech Academy of Sciences Publication Activity Database

Hofer, Michal; Pospíšil, Milan; Weiterová, Lenka; Znojil, V.; Vácha, J.; Holá, Jiřina; Vacek, Antonín; Pipalová, Iva

2001-01-01

Roč. 50, č. 5 (2001), s. 521-524 ISSN 0862-8408 R&D Projects: GA ČR GA306/99/0027; GA AV ČR IBS5004009 Institutional research plan: CEZ:AV0Z5004920 Keywords : 5-fluorouracil * granulopoiesis * extracellular adenosine Subject RIV: BO - Biophysics Impact factor : 1.027, year: 2001

Silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine - characterization of this primary explosive

Czech Academy of Sciences Publication Activity Database

Musil, T.; Matyáš, R.; Vala, R.; Růžička, A.; Vlček, Milan

2014-01-01

Roč. 39, č. 2 (2014), s. 251-259 ISSN 0721-3115 Institutional support: RVO:61389013 Keywords : primary explosive * AgDANT * silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine Subject RIV: CC - Organic Chemistry Impact factor: 1.604, year: 2014

Three new pancreatic cancer susceptibility signals identified on chromosomes 1q32.1, 5p15.33 and 8q24.21

Czech Academy of Sciences Publication Activity Database

Zhang, M.; Wang, Z.; Obazee, O.; Jia, J.; Childs, E.J.; Hoskins, J.; Figlioli, G.; Mocci, E.; Collins, I.; Chung, Ch.; Hautman, Ch.; Arslan, A.A.; Beane-Freeman, L.; Bracci, P. M.; Buring, J.; Duell, E. J.; Gallinger, S.; Giles, G.G.; Goodman, G. E.; Goodman, P. J.; Kamineni, A.; Kolonel, L. N.; Kulke, M. H.; Malats, N.; Olson, S. H.; Sesso, H. D.; Visvanathan, K.; White, E.; Zheng, W.; Abnet, Ch. C.; Albanes, D.; Andreotti, G.; Brais, L.; Bueno-de-Mesquita, H. B.; Basso, D.; Berndt, S. I.; Boutron-Ruault, M. Ch.; Bijlsma, M.F.; Brenner, H.; Burdette, L.; Campa, D.; Caporaso, N. E.; Capurso, G.; Cavestro, G.M.; Cotterchio, M.; Costello, E.; Elena, J.; Boggi, U.; Gaziano, J. M.; Gazouli, M.; Giovannucci, E. L.; Goggins, M.; Gross, M.; Haiman, Ch. A.; Hassan, M.; Helzlsouer, K. J.; Hu, N.; Hunter, D. J.; Iskierka-Jazdzewska, E.; Jenab, M.; Kaaks, R.; Key, T.J.; Khaw, K. T.; Klein, E. A.; Kogevinas, M.; Krogh, V.; Kupcinskas, J.; Kurtz, R. C.; Landi, M. T.; Landi, S.; Le Marchand, L.; Mambrini, A.; Mannisto, S.; Milne, R. L.; Neale, R.E.; Oberg, A. L.; Panico, S.; Patel, A. V.; Peeters, P. H. M.; Peters, U.; Pezzilli, R.; Porta, M.; Purdue, M.; Ramon Quiros, J.; Riboli, E.; Rothman, N.; Scarpa, A.; Scelo, G.; Shu, X. O.; Silverman, D. T.; Souček, P.; Strobel, O.; Sund, M.; Malecka-Panas, E.; Taylor, P. R.; Tavano, F.; Travis, R. C.; Thornquist, M.; Tjonneland, A.; Tobias, G. S.; Trichopoulos, D.; Vashist, Y.; Vodička, Pavel; Wactawski-Wende, J.; Wentzensen, N.; Yu, H.; Yu, K.; Zeleniuch-Jacquotte, A.; Kooperberg, Ch.; Risch, H. A.; Jacobs, E. J.; Li, D.; Fuchs, Ch.; Hoover, R.; Hartge, P.; Chanock, S. J.; Petersen, G. M.; Stolzenberg-Solomon, R. S.; Wolpin, B. M.; Kraft, P.; Klein, A. P.; Canzian, F.; Amundadottir, L. T.

2016-01-01

Roč. 7, č. 41 (2016), s. 66328-66343 ISSN 1949-2553 Institutional support: RVO:68378041 Keywords : genome-wide association * urinary-bladder cancer * long-range interaction Subject RIV: FP - Other Medical Disciplines Impact factor: 5.168, year: 2016

Adaptation of the S-5-S Pendulím Seismometer for Measurement of Rotational Ground Motion

Czech Academy of Sciences Publication Activity Database

Knejzlík, Jaromír; Kaláb, Zdeněk; Rambouský, Zdeněk

2012-01-01

Roč. 16, č. 4 (2012), s. 649-656 ISSN 1383-4649 Institutional support: RVO:68145535 Keywords : rotation al ground motion * experimental measurement * mining induced seismicity * S-5-S seismometer Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.388, year: 2012 http://link.springer.com/article/10.1007%2Fs10950-012-9279-6

High Temperature Creep of an Al-8,5Fe-1,3V-1,7Si Alloy

Czech Academy of Sciences Publication Activity Database

Kuchařová, Květa; Zhu, S. J.; Čadek, Josef

2002-01-01

Roč. 40, č. 2 (2002), s. 69-84 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : Al-8,5Fe 1,3V 1,7Si alloy * creep behavior , true threshold stress Subject RIV: JI - Composite Materials Impact factor: 0.493, year: 2002

Pre-clinical evaluation of AAV5-miHTT gene therapy of Huntington´s disease

Czech Academy of Sciences Publication Activity Database

Konstantinová, P.; Miniarikova, J.; Blits, B.; Zimmer, V.; Spoerl, A.; Southwell, A.; Hayden, M.; van Deventer, S.; Deglon, N.; Motlík, Jan; Juhás, Štefan; Juhásová, Jana; Richard, Ch.; Petry, H.

2015-01-01

Roč. 78, Supl 2 (2015), s. 8-8 ISSN 1210-7859. [Conference on Animal Models for neurodegenerative Diseases /3./. 08.11.2015-10.11.2015, Liblice] R&D Projects: GA MŠk ED2.1.00/03.0124 Institutional support: RVO:67985904 Keywords : Huntington ´s disease * gene therapy * AAV5-miHTT Subject RIV: EB - Genetics ; Molecular Biology

GLOBAL JOURNAL OF GEOLOGICAL SCIENCE (ISSN 1596 – 6798)

African Journals Online (AJOL)

Ada Global

in wells closest to and down slope of the waste dump (total acidity 5.1-10.0 mg/l; Na+ 8.92-11.07 mg/l; Cl- 127.62- ... (human and animal wastes, dead animals, hospital waste etc.); industrial wastes such as chemicals, waste .... Test methods.

5. setkání českých uživatelů systému DSpace v Ostravě

Czech Academy of Sciences Publication Activity Database

Burešová, Iva

-, č. 2 (2012), s. 1 E-ISSN 1805-2800 Keywords : Asociace knihoven vysokých škol České republiky * digital repositories * DSpace * electronical publishing * institutional repositories * open access http://www.lib.cas.cz/casopis-informace/5-setkani-ceskych-uzivatelu-systemu-dspace-v-ostrave/

Lump Sum Alternatives to Current Veterans’ Disability Compensation

Science.gov (United States)

2006-11-01

5281 FOOT CONDITION: HALLUX RIGIDUS 5282 HAMMER TOE 5286 SPINE, COMPLETE BONY FIXATION 5287 ANKYLOSIS OF CERVICAL SPINE 5288 ANKYLOSIS OF... HERNIA 5327 MALIGNANT MUSCLE GROWTH 5328 BENIGN MUSCLE GROWTH 5399 MUSCLE CONDITION 6002 INFLAMMATION OF SCLERA 6003 INFLAMMATION OF IRIS 6009...HEPATIC 7330 FISTULA OF THE INTESTINE 7333 STRICTURE OF RECTUM AND ANUS 7336 HEMORRHOIDS 7337 PRURITUS ANI 7338 INGUINAL HERNIA 7501 ABCESS

Improved energy of the 21.5 keV M1+E2 nuclear transition in Eu-151

Czech Academy of Sciences Publication Activity Database

Inoyatov, A. K.; Kovalík, Alojz; Filosofov, D. V.; Ryšavý, Miloš; Perevoshchikov, L. L.; Baimukhanova, A.

2016-01-01

Roč. 52, č. 5 (2016), s. 133 ISSN 1434-6001 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : electron binding energies * internal conversion * Gd-151 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.833, year: 2016

GLOBAL JOURNAL OF GEOLOGICAL SCIENCE (ISSN 1596 – 6798)

African Journals Online (AJOL)

Ada Global

limestone is fine-grained, fossiliferous and composed dominantly of algal boundstone and lenses of oolitic wackestone and packstone. ..... natural gas for fuel. Both oil and gas contain sulphur compounds which vary from 0.5 to 3%. Sulphur will combine with CaO at proper temperature and produce calcium sulfide or ...

Air-tolerant C–C bond formation via organometallic ruthenium catalysis: diverse catalytic pathways involving (C5Me5)Ru or (C5H5)Ru are robust to molecular oxygen

Czech Academy of Sciences Publication Activity Database

Severa, Lukáš; Vávra, Jan; Kohoutová, Anna; Čížková, Martina; Šálová, Tereza; Hývl, Jakub; Šaman, David; Pohl, Radek; Adriaenssens, Louis; Teplý, Filip

2009-01-01

Roč. 50, č. 31 (2009), s. 4526-4528 ISSN 0040-4039 Institutional research plan: CEZ:AV0Z40550506 Keywords : ruthenium * organometallic catalysis * [2+2+2] cycloaddition * terminal alkynes Subject RIV: CC - Organic Chemistry Impact factor: 2.660, year: 2009

Isolation and characterization of two new lipopeptide biosurfactants produced by Pseudomonas fluorescens BD5 isolated from water from the Arctic Archipelago of Svalbard

Czech Academy of Sciences Publication Activity Database

Janek, T.; Lukaszewicz, M.; Řezanka, Tomáš; Krasowska, A.

2010-01-01

Roč. 101, č. 15 (2010), s. 6118-6123 ISSN 0960-8524 Institutional research plan: CEZ:AV0Z50200510 Keywords : Pseudomonas fluorescens BD5 * Lipopeptide * Pseudofactins Subject RIV: EE - Microbiology, Virology Impact factor: 4.365, year: 2010

Energy Transfer in Microhydrated Uracil, 5-Fluorouracil, and 5-Bromouracil

Czech Academy of Sciences Publication Activity Database

Poštulka, J.; Slavíček, P.; Fedor, Juraj; Fárník, Michal; Kočišek, Jaroslav

2017-01-01

Roč. 121, č. 38 (2017), s. 8965-8974 ISSN 1520-6106 R&D Projects: GA ČR GJ16-10995Y; GA ČR(CZ) GA17-04068S Institutional support: RVO:61388955 Keywords : Aromatic compounds * Electrons * Energy transfer Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.177, year: 2016

Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

Czech Academy of Sciences Publication Activity Database

Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

2005-01-01

Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

Type I iodothyronine 5′-deiodinase mRNA and activity is increased in adipose tissue of obese subjects

Czech Academy of Sciences Publication Activity Database

Ortega, F.J.; Jílková, Zuzana; Moreno-Navarrete, J.M.; Pavelka, S.; Rodriguez-Hermosa, J.I.; Kopecký, Jan; Fernández-Real, J.M.

2012-01-01

Roč. 36, č. 2 (2012), s. 320-324 ISSN 0307-0565 R&D Projects: GA MŠk(CZ) OC08008 Institutional research plan: CEZ:AV0Z50110509 Keywords : adipose tissue * thyroid hormones * deiodinases * tissue expression * enzyme activity Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 5.221, year: 2012

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

Head and Neck Cancer (H&N CA) has had a fascinating and, along with most surgery, a fairly ... Innovations utilized by George Crile: ... As the management of H&N CA advanced in the 1950s oncology and surgery began working together.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

Difficult Gallbladder Surgery, Improving Patient Outcomes Through Appropriate Surgical. Decisions. ... If the position is too close to the common bile duct, an aberrant ... M.M, a 65-years old female had a bile duct injury post open cholecystectomy. She had .... With radiologic advances, cholecystostomy can be performed as a.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

Background: A case report of stab neck presenting at Kalafong Hospital, Pretoria, South. Africa with atypical meningitis. The objective was to illustrate the challenge of diagnosing this unusual and late presentation of meningitis. Case Report: A 48 year-old male patient presented to us two days after a stab neck. He was ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

Prof Kakande

Afr. J. surg. ..... September/October 2003. 3. Hardin R, Stevenson M, Downie W, Wilson G. Assessment of clinical competence using objective ... Michael J. Griesser, Matthew C. Beran, David C. Flanigan, Michael Quackenbush, DO, Corey Van ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

2005-04-10

Apr 10, 2005 ... J. Gathara1, M. Galukande1, E. Kiguli-Malwadde2 ... The reason for this apparent surge is mostly speculative; presumed change in lifestyle to a .... HBD and breast cancer, cigarette smoking is documented to have an anti ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

Antibiotic Prescription Patterns in the Management of Open Fractures at Mulago Hospital in. Kampala. ... antibiotics and also the use of checklists to ensure patients receive all necessary medications .... There was no relationship between the.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

Prof Kakande

This study was aimed at determining the pattern of gastric malignancies in Nigeria, a developing country like and ... Methods: a retrospective study utilizing case-files, histopathology reports and cancer registry data of patients who have .... which are attributed to better living conditions and dietary changes2. Conversely, in ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

Prof Kakande

Use of a laparoscopic bag for facilitating extraction/ morcellation of the operative ... which are freely available and hence can solve the problem without extra cost ... Before inserting into the abdominal cavity, one edge of plastic bag is cut short ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

Prof Kakande

value=0.08). Conclusion: ... examination, problem-solve, arrive at a working diagnosis, and outline a plan of management 1, 2. Traditionally, clinical skills have been evaluated by means of multiple choice tests, oral examinations, progressive ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

. Before specific measurement of the portal vein diameter was performed, routine scanning was done to check for the sonographic exclusion criterias. The patient was scanned in supine and right anterior oblique position with the transducer in ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

Background: Uterine rupture is an infrequent but life threatening obstetric emergency. Rupture of previously scarred uterus is often encountered especially in multiparous women, but the traumatic rupture of an unscarred primigravid uterus as presented here is a relatively rare event. We report a case of rupture of an ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

Page 69. 12. Aldemir M, Yagnur Y, Tacyildir I. The predictive factors for the necessity of operative treatment in adhesive small bowel obstruction cases. Acta Chir Belg 2004; 104; 76-80. 13. Fevang BTS, Fevang J, Lie SA, Soriede O, Svanes K, Viste A. Long-term prognosis after operation for adhesive small bowel obstruction.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

the centre for disease control (CDC 2001) in the United state of America ... for preventing injury by sharp objects involving disinfection procedures but in sub Saharan Africa .... Barnett T, Whiteside A, Aids in twenty first centaury disease And ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

Prof Kakande

vomiting and constipation. Abdominal X-rays demonstrated large bowel obstruction. At laparotomy, this patient was found to have adhesions causing sigmoid colon obstruction. Conclusion: In this paper, we demonstrate the rarity of large bowel obstruction secondary to adhesions especially in a virgin abdomen, emphasize ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

This was traumatic and done under anaesthesia and subsequently Fine Needle Biopsy (FNB) was introduced by Guthrie in the United States to diagnose cancer 2, which was later popularized by. Martin and Ellis3.FNB is the most accurate, cost effective and simplest screening test for the rapid diagnosis of breast lumps and ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

2005-04-29

Apr 29, 2005 ... in the urethra and genitourinary system of male newborns. .... surveillance and care and that even today the eventual outcome is unclear in many instances6. ... Urinary tract infection was taken as prior history of recurrent fever.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

Emergency department of Bugando Medical Centre between April 2009 and March ... surgeon or senior registrar or under their supervision, in case the operative .... from the stump or blow out of appendicular stump, less chances of peritonitis ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

adnexal mass, with normal cervix, uterus and endometrium, the differential diagnosis of fallopian tube carcinoma should be kept in mind. Introduction. Primary fallopian tube carcinoma is an uncommon tumor accounting for approximately 0.14% to. 1.8% of female genital malignancies1. The first classic case was reported in ...

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

Prof Kakande

bacterial culturing and drug sensitivity testing. Data was .... The sample was placed in a sterile transportation/storage container. Following this ..... associated with antibiotic resistance in coliform organisms from community urinary tract infection in ... parenteral drug abuse: presentation, microbiology, and treatment. Am Surg.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

identify risk factors that contribute to complications following tracheostomies. The aim of this ... important to perform an objective audit on the complications following this important surgery. .... the model and the results have been excluded.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 9990 ...

African Journals Online (AJOL)

DELL

%), Gastritis. (12.6%) and Peptic ulcer disease (duodenal and gastric ulcers) was 6.2%. The malignant conditions (Gastric and Esophageal cancers) contributed to 2.6% . Other less frequent causes of. UGIB were Hiatus hernia (1.8), ...