Mechanical Design of the SMC (Short Model Coil) Dipole Magnet

Energy Technology Data Exchange (ETDEWEB)

Regis, F.; Fessia, P.; Bajko, M.; Rijk, G. de [European Organization for Nuclear Research - CERN, CH-1211, Geneve 23 (Switzerland); Manil, P. [CEA/Saclay, IRFU/SIS, 91191 Gif-sur-Yvette (France)

2010-06-15

The Short Model Coil (SMC) working group was set in February 2007 within the Next European Dipole (NED) program, in order to develop a short-scale model of a Nb{sub 3}Sn dipole magnet. The SMC group comprises four laboratories: CERN/TE-MSC group (CH), CEA/IRFU (FR), RAL (UK) and LBNL (US). The SMC magnet was originally conceived to reach a peak field of about 13 T on conductor, using a 2500 A/mm{sup 2} Powder-In-Tube (PIT) strand. The aim of this magnet device is to study the degradation of the magnetic properties of the Nb{sub 3}Sn cable, by applying different level of pre-stress. To fully satisfy this purpose, a versatile and easy-to-assemble structure has to be realized. The design of the SMC magnet has been developed from an existing dipole magnet, the SD01, designed, built and tested at LBNL with support from CEA. In this paper we will describe the mechanical optimization of the dipole, starting from a conceptual configuration based on a former magnetic analysis. Two and three-dimensional Finite Element Method (FEM) models have been implemented in ANSYS and in CAST3M, aiming at setting the mechanical parameters of the dipole magnet structure, thus fulfilling the design constraints imposed by the materials. (authors)

Phospho-SMC1 in-Cell ELISA based Detection of Ataxia Telangiectasia

Directory of Open Access Journals (Sweden)

Majid Zaki dizaji

2016-12-01

Full Text Available BackgroundAtaxia telangiectasia (A-T is a common genetically inherited cause of early childhood-onset ataxia. The infrequency of this disease, vast phenotype variation, disorders with features similar to those of A-T, and lack of definite laboratory test, make diagnosis difficult.  In addition, there is no rapid reliable laboratory method for identifying A-T heterozygotes, who susceptible to ionizing radiation (IR, atherosclerosis, diabetes, and cancers. We used SMC1pSer966 (pSMC1 in-cell colorimetric ELISA to diagnosis and screen in A-T families.Materials and Methods: With informed consent, 2cc peripheral blood was collected from the 15 A-T patients, their parents, and 24 healthy controls with no family history of malignancy, diabetes, and atherosclerosis. Extracted peripheral blood mononuclear cells (PBMCs were cultured in poly-L-Lysine treated 96-well plate with density of 70,000 cells per well. SMC1 phosphorylation was evaluated with cell-based ELISA kit 1 hour after 5 Gy IR and the pSMC1data normalized with Glyceraldehyde-3-phosphate dehydrogenase (GAPDH.Results: SMC1 phosphorylation was significantly low in A-T`s PBMC (mean + standard deviation [SD]: 0.075 + 0.034 in comparison to carriers (mean + SD: 0.190 + 0.060 and healthy controls (mean + SD: 0.312 +0.081, but unluckily could only discriminate A-T patients (Area Under the Curve -receiver operating characteristic [AUC-ROC]: 1.00, 1.00-1.00. This method in spite of rapidness and simplicity showed poor imprecision (22.49% coefficient of variation [CV] for intraday imprecision.Conclusion: It seems pSMC1 assessment by in-cell ELISA can be used for detection of A-T patients, but it may not sensitive enough for identification of carriers. This ELISA test is very simple, rapid, and requires less than 2cc blood. Thus it may be proposed for the early differential diagnosis of A-T as an alternative method.

The SMC5/6 complex is involved in crucial processes during human spermatogenesis

NARCIS (Netherlands)

Verver, Dideke E.; Langedijk, Nathalia S. M.; Jordan, Philip W.; Repping, Sjoerd; Hamer, Geert

2014-01-01

Genome integrity is crucial for safe reproduction. Therefore, chromatin structure and dynamics should be tightly regulated during germ cell development. Chromatin structure and function are in large part determined by the structural maintenance of chromosomes (SMC) protein complexes, of which SMC5/6

A fault-tolerant strategy based on SMC for current-controlled converters

Science.gov (United States)

Azer, Peter M.; Marei, Mostafa I.; Sattar, Ahmed A.

2018-05-01

The sliding mode control (SMC) is used to control variable structure systems such as power electronics converters. This paper presents a fault-tolerant strategy based on the SMC for current-controlled AC-DC converters. The proposed SMC is based on three sliding surfaces for the three legs of the AC-DC converter. Two sliding surfaces are assigned to control the phase currents since the input three-phase currents are balanced. Hence, the third sliding surface is considered as an extra degree of freedom which is utilised to control the neutral voltage. This action is utilised to enhance the performance of the converter during open-switch faults. The proposed fault-tolerant strategy is based on allocating the sliding surface of the faulty leg to control the neutral voltage. Consequently, the current waveform is improved. The behaviour of the current-controlled converter during different types of open-switch faults is analysed. Double switch faults include three cases: two upper switch fault; upper and lower switch fault at different legs; and two switches of the same leg. The dynamic performance of the proposed system is evaluated during healthy and open-switch fault operations. Simulation results exhibit the various merits of the proposed SMC-based fault-tolerant strategy.

SMC5/6 is required for the formation of segregation-competent bivalent chromosomes during meiosis I in mouse oocytes.

Science.gov (United States)

Hwang, Grace; Sun, Fengyun; O'Brien, Marilyn; Eppig, John J; Handel, Mary Ann; Jordan, Philip W

2017-05-01

SMC complexes include three major classes: cohesin, condensin and SMC5/6. However, the localization pattern and genetic requirements for the SMC5/6 complex during mammalian oogenesis have not previously been examined. In mouse oocytes, the SMC5/6 complex is enriched at the pericentromeric heterochromatin, and also localizes along chromosome arms during meiosis. The infertility phenotypes of females with a Zp3-Cre -driven conditional knockout (cKO) of Smc5 demonstrated that maternally expressed SMC5 protein is essential for early embryogenesis. Interestingly, protein levels of SMC5/6 complex components in oocytes decline as wild-type females age. When SMC5/6 complexes were completely absent in oocytes during meiotic resumption, homologous chromosomes failed to segregate accurately during meiosis I. Despite what appears to be an inability to resolve concatenation between chromosomes during meiosis, localization of topoisomerase IIα to bivalents was not affected; however, localization of condensin along the chromosome axes was perturbed. Taken together, these data demonstrate that the SMC5/6 complex is essential for the formation of segregation-competent bivalents during meiosis I, and findings suggest that age-dependent depletion of the SMC5/6 complex in oocytes could contribute to increased incidence of oocyte aneuploidy and spontaneous abortion in aging females. © 2017. Published by The Company of Biologists Ltd.

Coordinating IMC-PID and adaptive SMC controllers for a PEMFC.

Science.gov (United States)

Wang, Guo-Liang; Wang, Yong; Shi, Jun-Hai; Shao, Hui-He

2010-01-01

For a Proton Exchange Membrane Fuel Cell (PEMFC) power plant with a methanol reformer, the process parameters and power output are considered simultaneously to avoid violation of the constraints and to keep the fuel cell power plant safe and effective. In this paper, a novel coordinating scheme is proposed by combining an Internal Model Control (IMC) based PID Control and adaptive Sliding Mode Control (SMC). The IMC-PID controller is designed for the reformer of the fuel flow rate according to the expected first-order dynamic properties. The adaptive SMC controller of the fuel cell current has been designed using the constant plus proportional rate reaching law. The parameters of the SMC controller are adaptively tuned according to the response of the fuel flow rate control system. When the power output controller feeds back the current references to these two controllers, the coordinating controllers system works in a system-wide way. The simulation results of the PEMFC power plant demonstrate the effectiveness of the proposed method. 2009 ISA. Published by Elsevier Ltd. All rights reserved.

Acute Smc5/6 depletion reveals its primary role in rDNA replication by restraining recombination at fork pausing sites.

Directory of Open Access Journals (Sweden)

Xiao P Peng

2018-01-01

Full Text Available Smc5/6, a member of the conserved SMC family of complexes, is essential for growth in most organisms. Its exact functions in a mitotic cell cycle are controversial, as chronic Smc5/6 loss-of-function alleles produce varying phenotypes. To circumvent this issue, we acutely depleted Smc5/6 in budding yeast and determined the first cell cycle consequences of Smc5/6 removal. We found a striking primary defect in replication of the ribosomal DNA (rDNA array. Each rDNA repeat contains a programmed replication fork barrier (RFB established by the Fob1 protein. Fob1 removal improves rDNA replication in Smc5/6 depleted cells, implicating Smc5/6 in the management of programmed fork pausing. A similar improvement is achieved by removing the DNA helicase Mph1 whose recombinogenic activity can be inhibited by Smc5/6 under DNA damage conditions. DNA 2D gel analyses further show that Smc5/6 loss increases recombination structures at RFB regions; moreover, mph1∆ and fob1∆ similarly reduce this accumulation. These findings point to an important mitotic role for Smc5/6 in restraining recombination events when protein barriers in rDNA stall replication forks. As rDNA maintenance influences multiple essential cellular processes, Smc5/6 likely links rDNA stability to overall mitotic growth.

The MACHO Project: Preliminary Results from 4 years of SMC observations.

Science.gov (United States)

Vandehei, T.; Griest, K.; Lehner, M.; Alcock, C.; Alves, D.; Cook, K.; Marshall, S.; Minniti, D.; Allsman, R.; Axelrod, T.; Freeman, K.; Peterson, B.; Rodgers, A.; Pratt, M.; Becker, A.; Stubbs, C.; Tomaney, A.; Bennett, D.; Quinn, P.; Sutherland, W.; Welch, D.

1997-12-01

The MACHO project is a search for dark matter in the form of massive compact halo objects(MACHOs). The project has photometrically monitored tens of millions of stars in the Large Magellanic Cloud (LMC), Small Magellanic Cloud (SMC), and Galactic bulge in search of rare gravitational microlensing events caused by these otherwise invisible objects. Microlensing toward the LMC has allowed powerful statements to be made about the dark population in the halo of our Galaxy, indicating that the MACHO halo fraction could be as high as f=0.5 with a most probable MACHO mass being ~ 0.5Msun. However, to date the LMC has been the only line of sight out of our Galaxy's halo. Clearly, another line of sight would provide a consistency check on these results, as well as another contraint on models of the halo, in particular on halo flattening. The SMC affords us this second line of sight. Here we give a status report on our upcoming 4 year results toward the SMC. We present the results of a preliminary analysis on over 2.2 million stars from 3 square degrees and discuss the implications for the dark matter in the halo of our Galaxy. A detailed analysis of the microlensing candidates toward the SMC, with blending and parallax fits, will be shown. This work is dedicated to the memory of Alex Rodgers.

Conditional mutation of Smc5 in mouse embryonic stem cells perturbs condensin localization and mitotic progression.

Science.gov (United States)

Pryzhkova, Marina V; Jordan, Philip W

2016-04-15

Correct duplication of stem cell genetic material and its appropriate segregation into daughter cells are requisites for tissue, organ and organism homeostasis. Disruption of stem cell genomic integrity can lead to developmental abnormalities and cancer. Roles of the Smc5/6 structural maintenance of chromosomes complex in pluripotent stem cell genome maintenance have not been investigated, despite its important roles in DNA synthesis, DNA repair and chromosome segregation as evaluated in other model systems. Using mouse embryonic stem cells (mESCs) with a conditional knockout allele of Smc5, we showed that Smc5 protein depletion resulted in destabilization of the Smc5/6 complex, accumulation of cells in G2 phase of the cell cycle and apoptosis. Detailed assessment of mitotic mESCs revealed abnormal condensin distribution and perturbed chromosome segregation, accompanied by irregular spindle morphology, lagging chromosomes and DNA bridges. Mutation of Smc5 resulted in retention of Aurora B kinase and enrichment of condensin on chromosome arms. Furthermore, we observed reduced levels of Polo-like kinase 1 at kinetochores during mitosis. Our study reveals crucial requirements of the Smc5/6 complex during cell cycle progression and for stem cell genome maintenance. © 2016. Published by The Company of Biologists Ltd.

SMC1-Mediated Intra-S-Phase Arrest Facilitates Bocavirus DNA Replication

Science.gov (United States)

Luo, Yong; Deng, Xuefeng; Cheng, Fang; Li, Yi

2013-01-01

Activation of a host DNA damage response (DDR) is essential for DNA replication of minute virus of canines (MVC), a member of the genus Bocavirus of the Parvoviridae family; however, the mechanism by which DDR contributes to viral DNA replication is unknown. In the current study, we demonstrate that MVC infection triggers the intra-S-phase arrest to slow down host cellular DNA replication and to recruit cellular DNA replication factors for viral DNA replication. The intra-S-phase arrest is regulated by ATM (ataxia telangiectasia-mutated kinase) signaling in a p53-independent manner. Moreover, we demonstrate that SMC1 (structural maintenance of chromosomes 1) is the key regulator of the intra-S-phase arrest induced during infection. Either knockdown of SMC1 or complementation with a dominant negative SMC1 mutant blocks both the intra-S-phase arrest and viral DNA replication. Finally, we show that the intra-S-phase arrest induced during MVC infection was caused neither by damaged host cellular DNA nor by viral proteins but by replicating viral genomes physically associated with the DNA damage sensor, the Mre11-Rad50-Nbs1 (MRN) complex. In conclusion, the feedback loop between MVC DNA replication and the intra-S-phase arrest is mediated by ATM-SMC1 signaling and plays a critical role in MVC DNA replication. Thus, our findings unravel the mechanism underlying DDR signaling-facilitated MVC DNA replication and demonstrate a novel strategy of DNA virus-host interaction. PMID:23365434

Central Stars of Planetary Nebulae in the SMC

Science.gov (United States)

Bianchi, Luciana

2004-01-01

In FUSE cycle 3's program C056 we studied four Central Stars of Planetary Nebulae (CSPN) in the Small Magellanic Could. All FUSE observations have been successfully completed and have been reduced and analyzed. The observation of one object (SMP SMC 5) appeared to be off-target and no useful stellar flux was gathered. For another observation (SMP SMC 1) the voltage problems resulted in the loss of data from one of the SiC detectors, but we were still able to analyze the remaining data. The analysis and the results are summarized below. The FUSE data were reduced using the latest available version of the FUSE calibration pipeline (CALFUSE v2.4). The flux of these SMC post-AGB objects is at the threshold of FUSE S sensitivity, and the targets required many orbit-long exposures, each of which typically had low (target) count-rates. The background subtraction required special care during the reduction, and was done in a similar manner to our FUSE cycle 2 BOO1 objects. The resulting calibrated data from the different channels were compared in the overlapping regions for consistency. The final combined, extracted spectra of each target was then modeled to determine the stellar and nebular parameters. The FUSE spectra, combined with archival HST spectra, have been analyzed using stellar atmospheres codes such as TLUSTY and CMFGEN to derive photospheric and wind parameters of the central stars, and with ISM models to determine the amount and temperature of the surrounding atomic and molecular hydrogen. We have combined these results with those of our cycle 4 (D034) program (CSPN of the LMC) in Herald & Bianchi 2004a (paper in preparation, will be submitted to ApJ in June 2004). Two of the three SMC objects analyzed were found to have significantly lower stellar temperatures than had been predicted using nebular photoionization models, indicating either a hotter ionizing companion or the existence of strong shocks in the nebular environment. The analysis also revealed that

Magnetic Design and Code Benchmarking of the SMC (Short Model Coil) Dipole Magnet

CERN Document Server

Manil, P; Rochford, J; Fessia, P; Canfer, S; Baynham, E; Nunio, F; de Rijk, G; Védrine, P

2010-01-01

The Short Model Coil (SMC) working group was set in February 2007 to complement the Next European Dipole (NED) program, in order to develop a short-scale model of a Nb$_{3}$Sn dipole magnet. In 2009, the EuCARD/HFM (High Field Magnets) program took over these programs. The SMC group comprises four laboratories: CERN/TE-MSC group (CH), CEA/IRFU (FR), RAL (UK) and LBNL (US). The SMC magnet is designed to reach a peak field of about 13 Tesla (T) on conductor, using a 2500 A/mm2 Powder-In-Tube (PIT) strand. The aim of this magnet device is to study the degradation of the magnetic properties of the Nb$_{3}$Sn cable, by applying different levels of pre-stress. To fully satisfy this purpose, a versatile and easy-to-assemble structure has been realized. The design of the SMC magnet has been developed from an existing dipole magnet, the SD01, designed, built and tested at LBNL with support from CEA. The goal of the magnetic design presented in this paper is to match the high field region with the high stress region, l...

The stellar content of NGC 346 - A plethora of O stars in the SMC

International Nuclear Information System (INIS)

Massey, P.; Parker, J.W.; Garmany, C.D.

1989-01-01

The stellar content of NGC 346, the largest and brightest H II region in the SMC, was investigated using the results of CCD UBV photometry and spectroscopy. Spectra of 42 blue stars were classified, showing that 33 are of the O type, of which 11 are of type O6.5 or earlier, which is as many early-type O stars known in the rest of the SMC. The results identify 25-30 NGC 346 stars more massive than 25 solar masses, and six stars more massive than 40 solar masses, indicating that the upper-mass cutoff to the IMF is not lower in the SMC than in the Galaxy or the LMC. The presence of evolved 15 solar-mass stars in the NGC 346 indicates that some massive stars formed 15 million yr ago. The results of spatial distribution suggest that star formation began at the southwest side of the association and has spread to where the central cluster lies now, providing an example of sequential star formation in the SMC. 69 refs

The SMC (Short Model Coil) Nb$_{3}$Sn Program: FE Analysis with 3D Modeling

CERN Document Server

Kokkinos, C; Guinchard, M; Karppinen, M; Manil, P; Perez, J C; Regis, F

2012-01-01

The SMC (Short Model Coil) project aims at testing superconducting coils in racetrack configuration, wound with Nb$_{3}$Sn cable. The degradation of the magnetic properties of the cable is studied by applying different levels of pre-stress. It is an essential step in the validation of procedures for the construction of superconducting magnets with high performance conductor. Two SMC assemblies have been completed and cold tested in the frame of a European collaboration between CEA (FR), CERN and STFC (UK), with the technical support from LBNL (US). The second assembly showed remarkable good quench results, reaching a peak field of 12.5T. This paper details the new 3D modeling method of the SMC, implemented using the ANSYS® Workbench environment. Advanced computer-aided-design (CAD) tools are combined with multi-physics Finite Element Analyses (FEA), in the same integrated graphic interface, forming a fully parametric model that enables simulation driven development of the SMC project. The magnetic and struct...

40 CFR Appendix - Alternative Organic HAP Emissions Limits for Open Molding, Centrifugal Casting, and SMC...

Science.gov (United States)

2010-07-01

... Limits for Open Molding, Centrifugal Casting, and SMC Manufacturing Operations Where the Standards Are..., Table 5 Alternative Organic HAP Emissions Limits for Open Molding, Centrifugal Casting, and SMC... casting—CR/HS 3,4 A vent system that moves heated air through the mold 27 lb/ton. 8. Centrifugal casting...

A Comparative study of two RVE modelling methods for chopped carbon fiber SMC

Energy Technology Data Exchange (ETDEWEB)

Chen, Zhangxing; Li, Yi; Shao, Yimin; Huang, Tianyu; Xu, Hongyi; Li, Yang; Chen, Wei; Zeng, Danielle; Avery, Katherine; Kang, HongTae; Su, Xuming

2017-04-06

To achieve vehicle light-weighting, the chopped carbon fiber sheet molding compound (SMC) is identified as a promising material to replace metals. However, there are no effective tools and methods to predict the mechanical property of the chopped carbon fiber SMC due to the high complexity in microstructure features and the anisotropic properties. In this paper, the Representative Volume Element (RVE) approach is used to model the SMC microstructure. Two modeling methods, the Voronoi diagram-based method and the chip packing method, are developed for material RVE property prediction. The two methods are compared in terms of the predicted elastic modulus and the predicted results are validated using the Digital Image Correlation (DIC) tensile test results. Furthermore, the advantages and shortcomings of these two methods are discussed in terms of the required input information and the convenience of use in the integrated processing-microstructure-property analysis.

Introducing cellulose nanocrystals in sheet molding compounds (SMC)

Science.gov (United States)

Amir Asadi; Mark Miller; Sanzida Sultana; Robert J. Moon; Kyriaki Kalaitzidou

2016-01-01

The mechanical properties of short glass fiber/epoxy composites containing cellulose nanocrystals (CNC) made using sheet molding compound (SMC) manufacturing method as well as the rheological and thermomechanical properties of the CNC-epoxy composites were investigated as a function of the CNC content. CNC up to 1.4 wt% were dispersed in the epoxy to produce the resin...

SMC SMP 24: A newly radio-detected planetary nebula in the small Magellanic cloud

Directory of Open Access Journals (Sweden)

Bojičić I.S.

2010-01-01

Full Text Available In this paper we report a new radio-continuum detection of an extragalactic planetary nebula (PN: SMC SMP 24. We show the radio-continuum image of this PN and present the measured radio data. The newly reduced radio observations are consistent with the multi-wavelength data and derived parameters found in the literature. SMC SMP 24 appears to be a young and compact PN, optically thick at frequencies below 2 GHz.

SMC SMP 24: A Newly Radio-Detected Planetary Nebula in the Small Magellanic Cloud

Directory of Open Access Journals (Sweden)

Bojicic, I. S.

2010-12-01

Full Text Available In this paper we report a new radio-continuum detection of an extragalactic planetary nebula (PN: SMC~SMP~24. We show the radio-continuum image of this PN and present the measured radio data. The newly reduced radio observations are consistent with the multi-wavelength data and derived parameters found in the literature. SMC~SMP~24 appears to be a young and compact PN, optically thick at frequencies below 2~GHz.

Design of SMC base on FeSi and modified resin

Czech Academy of Sciences Publication Activity Database

Strečková, M.; Fáberová, M.; Bureš, R.; Kobera, Libor; Brus, Jiří

2013-01-01

Roč. 13, 3-4 (2013), s. 147-151 ISSN 1335-8987 Institutional support: RVO:61389013 Keywords : SMC * core - shell powder * microcomposites Subject RIV: CD - Macromolecular Chemistry http://www.imr.saske.sk/pmp/c3-4_2013.html

Highlights in radiation measuring technique's - Serial Micro Channel SMC 2100

International Nuclear Information System (INIS)

Kandler, M.; Hoffmann, Ch.

2002-01-01

The Serial Micro Channel SMC 2100 offers an ''intelligent stand alone'' electronics for the radiation measuring technique's. First it is designed of being connected to a serial interface RS232 of a PC. With a RS485 serial interface on a PC, a network structure can be generated. It has all functional modules which are necessary for the measurement of detector signals. Hence it is possible to directly connect any detector for radiation measurement to a PC, laptop, or notebook. All variations can be operated without PC support too. It has a modular structure and consists of two blocks, the functional modules and the basic modules. The Serial Micro Channel SMC 2100 may be directly coupled to a detector, which therefore makes the realisation of an ''intelligent radiation detector'' with serial link RS232 or RS485. (orig.)

De novo heterozygous mutations in SMC3 cause a range of Cornelia de Lange syndrome-overlapping phenotypes

DEFF Research Database (Denmark)

Gil-Rodríguez, María Concepción; Deardorff, Matthew A; Ansari, Morad

2015-01-01

Cornelia de Lange syndrome (CdLS) is characterized by facial dysmorphism, growth failure, intellectual disability, limb malformations, and multiple organ involvement. Mutations in five genes, encoding subunits of the cohesin complex (SMC1A, SMC3, RAD21) and its regulators (NIPBL, HDAC8), account ...

Post-irradiation phosphorylation of structural maintenance chromosome 1 (SMC1) is independent of the Fanconi protein pathway

International Nuclear Information System (INIS)

Nahas, Shareef A.; Lai, C.-H.; Gatti, Richard A.

2005-01-01

Purpose: To confirm the sensitivity of cells from patients with Fanconi anemia (FA) to ionizing radiation, and to determine whether the phosphorylation of structural maintenance chromosome 1 (SMC1) was associated with radiosensitivity, as it is in other DNA repair disorders. Methods and materials: Using lymphoblastoid cell lines from FA patients before and after exposure to ionizing radiation, the colony survival assay, radioresistant DNA synthesis, and SMC1 phosphorylation were measured. FA lymphoblastoid cell lines that had been transfected with the wild-type FANC gene were used as controls. Results: Cells from FA patients of six complementation groups were radiosensitive. Despite this, SMC1 phosphorylation was normal in each case; radioresistant DNA synthesis, a measure of S phase checkpoint integrity, was defective in FANCD2 lymphoblastoid cell lines and was corrected in FANCD2 + D2 cells. Conclusions: The data indicate that the FANC pathway proteins play a major role in the cellular responses to ionizing radiation, but not in SMC1 phosphorylation or in the S phase checkpoint of FANCD2-deficient cells. Thus, SMC1 activation is not a common denominator of radiosensitivity, as has been suggested by radiation responses of cells from ataxia-telangiectasia, Nijmegen breakage syndrome, or Mre11 deficiency patients

De novo heterozygous mutations in SMC3 cause a range of Cornelia de Lange syndrome-overlapping phenotypes

NARCIS (Netherlands)

Gil-Rodriguez, M.C.; Deardorff, M.A.; Ansari, M.; Tan, C.A.; Parenti, I.; Baquero-Montoya, C.; Ousager, L.B.; Puisac, B.; Hernandez-Marcos, M.; Teresa-Rodrigo, M.E.; Marcos-Alcalde, I.; Wesselink, J.J.; Lusa-Bernal, S.; Bijlsma, E.K.; Braunholz, D.; Bueno-Martinez, I.; Clark, D.; Cooper, N.S.; Curry, C.J.; Fisher, R.; Fryer, A.; Ganesh, J.; Gervasini, C.; Gillessen-Kaesbach, G.; Guo, Y.; Hakonarson, H.; Hopkin, R.J.; Kaur, M.; Keating, B.J.; Kibaek, M.; Kinning, E.; Kleefstra, T.; Kline, A.D.; Kuchinskaya, E.; Larizza, L.; Li, Y.R.; Liu, X.; Mariani, M.; Picker, J.D.; Pie, A.; Pozojevic, J.; Queralt, E.; Richer, J.; Roeder, E.; Sinha, A.; Scott, R.H.; So, J.; Wusik, K.A.; Wilson, L.; Zhang, J.; Gomez-Puertas, P.; Casale, C.H.; Strom, L.; Selicorni, A.; Ramos, F.J.; Jackson, L.G.; Krantz, I.D.; Das, S.; Hennekam, R.C.; Kaiser, F.J.; FitzPatrick, D.R.; Pie, J.

2015-01-01

Cornelia de Lange syndrome (CdLS) is characterized by facial dysmorphism, growth failure, intellectual disability, limb malformations, and multiple organ involvement. Mutations in five genes, encoding subunits of the cohesin complex (SMC1A, SMC3, RAD21) and its regulators (NIPBL, HDAC8), account for

SAGE-SMC: Surveying the Agents of Galaxy Evolution in the Tidally-Disrupted, Low-Metallicity Small Magellanic Cloud

Science.gov (United States)

Gordon, Karl; Babler, Brian; Bernard, Jean-Philippe; Block, Miwa; Blum, Robert; Bolatto, Alberto; Bot, Caroline; Bracker, Steve; Carlson, Lynn; Churchwell, Ed; Clayton, Geoffrey; Cohen, Martin; Engelbracht, Charles; Fukui, Yasuo; Gorjian, Varoujan; Harris, Jason; Hony, Sacha; Hora, Joseph; Indebetouw, Remy; Israel, Frank; Kawamura, Akiko; Leroy, Adam; Li, Aigen; Madden, Suzanne; Markwick-Kemper, Ciska; Meade, Marilyn; Meixner, Margaret; Misselt, Karl; Mizuno, Norikazu; Mizuno, Akira; Muller, Erik; Oliveira, Joana; Olsen, Knut; Onishi, Toshikazu; Paladini, Roberta; Points, Sean; Reach, William; Robitaille, Thomas; Rubin, Douglas; Sandstrom, Karin; Sato, Shuji; Sewilo, Marta; Shibai, Hiroshi; Simon, Josh; Smith, Linda; Srinivasan, Sundar; Tielens, Xander; van Dyk, Schuyler; van Loon, Jacco; Vijh, Uma; Volk, Kevin; Whitney, Barbara; Zaritsky, Dennis

2007-05-01

The observable properties of galaxy evolution are largely driven by the life-cycle of baryonic matter: stars precipitate out of a complex, multi-phase interstellar medium; and eventually, evolved stellar populations return enriched material back to the ISM via stellar winds or supernova explosions. As demonstrated by the SAGE-LMC survey, comprehensive Spitzer imaging of a nearby galaxy provides an incredibly rich view of this baryonic lifecycle, allowing for an unprecedented understanding of the physical processes which drive galaxy evolution. This proposal will extend the SAGE analysis to the whole SMC (Bar, Wing, and high-density portion of the Magellanic Bridge), a galaxy whose properties are uniquely similar to those of star-forming galaxies at high redshift. Specifically, the SMC's metallicity is below the critical threshold (1/3-1/4 Z_sun) where interstellar medium properties are observed to change dramatically (sharp reduction in the PAH dust mass fraction, reduced dust-to-gas ratio, and extreme ultraviolet extinction curve variations). In addition, the SMC has been profoundly influenced by past interactions with the LMC and Milky Way, allowing us to study the impact of periodic interactions on the structure of the ISM and the physical processes of star formation. We will gain crucial insight into the ISM and star formation in a known tidal debris structure (Bridge portion of SMC), which has a metallicity 4 times lower than the rest of the SMC. When combined with observations of the Milky Way (GLIMPSE, MIPSGAL) and the LMC (SAGE-LMC), our survey of the SMC (SAGE-SMC) will provide a complete and detailed picture of the life-cycle of baryons in galactic environments spanning orders of magnitude in metallicity, and wide ranges in star formation history. This understanding will equip us to properly interpret the infrared properties of more distant galaxies, both in the local (e.g., SINGS) and high-redshift (e.g., GOODS and SWIRE) universe.

VizieR Online Data Catalog: IR-bright MSX sources in the SMC with Spitzer/IRS (Kraemer+, 2017)

Science.gov (United States)

Kraemer, K. E.; Sloan, G. C.; Wood, P. R.; Jones, O. C.; Egan, M. P.

2017-07-01

Our original set of infrared spectra of MSX SMC sources was obtained in Spitzer Cycle 1 (Program ID 3277, P.I. M. Egan). This program included 35 targets from the MSX SMC catalog. 24 targets were discussed in previous papers; this paper examines the remaining 11 sources in the sample. We also selected 4 objects in the MSX SMC catalog with similar photometric characteristics in an effort to uncover additional sources with crystalline dust. We observed these targets in Spitzer Cycle 3 (Program ID 30355, P.I. J. Houck). See tables 1 and 2 for observation data and basic properties of the targets. Table 3 lists 20 additional MSX SMC sources that were observed by other Spitzer IRS programs. Overall, 59 MSX SMC sources were observed with the IRS. The spectra were observed using the low-resolution modules of the IRS, Short-Low (SL) and Long-Low (LL), which provided spectra in the 5-14 and 14-37um ranges, respectively, at a resolution between ~60 and 120. For 10 evolved stars with oxygen-rich dust in our Cycle 1 program, we obtained spectra from 0.45 to 1.03um with the Double-Beam Spectrograph at the 2.3m telescope of the Australian National University at Siding Spring Observatory. A 0.45-0.89um spectrum for one of the stars in program 30355 was also observed. These spectra have a resolution of 10Å. Tables 5-7: catalog based on the 243 sources detected in the MSX survey of the SMC, updated with positions and photometry from more recent space-based missions and ground-based surveys. See the Appendix section for more details. The SMC catalog from MSX consists of the 243 sources in the main MSX catalog (Egan+ 2003, see V/114) that lie within the region 7°

Characterization of the cGMP-dependent protein kinase SmcGK1 of Schistosoma mansoni

Directory of Open Access Journals (Sweden)

Silke Leutner

2011-06-01

Full Text Available Schistosomes are trematode parasites and of worldwide medical importance for humans and animals. Growth and development of these parasites require a specific host environment, but also permanent communication processes between the two genders. Accumulating molecular evidence indicates that the responsible interactions are mediated by signal transduction processes. Conserved signaling molecules were identified, and first approaches made for their characterization. However, no representative of the conserved family of cGMP-dependent protein kinases (cGKs has been described in this parasite yet. Within the Schistosoma mansoni genome data-set we identified cGK homologs, of which one was investigated in more detail in this study. We present the cloning of SmcGK1, whose sequence shows homology to cGKs of higher eukaryotes. SmcGK1 was found to be gender-independently transcribed in adult schistosomes. The occurrence of SmcGK1 sense and antisense transcripts suggests that the expression of this gene is controlled at the post-transcriptional level. In situ hybridization experiments demonstrated a gonad-preferential expression profile in both genders indicating a role of SmcGK1, at least during sexual development of schistosomes. Using a cGK-specific inhibitor to treat adult schistosomes in vitro finally resulted in a multifaceted phenotype including slow motion, oocyte congestion, and reduced egg production.Esquistossomos são parasitas trematodos de importância médica em todo o mundo para o homem e os animais. O crescimento e o desenvolvimento destes parasitas requerem um ambiente específico do hospedeiro, mas também um processo de comunicação permanente entre parasitas dos dois sexos. Evidência molecular tem se acumulado e indica que as interações são mediadas por processos de transdução de sinal. Moléculas sinalizadoras conservadas foram identificadas, e as primeiras abordagens têm sido feitas para sua caracterização. Contudo, não foi

[Tissue repositories for research at Sheba Medical Center(SMC].

Science.gov (United States)

Cohen, Yehudit; Barshack, Iris; Onn, Amir

2013-06-01

Cancer is the number one cause of death in both genders. Breakthroughs in the understanding of cancer biology, the identification of prognostic factors, and the development of new treatments are increasingly dependent on access to human cancer tissues with linked clinicopathological data. Access to human tumor samples and a large investment in translational research are needed to advance this research. The SMC tissue repositories provide researchers with biological materials, which are essential tools for cancer research. SMC tissue repositories for research aim to collect, document and preserve human biospecimens from patients with cancerous diseases. This is in order to provide the highest quality and well annotated biological biospecimens, used as essential tools to achieve the growing demands of scientific research needs. Such repositories are partners in acceLerating biomedical research and medical product development through clinical resources, in order to apply best options to the patients. Following Institutional Review Board approval and signing an Informed Consent Form, the tumor and tumor-free specimens are coLLected by a designated pathologist at the operating room only when there is a sufficient amount of the tumor, in excess of the routine needs. Blood samples are collected prior to the procedure. Other types of specimens collected include ascites fluid, pleural effusion, tissues for Optimal Cutting Temperature [OCT] and primary culture etc. Demographic, clinical, pathologicaL, and follow-up data are collected in a designated database. SMC has already established several organ or disease-specific tissue repositories within different departments. The foundation of tissue repositories requires the concentrated effort of a multidisciplinary team composed of paramedical, medical and scientific professionals. Research projects using these specimens facilitate the development of 'targeted therapy', accelerate basic research aimed at clarifying molecular

Further RIOTS4 Characterization of Field OB Stars in the SMC

Science.gov (United States)

Oey, M. S.; Barnes, Jesse R.; Paggeot, Kevin J.; Dorigo Jones, John; Castro, Norberto; Simon-Diaz, Sergio; Kratter, Kaitlin M.; Moe, Maxwell; Szymanski, Michal

2018-06-01

We present recent results from the Runaways and O-Type Star Spectroscopic Survey of the SMC (RIOTS4), a survey quantifying properties of the field OB stars in the Small Magellanic Cloud (SMC). Based on PSF-fitting photometry and astrometry of OGLE-III I-band images, we quantify the degree of isolation for the target OB stars, classifying them as "tip-of-the-iceberg" stars accompanied by small, sparse, clusters; or as true, isolated field stars. Many of these field stars must be runaways, which we evaluate using GAIA DR2 proper motions. We measure v sin i using the IACOB code Fourier analysis, finding that the bimodal distribution of projected rotation velocities is less pronounced for O stars than early B stars. We examine rotation in relation to relative isolation and runaway status.

The SMC-5/6 Complex and the HIM-6 (BLM Helicase Synergistically Promote Meiotic Recombination Intermediate Processing and Chromosome Maturation during Caenorhabditis elegans Meiosis.

Directory of Open Access Journals (Sweden)

Ye Hong

2016-03-01

Full Text Available Meiotic recombination is essential for the repair of programmed double strand breaks (DSBs to generate crossovers (COs during meiosis. The efficient processing of meiotic recombination intermediates not only needs various resolvases but also requires proper meiotic chromosome structure. The Smc5/6 complex belongs to the structural maintenance of chromosome (SMC family and is closely related to cohesin and condensin. Although the Smc5/6 complex has been implicated in the processing of recombination intermediates during meiosis, it is not known how Smc5/6 controls meiotic DSB repair. Here, using Caenorhabditis elegans we show that the SMC-5/6 complex acts synergistically with HIM-6, an ortholog of the human Bloom syndrome helicase (BLM during meiotic recombination. The concerted action of the SMC-5/6 complex and HIM-6 is important for processing recombination intermediates, CO regulation and bivalent maturation. Careful examination of meiotic chromosomal morphology reveals an accumulation of inter-chromosomal bridges in smc-5; him-6 double mutants, leading to compromised chromosome segregation during meiotic cell divisions. Interestingly, we found that the lethality of smc-5; him-6 can be rescued by loss of the conserved BRCA1 ortholog BRC-1. Furthermore, the combined deletion of smc-5 and him-6 leads to an irregular distribution of condensin and to chromosome decondensation defects reminiscent of condensin depletion. Lethality conferred by condensin depletion can also be rescued by BRC-1 depletion. Our results suggest that SMC-5/6 and HIM-6 can synergistically regulate recombination intermediate metabolism and suppress ectopic recombination by controlling chromosome architecture during meiosis.

The SMC-5/6 Complex and the HIM-6 (BLM) Helicase Synergistically Promote Meiotic Recombination Intermediate Processing and Chromosome Maturation during Caenorhabditis elegans Meiosis.

Science.gov (United States)

Hong, Ye; Sonneville, Remi; Agostinho, Ana; Meier, Bettina; Wang, Bin; Blow, J Julian; Gartner, Anton

2016-03-01

Meiotic recombination is essential for the repair of programmed double strand breaks (DSBs) to generate crossovers (COs) during meiosis. The efficient processing of meiotic recombination intermediates not only needs various resolvases but also requires proper meiotic chromosome structure. The Smc5/6 complex belongs to the structural maintenance of chromosome (SMC) family and is closely related to cohesin and condensin. Although the Smc5/6 complex has been implicated in the processing of recombination intermediates during meiosis, it is not known how Smc5/6 controls meiotic DSB repair. Here, using Caenorhabditis elegans we show that the SMC-5/6 complex acts synergistically with HIM-6, an ortholog of the human Bloom syndrome helicase (BLM) during meiotic recombination. The concerted action of the SMC-5/6 complex and HIM-6 is important for processing recombination intermediates, CO regulation and bivalent maturation. Careful examination of meiotic chromosomal morphology reveals an accumulation of inter-chromosomal bridges in smc-5; him-6 double mutants, leading to compromised chromosome segregation during meiotic cell divisions. Interestingly, we found that the lethality of smc-5; him-6 can be rescued by loss of the conserved BRCA1 ortholog BRC-1. Furthermore, the combined deletion of smc-5 and him-6 leads to an irregular distribution of condensin and to chromosome decondensation defects reminiscent of condensin depletion. Lethality conferred by condensin depletion can also be rescued by BRC-1 depletion. Our results suggest that SMC-5/6 and HIM-6 can synergistically regulate recombination intermediate metabolism and suppress ectopic recombination by controlling chromosome architecture during meiosis.

Chemorheology of in-mold coating for compression molded SMC applications

Science.gov (United States)

Ko, Seunghyun; Straus, Elliott J.; Castro, Jose M.

2015-05-01

In-mold coating (IMC) is applied to compression molded sheet molding compound (SMC) exterior automotive or truck body panels as an environmentally friendly alternative to make the surface conductive for subsequent electrostatic painting operations. The coating is a thermosetting liquid that when injected onto the surface of the part cures and bonds to provide a smooth conductive surface. In order to optimize the IMC process, it is essential to predict the time available for flow, that is the time before the thermosetting reaction starts (inhibition time) as well as the time when the coating has enough structural integrity so that the mold can be opened without damaging the part surface (cure time). To predict both the inhibition time and the cure time, it is critical to study the chemorheology of IMC. In this paper, we study the chemorheology for a typical commercial IMC system, and show its relevance to both the flow and cure time for the IMC stage during SMC compression molding.

How to Prepare SMC and BMC-like Compounds to Perform Relevant Rheological Experiments?

Science.gov (United States)

Guiraud, Olivier; Dumont, Pierre J. J.; Orgéas, Laurent

2013-04-01

The study of the rheology of injected or compression moulded compounds like SMC or BMC is made particularly difficult by the high content and the intricate arrangement of their fibrous reinforcement. For these two types of compounds, inappropriate rheological testing protocols and rheometers are often used, which leads to a very large scatter of the experimental data. This study describes specific sampling and specimen's preparation methods, as well as dedicated rheometry devices to test their rheology. Following the proposed protocols, it is possible to obtain rheological measurements showing low scatter of the recorded stress values: about ±10% for SMC and about ±15% for BMC-like compounds.

SURVEYING THE AGENTS OF GALAXY EVOLUTION IN THE TIDALLY STRIPPED, LOW METALLICITY SMALL MAGELLANIC CLOUD (SAGE-SMC). II. COOL EVOLVED STARS

International Nuclear Information System (INIS)

Boyer, Martha L.; Meixner, Margaret; Gordon, Karl D.; Shiao, Bernie; Srinivasan, Sundar; Van Loon, Jacco Th.; McDonald, Iain; Kemper, F.; Zaritsky, Dennis; Block, Miwa; Engelbracht, Charles W.; Misselt, Karl; Babler, Brian; Bracker, Steve; Meade, Marilyn; Whitney, Barbara; Hora, Joe; Robitaille, Thomas; Indebetouw, Remy; Sewilo, Marta

2011-01-01

We investigate the infrared (IR) properties of cool, evolved stars in the Small Magellanic Cloud (SMC), including the red giant branch (RGB) stars and the dust-producing red supergiant (RSG) and asymptotic giant branch (AGB) stars using observations from the Spitzer Space Telescope Legacy program entitled 'Surveying the Agents of Galaxy Evolution in the Tidally Stripped, Low Metallicity SMC', or SAGE-SMC. The survey includes, for the first time, full spatial coverage of the SMC bar, wing, and tail regions at IR wavelengths (3.6-160 μm). We identify evolved stars using a combination of near-IR and mid-IR photometry and point out a new feature in the mid-IR color-magnitude diagram that may be due to particularly dusty O-rich AGB stars. We find that the RSG and AGB stars each contribute ∼20% of the global SMC flux (extended + point-source) at 3.6 μm, which emphasizes the importance of both stellar types to the integrated flux of distant metal-poor galaxies. The equivalent SAGE survey of the higher-metallicity Large Magellanic Cloud (SAGE-LMC) allows us to explore the influence of metallicity on dust production. We find that the SMC RSG stars are less likely to produce a large amount of dust (as indicated by the [3.6] - [8] color). There is a higher fraction of carbon-rich stars in the SMC, and these stars appear to reach colors as red as their LMC counterparts, indicating that C-rich dust forms efficiently in both galaxies. A preliminary estimate of the dust production in AGB and RSG stars reveals that the extreme C-rich AGB stars dominate the dust input in both galaxies, and that the O-rich stars may play a larger role in the LMC than in the SMC.

Destabilized SMC5/6 complex leads to chromosome breakage syndrome with severe lung disease

Science.gov (United States)

van der Crabben, Saskia N.; Hennus, Marije P.; McGregor, Grant A.; Ritter, Deborah I.; Nagamani, Sandesh C.S.; Wells, Owen S.; Harakalova, Magdalena; Chinn, Ivan K.; Alt, Aaron; Vondrova, Lucie; Hochstenbach, Ron; van Montfrans, Joris M.; Terheggen-Lagro, Suzanne W.; van Lieshout, Stef; van Roosmalen, Markus J.; Renkens, Ivo; Duran, Karen; Nijman, Isaac J.; Kloosterman, Wigard P.; Hennekam, Eric; van Hasselt, Peter M.; Wheeler, David A.; Palecek, Jan J.; Lehmann, Alan R.; Oliver, Antony W.; Pearl, Laurence H.; Plon, Sharon E.; Murray, Johanne M.

2016-01-01

The structural maintenance of chromosomes (SMC) family of proteins supports mitotic proliferation, meiosis, and DNA repair to control genomic stability. Impairments in chromosome maintenance are linked to rare chromosome breakage disorders. Here, we have identified a chromosome breakage syndrome associated with severe lung disease in early childhood. Four children from two unrelated kindreds died of severe pulmonary disease during infancy following viral pneumonia with evidence of combined T and B cell immunodeficiency. Whole exome sequencing revealed biallelic missense mutations in the NSMCE3 (also known as NDNL2) gene, which encodes a subunit of the SMC5/6 complex that is essential for DNA damage response and chromosome segregation. The NSMCE3 mutations disrupted interactions within the SMC5/6 complex, leading to destabilization of the complex. Patient cells showed chromosome rearrangements, micronuclei, sensitivity to replication stress and DNA damage, and defective homologous recombination. This work associates missense mutations in NSMCE3 with an autosomal recessive chromosome breakage syndrome that leads to defective T and B cell function and acute respiratory distress syndrome in early childhood. PMID:27427983

THE RUNAWAYS AND ISOLATED O-TYPE STAR SPECTROSCOPIC SURVEY OF THE SMC (RIOTS4)

Energy Technology Data Exchange (ETDEWEB)

Lamb, J. B.; Oey, M. S.; Segura-Cox, D. M.; Graus, A. S.; Golden-Marx, J. B. [Astronomy Department, University of Michigan, 1085 S. University Ave., Ann Arbor, MI 48109-1107 (United States); Kiminki, D. C. [Department of Astronomy, University of Arizona, Tucson, AZ 85721 (United States); Parker, J. Wm., E-mail: joellamb@umich.edu [Southwest Research Institute, Department of Space Studies, Suite 300, 1050 Walnut Street, Boulder, CO 80302-5150 (United States)

2016-02-01

We present the Runaways and Isolated O-Type Star Spectroscopic Survey of the SMC (RIOTS4), a spatially complete survey of uniformly selected field OB stars that covers the entire star-forming body of the Small Magellanic Cloud (SMC). Using the IMACS (Inamori-Magellan Areal Camera and Spectrograph) multislit spectrograph and MIKE (Magellan Inamori Kyocera Echelle) echelle spectrograph on the Magellan telescopes, we obtained spectra of 374 early-type field stars that are at least 28 pc from any other OB candidates. We also obtained spectra of an additional 23 field stars in the SMC bar identified from slightly different photometric criteria. Here, we present the observational catalog of stars in the RIOTS4 survey, including spectral classifications and radial velocities. For three multi-slit fields covering 8% of our sample, we carried out monitoring observations over 9–16 epochs to study binarity, finding a spectroscopic, massive binary frequency of at least ∼60% in this subsample. Classical Oe/Be stars represent a large fraction of RIOTS4 (42%), occurring at much higher frequency than in the Galaxy, consistent with expectation at low metallicity. RIOTS4 confirmed a steep upper initial mass function in the field, apparently caused by the inability of the most massive stars to form in the smallest clusters. Our survey also yields evidence for in situ field OB star formation, and properties of field emission-line star populations, including sgB[e] stars and classical Oe/Be stars. We also discuss the radial velocity distribution and its relation to SMC kinematics and runaway stars. RIOTS4 presents a first quantitative characterization of field OB stars in an external galaxy, including the contributions of sparse, but normal, star formation; runaway stars; and candidate isolated star formation.

Operational warnings issued by the SMC in the 8th March snow event in Catalonia

Science.gov (United States)

Vilaclara, E.; Segalà, S.; Andrés, A.; Aran, M.

2010-09-01

The snowfall event of 8th March 2010 was one of the most important of the last years in Catalonia, with high societal impact in the communication and in the power distribution. Since 2002, after an agreement between Meteorological Service of Catalonia (SMC) and Civil Protection authority, the SMC is the agency responsible to carry out meteorological warnings in Catalonia. These warnings are issued depending on the thresholds which are expected to be exceeded (three different probability degrees are defined), and are characterized by a high spatial and temporal resolution. In the snow event of 8th March, forecasting team of the SMC did the first meteorological warning three days before, on 5th March. During the two following days broadcasted four different warnings, taking into account the high probability of exceeding 2 cm of snow above 200 meters, 15 above 400 m and 30 above 800 m. Furthermore, the SMC disseminated also two special press releases with the aim to extend the forecast to the public. In the afternoon of Sunday, 7th March, the snow precipitation started in some areas of Catalonia. From this moment, the SMC followed the surveillance of situation with the remote sensing tools and the Meteorological Observers Network data. This network is formed by a hundred of spotters with mobile phones able to transmit observations in real time to our web site. This surveillance and the conceptual model of snow events in Catalonia allowed the forecasters to improve the estimation of the snow level forecasted by mesoscale meteorological models. In this event, the snow level obtained from these models was higher than the real one. In spite of the accuracy of the forecast, the impact was very important in Catalonia. On one hand, it was due to the exceptionality of the event, with 3 cm of snow in Barcelona in the afternoon of a working day. On the other hand, the large amount of wet snow precipitation (until 100 mm), and the wind, contributed to an important snow

Performance analysis of a new radial-axial flux machine with SMC cores and ferrite magnets

Science.gov (United States)

Liu, Chengcheng; Wang, Youhua; Lei, Gang; Guo, Youguang; Zhu, Jianguo

2017-05-01

Soft magnetic composite (SMC) is a popular material in designing of new 3D flux electrical machines nowadays for it has the merits of isotropic magnetic characteristic, low eddy current loss and high design flexibility over the electric steel. The axial flux machine (AFM) with the extended stator tooth tip both in the radial and circumferential direction is a good example, which has been investigated in the last years. Based on the 3D flux AFM and radial flux machine, this paper proposes a new radial-axial flux machine (RAFM) with SMC cores and ferrite magnets, which has very high torque density though the low cost low magnetic energy ferrite magnet is utilized. Moreover, the cost of RAFM is quite low since the manufacturing cost can be reduced by using the SMC cores and the material cost will be decreased due to the adoption of the ferrite magnets. The 3D finite element method (FEM) is used to calculate the magnetic flux density distribution and electromagnetic parameters. For the core loss calculation, the rotational core loss computation method is used based on the experiment results from previous 3D magnetic tester.

SOLO: a meiotic protein required for centromere cohesion, coorientation, and SMC1 localization in Drosophila melanogaster.

Science.gov (United States)

Yan, Rihui; Thomas, Sharon E; Tsai, Jui-He; Yamada, Yukihiro; McKee, Bruce D

2010-02-08

Sister chromatid cohesion is essential to maintain stable connections between homologues and sister chromatids during meiosis and to establish correct centromere orientation patterns on the meiosis I and II spindles. However, the meiotic cohesion apparatus in Drosophila melanogaster remains largely uncharacterized. We describe a novel protein, sisters on the loose (SOLO), which is essential for meiotic cohesion in Drosophila. In solo mutants, sister centromeres separate before prometaphase I, disrupting meiosis I centromere orientation and causing nondisjunction of both homologous and sister chromatids. Centromeric foci of the cohesin protein SMC1 are absent in solo mutants at all meiotic stages. SOLO and SMC1 colocalize to meiotic centromeres from early prophase I until anaphase II in wild-type males, but both proteins disappear prematurely at anaphase I in mutants for mei-S332, which encodes the Drosophila homologue of the cohesin protector protein shugoshin. The solo mutant phenotypes and the localization patterns of SOLO and SMC1 indicate that they function together to maintain sister chromatid cohesion in Drosophila meiosis.

The Short Model Coil (SMC) dipole: an R&D program towards Nb$_{3}$Sn accelerator magnets

CERN Document Server

Bajko, M; Canfer, S; Ellwood, G; Feuvrier, J; Guinchard, M; Karppinen, M; Kokkinos, C; Manil, P; Milanese, A; Oberli, L; Perez, J-C; Regis, F; de Rijk, G

2011-01-01

The Short Model Coil (SMC) assembly has been designed, as test bench for short racetrack coils wound with Nb$_{3}$Sn cable. The mechanical structure comprises an iron yoke surrounded by a 20 mm thick aluminium alloy shell, and includes four loading pads that transmit the required pre-compression from the outer shell into the two coils. The outer shell is pre-tensioned with mechanical keys that are inserted with the help of pressurized bladders and two 30 mm diameter aluminium alloy rods provide the axial loading to the coil ends. The outer shell, the axial rods, and the coils are instrumented with strain gauges, which allow precise monitoring of the loading conditions during the assembly and at cryogenic temperature during the magnet test. Two SMC assemblies have been completed and cold tested in the frame of a European collaboration between CEA (FR), CERN and STFC (UK) and with the technical support from LBNL (US). This paper describes the main features of the SMC assembly, the experience from the dummy asse...

The SMC (Short Model Coil) dipole: An R&D program for Nb$_{3}$Sn accelerator magnets

CERN Document Server

Perez, J C; Bordini, B; Canfer, S; Ellwood, G; Feuvrier, J; Guinchard, M; Karppinen, M; Kokkinos, C; Manil, P; Milanese, A; Oberli, L; Regis, F; de Rijk, G

2012-01-01

The Short Model Coil (SMC) assembly has been designed, as test bench for short racetrack coils wound with Nb$_{3}$Sn cable. The mechanical structure comprises an iron yoke surrounded by a 20 mm thick aluminium alloy shell, and includes four loading pads that transmit the required pre-compression from the outer shell into the two coils. The outer shell is pre-tensioned with mechanical keys that are inserted with the help of pressurized bladders and two 30 mm diameter aluminium alloy rods provide the axial loading to the coil ends. The outer shell, the axial rods, and the coils are instrumented with strain gauges, which allow precise monitoring of the loading conditions during the assembly and at cryogenic temperature during the magnet test. Two SMC assemblies have been completed and cold tested in the frame of a European collaboration between CEA (FR), CERN and STFC (UK) and with the technical support from LBNL (US). This paper describes the main features of the SMC assembly, the experience from the dummy ass...

Server-Based and Server-Less Byod Solutions to Support Electronic Learning

Science.gov (United States)

2016-06-01

landscape and has empowered employees to conduct work-related business from the comfort of their own phone, tablet, or other personal electronic device...commercial landscape and has empowered employees to conduct work-related business from the comfort of their own phone, tablet, or other personal electronic...3.  Dell Latitude E6500. Source: Hinum (2012). ............................................27  Figure 4.  Linksys WRT 1900 AC. Source: Linksys (2016

Computer control of the SMC polarized target

International Nuclear Information System (INIS)

Le Goff, J.M.; Azoulay, R.; Berglund, P.; Dulya, C.; Gournay, J.F.; Hayashi, N.; Kyynaeraeinen, J.; Magnon, A.; Niinikoski, T.O.; Trentalange, S.

1995-01-01

The SMC polarized target is controlled through VME crates driven by CPUs working under the VxWorks operating system. The CPUs are connected to a SUN workstation which provides the user interface due to a graphical package named SL-GMS. This results in user friendliness, high modularity and flexibility. The system allows the control of: (1) the superconductive solenoid and the transverse dipole: control of the power supplies; automatic reversal of the spin direction by field rotation; acquisition, display and storage of the electric and cryogenic parameters; generation of alarms; and (2) the dilution refrigerator: evaporator level control; acquisition, display and storage of ∼100 cryogenic parameters; and generation of alarms. ((orig.))

The Discovery of an Outburst and Pulsed X-ray Flux from SMC X-2 from RXTE Observations

CERN Document Server

Corbet, R H D; Coe, M J; Laycock, S; Handler, G

2001-01-01

Rossi X-ray Timing Explorer All Sky Monitor observations of SMC X-2 show that the source experienced an outburst in January to April 2000 reaching a peak luminosity of greater than ~10^38 ergs s^-1. RXTE Proportional Counter Array observations during this outburst reveal the presence of pulsations with a 2.37s period. However, optical photometry of the optical counterpart showed the source to be still significantly fainter than it was more than half a year after the outburst in the 1970s when SMC X-2 was discovered.

Examining the infrared variable star population discovered in the Small Magellanic Cloud using the SAGE-SMC survey

International Nuclear Information System (INIS)

Polsdofer, Elizabeth; Marengo, M.; Seale, J.; Sewiło, M.; Vijh, U. P.; Terrazas, M.; Meixner, M.

2015-01-01

We present our study on the infrared variability of point sources in the Small Magellanic Cloud (SMC). We use the data from the Spitzer Space Telescope Legacy Program “Surveying the Agents of Galaxy Evolution in the Tidally Stripped, Low Metallicity Small Magellanic Cloud” (SAGE-SMC) and the “Spitzer Survey of the Small Magellanic Cloud” (S 3 MC) survey, over three different epochs, separated by several months to 3 years. Variability in the thermal infrared is identified using a combination of Spitzer’s InfraRed Array Camera 3.6, 4.5, 5.8, and 8.0 μm bands, and the Multiband Imaging Photometer for Spitzer 24 μm band. An error-weighted flux difference between each pair of three epochs (“variability index”) is used to assess the variability of each source. A visual source inspection is used to validate the photometry and image quality. Out of ∼2 million sources in the SAGE-SMC catalog, 814 meet our variability criteria. We matched the list of variable star candidates to the catalogs of SMC sources classified with other methods, available in the literature. Carbon-rich Asymptotic Giant Branch (AGB) stars make up the majority (61%) of our variable sources, with about a third of all of our sources being classified as extreme AGB stars. We find a small, but significant population of oxygen-rich (O-rich) AGB (8.6%), Red Supergiant (2.8%), and Red Giant Branch (<1%) stars. Other matches to the literature include Cepheid variable stars (8.6%), early type stars (2.8%), Young-stellar objects (5.8%), and background galaxies (1.2%). We found a candidate OH maser star, SSTISAGE1C J005212.88-730852.8, which is a variable O-rich AGB star, and would be the first OH/IR star in the SMC, if confirmed. We measured the infrared variability of a rare RV Tau variable (a post-AGB star) that has recently left the AGB phase. 59 variable stars from our list remain unclassified.

Examining the infrared variable star population discovered in the Small Magellanic Cloud using the SAGE-SMC survey

Energy Technology Data Exchange (ETDEWEB)

Polsdofer, Elizabeth; Marengo, M. [Iowa State University, Department of Physics and Astronomy, 12 Physics Hall, Ames, Iowa 50011 (United States); Seale, J.; Sewiło, M. [The Johns Hopkins University, Department of Physics and Astronomy, 366 Bloomberg Center, 3400 N. Charles Street, Baltimore, MD 21218 (United States); Vijh, U. P.; Terrazas, M. [Ritter Astrophysical Research Center, University of Toledo, Toledo, OH 43606 (United States); Meixner, M., E-mail: empolsdofer@gmail.com [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States)

2015-02-01

We present our study on the infrared variability of point sources in the Small Magellanic Cloud (SMC). We use the data from the Spitzer Space Telescope Legacy Program “Surveying the Agents of Galaxy Evolution in the Tidally Stripped, Low Metallicity Small Magellanic Cloud” (SAGE-SMC) and the “Spitzer Survey of the Small Magellanic Cloud” (S{sup 3}MC) survey, over three different epochs, separated by several months to 3 years. Variability in the thermal infrared is identified using a combination of Spitzer’s InfraRed Array Camera 3.6, 4.5, 5.8, and 8.0 μm bands, and the Multiband Imaging Photometer for Spitzer 24 μm band. An error-weighted flux difference between each pair of three epochs (“variability index”) is used to assess the variability of each source. A visual source inspection is used to validate the photometry and image quality. Out of ∼2 million sources in the SAGE-SMC catalog, 814 meet our variability criteria. We matched the list of variable star candidates to the catalogs of SMC sources classified with other methods, available in the literature. Carbon-rich Asymptotic Giant Branch (AGB) stars make up the majority (61%) of our variable sources, with about a third of all of our sources being classified as extreme AGB stars. We find a small, but significant population of oxygen-rich (O-rich) AGB (8.6%), Red Supergiant (2.8%), and Red Giant Branch (<1%) stars. Other matches to the literature include Cepheid variable stars (8.6%), early type stars (2.8%), Young-stellar objects (5.8%), and background galaxies (1.2%). We found a candidate OH maser star, SSTISAGE1C J005212.88-730852.8, which is a variable O-rich AGB star, and would be the first OH/IR star in the SMC, if confirmed. We measured the infrared variability of a rare RV Tau variable (a post-AGB star) that has recently left the AGB phase. 59 variable stars from our list remain unclassified.

Heterozygous truncation mutations of the SMC1A gene cause a severe early onset epilepsy with cluster seizures in females: Detailed phenotyping of 10 new cases.

Science.gov (United States)

Symonds, Joseph D; Joss, Shelagh; Metcalfe, Kay A; Somarathi, Suresh; Cruden, Jamie; Devlin, Anita M; Donaldson, Alan; DiDonato, Nataliya; Fitzpatrick, David; Kaiser, Frank J; Lampe, Anne K; Lees, Melissa M; McLellan, Ailsa; Montgomery, Tara; Mundada, Vivek; Nairn, Lesley; Sarkar, Ajoy; Schallner, Jens; Pozojevic, Jelena; Parenti, Ilaria; Tan, Jeen; Turnpenny, Peter; Whitehouse, William P; Zuberi, Sameer M

2017-04-01

The phenotype of seizure clustering with febrile illnesses in infancy/early childhood is well recognized. To date the only genetic epilepsy consistently associated with this phenotype is PCDH19, an X-linked disorder restricted to females, and males with mosaicism. The SMC1A gene, which encodes a structural component of the cohesin complex is also located on the X chromosome. Missense variants and small in-frame deletions of SMC1A cause approximately 5% of Cornelia de Lange Syndrome (CdLS). Recently, protein truncating mutations in SMC1A have been reported in five females, all of whom have been affected by a drug-resistant epilepsy, and severe developmental impairment. Our objective was to further delineate the phenotype of SMC1A truncation. Female cases with de novo truncation mutations in SMC1A were identified from the Deciphering Developmental Disorders (DDD) study (n = 8), from postmortem testing of an affected twin (n = 1), and from clinical testing with an epilepsy gene panel (n = 1). Detailed information on the phenotype in each case was obtained. Ten cases with heterozygous de novo mutations in the SMC1A gene are presented. All 10 mutations identified are predicted to result in premature truncation of the SMC1A protein. All cases are female, and none had a clinical diagnosis of CdLS. They presented with onset of epileptic seizures between <4 weeks and 28 months of age. In the majority of cases, a marked preponderance for seizures to occur in clusters was noted. Seizure clusters were associated with developmental regression. Moderate or severe developmental impairment was apparent in all cases. Truncation mutations in SMC1A cause a severe epilepsy phenotype with cluster seizures in females. These mutations are likely to be nonviable in males. Wiley Periodicals, Inc. © 2017 International League Against Epilepsy.

SURVEYING THE AGENTS OF GALAXY EVOLUTION IN THE TIDALLY STRIPPED, LOW METALLICITY SMALL MAGELLANIC CLOUD (SAGE-SMC). I. OVERVIEW

International Nuclear Information System (INIS)

Gordon, K. D.; Meixner, M.; Boyer, M. L.; Lawton, B.; Meade, M. R.; Whitney, B.; Babler, B.; Bracker, S.; Engelbracht, C.; Block, M.; Misselt, K.; Bot, C.; Sewilo, M.; Bernard, J.-P.; Blum, R.; Harris, J.; Bolatto, A.; Bonanos, A.; Hora, J. L.; Indebetouw, R.

2011-01-01

The Small Magellanic Cloud (SMC) provides a unique laboratory for the study of the lifecycle of dust given its low metallicity (∼1/5 solar) and relative proximity (∼60 kpc). This motivated the SAGE-SMC (Surveying the Agents of Galaxy Evolution in the Tidally Stripped, Low Metallicity Small Magellanic Cloud) Spitzer Legacy program with the specific goals of studying the amount and type of dust in the present interstellar medium, the sources of dust in the winds of evolved stars, and how much dust is consumed in star formation. This program mapped the full SMC (30 deg 2 ) including the body, wing, and tail in seven bands from 3.6 to 160 μm using IRAC and MIPS on the Spitzer Space Telescope. The data were reduced and mosaicked, and the point sources were measured using customized routines specific for large surveys. We have made the resulting mosaics and point-source catalogs available to the community. The infrared colors of the SMC are compared to those of other nearby galaxies and the 8 μm/24 μm ratio is somewhat lower than the average and the 70 μm/160 μm ratio is somewhat higher than the average. The global infrared spectral energy distribution (SED) shows that the SMC has approximately 1/3 the aromatic emission/polycyclic aromatic hydrocarbon abundance of most nearby galaxies. Infrared color-magnitude diagrams are given illustrating the distribution of different asymptotic giant branch stars and the locations of young stellar objects. Finally, the average SED of H II/star formation regions is compared to the equivalent Large Magellanic Cloud average H II/star formation region SED. These preliminary results will be expanded in detail in subsequent papers.

Destabilized SMC5/6 complex leads to chromosome breakage syndrome with severe lung disease

NARCIS (Netherlands)

van der Crabben, Saskia N; Hennus, Marije P; McGregor, Grant A; Ritter, Deborah I; Nagamani, Sandesh C S; Wells, Owen S; Harakalova, Magdalena; Chinn, Ivan K; Alt, Aaron; Vondrova, Lucie; Hochstenbach, Ron; van Montfrans, Joris M; Terheggen-Lagro, Suzanne W; van Lieshout, Stef; van Roosmalen, Markus J; Renkens, Ivo; Duran, Karen; Nijman, Isaäc J.; Kloosterman, Wigard P; Hennekam, Eric; Orange, Jordan S; van Hasselt, Peter M; Wheeler, David A; Palecek, Jan J; Lehmann, Alan R; Oliver, Antony W; Pearl, Laurence H; Plon, Sharon E; Murray, Johanne M; van Haaften, Gijs

The structural maintenance of chromosomes (SMC) family of proteins supports mitotic proliferation, meiosis, and DNA repair to control genomic stability. Impairments in chromosome maintenance are linked to rare chromosome breakage disorders. Here, we have identified a chromosome breakage syndrome

Structural mapping of the coiled-coil domain of a bacterial condensin and comparative analyses across all domains of life suggest conserved features of SMC proteins.

Science.gov (United States)

Waldman, Vincent M; Stanage, Tyler H; Mims, Alexandra; Norden, Ian S; Oakley, Martha G

2015-06-01

The structural maintenance of chromosomes (SMC) proteins form the cores of multisubunit complexes that are required for the segregation and global organization of chromosomes in all domains of life. These proteins share a common domain structure in which N- and C- terminal regions pack against one another to form a globular ATPase domain. This "head" domain is connected to a central, globular, "hinge" or dimerization domain by a long, antiparallel coiled coil. To date, most efforts for structural characterization of SMC proteins have focused on the globular domains. Recently, however, we developed a method to map interstrand interactions in the 50-nm coiled-coil domain of MukB, the divergent SMC protein found in γ-proteobacteria. Here, we apply that technique to map the structure of the Bacillus subtilis SMC (BsSMC) coiled-coil domain. We find that, in contrast to the relatively complicated coiled-coil domain of MukB, the BsSMC domain is nearly continuous, with only two detectable coiled-coil interruptions. Near the middle of the domain is a break in coiled-coil structure in which there are three more residues on the C-terminal strand than on the N-terminal strand. Close to the head domain, there is a second break with a significantly longer insertion on the same strand. These results provide an experience base that allows an informed interpretation of the output of coiled-coil prediction algorithms for this family of proteins. A comparison of such predictions suggests that these coiled-coil deviations are highly conserved across SMC types in a wide variety of organisms, including humans. © 2015 Wiley Periodicals, Inc.

SMC west halo: a slice of the galaxy that is being tidally stripped?. Star clusters trace age and metallicity gradients

Science.gov (United States)

Dias, B.; Kerber, L.; Barbuy, B.; Bica, E.; Ortolani, S.

2016-06-01

Context. The evolution and structure of the Magellanic Clouds is currently under debate. The classical scenario in which both the Large and Small Magellanic Clouds (LMC, SMC) are orbiting the Milky Way has been challenged by an alternative in which the LMC and SMC are in their first close passage to our Galaxy. The clouds are close enough to us to allow spatially resolved observation of their stars, and detailed studies of stellar populations in the galaxies are expected to be able to constrain the proposed scenarios. In particular, the west halo (WH) of the SMC was recently characterized with radial trends in age and metallicity that indicate tidal disruption. Aims: We intend to increase the sample of star clusters in the west halo of the SMC with homogeneous age, metallicity, and distance derivations to allow a better determination of age and metallicity gradients in this region. Positions are compared with the orbital plane of the SMC from models. Methods: Comparisons of observed and synthetic V(B-V) colour-magnitude diagrams were used to derive age, metallicity, distance, and reddening for star clusters in the SMC west halo. Observations were carried out using the 4.1 m SOAR telescope. Photometric completeness was determined through artificial star tests, and the members were selected by statistical comparison with a control field. Results: We derived an age of 1.23 ± 0.07 Gyr and [Fe/H] = -0.87 ± 0.07 for the reference cluster NGC 152, compatible with literature parameters. Age and metallicity gradients are confirmed in the WH: 2.6 ± 0.6 Gyr/° and -0.19 ± 0.09 dex/°, respectively. The age-metallicity relation for the WH has a low dispersion in metallicity and is compatible with a burst model of chemical enrichment. All WH clusters seem to follow the same stellar distribution predicted by dynamical models, with the exception of AM-3, which should belong to the counter-bridge. Brück 6 is the youngest cluster in our sample. It is only 130 ± 40 Myr old and

The Smc5/6 Complex Restricts HBV when Localized to ND10 without Inducing an Innate Immune Response and Is Counteracted by the HBV X Protein Shortly after Infection

Science.gov (United States)

Daffis, Stephane; Ramakrishnan, Dhivya; Burdette, Dara; Peiser, Leanne; Salas, Eduardo; Ramos, Hilario; Yu, Mei; Cheng, Guofeng; Strubin, Michel; Delaney IV, William E.; Fletcher, Simon P.

2017-01-01

The structural maintenance of chromosome 5/6 complex (Smc5/6) is a restriction factor that represses hepatitis B virus (HBV) transcription. HBV counters this restriction by expressing HBV X protein (HBx), which targets Smc5/6 for degradation. However, the mechanism by which Smc5/6 suppresses HBV transcription and how HBx is initially expressed is not known. In this study we characterized viral kinetics and the host response during HBV infection of primary human hepatocytes (PHH) to address these unresolved questions. We determined that Smc5/6 localizes with Nuclear Domain 10 (ND10) in PHH. Co-localization has functional implications since depletion of ND10 structural components alters the nuclear distribution of Smc6 and induces HBV gene expression in the absence of HBx. We also found that HBV infection and replication does not induce a prominent global host transcriptional response in PHH, either shortly after infection when Smc5/6 is present, or at later times post-infection when Smc5/6 has been degraded. Notably, HBV and an HBx-negative virus establish high level infection in PHH without inducing expression of interferon-stimulated genes or production of interferons or other cytokines. Our study also revealed that Smc5/6 is degraded in the majority of infected PHH by the time cccDNA transcription could be detected and that HBx RNA is present in cell culture-derived virus preparations as well as HBV patient plasma. Collectively, these data indicate that Smc5/6 is an intrinsic antiviral restriction factor that suppresses HBV transcription when localized to ND10 without inducing a detectable innate immune response. Our data also suggest that HBx protein may be initially expressed by delivery of extracellular HBx RNA into HBV-infected cells. PMID:28095508

UPPAAL-SMC: Statistical Model Checking for Priced Timed Automata

DEFF Research Database (Denmark)

Bulychev, Petr; David, Alexandre; Larsen, Kim Guldstrand

2012-01-01

on a series of extensions of the statistical model checking approach generalized to handle real-time systems and estimate undecidable problems. U PPAAL - SMC comes together with a friendly user interface that allows a user to specify complex problems in an efficient manner as well as to get feedback...... in the form of probability distributions and compare probabilities to analyze performance aspects of systems. The focus of the survey is on the evolution of the tool – including modeling and specification formalisms as well as techniques applied – together with applications of the tool to case studies....

A new search for R Coronae Borealis stars in the SMC

Directory of Open Access Journals (Sweden)

Nikzat Fatemeh

2017-01-01

Full Text Available R Coronae Borealis (RCB stars are rare, and their evolutionary origin is not well understood. Since they are obscured due to formation of carbon dust around the star during their mass loss events, RCB stars can be classified as self-eclipsing variable stars. The purpose of this work is to present a new search for RCB stars in the Small Magellanic Cloud (SMC, by analysing VI data from the OGLE project.

Safety of Seasonal Malaria Chemoprevention (SMC with Sulfadoxine-Pyrimethamine plus Amodiaquine when Delivered to Children under 10 Years of Age by District Health Services in Senegal: Results from a Stepped-Wedge Cluster Randomized Trial.

Directory of Open Access Journals (Sweden)

J L NDiaye

Full Text Available It is recommended that children aged 3 months to five years of age living in areas of seasonal transmission in the sub-Sahel should receive Seasonal Malaria Chemoprevention (SMC with sulfadoxine-pyrimethamine plus amodiaquine (SPAQ during the malaria transmission season. The purpose of this study was to evaluate the safety of SMC with SPAQ in children when delivered by community health workers in three districts in Senegal where SMC was introduced over three years, in children from 3 months of age to five years of age in the first year, then in children up to 10 years of age.A surveillance system was established to record all deaths and all malaria cases diagnosed at health facilities and a pharmacovigilance system was established to detect adverse drug reactions. Health posts were randomized to introduce SMC in a stepped wedge design. SMC with SPAQ was administered once per month from September to November, by nine health-posts in 2008, by 27 in 2009 and by 45 in 2010.After three years, 780,000 documented courses of SMC had been administered. High coverage was achieved. No serious adverse events attributable to the intervention were detected, despite a high level of surveillance.SMC is being implemented in countries of the sub-Sahel for children under 5 years of age, but in some areas the age distribution of cases of malaria may justify extending this age limit, as has been done in Senegal. Our results show that SMC is well tolerated in children under five and in older children. However, pharmacovigilance should be maintained where SMC is implemented and provision for strengthening national pharmacovigilance systems should be included in plans for SMC implementation.ClinicalTrials.gov NCT 00712374.

Degeneracy lifting due to thermal fluctuations around the frustration point between anticlinic antiferroelectric SmC(A)* and synclinic ferroelectric SmC*.

Science.gov (United States)

Sandhya, K L; Chandani, A D L; Fukuda, Atsuo; Vij, Jagdish K; Emelyanenko, A V; Ishikawa, Ken

2013-01-01

In the binary mixture phase diagram of MC881 and MC452, the borderline between anticlinic antiferroelectric SmC(A)(*) and synclinic ferroelectric SmC(*) becomes apparently parallel to the temperature ordinate axis at the critical concentration r(c). The free energy difference between SmC(A)(*) and SmC^{*} is extremely small in a wide temperature range near r(c). In such circumstances, by observing Bragg reflection spectra due to the director helical structure and electric-field-induced birefringence, we have observed the continuous change from SmC(A)(*) to SmC(*) for r/~r(c). These intriguing phenomena have been explained, successfully at least in the high-temperature region, by a thermal equilibrium between the synclinic and anticlinic orderings and the resulting Boltzmann distribution for the ratio between them; the thermal equilibrium is considered to be attained in a nonuniform defect-assisted way through solitary waves moving around dynamically. We have also discussed qualitatively an important role played by the effective long-range interlayer interactions in the low-temperature region.

Surveying the agents of galaxy evolution in the tidally stripped, low metallicity small Magellanic Cloud (SAGE-SMC). III. Young stellar objects

International Nuclear Information System (INIS)

Sewiło, M.; Carlson, L. R.; Seale, J. P.; Meixner, M.; Gordon, K.; Shiao, B.

2013-01-01

The Spitzer Space Telescope Legacy Program SAGE-SMC allows global studies of resolved stellar populations in the SMC in a different environment than our Galaxy. Using the SAGE-SMC IRAC (3.6-8.0 μm) and MIPS (24 and 70 μm) catalogs and images combined with near-infrared (JHK s ) and optical (UBVI) data, we identified a population of ∼1000 intermediate- to high-mass young stellar objects (YSOs) in the SMC (three times more than previously known). Our method of identifying YSO candidates builds on the method developed for the Large Magellanic Cloud by Whitney et al. with improvements based on what we learned from our subsequent studies and techniques described in the literature. We perform (1) color-magnitude cuts based on five color-magnitude diagrams (CMDs), (2) visual inspection of multi-wavelength images, and (3) spectral energy distribution (SED) fitting with YSO models. For each YSO candidate, we use its photometry to calculate a measure of our confidence that the source is not a non-YSO contaminant, but rather a true YSO, based on the source's location in the color-magnitude space with respect to non-YSOs. We use this CMD score and the SED fitting results to define two classes of sources: high-reliability YSO candidates and possible YSO candidates. We found that, due to polycyclic aromatic hydrocarbon emission, about half of our sources have [3.6]-[4.5] and [4.5]-[5.8] colors not predicted by previous YSO models. The YSO candidates are spatially correlated with gas tracers.

Surveying the agents of galaxy evolution in the tidally stripped, low metallicity small Magellanic Cloud (SAGE-SMC). III. Young stellar objects

Energy Technology Data Exchange (ETDEWEB)

Sewiło, M. [The Johns Hopkins University, Department of Physics and Astronomy, 366 Bloomberg Center, 3400 N. Charles Street, Baltimore, MD 21218 (United States); Carlson, L. R. [Sterrewacht Leiden, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands); Seale, J. P.; Meixner, M.; Gordon, K.; Shiao, B., E-mail: mmsewilo@pha.jhu.edu, E-mail: carlson@strw.leidenuniv.nl, E-mail: seale@stsci.edu, E-mail: meixner@stsci.edu, E-mail: kgordon@stsci.edu, E-mail: shiao@stsci.edu [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); and others

2013-11-20

The Spitzer Space Telescope Legacy Program SAGE-SMC allows global studies of resolved stellar populations in the SMC in a different environment than our Galaxy. Using the SAGE-SMC IRAC (3.6-8.0 μm) and MIPS (24 and 70 μm) catalogs and images combined with near-infrared (JHK {sub s}) and optical (UBVI) data, we identified a population of ∼1000 intermediate- to high-mass young stellar objects (YSOs) in the SMC (three times more than previously known). Our method of identifying YSO candidates builds on the method developed for the Large Magellanic Cloud by Whitney et al. with improvements based on what we learned from our subsequent studies and techniques described in the literature. We perform (1) color-magnitude cuts based on five color-magnitude diagrams (CMDs), (2) visual inspection of multi-wavelength images, and (3) spectral energy distribution (SED) fitting with YSO models. For each YSO candidate, we use its photometry to calculate a measure of our confidence that the source is not a non-YSO contaminant, but rather a true YSO, based on the source's location in the color-magnitude space with respect to non-YSOs. We use this CMD score and the SED fitting results to define two classes of sources: high-reliability YSO candidates and possible YSO candidates. We found that, due to polycyclic aromatic hydrocarbon emission, about half of our sources have [3.6]-[4.5] and [4.5]-[5.8] colors not predicted by previous YSO models. The YSO candidates are spatially correlated with gas tracers.

Spectral and temporal properties of the X-ray pulsar SMC X-1 at hard X-rays

Science.gov (United States)

Kunz, M.; Gruber, D. E.; Kendziorra, E .; Kretschmar, P.; Maisack, M.; Mony, B.; Staubert, R.; Doebereiner, S.; Englhauser, J.; Pietsch, W.

1993-01-01

The binary X-ray pulsar SMC X- 1 has been observed at hard X-rays with the High Energy X-Ray Experiment (HEXE) on nine occasions between Nov. 1987 and March 1989. A thin thermal bremsstrahlung fit to the phase averaged spectrum yields a plasma temperature (14.4 +/- 1.3) keV and a luminosity above (1.1 +/- 0.1) x 10 exp 38 erg/s in the 20-80 keV band. Pulse period values have been established for three observations, confirming the remarkably stable spin-up trend of SMC X-1. In one of the three observations the pulse profile was seen to deviate from a dominant double pulsation, while at the same time the pulsed fraction was unusually large. For one observation we determined for the first time the pulsed fraction in narrow energy bands. It increases with photon energy from about 20 percent up to over 60 percent in the energy range from 20 to 80 keV.

The evolution of hydrocarbons past the asymptotic giant branch: the case of MSX SMC 029

Science.gov (United States)

Pauly, Tyler; Sloan, Gregory C.; Kraemer, Kathleen E.; Bernard-Salas, Jeronimo; Lebouteiller, Vianney; Goes, Christopher; Barry, Donald

2015-01-01

We present an optimally extracted high-resolution spectrum of MSX SMC 029 obtained by the Infrared Spectrograph on the Spitzer Space Telescope. MSX SMC 029 is a carbon-rich object in the Small Magellanic Cloud that has evolved past the asymptotic giant branch (AGB). The spectrum reveals a cool carbon-rich dust continuum with emission from polycyclic aromatic hydrocarbons (PAHs) and absorption from simpler hydrocarbons, both aliphatic and aromatic, including acetylene and benzene. The spectrum shows many similarities to the carbon-rich post-AGB objects SMP LMC 011 in the Large Magellanic Cloud and AFGL 618 in the Galaxy. Both of these objects also show infrared absorption features from simple hydrocarbons. All three spectra lack strong atomic emission lines in the infrared, indicating that we are observing the evolution of carbon-rich dust and free hydrocarbons in objects between the AGB and planetary nebulae. These three objects give us a unique view of the elusive phase when hydrocarbons exist both as relatively simple molecules and the much more complex and ubiquitous PAHs. We may be witnessing the assembly of amorphous carbon into PAHs.

VizieR Online Data Catalog: JHK lightcurves of red giants in the SMC (Takayama+, 2015)

Science.gov (United States)

Takayama, M.; Wood, P. R.; Ita, Y.

2017-11-01

This is JHK light curves of 7 oxygen rich stars and 14 carbon stars which show the variability of prominent long secondary periods (LSPs). Those stars are cross-identified with OGLE LSP variables in the Small Magellanic Cloud (Soszynski et al. 2011, J/AcA/61/217). A long-term multiband near-IR photometric survey for variable stars in the Large and Small Magellanic Clouds has been carried out at the South African Astronomical Observatory at Sutherland (Ita et al., in preparation). The SIRIUS camera attached to the IRSF 1.4 m telescope was used for this survey and more than 10 yr of observations in the near-IR bands J(1.25 μm), H(1.63 μm) and KS(2.14 μm) band were obtained. In this work, we select the SMC stars from the SIRIUS data base. We obtained the V- and I-band time series of SMC red giants from the OGLE project (Soszynski et al. 2011, J/AcA/61/217). (2 data files).

The life cycles of Be viscous decretion discs: fundamental disc parameters of 54 SMC Be stars

Science.gov (United States)

Rímulo, L. R.; Carciofi, A. C.; Vieira, R. G.; Rivinius, Th; Faes, D. M.; Figueiredo, A. L.; Bjorkman, J. E.; Georgy, C.; Ghoreyshi, M. R.; Soszyński, I.

2018-05-01

Be stars are main-sequence massive stars with emission features in their spectrum, which originates in circumstellar gaseous discs. Even though the viscous decretion disc model can satisfactorily explain most observations, two important physical ingredients, namely the magnitude of the viscosity (α) and the disc mass injection rate, remain poorly constrained. The light curves of Be stars that undergo events of disc formation and dissipation offer an opportunity to constrain these quantities. A pipeline was developed to model these events that use a grid of synthetic light curves, computed from coupled hydrodynamic and radiative transfer calculations. A sample of 54 Be stars from the OGLE survey of the Small Magellanic Cloud (SMC) was selected for this study. Because of the way our sample was selected (bright stars with clear disc events), it likely represents the densest discs in the SMC. Like their siblings in the Galaxy, the mass of the disc in the SMC increases with the stellar mass. The typical mass and angular momentum loss rates associated with the disc events are of the order of ˜10-10 M⊙ yr-1 and ˜5 × 1036 g cm2 s-2, respectively. The values of α found in this work are typically of a few tenths, consistent with recent results in the literature and with the ones found in dwarf novae, but larger than current theory predicts. Considering the sample as a whole, the viscosity parameter is roughly two times larger at build-up ( = 0.63) than at dissipation ( = 0.26). Further work is necessary to verify whether this trend is real or a result of some of the model assumptions.

The polarized double cell target of the SMC

International Nuclear Information System (INIS)

Adams, D.; Adeva, B.; Arik, E.; Arvidson, A.; Badelek, B.; Ballintijn, M.K.; Bardin, G.; Baum, G.; Berglund, P.; Betev, L.; Bird, I.G.; Birsa, R.; Bjoerkholm, P.; Bonner, B.E.; Botton, N. de; Boutemeur, M.; Bradamante, F.; Bravar, A.; Bressan, A.; Bueltmann, S.; Burtin, E.; Cavata, C.; Crabb, D.; Cranshaw, J.; Cuhadar, T.; Torre, S. Dalla; Dantzig, R. van; Derro, B.; Deshpande, A.; Dhawan, S.; Dulya, C.; Dyring, A.; Eichblatt, S.; Faivre, J.C.; Fasching, D.; Feinstein, F.; Fernandez, C.; Forthmann, S.; Frois, B.; Gallas, A.; Garzon, J.A.; Gaussiran, T.; Gilly, H.; Giorgi, M.; Goeler, E. von; Goertz, S.; Gracia, G.; Groot, N. de; Perdekamp, M. Grosse; Guelmez, E.; Haft, K.; Harrach, D. von; Hasegawa, T.; Hautle, P.; Hayashi, N.; Heusch, C.A.; Horikawa, N.; Hughes, V.W.; Igo, G.; Ishimoto, S.; Iwata, T.; Kabuss, E.M.; Kageya, T.; Karev, A.; Kessler, H.J.; Ketel, T.J.; Kiryluk, J.; Kishi, A.; Kisselev, Yu.; Klostermann, L.; Kraemer, D.; Krivokhijine, V.; Kroeger, W.; Kurek, K.; Kyynaeraeinen, J.; Lamanna, M.; Landgraf, U.; Layda, T.; Le Goff, J.M.; Lehar, F.; Lesquen, A. de; Lichtenstadt, J.; Lindqvist, T.; Litmaath, M.; Lowe, M.; Magnon, A.; Mallot, G.K.; Marie, F.; Martin, A.; Martino, J.; Matsuda, T.; Mayes, B.; McCarthy, J.S.; Medved, K.; Meyer, W.; Middelkoop, G. van; Miller, D.; Miyachi, Y.; Mori, K.; Moromisato, J.; Nassalski, J.; Naumann, L.; Neganov, B.; Niinikoski, T.O.; Oberski, J.E.J.; Ogawa, A.; Ozben, C.; Parks, D.P.; Pereira, H.; Penzo, A.; Perrot-Kunne, F.; Peshekhonov, D.; Piegaia, R.; Pinsky, L.; Platchkov, S.; Plo, M.; Pose, D.; Postma, H.; Pretz, J.; Pussieux, T.; Pyrlik, J.; Raedel, G.; Reyhancan, I.; Reicherz, G.; Rieubland, J.M.; Rijllart, A.; Roberts, J.B.; Rock, S.; Rodriguez, M.; Rondio, E.; Rosado, A.; Roscherr, B.; Sabo, I.; Saborido, J.; Sandacz, A.; Savin, I.; Schiavon, P.; Schiller, A.; Schueler, K.P.; Segel, R.; Seitz, R.; Semertzidis, Y.; Sever, F.; Shanahan, P.; Sichtermann, E.P.; Simeoni, F.; Smirnov, G.I.; Staude, A.; Steinmetz, A.; Stiegler, U.; Stuhrmann, H.; Szleper, M.; Teichert, K.M.; Tessarotto, F.; Thers, D.; Tlaczala, W.; Trentalange, S.; Tripet, A.; Unel, G.; Velasco, M.; Vogt, J.; Voss, R.; Weinstein, R.; Whitten, C.; Windmolders, R.; Willumeit, R.; Wislicki, W.; Witzmann, A.; Zanetti, A.M.; Zaremba, K.; Zhao, J.

1999-01-01

The polarized target of the Spin Muon Collaboration at CERN was used for deep inelastic muon scattering experiments during 1993-1996 with a polarized muon beam to investigate the spin structure of the nucleon. Most of the experiments were carried out with longitudinal target polarization and 190 GeV muons, and some were done with transverse polarization and 100 GeV muons. Protons as well as deuterons were polarized by dynamic nuclear polarization (DNP) in three kinds of solid materials -- butanol, ammonia, and deuterated butanol -- with maximum degrees of polarization of 94%, 91% and 60%, respectively. Considerable attention was paid to the accuracies of the NMR polarization measurements and their analyses, the accuracies achieved were between 2.0% and 3.2%. The SMC target system with two cells of opposite polarizations, each cell 65 cm long and 5 cm in diameter, constitutes the largest polarized target system ever built and facilitates accurate spin asymmetry measurements. The design considerations, construction and performance of the target are reviewed

The polarized double cell target of the SMC

CERN Document Server

Adams, D; Adeva, B; Arik, E; Arvidson, A; Badelek, B; Ballintijn, M K; Bardin, G; Baum, G; Berglund, P; Betev, L; Bird, I G; Birsa, R; Björkholm, P; Bonner, B E; De Botton, N R; Boutemeur, M; Bradamante, Franco; Bravar, A; Bressan, A; Bültmann, S; Burtin, E; Cavata, C; Crabb, D; Cranshaw, J; Çuhadar-Dönszelmann, T; Dalla Torre, S; Van Dantzig, R; Derro, B R; Deshpande, A A; Dhawan, S K; Dulya, C M; Dyring, A; Eichblatt, S; Faivre, Jean-Claude; Fasching, D; Feinstein, F; Fernández, C; Forthmann, S; Frois, Bernard; Gallas, A; Garzón, J A; Gaussiran, T; Gilly, H; Giorgi, M A; von Goeler, E; Görtz, S; Gracia, G; De Groot, N; Grosse-Perdekamp, M; Gülmez, E; Haft, K; Von Harrach, D; Hasegawa, T; Hautle, P; Hayashi, N; Heusch, C A; Horikawa, N; Hughes, V W; Igo, G; Ishimoto, S; Iwata, T; Kabuss, E M; Kageya, T; Karev, A G; Kessler, H J; Ketel, T; Kiryluk, J; Kishi, A; Kiselev, Yu F; Klostermann, L; Krämer, Dietrich; Krivokhizhin, V G; Kröger, W; Kurek, K; Kyynäräinen, J; Lamanna, M; Landgraf, U; Layda, T; Le Goff, J M; Lehár, F; de Lesquen, A; Lichtenstadt, J; Lindqvist, T; Litmaath, M; Loewe, M; Magnon, A; Mallot, G K; Marie, F; Martin, A; Martino, J; Matsuda, T; Mayes, B W; McCarthy, J S; Medved, K S; Meyer, W T; Van Middelkoop, G; Miller, D; Miyachi, Y; Mori, K; Moromisato, J H; Nassalski, J P; Naumann, Lutz; Neganov, B S; Niinikoski, T O; Oberski, J; Ogawa, A; Ozben, C; Parks, D P; Pereira, H; Penzo, Aldo L; Perrot-Kunne, F; Peshekhonov, V D; Piegaia, R; Pinsky, L; Platchkov, S K; Pló, M; Pose, D; Postma, H; Pretz, J; Pussieux, T; Pyrlik, J; Rädel, G; Reyhancan, I; Reicherz, G; Rijllart, A; Roberts, J B; Rock, S E; Rodríguez, M; Rondio, Ewa; Rosado, A; Roscherr, B; Sabo, I; Saborido, J; Sandacz, A; Savin, I A; Schiavon, R P; Schiller, A; Schüler, K P; Segel, R E; Seitz, R; Semertzidis, Y K; Sever, F; Shanahan, P; Sichtermann, E P; Simeoni, F; Smirnov, G I; Staude, A; Steinmetz, A; Stiegler, U; Stuhrmann, H B; Szleper, M; Teichert, K M; Tessarotto, F; Thers, D; Tlaczala, W; Trentalange, S; Tripet, A; Ünel, G; Velasco, M; Vogt, J; Voss, Rüdiger; Weinstein, R; Whitten, C; Windmolders, R; Willumeit, R; Wislicki, W; Witzmann, A; Zanetti, A M; Zaremba, K; Zhao, J

1999-01-01

The polarized target of the Spin Muon Collaboration at CERN was used for deep inelastic muon scattering experiments during 1993 to 1996 with a polarized muon beam to investigate the spin structure of the nucleon. Most of the experiments were carried out with longitudinal target polarization and 190 GeV muons, and some were done with transverse polarization and 100 GeV muons. Protons as well as deuterons were polarized by dynamic nuclear polarization (DNP) in three kinds of solid materials $-$ butanol, ammonia, and deuterated butanol, with maximum degrees of polarization of 94, 91, and 60 \\%, respectively. Considerable attention was paid to the accuracies of the NMR polarization measurements and their analyses. The achieved accuracies were between 2.0 and 3.2 \\%. The SMC target system with two cells of opposite polarizations, each cell 65 cm long and 5 cm in diameter, constitutes the largest polarized target system ever built and facilitates accurate spin asymmetry measurements. The design considerations, the ...

Semi-analog Monte Carlo (SMC) method for time-dependent non-linear three-dimensional heterogeneous radiative transfer problems

International Nuclear Information System (INIS)

Yun, Sung Hwan

2004-02-01

Radiative transfer is a complex phenomenon in which radiation field interacts with material. This thermal radiative transfer phenomenon is composed of two equations which are the balance equation of photons and the material energy balance equation. The two equations involve non-linearity due to the temperature and that makes the radiative transfer equation more difficult to solve. During the last several years, there have been many efforts to solve the non-linear radiative transfer problems by Monte Carlo method. Among them, it is known that Semi-Analog Monte Carlo (SMC) method developed by Ahrens and Larsen is accurate regard-less of the time step size in low temperature region. But their works are limited to one-dimensional, low temperature problems. In this thesis, we suggest some method to remove their limitations in the SMC method and apply to the more realistic problems. An initially cold problem was solved over entire temperature region by using piecewise linear interpolation of the heat capacity, while heat capacity is still fitted as a cubic curve within the lowest temperature region. If we assume the heat capacity to be linear in each temperature region, the non-linearity still remains in the radiative transfer equations. We then introduce the first-order Taylor expansion to linearize the non-linear radiative transfer equations. During the linearization procedure, absorption-reemission phenomena may be described by a conventional reemission time sampling scheme which is similar to the repetitive sampling scheme in particle transport Monte Carlo method. But this scheme causes significant stochastic errors, which necessitates many histories. Thus, we present a new reemission time sampling scheme which reduces stochastic errors by storing the information of absorption times. The results of the comparison of the two schemes show that the new scheme has less stochastic errors. Therefore, the improved SMC method is able to solve more realistic problems with

AN X-RAY AND OPTICAL LIGHT CURVE MODEL OF THE ECLIPSING SYMBIOTIC BINARY SMC3

International Nuclear Information System (INIS)

Kato, Mariko; Hachisu, Izumi; Mikołajewska, Joanna

2013-01-01

Some binary evolution scenarios for Type Ia supernovae (SNe Ia) include long-period binaries that evolve to symbiotic supersoft X-ray sources in their late stage of evolution. However, symbiotic stars with steady hydrogen burning on the white dwarf's (WD) surface are very rare, and the X-ray characteristics are not well known. SMC3 is one such rare example and a key object for understanding the evolution of symbiotic stars to SNe Ia. SMC3 is an eclipsing symbiotic binary, consisting of a massive WD and red giant (RG), with an orbital period of 4.5 years in the Small Magellanic Cloud. The long-term V light curve variations are reproduced as orbital variations in the irradiated RG, whose atmosphere fills its Roche lobe, thus supporting the idea that the RG supplies matter to the WD at rates high enough to maintain steady hydrogen burning on the WD. We also present an eclipse model in which an X-ray-emitting region around the WD is almost totally occulted by the RG swelling over the Roche lobe on the trailing side, although it is always partly obscured by a long spiral tail of neutral hydrogen surrounding the binary in the orbital plane.

First Results from the $Herschel$ and ALMA Spectroscopic Surveys of the SMC: The Relationship Between [CII]-bright Gas and CO-bright Gas at Low Metallicity

OpenAIRE

Jameson, Katherine E.; Bolatto, Alberto D.; Wolfire, Mark; Warren, Steven R.; Herrera-Camus, Rodrigo; Croxall, Kevin; Pellegrini, Eric; Smith, John-David; Rubio, Monica; Indebetouw, Remy; Israel, Frank P.; Meixner, Margaret; Roman-Duval, Julia; van Loon, Jacco Th.; Muller, Erik

2018-01-01

The Small Magellanic Cloud (SMC) provides the only laboratory to study the structure of molecular gas at high resolution and low metallicity. We present results from the Herschel Spectroscopic Survey of the SMC (HS$^{3}$), which mapped the key far-IR cooling lines [CII], [OI], [NII], and [OIII] in five star-forming regions, and new ALMA 7m-array maps of $^{12}$CO and $^{13}$CO $(2-1)$ with coverage overlapping four of the five HS$^{3}$ regions. We detect [CII] and [OI] throughout all of the r...

The Carnegie Hubble Program: The Distance and Structure of the SMC as Revealed by Mid-Infrared Observations of Cepheids

Science.gov (United States)

Scowcroft, Victoria; Freedman, Wendy L.; Madore, Barry F.; Monson, Andy; Persson, S. E.; Rich, Jeff; Seibert, Mark; Rigby, Jane R.

2016-01-01

Using Spitzer observations of classical Cepheids we have measured the true average distance modulus of the Small Magellanic Cloud (SMC) to be18.96 +/- 0.01 stat +/- 0.03sys mag (corresponding to 62+/- 0.3kpc), which is 0.48 +/- 0.01 mag more distant than the LMC. This is in agreement with previous results from Cepheid observations, as well as with measurements from other indicators such as RR Lyrae stars and the tip of the red giant branch. Utilizing the properties of the mid-infrared Leavitt Law we measured precise distances to individual Cepheids in the SMC, and have confirmed that the galaxy is tilted and elongated such that its eastern side is up to20 kpc closer than its western side. This is in agreement with the results from red clump stars and dynamical simulations of the Magellanic Clouds and Stream.

Non-SMC condensin I complex proteins control chromosome segregation and survival of proliferating cells in the zebrafish neural retina

Directory of Open Access Journals (Sweden)

Harris William A

2009-07-01

Full Text Available Abstract Background The condensation of chromosomes and correct sister chromatid segregation during cell division is an essential feature of all proliferative cells. Structural maintenance of chromosomes (SMC and non-SMC proteins form the condensin I complex and regulate chromosome condensation and segregation during mitosis. However, due to the lack of appropriate mutants, the function of the condensin I complex during vertebrate development has not been described. Results Here, we report the positional cloning and detailed characterization of retinal phenotypes of a zebrafish mutation at the cap-g locus. High resolution live imaging reveals that the progression of mitosis between prometa- to telophase is delayed and that sister chromatid segregation is impaired upon loss of CAP-G. CAP-G associates with chromosomes between prometa- and telophase of the cell cycle. Loss of the interaction partners CAP-H and CAP-D2 causes cytoplasmic mislocalization of CAP-G throughout mitosis. DNA content analysis reveals increased genomic imbalances upon loss of non-SMC condensin I subunits. Within the retina, loss of condensin I function causes increased rates of apoptosis among cells within the proliferative ciliary marginal zone (CMZ whereas postmitotic retinal cells are viable. Inhibition of p53-mediated apoptosis partially rescues cell numbers in cap-g mutant retinae and allows normal layering of retinal cell types without alleviating their aberrant nuclear sizes. Conclusion Our findings indicate that the condensin I complex is particularly important within rapidly amplifying progenitor cell populations to ensure faithful chromosome segregation. In contrast, differentiation of postmitotic retinal cells is not impaired upon polyploidization.

The present-day chemical composition of the SMC from UVES spectra of the sharp-lined, B-type dwarf AV 304

NARCIS (Netherlands)

Rolleston, WRJ; Venn, K; Tolstoy, E; Dufton, PL

High-resolution spectroscopic VLT/UVES observations are presented for the B-type main-sequence star, AV 304, in the Small Magellanic Cloud (SMC). These spectra have been analysed using LTE model-atmosphere techniques, to derive stellar atmospheric parameters and chemical compositions. As AV 304 is

SMC 1 or What's in a Name?

Science.gov (United States)

Dickel, H. R.

What's in a name? everything! SMC 1 is a planetary nebula in the Large Magellanic Cloud! This new planetary nebula near the LMC was noted by Savage, Murdin and Clark (in The Observatory 1982); it is also known as SMP LMC 104A (Sanduleak, MacConnell, and Philip in PASP 1978). In an effort to promote clear and unambiguous identification of all astronomical objects outside the solar system, the IAU Task Group on Designations attempts to clarify existing astronomical designations and the TG reviews, updates, and advertises the IAU Recommendations for Nomenclature. The following documents on the Web are provided as a service to astronomers to help them with designating astronomical sources of radiation outside the solar system: How to refer to a source or designate a new one: instructions IAU Recommendations for Nomenclature: nomenclature Second Reference Dictionary of Nomenclature of Celestial Objects: dictionary **NEW** (pre-)Registry of New Acronyms: acronym registry The Task Group in collaboration with several editors of astronomical journals and managers of large data archives is now studying the feasibility of an automated system to detect nonconforming designations when an article and/or survey data are submitted for publication and/or to an electronic archive. H. Dickel is available during the Symposium to discuss your designation concerns and to offer possible solutions.

Design and analysis of a 3D-flux flux-switching permanent magnet machine with SMC cores and ferrite magnets

Directory of Open Access Journals (Sweden)

Chengcheng Liu

2017-05-01

Full Text Available Since permanent magnets (PM are stacked between the adjacent stator teeth and there are no windings or PMs on the rotor, flux-switching permanent magnet machine (FSPMM owns the merits of good flux concentrating and robust rotor structure. Compared with the traditional PM machines, FSPMM can provide higher torque density and better thermal dissipation ability. Combined with the soft magnetic composite (SMC material and ferrite magnets, this paper proposes a new 3D-flux FSPMM (3DFFSPMM. The topology and operation principle are introduced. It can be found that the designed new 3DFFSPMM has many merits over than the traditional FSPMM for it can utilize the advantages of SMC material. Moreover, the PM flux of this new motor can be regulated by using the mechanical method. 3D finite element method (FEM is used to calculate the magnetic field and parameters of the motor, such as flux density, inductance, PM flux linkage and efficiency map. The demagnetization analysis of the ferrite magnet is also addressed to ensure the safety operation of the proposed motor.

Perancangan dan Implementasi Pengaturan Kecepatan Motor Tiga Fasa Pada Mesin Sentrifugal Menggunakan Metode Sliding Mode Control (SMC

Directory of Open Access Journals (Sweden)

Adityo Yudistira

2014-03-01

Full Text Available Motor induksi tiga fasa banyak digunakan di industri, salah satunya pada industri pabrik gula. Di industri pabrik gula motor industri tiga fasa banyak digunakan pada mesin sentrifugal. Mesin ini digunakan pada proses pemisahan cairan massacuite dan strup hingga didapat kristal gula. Pada proses tersebut terjadi perubahan beban oleh karena itu pada siklus kecepatannya mengalami proses Charging, Spinning dan Discharging. Pengaturan kecepatan motor induksi masih dilakukan secara manual yaitu dengan merubah posisi puli atau ukuran poros dari mesin sentrifugal. Pengaturan dengan metode ini mengakibatkan kecepatan motor akan sulit dikendalikan sesuai dengan yang diharapkan. Pengaturan kecepatan yang tidak tepat juga dapat mengakibatkan hasil produksi gula yang kurang maksimal. Oleh karena itu dibutuhkan metode kontrol untuk mengoptimalkan kecepatan setpoint motor saat mengalami proses Charging, Spinning dan Discharging. Metode kontrol yang digunakan adalah metode Sliding Mode Control. Kontroler SMC yang diimplementasikan pada PLC memiliki W= 10 dan α=0,2. Dari hasil analisa sliding surface diketahui bahwa semakin bertambahnya beban maka hitting time semakin lama. Hasil implementasi kontroler SMC yang digunakan terjadi error ± 6,6% pada kecepatan 300 rpm sedangkan pada kecepatan 800 rpm dan 200 rpm terjadi error ± 2,5%. Sehingga Tugas Akhir ini dapat membantu meningkatkan efisiensi mesin sentrifugal pada pabrik gula.

76 FR 68785 - Certain Communications Equipment, Components Thereof, and Products Containing the Same, Including...

Science.gov (United States)

2011-11-07

... complaint names as respondents Cisco Systems, Inc. of San Jose, CA; Cisco Consumer Products LLC of Irvine, CA; Cisco Systems International B.V. of Amsterdam, Netherlands; Cisco-Linksys LLC of Irvine, CA...

Science and Technology (S and T) Roadmap Collaboration between SMC, NASA, and Government Partners

Science.gov (United States)

Betser, Joseph; Ewart, Roberta; Chandler, Faith

2016-01-01

National Security Space (NSS) presents multi-faceted S and T challenges. We must continually innovate enterprise and information management; provide decision support; develop advanced materials; enhance sensor technology; transform communication technology; develop advanced propulsion and resilient space architectures and capabilities; and enhance multiple additional S and T domains. These challenges are best met by leveraging advanced S and T research and technology development from a number of DoD agencies and civil agencies such as NASA. The authors of this paper have engaged in these activities since 2006 and over the past decade developed multiple strategic S and T relationships. This paper highlights the Office of the Space Missile Systems Center (SMC) Chief Scientist (SMC/ST) collaboration with the NASA Office of Chief Technologist (NASA OCT), which has multiple S and T activities that are relevant to NSS. In particular we discuss the development of the Technology Roadmaps that benefit both Civil Space and NSS. Our collaboration with NASA OCT has been of mutual benefit to multiple participants. Some of the other DoD components include the Defense Advanced Research Projects agency (DARPA), Air Force Research Laboratory (AFRL), Naval Research Laboratory (NRL), The USAF Office of Chief Scientist, the USAF Science Advisory Board (SAB), Space and Naval Warfare Systems Command (SPAWAR), and a number of other services and agencies. In addition, the human talent is a key enabler of advanced S and T activities; it is absolutely critical to have a strong supply of talent in the fields of Science Technology, Engineering, and Mathematics (STEM). Consequently, we continually collaborate with the USAF Institute of Technology (AFIT), other service academies and graduate schools, and other universities and colleges. This paper highlights the benefits that result from such strategic S and T partnerships and recommends a way forward that will continually build upon these

Whether the idea of Single Member Company (SMC, is a device to exploit and to avoid the corporate liability by the Capitalist? A critical Analysis of Section 160 of (Pakistan Companies Ordinance, 1984

Directory of Open Access Journals (Sweden)

Rehmat Ali

2015-12-01

Full Text Available The concept of Single Member Company (the “SMC” was introduced in Company law of Pakistan in 2002. However, besides having created anomalies within the existing legislation that have already been analyzed by different academics, there remains potential for abuse of the concept of separate legal entity and/or the doctrine of limited liability at the hand of the single member of the SMC. In this view of matter, this article proposes to review the Section 160 of Companies Ordinance, 1984 to argue that there is no provision in the law in Pakistan to effectively place a mechanism of checks and balances so as to reduce the risk of escaping the corporate liability by the SMC in Pakistan. In the same context, this article also dilates upon the inadequacies of SMC legislation in relation to the concept of social, economic and environmental responsibilities of corporate entities.

Steel skin - SMC laminate structures for lightweight automotive manufacturing

Science.gov (United States)

Quagliato, Luca; Jang, Changsoon; Murugesan, Mohanraj; Kim, Naksoo

2017-09-01

In the present research work an innovative material, made of steel skin and sheet molding compound core, is presented and is aimed to be utilized for the production of automotive body frames. For a precise description of the laminate structure, the material properties of all the components, including the adhesive utilized as an interlayer, have been carried out, along with the simple tension test of the composite material. The result have shown that the proposed laminate structure has a specific yield strength 114% higher than 6061 T6 aluminum, 34% higher than 7075 T6 aluminum, 186% higher than AISI 304 stainless steel (30HRC) and 42% than SK5 high-strength steel (52HRC), showing its reliability and convenience for the realization of automotive components. After calibrating the material properties of the laminate structure, and utilizing as reference the simple tension results of the laminate structure, the derived material properties have been utilized for the simulation of the mechanical behavior of an automotive B-pillar. The results have been compared with those of a standard B-pillar made of steel, showing that the MS-SMC laminate structure manifests load and impact carry capacity comparable with those of high strength steel, while granting, at least, an 11% weight reduction.

Estudio de la aplicación de SPCH como fertilizante y en­mienda orgánica en un suelo vitícola Study of the application of SMC as fertilizer and as organic amendment on a vineyard soil

Directory of Open Access Journals (Sweden)

C. Larrieta

2010-01-01

­room Substrate (SMC are yearly produced at La Rioja. These SMC have been accumu­lated at opencast dumping sites, which are a serious contamination source. Nowadays, in the agriculture, different SMC are widely used to replace the soil organic matter losses, to enhance the exchangeable phos­phorus and potassium, and to improve the soil porosity and its water retention. In this work, the annual application of SMC is evaluated as fertilizer and as or­ganic amendment for vineyard soil. A ex­perimental assay is performed with three blocks and five treatments on a Typic Hap­loxerepts. Two SMC: Recomposted SMC, and “Fresh” SMC (No recomposted SMC were evaluated for three SMC total amounts: 0, 8.000 and 25.000 kg·ha-1 (d.m.. The Organic matter, N (N-org+N-NH4+, pH, electrical conductivity, extractable P, K+, Ca2+, Mg2+, Na+, SO4(2-, Fe, Mn, Cu, Zn, and B, among other elements, were evalu­ated in the soil profile. Nutrient content was not increased after two annual SMC applications on the soil for the most of nutrients. Only the higher amounts of SMC increased the available K+ and extractable sulphate in the upper hori­zon (0-30 cm. CE was also increased, al­though its values don’t represent a risk for the crop. However, considering the SMC amounts applied, it is neccessary the moni­toring of the CE and nutrient content in the soil to evaluate the SMC potential as a fertil­izer; velocity of the nutrient liberation; and the possible loss of nutrients. The SMC be­haviour could be simmilar to the behaviour of a low-liberation fertilizer. Therefore, con­tinuous applications could produce an ex­cessive amount of nitrogen and other nutri­ents in the soil, which will affect the crop yield and must quality. In addition, an ex­cessive liberation could agravate the nutrient lixiviation in vulnerable areas.

77 FR 53234 - Certain Communication Equipment, Components Thereof, and Products Containing the Same, Including...

Science.gov (United States)

2012-08-31

... respondents, including Avaya of Basking Ridge, New Jersey; Cisco Consumer Products LLC of Irvine, California, Cisco Systems International B.V. of the Netherlands, Cisco-Linksys LLC of Irvine, California (collectively, ``Cisco''); Hewlett-Packard Co. (``HP'') of Palo Alto, California; and Extreme Networks, Inc...

SPB stars in the open SMC cluster NGC 371

Science.gov (United States)

Karoff, C.; Arentoft, T.; Glowienka, L.; Coutures, C.; Nielsen, T. B.; Dogan, G.; Grundahl, F.; Kjeldsen, H.

2008-05-01

Pulsation in β Cep and slowly pulsating B (SPB) stars are driven by the κ mechanism which depends critically on the metallicity. It has therefore been suggested that β Cep and SPB stars should be rare in the Magellanic Clouds which have lower metallicities than the solar neighbourhood. To test this prediction we have observed the open Small Magellanic Cloud (SMC) cluster NGC 371 for 12 nights in order to search for β Cep and SPB stars. Surprisingly, we find 29 short-period B-type variables in the upper part of the main sequence, many of which are probably SPB stars. This result indicates that pulsation is still driven by the κ mechanism even in low-metallicity environments. All the identified variables have periods longer than the fundamental radial period which means that they cannot be β Cep stars. Within an amplitude detection limit of 5 mmag no stars in the top of the Hertzsprung-Russell diagram show variability with periods shorter than the fundamental radial period. So if β Cep stars are present in the cluster they oscillate with amplitudes below 5 mmag, which is significantly lower than the mean amplitude of β Cep stars in the Galaxy. We see evidence that multimode pulsation is more common in the upper part of the main sequence than in the lower. We have also identified five eclipsing binaries and three periodic pulsating Be stars in the cluster field.

76 FR 76436 - Certain Communication Equipment, Components Thereof, and Products Containing the Same, Including...

Science.gov (United States)

2011-12-07

... AGENCY: U.S. International Trade Commission. ACTION: Notice. SUMMARY: Notice is hereby given that a...: Cisco Systems, Inc., 170 West Tasman Drive, San Jose, CA 95134. Cisco Consumer Products LLC, 120 Theory... CH, Amsterdam, Netherlands. Cisco-Linksys LLC, 121 Theory Drive, Irvine, CA 92617. Hewlett-Packard Co...

Measurement of the SMC muon beam polarisation using the asymmetry in the elastic scattering off polarised electrons

CERN Document Server

Adams, D; Adeva, B; Akdogan, T; Arik, E; Arvidson, A; Badelek, B; Bardin, G; Baum, G; Berglund, P; Betev, L; Birsa, R; Björkholm, P; Bonner, B E; De Botton, N R; Boutemeur, M; Bradamante, Franco; Bravar, A; Bressan, A; Bültmann, S; Burtin, E; Cavata, C; Clocchiatti, M; Crabb, D; Cranshaw, J; Çuhadar-Dönszelmann, T; Dalla Torre, S; Van Dantzig, R; Derro, B R; Deshpande, A A; Dhawan, S K; Dulya, C M; Dyring, A; Eichblatt, S; Faivre, Jean-Claude; Fasching, D; Feinstein, F; Fernández, C; Forthmann, S; Frois, Bernard; Gallas, A; Garzón, J A; Gatignon, L; Gaussiran, T; Gilly, H; Giorgi, M A; von Goeler, E; Görtz, S; Golutvin, I A; Gracia, G; De Groot, N; Grosse-Perdekamp, M; Haft, K; Von Harrach, D; Hasegawa, T; Hautle, P; Hayashi, N; Heusch, C A; Horikawa, N; Hughes, V W; Igo, G; Ishimoto, S; Iwata, T; Kabuss, E M; Kageya, T; Karev, A G; Kessler, H J; Ketel, T; Kiryluk, J; Kiryushin, Yu T; Kishi, A; Kiselev, Yu F; Klostermann, L; Krämer, Dietrich; Krivokhizhin, V G; Kröger, W; Kukhtin, V V; Kurek, K; Kyynäräinen, J; Lamanna, M; Landgraf, U; Le Goff, J M; Lehár, F; de Lesquen, A; Lichtenstadt, J; Lindqvist, T; Litmaath, M; Loewe, M; Magnon, A; Mallot, G K; Marie, F; Martin, A; Martino, J; Matsuda, T; Mayes, B W; McCarthy, J S; Medved, K S; Meyer, W T; Van Middelkoop, G; Miller, D; Miyachi, Y; Mori, K; Moromisato, J H; Nagaitsev, A P; Nassalski, J P; Naumann, Lutz; Niinikoski, T O; Oberski, J; Ogawa, A; Ozben, C; Pereira, H; Perrot-Kunne, F; Peshekhonov, V D; Piegaia, R; Pinsky, L; Platchkov, S K; Pló, M; Pose, D; Postma, H; Pretz, J; Pussieux, T; Rädel, G; Rijllart, A; Reicherz, G; Roberts, J B; Rock, S E; Rodríguez, M; Rondio, Ewa; Ropelewski, Leszek; Sabo, I; Saborido, J; Sandacz, A; Savin, I A; Schiavon, R P; Schiller, A; Schüler, K P; Seitz, R; Semertzidis, Y K; Sergeev, S; Shanahan, P; Sichtermann, E P; Simeoni, F; Smirnov, G I; Staude, A; Steinmetz, A; Stiegler, U; Stuhrmann, H B; Szleper, M; Tessarotto, F; Thers, D; Tlaczala, W; Tripet, A; Ünel, G; Velasco, M; Vogt, J; Voss, Rüdiger; Whitten, C; Windmolders, R; Willumeit, R; Wislicki, W; Witzmann, A; Ylöstalo, J; Zanetti, A M; Zaremba, K; Zamiatin, N I; Zhao, J

2000-01-01

A muon beam polarimeter was built for the SMC experiment at the CERN SPS, for beam energies of 100 and 190 GeV. The beam polarisation is determined from the asymmetry in the elastic scattering off the polarised electrons of a ferromagnetic target whose magnetisation is periodically reversed. At muon energies of 100 and 190~GeV the measured polarisation is $P_{\\mu}=-0.80 \\pm 0.03 (stat.)\\pm 0.02 (syst.)$ and $P_{\\mu}=-0.797 \\pm 0.011 (stat.)\\pm 0.012 (syst.)$, respectively. These results agree with measurements of the beam polarisation using a shape analysis of the decay positron energy spectrum.

The cohesion protein SOLO associates with SMC1 and is required for synapsis, recombination, homolog bias and cohesion and pairing of centromeres in Drosophila Meiosis.

Science.gov (United States)

Yan, Rihui; McKee, Bruce D

2013-01-01

Cohesion between sister chromatids is mediated by cohesin and is essential for proper meiotic segregation of both sister chromatids and homologs. solo encodes a Drosophila meiosis-specific cohesion protein with no apparent sequence homology to cohesins that is required in male meiosis for centromere cohesion, proper orientation of sister centromeres and centromere enrichment of the cohesin subunit SMC1. In this study, we show that solo is involved in multiple aspects of meiosis in female Drosophila. Null mutations in solo caused the following phenotypes: 1) high frequencies of homolog and sister chromatid nondisjunction (NDJ) and sharply reduced frequencies of homolog exchange; 2) reduced transmission of a ring-X chromosome, an indicator of elevated frequencies of sister chromatid exchange (SCE); 3) premature loss of centromere pairing and cohesion during prophase I, as indicated by elevated foci counts of the centromere protein CID; 4) instability of the lateral elements (LE)s and central regions of synaptonemal complexes (SCs), as indicated by fragmented and spotty staining of the chromosome core/LE component SMC1 and the transverse filament protein C(3)G, respectively, at all stages of pachytene. SOLO and SMC1 are both enriched on centromeres throughout prophase I, co-align along the lateral elements of SCs and reciprocally co-immunoprecipitate from ovarian protein extracts. Our studies demonstrate that SOLO is closely associated with meiotic cohesin and required both for enrichment of cohesin on centromeres and stable assembly of cohesin into chromosome cores. These events underlie and are required for stable cohesion of centromeres, synapsis of homologous chromosomes, and a recombination mechanism that suppresses SCE to preferentially generate homolog crossovers (homolog bias). We propose that SOLO is a subunit of a specialized meiotic cohesin complex that mediates both centromeric and axial arm cohesion and promotes homolog bias as a component of chromosome

Operating system design the Xinu approach, Linksys version

CERN Document Server

Press, CRC

2011-01-01

Introduction and OverviewOperating SystemsApproach Used In The TextA Hierarchical DesignThe Xinu Operating SystemWhat An Operating System Is NotAn Operating System Viewed From The OutsideRemainder Of The TextConcurrent Execution And Operating System ServicesProgramming Models For Multiple ActivitiesOperating System ServicesConcurrent Processing Concepts And TerminologyDistinction Between Sequential And Concurrent ProgramsMultiple Processes Sharing A Single Piece Of CodeProcess Exit And Process TerminationShared Memory, Race Conditions, And SynchronizationSemaphores And Mutual ExclusionType Nam

SUPERORBITAL PHASE-RESOLVED ANALYSIS OF SMC X-1

Energy Technology Data Exchange (ETDEWEB)

Hu, Chin-Ping; Chou, Yi; Yang, Ting-Chang; Su, Yi-Hao, E-mail: m929011@astro.ncu.edu.tw, E-mail: yichou@astro.ncu.edu.tw [Graduate Institute of Astronomy, National Central University, Jhongli 32001, Taiwan (China)

2013-08-10

The high-mass X-ray binary SMC X-1 is an eclipsing binary with an orbital period of 3.89 days. This system exhibits a superorbital modulation with a period varying between {approx}40 days and {approx}65 days. The instantaneous frequency and the corresponding phase of the superorbital modulation can be obtained by a recently developed time-frequency analysis technique, the Hilbert-Huang transform (HHT). We present a phase-resolved analysis of both the spectra and the orbital profiles with the superorbital phase derived from the HHT. The X-ray spectra observed by the Proportional Counter Array on board the Rossi X-ray Timing Explorer are fitted well by a blackbody plus a Comptonized component. The plasma optical depth, which is a good indicator of the distribution of material along the line of sight, is significantly anti-correlated with the flux detected at 2.5-25 keV. However, the relationship between the plasma optical depth and the equivalent width of the iron line is not monotonic. There is no significant correlation for fluxes higher than {approx}35 mCrab but clear positive correlation when the intensity is lower than {approx}20 mCrab. This indicates that the iron line production is dominated by different regions of this binary system in different superorbital phases. To study the dependence of the orbital profile on the superorbital phase, we obtained the eclipse profiles by folding the All Sky Monitor light curve with the orbital period for different superorbital states. A dip feature, similar to the pre-eclipse dip in Her X-1, lying at orbital phase {approx}0.6-0.85, was discovered during the superorbital transition state. This indicates that the accretion disk has a bulge that absorbs considerable X-ray emission in the stream-disk interaction region. The dip width is anti-correlated with the flux, and this relation can be interpreted by the precessing tilted accretion disk scenario.

Remote sensing observing systems of the Meteorological Service of Catalonia (SMC): application to thunderstorm surveillance

Science.gov (United States)

Argemí, O.; Bech, J.; Pineda, N.; Rigo, T.

2009-09-01

Remote sensing observing systems of the Meteorological Service of Catalonia (SMC) have been upgraded during the last years with newer technologies and enhancements. Recent changes on the weather radar network have been motivated to improve precipitation estimates by radar as well as meteorological surveillance in the area of Catalonia. This region has approximately 32,000 square kilometres and is located in the NE of Spain, limited by the Pyrenees to the North (with mountains exceeding 3000 m) and by the Mediterranean Sea to the East and South. In the case of the total lightning (intra-cloud and cloud-to-ground lightning) detection system, the current upgrades will assure a better lightning detection efficiency and location accuracy. Both upgraded systems help to enhance the tracking and the study of thunderstorm events. Initially, the weather radar network was designed to cover the complex topography of Catalonia and surrounding areas to support the regional administration, which includes civil protection and water authorities. The weather radar network was upgraded in 2008 with the addition of a new C-band Doppler radar system, which is located in the top of La Miranda Mountain (Tivissa) in the southern part of Catalonia enhancing the coverage, particularly to the South and South-West. Technically the new radar is very similar to the last one installed in 2003 (Creu del Vent radar), using a 4 m antenna (i.e., 1 degree beam width), a Vaisala-Sigmet RVP-8 digital receiver and processor and a low power transmitter using a Travelling Wave Tube (TWT) amplifier. This design allows using pulse-compression techniques to enhance radial resolution and sensitivity. Currently, the SMC is upgrading its total lightning detection system, operational since 2003. While a fourth sensor (Amposta) was added last year to enlarge the system coverage, all sensors and central processor will be upgraded this year to the new Vaisala’s total lightning location technology. The new LS8000

Bovine exome sequence analysis and targeted SNP genotyping of recessive fertility defects BH1, HH2, and HH3 reveal a putative causative mutation in SMC2 for HH3.

Science.gov (United States)

McClure, Matthew C; Bickhart, Derek; Null, Dan; Vanraden, Paul; Xu, Lingyang; Wiggans, George; Liu, George; Schroeder, Steve; Glasscock, Jarret; Armstrong, Jon; Cole, John B; Van Tassell, Curtis P; Sonstegard, Tad S

2014-01-01

The recent discovery of bovine haplotypes with negative effects on fertility in the Brown Swiss, Holstein, and Jersey breeds has allowed producers to identify carrier animals using commercial single nucleotide polymorphism (SNP) genotyping assays. This study was devised to identify the causative mutations underlying defective bovine embryo development contained within three of these haplotypes (Brown Swiss haplotype 1 and Holstein haplotypes 2 and 3) by combining exome capture with next generation sequencing. Of the 68,476,640 sequence variations (SV) identified, only 1,311 genome-wide SNP were concordant with the haplotype status of 21 sequenced carriers. Validation genotyping of 36 candidate SNP identified only 1 variant that was concordant to Holstein haplotype 3 (HH3), while no variants located within the refined intervals for HH2 or BH1 were concordant. The variant strictly associated with HH3 is a non-synonymous SNP (T/C) within exon 24 of the Structural Maintenance of Chromosomes 2 (SMC2) on Chromosome 8 at position 95,410,507 (UMD3.1). This polymorphism changes amino acid 1135 from phenylalanine to serine and causes a non-neutral, non-tolerated, and evolutionarily unlikely substitution within the NTPase domain of the encoded protein. Because only exome capture sequencing was used, we could not rule out the possibility that the true causative mutation for HH3 might lie in a non-exonic genomic location. Given the essential role of SMC2 in DNA repair, chromosome condensation and segregation during cell division, our findings strongly support the non-synonymous SNP (T/C) in SMC2 as the likely causative mutation. The absence of concordant variations for HH2 or BH1 suggests either the underlying causative mutations lie within a non-exomic region or in exome regions not covered by the capture array.

Bovine exome sequence analysis and targeted SNP genotyping of recessive fertility defects BH1, HH2, and HH3 reveal a putative causative mutation in SMC2 for HH3.

Directory of Open Access Journals (Sweden)

Matthew C McClure

Full Text Available The recent discovery of bovine haplotypes with negative effects on fertility in the Brown Swiss, Holstein, and Jersey breeds has allowed producers to identify carrier animals using commercial single nucleotide polymorphism (SNP genotyping assays. This study was devised to identify the causative mutations underlying defective bovine embryo development contained within three of these haplotypes (Brown Swiss haplotype 1 and Holstein haplotypes 2 and 3 by combining exome capture with next generation sequencing. Of the 68,476,640 sequence variations (SV identified, only 1,311 genome-wide SNP were concordant with the haplotype status of 21 sequenced carriers. Validation genotyping of 36 candidate SNP identified only 1 variant that was concordant to Holstein haplotype 3 (HH3, while no variants located within the refined intervals for HH2 or BH1 were concordant. The variant strictly associated with HH3 is a non-synonymous SNP (T/C within exon 24 of the Structural Maintenance of Chromosomes 2 (SMC2 on Chromosome 8 at position 95,410,507 (UMD3.1. This polymorphism changes amino acid 1135 from phenylalanine to serine and causes a non-neutral, non-tolerated, and evolutionarily unlikely substitution within the NTPase domain of the encoded protein. Because only exome capture sequencing was used, we could not rule out the possibility that the true causative mutation for HH3 might lie in a non-exonic genomic location. Given the essential role of SMC2 in DNA repair, chromosome condensation and segregation during cell division, our findings strongly support the non-synonymous SNP (T/C in SMC2 as the likely causative mutation. The absence of concordant variations for HH2 or BH1 suggests either the underlying causative mutations lie within a non-exomic region or in exome regions not covered by the capture array.

Reduction of inorganics from macroalgae Laminaria digitata and spent mushroom compost (SMC) by acid leaching and selective hydrothermal liquefaction

DEFF Research Database (Denmark)

Toor, Saqib Sohail; Jasiunas, Lukas; Xu, Chunbao (Charles)

2018-01-01

Hydrothermal liquefaction (HTL) is a promising route for producing bio-crude from various biomass feedstocks. However, high content of inorganic constituents in biomass like macroalgae Laminaria digitata and spent mushroom compost (SMC) affect the conversion process and the resulting fuel products....... This research studied the effects of different acid leaching treatments on such feedstocks, subsequent HTL, and bio-crude properties. Leaching treatments were performed using five different agents: deionized water, acetic acid, citric acid, sulfuric acid, and hydrochloric acid. Performance of leaching...... was evaluated by analyzing both leached biomass and HTL products by elemental analysis, ash content, inductively coupled plasma (ICP) analysis, and X-ray diffraction (XRD) analysis. Catalytic and non-catalytic HTL of both feedstocks before and after treatment were performed in a 10-mL microreactor at 400 °C...

A droplet-based building block approach for bladder smooth muscle cell (SMC) proliferation

Energy Technology Data Exchange (ETDEWEB)

Xu, F; Moon, S J; Emre, A E; Turali, E S; Song, Y S; Hacking, S A; Demirci, U [Department of Medicine, Bio-Acoustic-MEMS in Medicine (BAMM) Laboratory, Center for Biomedical Engineering, Brigham and Women' s Hospital, Harvard Medical School, Boston, MA (United States); Nagatomi, J, E-mail: udemirci@rics.bwh.harvard.ed [Department of Bioengineering, Clemson University, Clemson, SC (United States)

2010-03-15

Tissue engineering based on building blocks is an emerging method to fabricate 3D tissue constructs. This method requires depositing and assembling building blocks (cell-laden microgels) at high throughput. The current technologies (e.g., molding and photolithography) to fabricate microgels have throughput challenges and provide limited control over building block properties (e.g., cell density). The cell-encapsulating droplet generation technique has potential to address these challenges. In this study, we monitored individual building blocks for viability, proliferation and cell density. The results showed that (i) SMCs can be encapsulated in collagen droplets with high viability (>94.2 +- 3.2%) for four cases of initial number of cells per building block (i.e. 7 +- 2, 16 +- 2, 26 +- 3 and 37 +- 3 cells/building block). (ii) Encapsulated SMCs can proliferate in building blocks at rates that are consistent (1.49 +- 0.29) across all four cases, compared to that of the controls. (iii) By assembling these building blocks, we created an SMC patch (5 mm x 5 mm x 20 mum), which was cultured for 51 days forming a 3D tissue-like construct. The histology of the cultured patch was compared to that of a native rat bladder. These results indicate the potential of creating 3D tissue models at high throughput in vitro using building blocks.

The fate of NGC602, an intense region of star-formation in the Wing of the SMC

Science.gov (United States)

Sabbi, Elena

2017-08-01

This is a small 2 orbit proposal designed to measure the internal dynamics of NGC602, a small region of intense star formation in the Wing of the SMC, with a low gas and dust density that has been often considered an unfavorable place for star formation. Small regions of massive star formation are important to study for our understanding of the process of star and cluster formation, the ionization of the interstellar medium, and the injection of energy and momentum into their host galaxy. By combining our new observations with archival ACS/WFC data acquired in July 2004, we will be able to measure the relative proper motions of the NGC602 sub-structures better than 2.3 km/s and investigate the nature of the apparently isolated massive stars found around NGC602. This study will provide unique observational data to characterize the early phase of cluster evolution and test cluster formation theories. It will also address significant open issues in star formation, cluster dynamics and the origin of isolated supernovae and GRBs.

Firmware Counterfeiting and Modification Attacks on Programmable Logic Controllers

Science.gov (United States)

2013-03-01

employees to find and use, or the attackers may have breached physical security to deliver the worm [19]. Once introduced to a computer running Microsoft ...physical inputs and outputs. PLCs typically require proprietary software installed on a standard computer (usually running Microsoft Windows) to provide a...Hack in the Box Sec-Conference. Kuala Lumpur, Malaysia . 2010. [23] He↵ner, Craig. “Reverse Engineering Firmware: Linksys WAG120N”. DEV/TTYS0, May 29

Direct Yaw-Moment Control of All-Wheel-Independent-Drive Electric Vehicles with Network-Induced Delays through Parameter-Dependent Fuzzy SMC Approach

Directory of Open Access Journals (Sweden)

Wanke Cao

2017-01-01

Full Text Available This paper investigates the robust direct yaw-moment control (DYC through parameter-dependent fuzzy sliding mode control (SMC approach for all-wheel-independent-drive electric vehicles (AWID-EVs subject to network-induced delays. AWID-EVs have obvious advantages in terms of DYC over the traditional centralized-drive vehicles. However it is one of the most principal issues for AWID-EVs to ensure the robustness of DYC. Furthermore, the network-induced delays would also reduce control performance of DYC and even deteriorate the EV system. To ensure robustness of DYC and deal with network-induced delays, a parameter-dependent fuzzy sliding mode control (FSMC method based on the real-time information of vehicle states and delays is proposed in this paper. The results of cosimulations with Simulink® and CarSim® demonstrate the effectiveness of the proposed controller. Moreover, the results of comparison with a conventional FSMC controller illustrate the strength of explicitly dealing with network-induced delays.

Properties of the fullerene C_6_0-containing PN Lin49 in the SMC; Explanations of strong near-IR excess

International Nuclear Information System (INIS)

Otsuka, Masaaki; Kemper, Francisca; Leal-Ferreira, Marcelo L.; Aleman, Isabel; Ochsendorf, Bram; Bernard-Salas, Jeronimo; Cami, Jan; Peeters, Els

2016-01-01

We performed a detailed spectroscopic analysis of the fullerene C_6o-containing planetary nebula (PN) Lin49 in the Small Magellanic Cloud (SMC). Lin49 is a C-rich and metal- deficient PN (Z∼⃒0.0006) and its nebular abundances are in agreement with the AGB model for the initially 1.25M_☉ stars with the metallicity Z = 0.001 of Fishlock et al. (2014, [1]). By stellar absorption fitting with TLUSTY, we derived stellar abundances, effective temperature, and surface gravity. We constructed the photo-ionization model with CLOUDY in order to investigate physical conditions of Lin49. The model with the 0.005-0.1 μm radius graphite and a constant hydrogen density shell could not fit the ∼⃒1-5 μm SED owing to the strong near-IR excess. We propose that the near-IR excess indicates (1) the presence of extremely small carbon molecules or (2) the presence of high-density structure surrounding the central star. (paper)

The metabolic network of Clostridium acetobutylicum: Comparison of the approximate Bayesian computation via sequential Monte Carlo (ABC-SMC) and profile likelihood estimation (PLE) methods for determinability analysis.

Science.gov (United States)

Thorn, Graeme J; King, John R

2016-01-01

The Gram-positive bacterium Clostridium acetobutylicum is an anaerobic endospore-forming species which produces acetone, butanol and ethanol via the acetone-butanol (AB) fermentation process, leading to biofuels including butanol. In previous work we looked to estimate the parameters in an ordinary differential equation model of the glucose metabolism network using data from pH-controlled continuous culture experiments. Here we combine two approaches, namely the approximate Bayesian computation via an existing sequential Monte Carlo (ABC-SMC) method (to compute credible intervals for the parameters), and the profile likelihood estimation (PLE) (to improve the calculation of confidence intervals for the same parameters), the parameters in both cases being derived from experimental data from forward shift experiments. We also apply the ABC-SMC method to investigate which of the models introduced previously (one non-sporulation and four sporulation models) have the greatest strength of evidence. We find that the joint approximate posterior distribution of the parameters determines the same parameters as previously, including all of the basal and increased enzyme production rates and enzyme reaction activity parameters, as well as the Michaelis-Menten kinetic parameters for glucose ingestion, while other parameters are not as well-determined, particularly those connected with the internal metabolites acetyl-CoA, acetoacetyl-CoA and butyryl-CoA. We also find that the approximate posterior is strongly non-Gaussian, indicating that our previous assumption of elliptical contours of the distribution is not valid, which has the effect of reducing the numbers of pairs of parameters that are (linearly) correlated with each other. Calculations of confidence intervals using the PLE method back this up. Finally, we find that all five of our models are equally likely, given the data available at present. Copyright © 2015 Elsevier Inc. All rights reserved.

77 FR 32168 - Overseas Schools Advisory Council Notice of Meeting

Science.gov (United States)

2012-05-31

... DEPARTMENT OF STATE [Public Notice 7904] Overseas Schools Advisory Council Notice of Meeting The Overseas Schools Advisory Council, Department of State, will hold its Annual Meeting on Thursday, June 21... Schools Advisory Council works closely with the U.S. business community in improving those American...

No clinical utility of KRAS variant rs61764370 for ovarian or breast cancer

DEFF Research Database (Denmark)

Hollestelle, Antoinette; van der Baan, Frederieke H; Berchuck, Andrew

2015-01-01

,357 ovarian cancer patients; 30,816 controls), the Breast Cancer Association Consortium (33,530 breast cancer patients; 37,640 controls), and the Consortium of Modifiers of BRCA1 and BRCA2 (14,765 BRCA1 and 7904 BRCA2 mutation carriers). RESULTS: We found no association with risk of ovarian cancer (OR=0...

78 FR 43093 - Richard C. Theuer; Filing of Food Additive Petition and Citizen Petition

Science.gov (United States)

2013-07-19

... [Docket Nos. FDA-2013-F-0700 and FDA-2013-P-0472] Richard C. Theuer; Filing of Food Additive Petition and... proposing that the food additive regulations be amended to prohibit the use of carrageenan and salts of... that Richard C. Theuer, Ph.D., 7904 Sutterton Ct., Raleigh, NC 27615, has filed a food additive...

Synergy between pathogen release and resource availability in plant invasion

Czech Academy of Sciences Publication Activity Database

Blumenthal, D.; Mitchell, C. E.; Pyšek, Petr; Jarošík, Vojtěch

2009-01-01

Roč. 106, č. 19 (2009), s. 7899-7904 ISSN 0027-8424 R&D Projects: GA MŠk LC06073 Grant - others:Evropská komise(XE) GOCE-CT-2003-506675 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * enemy release * resource availability Subject RIV: EG - Zoology Impact factor: 9.432, year: 2009

Generation and characterization of human smooth muscle cell lines derived from atherosclerotic plaque.

Science.gov (United States)

Bonin, L R; Madden, K; Shera, K; Ihle, J; Matthews, C; Aziz, S; Perez-Reyes, N; McDougall, J K; Conroy, S C

1999-03-01

The study of atherogenesis in humans has been restricted by the limited availability and brief in vitro life span of plaque smooth muscle cells (SMCs). We describe plaque SMC lines with extended life spans generated by the expression of the human papillomavirus (HPV)-16 E6 and E7 genes, which has been shown to extend the life span of normal adult human aortic SMCs. Resulting cell lines (pdSMC1A and 2) demonstrated at least 10-fold increases in life span; pdSMC1A became immortal. The SMC identity of both pdSMC lines was confirmed by SM22 mRNA expression. pdSMC2 were generally diploid but with various structural and numerical alterations; pdSMC1A demonstrated several chromosomal abnormalities, most commonly -Y, +7, -13, anomalies previously reported in both primary pdSMCs and atherosclerotic tissue. Confluent pdSMC2 appeared grossly similar to HPV-16 E6/E7-expressing normal adult aortic SMCs (AASMCs), exhibiting typical SMC morphology/growth patterns; pdSMC1A displayed irregular cell shape/organization with numerous mitotic figures. Dedifferentiation to a synthetic/proliferative phenotype has been hypothesized as a critical step in atherogenesis, because rat neonatal SMCs and adult intimal SMCs exhibit similar gene expression patterns. To confirm that our pdSMC lines likewise express this apparent plaque phenotype, osteopontin, platelet-derived growth factor B, and elastin mRNA levels were determined in pdSMC1A, pdSMC2, and AASMCs. However, no significant increases in osteopontin or platelet-derived growth factor B expression levels were observed in either pdSMC compared with AASMCs. pdSMC2 alone expressed high levels of elastin mRNA. Lower levels of SM22 mRNA in pdSMC1A suggested greater dedifferentiation and/or additional population doublings in pdSMC1A relative to pdSMC2. Both pdSMC lines (particularly 1A) demonstrated high message levels for matrix Gla protein, previously reported to be highly expressed by human neointimal SMCs in vitro. These results describe 2

The comparison respond of braking torque control between PID and SMC controller for electric powered wheelchair descending on slope condition

Science.gov (United States)

Asyraf, S. M.; Heerwan, P. M.; Izhar, I. M.

2018-04-01

During descending on a slope, the speed of Electric Powered Wheelchair (EPW) tends to changed rapidly. Normally, most EPW is provided with mechanical braking system which transfers human pulling force of the lever creating friction at the tire. However, the task is difficult for the users are elderly or paralyses. However, even for normal user with good strength, in fear condition they tend to give sudden braking which leads to tire locking up and skidding, eventually EPW unstable. These problems will cause accident and injuries to the users if speed does not properly control. In this paper, the automated braking torque control method was proposed in EPW as alternative to solve this problem and increase the mobility and stability especially during descending on slope in other to help the user of the EPW as their daily transportation. In this research, Proportional-Integral-Derivative and Sliding Mode Control controller are compared to determine the best response for torque braking control. The rapid change of speed can be controlled by the braking torque using proposed controllers based on the desired constant speed set by the control designer. Moreover, the sudden braking that caused tire to lock up and skid can be avoided. Furthermore, result from SMC shows this controller have good time respond to maintain the speed based on desired value when descending at slope condition by controlling the braking torque compared to the PID controller.

Prolonged hypoxia modulates platelet activating factor receptor-mediated responses by fetal ovine pulmonary vascular smooth muscle cells.

Science.gov (United States)

Renteria, Lissette S; Raj, J Usha; Ibe, Basil O

2010-12-01

Hypoxia augments PAF receptor (PAFr) binding and PAFr protein expression in venous SMC (SMC-PV). We compared effect of acute and prolonged hypoxia (pO(2)<40 torr) on PAFr-mediated responses in arterial SMC (SMC-PA) and SMC-PV. Cells were studied for 30 min (acute) or for 48 h (prolonged) hypoxia and compared to normoxic (pO(2) ~100 torr) conditions. PAF binding was quantified in fmol/10(6) cells (mean ± SEM). PAF binding in normoxia were SMC-PA, 5.2 ± 0.2 and in SMC-PV, 19.3 ± 1.1; values in acute hypoxia were SMC-PA, 7.7 ± 0.4 and in SMC-PV, 27.8 ± 1.7. Prolonged hypoxia produced 6-fold increase in binding in SMC-PA, but only 2-fold increase in SMC-PV, but binding in SMC-PV was still higher. Acute hypoxia augmented inositol phosphate release by 50% and 40% in SMC-PA and SMC-PV, respectively. During normoxia, PAFr mRNA expression by both cell types was similar, but expression in hypoxia by SMC-PA was greater. In SMC-PA, hypoxia and PAF augmented intracellular calcium flux. Re-exposure of cells to 30 min normoxia after 48 h hypoxia decreased binding by 45-60%, suggesting immediate down-regulation of hypoxia-induced PAFr-mediated effects. We speculate that re-oxygenation immediately reverses hypoxia effect probably due to oxygen tension-dependent reversibility of PAFr activation and suggest that exposure of the neonate to prolonged state of hypoxia will vilify oxygen exchange capacity of the neonatal lungs. Copyright © 2010 Elsevier Inc. All rights reserved.

77 FR 7904 - Fall 2011 Semiannual Agenda of Regulations

Science.gov (United States)

2012-02-13

... ``Regulatory Planning and Review,'' and the Regulatory Flexibility Act, as amended, the Department of Commerce...-AS65 for Regulating Offshore Marine Aquaculture in the Gulf of Mexico (Reg Plan Seq No. 22). 206... Management Recommendations by the Atlantic States Marine Fisheries Commission. 207 Collection and Use of Tax...

76 FR 7904 - Submission for OMB Review; Comment Request

Science.gov (United States)

2011-02-11

... will be used by the IRS to determine whether numerical limits set forth in section 220(j)(1) have been... Layer; Special Rules for Certain Medical Uses of Chemicals That Deplete the Ozone Layer. Abstract... tax limit. Respondents: Private sector: Businesses or other for-profits. Estimated Total Burden Hours...

Effects of spent mushroom compost meal on growth performance and meat characteristics of grower geese

Directory of Open Access Journals (Sweden)

Shen-Chang Chang

2016-06-01

Full Text Available ABSTRACT The objective of this study was to determine the effect of spent mushroom compost (SMC meal on the growth performance and meat characteristics of geese. The SMC extracts contained 2.49±0.62 mg gallic acid equivalent/g dry weight (DW and 1.08±0.15 mg quercetin equivalent/g DW of the total phenolic and flavonoid contents. A total of 120 White Roman geese, aged five weeks, were randomly distributed among 12 pens and fed a grower diet ad libitum during the growing period, with each pen containing five males and five females in a completely randomized design. Each treatment comprised three pens (total of 30 geese, including control (corn-soybean meal; supplementation with 5% SMC meal (5% SMC; supplementation with 10% SMC (10% SMC; and supplementation with 15% SMC (15% SMC, for eight weeks. The results revealed that the body weight of the 15% SMC group was significantly lower than that of the control group at the age of 12 weeks. There were no significant effects among the groups on feed conversion ratio or intake. The malondialdehyde content of the serum in the 15% SMC group was lower than that of the control group at week 12. There were no significant effects among the groups for blood biochemical parameters in grower geese at week 12. The color values of meats in the SMC groups were higher than those obtained with control group. The flavor and acceptability score of meats in the 5% SMC group were significantly higher than for the 15% SMC and control group. Supplementation with SMC at 5% in the diet has no adverse effects on the growth performance of grower geese. However, SMC meal at 5% in the diet favorably affects sensory attributes (meat flavor and acceptability.

Expression and developmental control of platelet-derived growth factor A-chain and B-chain/Sis genes in rat aortic smooth muscle cells

International Nuclear Information System (INIS)

Majesky, M.W.; Benditt, E.P.; Schwartz, S.M.

1988-01-01

Cultured arterial smooth muscle cells (SMC) can produce platelet-derived growth factor (PDGF)-like molecules. This property raises the possibility that SMC-derived PDGFs function as autocrine/paracrine regulators in the formation and maintenance of the artery wall. In this study the authors have asked if levels of mRNAs directing synthesis of PDFG are modulated in aortic SMC during postnatal development. The authors report here that genes encoding PDGF A- and B-chain precursors are expressed at similar low levels in intact aortas from newborn and adult rats. Marked differences in regulation of transcript abundance of these genes were revealed when aortic SMC were grown in cell culture. PDGF B-chain transcripts accumulated in passaged newborn rat SMC but not adult rat SMC, whereas PDGF A-chain RNA was found in comparable amounts in SMC from both age groups. Similarly, SMC from newborn rats secreted at least 60-fold more PDGF-like activity into conditioned medium than did adult rat SMC. These results show that PDGF A- and B-chain genes are transcribed in the normal rat aorta and provide evidence for age-related change in the control of PDGF B-chain gene expression in aortic SMC. Independent regulation of transcript levels in cultured SMC leaves open the possibility that PDGFs of different composition (AA, AB, BB) play different roles in normal function of the artery wall

Intimal smooth muscle cells are a source but not a sensor of anti-inflammatory CYP450 derived oxylipins

Energy Technology Data Exchange (ETDEWEB)

Thomson, Scott [Comparative Biomedical Sciences, Royal Veterinary College, Royal College Street, London NW1 0TU (United Kingdom); Edin, Matthew L.; Lih, Fred B. [Division of Intramural Research, NIEHS/NIH, Research Triangle Park, NC 27709 (United States); Davies, Michael [Comparative Biomedical Sciences, Royal Veterinary College, Royal College Street, London NW1 0TU (United Kingdom); Yaqoob, Muhammad M. [Barts and the London, Queen Mary University, Charterhouse Square, London EC1M 6BQ (United Kingdom); Hammock, Bruce D. [Department of Entomology and Comprehensive Cancer Center, University of California, Davies, CA 95616-8584 (United States); Gilroy, Derek [University College London, University Street, London (United Kingdom); Zeldin, Darryl C. [Division of Intramural Research, NIEHS/NIH, Research Triangle Park, NC 27709 (United States); Bishop-Bailey, David, E-mail: dbishopbailey@rvc.ac.uk [Comparative Biomedical Sciences, Royal Veterinary College, Royal College Street, London NW1 0TU (United Kingdom)

2015-08-07

Vascular pathologies are associated with changes in the presence and expression of morphologically distinct vascular smooth muscle cells. In particular, in complex human vascular lesions and models of disease in pigs and rodents, an intimal smooth muscle cell (iSMC) which exhibits a stable epithelioid or rhomboid phenotype in culture is often found to be present in high numbers, and may represent the reemergence of a distinct developmental vascular smooth muscle cell phenotype. The CYP450-oxylipin - soluble epoxide hydrolase (sEH) pathway is currently of great interest in targeting for cardiovascular disease. sEH inhibitors limit the development of hypertension, diabetes, atherosclerosis and aneurysm formation in animal models. We have investigated the expression of CYP450-oxylipin-sEH pathway enzymes and their metabolites in paired intimal (iSMC) and medial (mSMC) cells isolated from rat aorta. iSMC basally released significantly larger amounts of epoxy-oxylipin CYP450 products from eicosapentaenoic acid > docosahexaenoic acid > arachidonic acid > linoleic acid, and expressed higher levels of CYP2C12, CYP2B1, but not CYP2J mRNA compared to mSMC. When stimulated with the pro-inflammatory TLR4 ligand LPS, epoxy-oxylipin production did not change greatly in iSMC. In contrast, LPS induced epoxy-oxylipin products in mSMC and induced CYP2J4. iSMC and mSMC express sEH which metabolizes primary epoxy-oxylipins to their dihydroxy-counterparts. The sEH inhibitors TPPU or AUDA inhibited LPS-induced NFκB activation and iNOS induction in mSMC, but had no effect on NFκB nuclear localization or inducible nitric oxide synthase in iSMC; effects which were recapitulated in part by addition of authentic epoxy-oxylipins. iSMCs are a rich source but not a sensor of anti-inflammatory epoxy-oxylipins. Complex lesions that contain high levels of iSMCs may be more resistant to the protective effects of sEH inhibitors. - Highlights: • We examined oxylipin production in different

Aortopathy in a Mouse Model of Marfan Syndrome Is Not Mediated by Altered Transforming Growth Factor β Signaling.

Science.gov (United States)

Wei, Hao; Hu, Jie Hong; Angelov, Stoyan N; Fox, Kate; Yan, James; Enstrom, Rachel; Smith, Alexandra; Dichek, David A

2017-01-24

Marfan syndrome (MFS) is caused by mutations in the gene encoding fibrillin-1 (FBN1); however, the mechanisms through which fibrillin-1 deficiency causes MFS-associated aortopathy are uncertain. Recently, attention was focused on the hypothesis that MFS-associated aortopathy is caused by increased transforming growth factor-β (TGF-β) signaling in aortic medial smooth muscle cells (SMC). However, there are many reasons to doubt that TGF-β signaling drives MFS-associated aortopathy. We used a mouse model to test whether SMC TGF-β signaling is perturbed by a fibrillin-1 variant that causes MFS and whether blockade of SMC TGF-β signaling prevents MFS-associated aortopathy. MFS mice (Fbn1 C1039G/+ genotype) were genetically modified to allow postnatal SMC-specific deletion of the type II TGF-β receptor (TBRII; essential for physiologic TGF-β signaling). In young MFS mice with and without superimposed deletion of SMC-TBRII, we measured aortic dimensions, histopathology, activation of aortic SMC TGF-β signaling pathways, and changes in aortic SMC gene expression. Young Fbn1 C1039G/+ mice had ascending aortic dilation and significant disruption of aortic medial architecture. Both aortic dilation and disrupted medial architecture were exacerbated by superimposed deletion of TBRII. TGF-β signaling was unaltered in aortic SMC of young MFS mice; however, SMC-specific deletion of TBRII in Fbn1 C1039G/+ mice significantly decreased activation of SMC TGF-β signaling pathways. In young Fbn1 C1039G/+ mice, aortopathy develops in the absence of detectable alterations in SMC TGF-β signaling. Loss of physiologic SMC TGF-β signaling exacerbates MFS-associated aortopathy. Our data support a protective role for SMC TGF-β signaling during early development of MFS-associated aortopathy. © 2017 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley Blackwell.

Ultraviolet spectroscopy of planetary nebulae in the Magellanic Clouds

International Nuclear Information System (INIS)

Maran, S.P.; Aller, L.H.; Gull, T.R.; Stecher, T.P.

1982-01-01

Ultraviolet spectra of three high excitation planetary nebulae in the Magellanic Clouds (LMC P40, SMC N2, SMC N5) were obtained with the International Ultraviolet Explorer. The results are analyzed together with new visual wavelength spectrophotometry of LMC P40 and published data on SMC N2 and SMC N5 to investigate chemical composition and in particular to make the first reliable estimates of the carbon abundance in extragalactic planetary nebulae. Although carbon is at most only slightly less abundant in the LMC and SMC planetary nebulae than in galactic planetaries, it is almost 40 times more abundant in the SMC planetaries than in the SMC interstellar medium, and is about 6 times more abundant in the LMC planetary than in the LMC interstellar medium. According to our limited sample, the net result of carbon synthesis and convective dredgeup in the progenitors of planetary nebulae, as reflected in the nebular carbon abundance, is roughly the same in the Galaxy, the LMC, and the SMC

Clinical implementation of a GPU-based simplified Monte Carlo method for a treatment planning system of proton beam therapy

International Nuclear Information System (INIS)

Kohno, R; Hotta, K; Nishioka, S; Matsubara, K; Tansho, R; Suzuki, T

2011-01-01

We implemented the simplified Monte Carlo (SMC) method on graphics processing unit (GPU) architecture under the computer-unified device architecture platform developed by NVIDIA. The GPU-based SMC was clinically applied for four patients with head and neck, lung, or prostate cancer. The results were compared to those obtained by a traditional CPU-based SMC with respect to the computation time and discrepancy. In the CPU- and GPU-based SMC calculations, the estimated mean statistical errors of the calculated doses in the planning target volume region were within 0.5% rms. The dose distributions calculated by the GPU- and CPU-based SMCs were similar, within statistical errors. The GPU-based SMC showed 12.30–16.00 times faster performance than the CPU-based SMC. The computation time per beam arrangement using the GPU-based SMC for the clinical cases ranged 9–67 s. The results demonstrate the successful application of the GPU-based SMC to a clinical proton treatment planning. (note)

A Marfan syndrome-like phenotype caused by a neocentromeric supernumerary ring chromosome 15.

Science.gov (United States)

Quinonez, Shane C; Gelehrter, Thomas D; Uhlmann, Wendy R

2017-01-01

Small supernumerary marker chromosomes (sSMC) are abnormal chromosomes that cannot be characterized by standard banding cytogenetic techniques. A minority of sSMC contain a neocentromere, which is an ectopic centromere lacking the characteristic alpha-satellite DNA. The phenotypic manifestations of sSMC and neocentromeric sSMC are variable and range from severe intellectual disability and multiple congenital anomalies to a normal phenotype. Here we report a patient with a diagnosis of Marfan syndrome and infertility found to have an abnormal karyotype consisting of a chromosome 15 deletion and a ring-type sSMC likely stabilized by a neocentromere derived via a mechanism initially described by Barbara McClintock in 1938. Analysis of the sSMC identified that it contained the deleted chromosome 15 material and also one copy of FBN1, the gene responsible for Marfan syndrome. We propose that the patient's diagnosis arose from disruption of the FBN1 allele on the sSMC. To date, a total of 29 patients have been reported with an sSMC derived from a chromosomal deletion. We review these cases with a specific focus on the resultant phenotypes and note significant difference between this class of sSMC and other types of sSMC. Through this review we also identified a patient with a clinical diagnosis of neurofibromatosis type 1 who lacked a family history of the condition but was found to have a chromosome 17-derived sSMC that likely contained NF1 and caused the patient's disorder. We also review the genetic counseling implications and recommendations for a patient or family harboring an sSMC. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Smooth muscle cell recruitment to lymphatic vessels requires PDGFB and impacts vessel size but not identity.

Science.gov (United States)

Wang, Yixin; Jin, Yi; Mäe, Maarja Andaloussi; Zhang, Yang; Ortsäter, Henrik; Betsholtz, Christer; Mäkinen, Taija; Jakobsson, Lars

2017-10-01

Tissue fluid drains through blind-ended lymphatic capillaries, via smooth muscle cell (SMC)-covered collecting vessels into venous circulation. Both defective SMC recruitment to collecting vessels and ectopic recruitment to lymphatic capillaries are thought to contribute to vessel failure, leading to lymphedema. However, mechanisms controlling lymphatic SMC recruitment and its role in vessel maturation are unknown. Here, we demonstrate that platelet-derived growth factor B (PDGFB) regulates lymphatic SMC recruitment in multiple vascular beds. PDGFB is selectively expressed by lymphatic endothelial cells (LECs) of collecting vessels. LEC-specific deletion of Pdgfb prevented SMC recruitment causing dilation and failure of pulsatile contraction of collecting vessels. However, vessel remodelling and identity were unaffected. Unexpectedly, Pdgfb overexpression in LECs did not induce SMC recruitment to capillaries. This was explained by the demonstrated requirement of PDGFB extracellular matrix (ECM) retention for lymphatic SMC recruitment, and the low presence of PDGFB-binding ECM components around lymphatic capillaries. These results demonstrate the requirement of LEC-autonomous PDGFB expression and retention for SMC recruitment to lymphatic vessels, and suggest an ECM-controlled checkpoint that prevents SMC investment of capillaries, which is a common feature in lymphedematous skin. © 2017. Published by The Company of Biologists Ltd.

Somatomedin-C stimulates glycogen synthesis in fetal rat hepatocytes

International Nuclear Information System (INIS)

Freemark, M.; D'Ercole, A.J.; Handwerger, S.

1985-01-01

The effects of somatomedin-C/insulin-like growth factor I (Sm-C) on glycogen metabolism in cultured hepatocytes from 20-day-old rat fetuses have been examined and compared with the effects of insulin. Sm-C (25-375 ng/ml; 3.25-50 nM) stimulated dose-dependent increases in [ 14 C]glucose incorporation into glycogen (14.4-72.9% and total cell glycogen content (10.6-34.3%. Maximal stimulation of glycogen synthesis by Sm-C occurred at 2-4 h of incubation. Insulin (10 nM to 10 microM) also stimulated [ 14 C]glucose incorporation but its potency was only 1/20th that of Sm-C. The time course of stimulation of glucose incorporation by insulin was identical to that of Sm-C, the dose-response curves of the two hormones were parallel, and the maximal effects of insulin were not enhanced by simultaneous exposure of cells to Sm-C. These findings suggest that Sm-C and insulin stimulate glycogenesis in fetal liver through similar or identical mechanisms. Since the potency of Sm-C was 20 times greater than that of insulin, the glycogenic action of insulin in fetal liver may be mediated through binding to a hepatic receptor which also binds Sm-C. In addition to having mitogenic effects on fetal tissues, Sm-C may have direct anabolic effects on fetal carbohydrate metabolism

Tricalcium phosphate/hydroxyapatite (TCP-HA) bone scaffold as potential candidate for the formation of tissue engineered bone.

Science.gov (United States)

Sulaiman, Shamsul Bin; Keong, Tan Kok; Cheng, Chen Hui; Saim, Aminuddin Bin; Idrus, Ruszymah Bt Hj

2013-06-01

Various materials have been used as scaffolds to suit different demands in tissue engineering. One of the most important criteria is that the scaffold must be biocompatible. This study was carried out to investigate the potential of HA or TCP/HA scaffold seeded with osteogenic induced sheep marrow cells (SMCs) for bone tissue engineering. HA-SMC and TCP/HA-SMC constructs were induced in the osteogenic medium for three weeks prior to implantation in nude mice. The HA-SMC and TCP/HA-SMC constructs were implanted subcutaneously on the dorsum of nude mice on each side of the midline. These constructs were harvested after 8 wk of implantation. Constructs before and after implantation were analyzed through histological staining, scanning electron microscope (SEM) and gene expression analysis. The HA-SMC constructs demonstrated minimal bone formation. TCP/HA-SMC construct showed bone formation eight weeks after implantation. The bone formation started on the surface of the ceramic and proceeded to the centre of the pores. H&E and Alizarin Red staining demonstrated new bone tissue. Gene expression of collagen type 1 increased significantly for both constructs, but more superior for TCP/HA-SMC. SEM results showed the formation of thick collagen fibers encapsulating TCP/HA-SMC more than HA-SMC. Cells attached to both constructs surface proliferated and secreted collagen fibers. The findings suggest that TCP/HA-SMC constructs with better osteogenic potential compared to HA-SMC constructs can be a potential candidate for the formation of tissue engineered bone.

Pharmacokinetics and N-acetylation metabolism of S-methyl-l-cysteine and trans-S-1-propenyl-l-cysteine in rats and dogs.

Science.gov (United States)

Amano, Hirotaka; Kazamori, Daichi; Itoh, Kenji

2016-11-01

1. Pharmacokinetics and N-acetylation metabolism of S-methyl-L-cysteine (SMC) and trans-S-1-propenyl-L-cysteine (S1PC) were examined in rats and dogs. SMC and S1PC (2-5 mg/kg) were well absorbed in both species with high bioavailability (88-100%). 2. SMC and S1PC were excreted only to a small extent in the urine of rats and dogs. The small renal clearance values (l/h/kg) indicated the extensive renal reabsorption of SMC and S1PC, which potentially contributed to their long elimination half-lives (>5 h) in dogs. 3. S1PC, but not SMC, underwent N-acetylation extensively in vivo, which can be explained by the relative activities of N-acetylation of S1PC/SMC and deacetylation of their N-acetylated forms, N-acetyl-S1PC/N-acetyl-SMC, in the liver and kidney in vitro. The activities for S1PC N-acetylation were similar to or higher than those for N-acetyl-S1PC deacetylation in liver S9 fractions of rat and dog, whereas liver and kidney S9 fractions of rat and dog had little activity for SMC N-acetylation or considerably higher activities for N-acetyl-SMC deacetylation. 4. Our study demonstrated that the pharmacokinetics of SMC and S1PC in rats and dogs was characterized by high bioavailability and extensive renal reabsorption; however, the extent of undergoing the N-acetylation metabolism was extremely different between SMC and S1PC.

The predictive value of self-rated health in the presence of subjective memory complaints on permanent nursing home placement in elderly primary care patients over 4-year follow-up

DEFF Research Database (Denmark)

Nielsen, Anni Brit Sternhagen; Siersma, Volkert Dirk; Waldemar, Gunhild

2013-01-01

self-rated health (SRH) predicts nursing home (NH) placement; subjective memory complaints (SMC) too. However, the predictive value of SRH in the presence of SMC is unclear.......self-rated health (SRH) predicts nursing home (NH) placement; subjective memory complaints (SMC) too. However, the predictive value of SRH in the presence of SMC is unclear....

Vascular smooth muscle cells exhibit a progressive loss of rigidity with serial culture passaging.

Science.gov (United States)

Dinardo, Carla Luana; Venturini, Gabriela; Omae, Samantha Vieira; Zhou, Enhua H; da Motta-Leal-Filho, Joaquim Maurício; Dariolli, Rafael; Krieger, José Eduardo; Alencar, Adriano Mesquita; Costa Pereira, Alexandre

2012-01-01

One drawback of in vitro cell culturing is the dedifferentiation process that cells experience. Smooth muscle cells (SMC) also change molecularly and morphologically with long term culture. The main objective of this study was to evaluate if culture passages interfere in vascular SMC mechanical behavior. SMC were obtained from five different porcine arterial beds. Optical magnetic twisting cytometry (OMTC) was used to characterize mechanically vascular SMC from different cultures in distinct passages and confocal microscopy/western blotting, to evaluate cytoskeleton and extracellular matrix proteins. We found that vascular SMC rigidity or viscoelastic complex modulus (G) decreases with progression of passages. A statistically significant negative correlation between G and passage was found in four of our five cultures studied. Phalloidin-stained SMC from higher passages exhibited lower mean signal intensity per cell (confocal microscopy) and quantitative western blotting analysis showed a decrease in collagen I content throughout passages. We concluded that vascular SMC progressively lose their stiffness with serial culture passaging. Thus, limiting the number of passages is essential for any experiment measuring viscoelastic properties of SMC in culture.

Effect of seasonal malaria chemoprevention on the acquisition of antibodies to Plasmodium falciparum antigens in Ouelessebougou, Mali.

Science.gov (United States)

Mahamar, Almahamoudou; Issiaka, Djibrilla; Barry, Amadou; Attaher, Oumar; Dembele, Adama B; Traore, Tiangoua; Sissoko, Adama; Keita, Sekouba; Diarra, Bacary Soumana; Narum, David L; Duffy, Patrick E; Dicko, Alassane; Fried, Michal

2017-07-18

Seasonal malaria chemoprevention (SMC) is a new strategy to reduce malaria burden in young children in Sahelian countries. It consists of the administration of full treatment courses of sulfadoxine-pyrimethamine plus amodiaquine to children at monthly intervals during the malaria season. However, it is not clear if there is a cumulative effect of SMC over time on acquisition of antibodies to malaria antigens. A cross-sectional serosurvey was carried out 1 month after the last dose of SMC in 2016. Children aged 3-4 years were randomly selected from areas where SMC was given for 1, 2 or 3 years during the malaria season. Children in the areas where SMC had been implemented for 1 year but who failed to receive SMC were used as comparison group. Antibody extracted from dry blood spots was used to measure IgG levels to CSP, MSP-1 42 and AMA1. The prevalence of antibodies to AMA-1 were high and similar in children who received SMC for 1, 2 or 3 years and also when compared to those who never received SMC (96.3 vs 97.5%, adjusted OR = 0.99, 95% CI 0.33-2.97, p = 0.99). The prevalence of antibodies to MSP-1 42 and to CSP were similar in children that received SMC for 1, 2 or 3 years, but were lower in these children compared to those who did not receive SMC (87.1 vs 91.2%, adjusted OR = 0.55, 95% CI 0.29-1.01, p = 0.05 for MSP-1 42 ; 79.8 vs 89.2%, adjusted OR = 0.52, 95% CI 0.30-0.90, p = 0.019 for CSP). SMC reduced seropositivity to MSP-1 42 and CSP, but the duration of SMC did not further reduce seropositivity. Exposure to SMC did not reduce the seropositivity to AMA1.

Mapping The Temporal and Spatial Variability of Soil Moisture Content Using Proximal Soil Sensing

Science.gov (United States)

Virgawati, S.; Mawardi, M.; Sutiarso, L.; Shibusawa, S.; Segah, H.; Kodaira, M.

2018-05-01

In studies related to soil optical properties, it has been proven that visual and NIR soil spectral response can predict soil moisture content (SMC) using proper data analysis techniques. SMC is one of the most important soil properties influencing most physical, chemical, and biological soil processes. The problem is how to provide reliable, fast and inexpensive information of SMC in the subsurface from numerous soil samples and repeated measurement. The use of spectroscopy technology has emerged as a rapid and low-cost tool for extensive investigation of soil properties. The objective of this research was to develop calibration models based on laboratory Vis-NIR spectroscopy to estimate the SMC at four different growth stages of the soybean crop in Yogyakarta Province. An ASD Field-spectrophotoradiometer was used to measure the reflectance of soil samples. The partial least square regression (PLSR) was performed to establish the relationship between the SMC with Vis-NIR soil reflectance spectra. The selected calibration model was used to predict the new samples of SMC. The temporal and spatial variability of SMC was performed in digital maps. The results revealed that the calibration model was excellent for SMC prediction. Vis-NIR spectroscopy was a reliable tool for the prediction of SMC.

A new moving strategy for the sequential Monte Carlo approach in optimizing the hydrological model parameters

Science.gov (United States)

Zhu, Gaofeng; Li, Xin; Ma, Jinzhu; Wang, Yunquan; Liu, Shaomin; Huang, Chunlin; Zhang, Kun; Hu, Xiaoli

2018-04-01

Sequential Monte Carlo (SMC) samplers have become increasing popular for estimating the posterior parameter distribution with the non-linear dependency structures and multiple modes often present in hydrological models. However, the explorative capabilities and efficiency of the sampler depends strongly on the efficiency in the move step of SMC sampler. In this paper we presented a new SMC sampler entitled the Particle Evolution Metropolis Sequential Monte Carlo (PEM-SMC) algorithm, which is well suited to handle unknown static parameters of hydrologic model. The PEM-SMC sampler is inspired by the works of Liang and Wong (2001) and operates by incorporating the strengths of the genetic algorithm, differential evolution algorithm and Metropolis-Hasting algorithm into the framework of SMC. We also prove that the sampler admits the target distribution to be a stationary distribution. Two case studies including a multi-dimensional bimodal normal distribution and a conceptual rainfall-runoff hydrologic model by only considering parameter uncertainty and simultaneously considering parameter and input uncertainty show that PEM-SMC sampler is generally superior to other popular SMC algorithms in handling the high dimensional problems. The study also indicated that it may be important to account for model structural uncertainty by using multiplier different hydrological models in the SMC framework in future study.

Efficient generation of smooth muscle cells from adipose-derived stromal cells by 3D mechanical stimulation can substitute the use of growth factors in vascular tissue engineering.

Science.gov (United States)

Parvizi, Mojtaba; Bolhuis-Versteeg, Lydia A M; Poot, André A; Harmsen, Martin C

2016-07-01

Occluding artery disease causes a high demand for bioartificial replacement vessels. We investigated the combined use of biodegradable and creep-free poly (1,3-trimethylene carbonate) (PTMC) with smooth muscle cells (SMC) derived by biochemical or mechanical stimulation of adipose tissue-derived stromal cells (ASC) to engineer bioartificial arteries. Biochemical induction of cultured ASC to SMC was done with TGF-β1 for 7d. Phenotype and function were assessed by qRT-PCR, immunodetection and collagen contraction assays. The influence of mechanical stimulation on non-differentiated and pre-differentiated ASC, loaded in porous tubular PTMC scaffolds, was assessed after culturing under pulsatile flow for 14d. Assays included qRT-PCR, production of extracellular matrix and scanning electron microscopy. ASC adhesion and TGF-β1-driven differentiation to contractile SMC on PTMC did not differ from tissue culture polystyrene controls. Mesenchymal and SMC markers were increased compared to controls. Interestingly, pre-differentiated ASC had only marginal higher contractility than controls. Moreover, in 3D PTMC scaffolds, mechanical stimulation yielded well-aligned ASC-derived SMC which deposited ECM. Under the same conditions, pre-differentiated ASC-derived SMC maintained their SMC phenotype. Our results show that mechanical stimulation can replace TGF-β1 pre-stimulation to generate SMC from ASC and that pre-differentiated ASC keep their SMC phenotype with increased expression of SMC markers. Copyright © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

The relationship between social functioning and subjective memory complaints in older persons: a population-based longitudinal cohort study.

Science.gov (United States)

Kuiper, Jisca S; Oude Voshaar, Richard C; Zuidema, Sytse U; Stolk, Ronald P; Zuidersma, Marij; Smidt, Nynke

2017-10-01

Poor social functioning is associated with cognitive decline in older adults. It is unclear whether social functioning is also associated with subjective memory complaints (SMC). We investigated the association between social functioning and incident SMC and SMC recovery. A population-based sample of 8762 older adults (aged ≥65 years) with good objective cognitive functioning at baseline (MMSE ≥26) from the LifeLines Cohort Study were followed for 1.5 years. Self-reported SMC were measured at baseline and after 1.5 years follow-up. Aspects of social functioning included marital status, household composition, social network size, social activity, quality of social relationships, social support, affection, behavioral confirmation, and status. Thirteen percent (513/3963) developed SMC during follow-up (incident SMC). Multivariate logistic regression analyses (adjusted for age, gender, education level, physical activity, alcohol use, smoking status, depression, arrhythmia, myocardial infarction, heart failure, stroke) showed that participants with better feelings of affection, behavioral confirmation and stable good social support had a lower risk of incident SMC. Thirty-four percent (1632/4799) reported recovery. Participants with good social functioning at baseline on all determinants reported more SMC recovery. People who remained stable in a relationship, stable in good quality of social relationships or increased in quality of social relationships more often report SMC recovery. Good social functioning is associated with less incident SMC and more SMC recovery over a follow-up period of 1.5 years. Albeit future confirmative studies are needed, we argue for targeting also social functioning when designing multidomain interventions to prevent or slow down cognitive decline. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

Immunohistochemical characterization of endometriosis-associated smooth muscle cells in human peritoneal endometriotic lesions.

Science.gov (United States)

Barcena de Arellano, Maria L; Gericke, Jessica; Reichelt, Uta; Okuducu, Ali Fuat; Ebert, Andreas D; Chiantera, Vito; Schneider, Achim; Mechsner, Sylvia

2011-10-01

Smooth muscle cells (SMC) are common components of endometriotic lesions. SMC have been characterized previously in peritoneal, ovarian and deep infiltrating endometriotic lesions and adenomyosis. The aim of this retrospective study was to investigate the extent of differentiation in endometriosis-associated SMC (EMaSMC) in peritoneal endometriotic lesions. We obtained biopsies from peritoneal endometriotic lesions (n = 60) and peritoneal sites distant from the endometriotic lesion (n = 60), as well as healthy peritoneum from patients without endometriosis (control tissue, n = 10). These controls were hysterectomy specimens from patients without endometriosis or adenomyosis. Histopathological examination of peritoneal specimens using antibodies against oxytocin receptor (OTR), vasopressin receptor (VPR), smooth muscle myosin heavy chain (SM-MHC), estrogen receptor (ER) or progesterone receptor (PR) was performed. To identify SMC and their level of differentiation, antibodies for smooth muscle actin desmin and caldesmon were used. SMC were detected in all endometriotic lesions. SMC were more abundant in unaffected peritoneum of women with endometriosis (38%) compared with women without endometriosis (6%; P endometriosis.

Subjective memory complaints in preclinical autosomal dominant Alzheimer disease.

Science.gov (United States)

Norton, Daniel J; Amariglio, Rebecca; Protas, Hillary; Chen, Kewei; Aguirre-Acevedo, Daniel C; Pulsifer, Brendan; Castrillon, Gabriel; Tirado, Victoria; Munoz, Claudia; Tariot, Pierre; Langbaum, Jessica B; Reiman, Eric M; Lopera, Francisco; Sperling, Reisa A; Quiroz, Yakeel T

2017-10-03

To cross-sectionally study subjective memory complaints (SMC) in autosomal dominant Alzheimer disease (ADAD). We examined self-reported and study partner-based SMC in 52 young, cognitively unimpaired individuals from a Colombian kindred with early-onset ADAD. Twenty-six carried the PSEN-1 E280A mutation, averaging 7 years of age younger than the kindred's expected clinical onset. Twenty-six were age-matched noncarriers. Participants also underwent structural MRI and cognitive testing. Self-reported SMC were greater in carriers than noncarriers ( p = 0.02). Study partner-based SMC did not differ between groups ( p = 0.21), but in carriers increased with age ( r = 0.66, p < 0.001) and decreased with hippocampal volume ( r = -0.35, p = 0.08). Cognitively unimpaired PSEN-1 carriers have elevated SMC. Self-reported SMC may be a relatively early indicator of preclinical AD, while partner- reported SMC increases later in preclinical AD, closer to clinical onset. © 2017 American Academy of Neurology.

(α,η) phase diagrams in tilted chiral smectics

International Nuclear Information System (INIS)

Rjili, M.; Marcerou, J.P.; Gharbi, A.; Othman, T.

2013-01-01

The polymorphism of tilted chiral smectics liquid crystals is incredibly rich and encompasses many subphases such as SmC A ⁎ ; SmC Fi1 ⁎ ; SmC Fi2 ⁎ ; SmC ⁎ ; SmC α ⁎ . The continuum theory established by Marcerou (2010) is used to derive an expression for the free energy density of those subphases. The minimization of this free energy is obtained through a combination of analytical and numerical methods. It leads to a phase diagram built in the (α,η) plane where α is local angular parameter and η describes the variation of the temperature. From this graphical representation, many experimentally observed phase sequences of ferroelectric liquid crystals can be explained, even them including subphases which were recently observed like the SmC 5 ⁎ and the SmC 6 ⁎ ones. However, it should be emphasized that the details of predicted phase diagram are strongly dependent on the compound studied.

U-61,431F, a stable prostacyclin analogue, inhibits the proliferation of bovine vascular smooth muscle cells with little antiproliferative effect on endothelial cells

International Nuclear Information System (INIS)

Shirotani, M.; Yui, Y.; Hattori, R.; Kawai, C.

1991-01-01

The effects of U-61,431F, ciprostene, a stable prostacyclin analogue, were examined on the proliferation of cultured quiescent bovine aortic endothelial cells (EC) and smooth muscle cells (SMC). After stimulation with 5% fetal calf serum, U-61,431F suppressed both the DNA synthesis and proliferation of SMC dose-dependently at the concentration of 3-100 microM, but had no effect on either of them in EC at a concentration of up to 30 microM. The inhibitory effect on DNA synthesis was greater in SMC than in EC at 3-50 microM. When SMC were stimulated with platelet-derived growth factor (PDGF) for 2 hrs followed by a 22-hr incubation with insulin, U-61,431F (1-50 microM) administered at the time of PDGF stimulation did not inhibit DNA synthesis. SMC initiated and terminated DNA synthesis at about 15-18 h and 24 h after stimulation with serum, respectively. Inhibition of DNA synthesis in serum-stimulated SMC as a function of the addition time of U-61,431F reduced at 3-12 h after the stimulation. U-61,431F raised the cyclic AMP (cAMP) content in SMC. Moreover, a phosphodiesterase inhibitor, 3-isobutyl-1-methylxanthine, and a more specific cAMP phosphodiesterase inhibitor, Ro 20-1724, augmented the inhibition of DNA synthesis in SMC concomitant with further elevation of cAMP level. These results suggest that U-61,431F inhibits DNA synthesis of SMC acting in the progression stage rather than in the competence stage, with little antiproliferative effect on EC. cAMP may play an important role in its antiproliferative action in SMC

A subpopulation of smooth muscle cells, derived from melanocyte-competent precursors, prevents patent ductus arteriosus.

Directory of Open Access Journals (Sweden)

Ichiro Yajima

Full Text Available BACKGROUND: Patent ductus arteriosus is a life-threatening condition frequent in premature newborns but also present in some term infants. Current mouse models of this malformation generally lead to perinatal death, not reproducing the full phenotypic spectrum in humans, in whom genetic inheritance appears complex. The ductus arteriosus (DA, a temporary fetal vessel that bypasses the lungs by shunting the aortic arch to the pulmonary artery, is constituted by smooth muscle cells of distinct origins (SMC1 and SMC2 and many fewer melanocytes. To understand novel mechanisms preventing DA closure at birth, we evaluated the importance of cell fate specification in SMC that form the DA during embryonic development. Upon specific Tyr::Cre-driven activation of Wnt/β-catenin signaling at the time of cell fate specification, melanocytes replaced the SMC2 population of the DA, suggesting that SMC2 and melanocytes have a common precursor. The number of SMC1 in the DA remained similar to that in controls, but insufficient to allow full DA closure at birth. Thus, there was no cellular compensation by SMC1 for the loss of SMC2. Mice in which only melanocytes were genetically ablated after specification from their potential common precursor with SMC2, demonstrated that differentiated melanocytes themselves do not affect DA closure. Loss of the SMC2 population, independent of the presence of melanocytes, is therefore a cause of patent ductus arteriosus and premature death in the first months of life. Our results indicate that patent ductus arteriosus can result from the insufficient differentiation, proliferation, or contractility of a specific smooth muscle subpopulation that shares a common neural crest precursor with cardiovascular melanocytes.

A Subpopulation of Smooth Muscle Cells, Derived from Melanocyte-Competent Precursors, Prevents Patent Ductus Arteriosus

Science.gov (United States)

Puig, Isabel; Champeval, Delphine; Kumasaka, Mayuko; Belloir, Elodie; Bonaventure, Jacky; Mark, Manuel; Yamamoto, Hiroaki; Taketo, Mark M.; Choquet, Philippe; Etchevers, Heather C.; Beermann, Friedrich; Delmas, Véronique; Monassier, Laurent; Larue, Lionel

2013-01-01

Background Patent ductus arteriosus is a life-threatening condition frequent in premature newborns but also present in some term infants. Current mouse models of this malformation generally lead to perinatal death, not reproducing the full phenotypic spectrum in humans, in whom genetic inheritance appears complex. The ductus arteriosus (DA), a temporary fetal vessel that bypasses the lungs by shunting the aortic arch to the pulmonary artery, is constituted by smooth muscle cells of distinct origins (SMC1 and SMC2) and many fewer melanocytes. To understand novel mechanisms preventing DA closure at birth, we evaluated the importance of cell fate specification in SMC that form the DA during embryonic development. Upon specific Tyr::Cre-driven activation of Wnt/β-catenin signaling at the time of cell fate specification, melanocytes replaced the SMC2 population of the DA, suggesting that SMC2 and melanocytes have a common precursor. The number of SMC1 in the DA remained similar to that in controls, but insufficient to allow full DA closure at birth. Thus, there was no cellular compensation by SMC1 for the loss of SMC2. Mice in which only melanocytes were genetically ablated after specification from their potential common precursor with SMC2, demonstrated that differentiated melanocytes themselves do not affect DA closure. Loss of the SMC2 population, independent of the presence of melanocytes, is therefore a cause of patent ductus arteriosus and premature death in the first months of life. Our results indicate that patent ductus arteriosus can result from the insufficient differentiation, proliferation, or contractility of a specific smooth muscle subpopulation that shares a common neural crest precursor with cardiovascular melanocytes. PMID:23382837

Robust Sliding Mode Control Based on GA Optimization and CMAC Compensation for Lower Limb Exoskeleton

Science.gov (United States)

Long, Yi; Du, Zhi-jiang; Wang, Wei-dong; Dong, Wei

2016-01-01

A lower limb assistive exoskeleton is designed to help operators walk or carry payloads. The exoskeleton is required to shadow human motion intent accurately and compliantly to prevent incoordination. If the user's intention is estimated accurately, a precise position control strategy will improve collaboration between the user and the exoskeleton. In this paper, a hybrid position control scheme, combining sliding mode control (SMC) with a cerebellar model articulation controller (CMAC) neural network, is proposed to control the exoskeleton to react appropriately to human motion intent. A genetic algorithm (GA) is utilized to determine the optimal sliding surface and the sliding control law to improve performance of SMC. The proposed control strategy (SMC_GA_CMAC) is compared with three other types of approaches, that is, conventional SMC without optimization, optimal SMC with GA (SMC_GA), and SMC with CMAC compensation (SMC_CMAC), all of which are employed to track the desired joint angular position which is deduced from Clinical Gait Analysis (CGA) data. Position tracking performance is investigated with cosimulation using ADAMS and MATLAB/SIMULINK in two cases, of which the first case is without disturbances while the second case is with a bounded disturbance. The cosimulation results show the effectiveness of the proposed control strategy which can be employed in similar exoskeleton systems. PMID:27069353

Contact-mediated and humoral communication between vascular endothelial and smooth muscle cells in vitro

International Nuclear Information System (INIS)

Davies, P.F.

1986-01-01

Vascular endothelial cells (EC) and smooth muscle cells (SMC) co-exist in close apposition to each other in all blood vessels except capillaries. Investigations of the metabolic interactions that may occur between these cells are essential to an understanding of vascular homeostasis and the pathogenesis of atherosclerosis. The authors have developed two in vitro models of co-temporal vascular cell communication. The first facilitates reversible microcarrier-mediated gap junctional communication between EC and SMC monolayers. When either EC or SMC were prelabelled with 3 H-uridine, intracellular nucleotide rapidly transferred across the region of heterocellular attachment to the complementary cell population. Cytoplasmic continuity between EC and SMC allowed metabolic cooperation via ions and small molecules (<1.5 KD). Thus, vascular reactivity, particularly in the microcirculation where myoendothelial gap junctions have been observed, may involve cytoplasmic second messengers transported from EC to SMC. In the second model, humoral communication was established between separated cultures of EC and SMC which shared the same culture medium. Endothelial-specific stimulation of SMC growth and lipoprotein metabolism via soluble factors was demonstrated. Two mechanisms of stimulation of SMC lipoprotein metabolism were identified; one endothelial derived mitogen-dependent, the other mitogen-independent which was mediated via low molecular weight endothelial cell products

Potential Impact of Seasonal Malaria Chemoprevention on the Acquisition of Antibodies Against Glutamate-Rich Protein and Apical Membrane Antigen 1 in Children Living in Southern Senegal

DEFF Research Database (Denmark)

Ndiaye, Magatte; Sylla, Khadime; Sow, Doudou

2015-01-01

Seasonal malaria chemoprevention (SMC) is defined as the intermittent administration of full treatment courses of an antimalarial drug to children during the peak of malaria transmission season with the aim of preventing malaria-associated mortality and morbidity. SMC using sulfadoxine-pyrimetham......Seasonal malaria chemoprevention (SMC) is defined as the intermittent administration of full treatment courses of an antimalarial drug to children during the peak of malaria transmission season with the aim of preventing malaria-associated mortality and morbidity. SMC using sulfadoxine......-pyrimethamine (SP) combined with amodiaquine (AQ) is a promising strategy to control malaria morbidity in areas of highly seasonal malaria transmission. However, a concern is whether SMC can delay the natural acquisition of immunity toward malaria parasites in areas with intense SMC delivery. To investigate this......, total IgG antibody (Ab) responses to Plasmodium falciparum antigens glutamate-rich protein R0 (GLURP-R0) and apical membrane antigen 1 (AMA-1) were measured by enzyme-linked immunosorbent assay in Senegalese children under the age of 10 years in 2010 living in Saraya and Velingara districts (with SMC...

Control system of executive mechanisms of a spectrometer on the IBR-2 reactor as a modern local network of controllers CAN

International Nuclear Information System (INIS)

Zhuravlev, V.V.; Kirillov, A.S.; Petukhova, T.B.; Sirotin, A.P.

2007-01-01

Controllers SMC-32 and SMC-32-CAN as elements of control systems of executive mechanisms of the IBR-2 spectrometers are submitted. The controllers provide management of executive mechanisms of spectrometers on the consecutive communication line RS232, RS422 (SMC-32, SMC-32-CAN), and on the local network CAN (SMC-32-CAN). The control systems of the executive mechanisms are easily modernized due to connection of additional elements of the local network CAN. Dynamic characteristics of the spectrometers' executive mechanisms are essentially improved. For example, it has been possible to increase the rotation frequency of the step motor DSHI-200 up to 10000 pps. (author)

The relationship between social functioning and subjective memory complaints in older persons : a population-based longitudinal cohort study

NARCIS (Netherlands)

Kuiper, Jisca S; Oude Voshaar, Richard C; Zuidema, Sytse U; Stolk, Ronald P; Zuidersma, Marij; Smidt, Nynke

2017-01-01

OBJECTIVE: Poor social functioning is associated with cognitive decline in older adults. It is unclear whether social functioning is also associated with subjective memory complaints (SMC). We investigated the association between social functioning and incident SMC and SMC recovery. METHODS: A

Experiment list: SRX151246 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 11: SMC1 ChIPSeq; Homo sapiens; ChIP-Seq source_name=BCBL1 pleural effusion lymphoma, SMC1 ChIP || cell line...=BCBL1 || cell type=KSHV-infected pleural effusion lymphoma cells || chip antibody=rabbit anti-SMC1 || antib

CHARACTERIZING THE POPULATION OF BRIGHT INFRARED SOURCES IN THE SMALL MAGELLANIC CLOUD

Energy Technology Data Exchange (ETDEWEB)

Kraemer, K. E. [Institute for Scientific Research, Boston College, 140 Commonwealth Avenue, Chestnut Hill, MA 02467 (United States); Sloan, G. C. [Center for Astrophysics and Planetary Science, Cornell University, Ithaca, NY 14853-6801 (United States); Wood, P. R. [Research School of Astronomy and Astrophysics, Australian National University, Cotter Road, Weston Creek ACT 2611 (Australia); Jones, O. C. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Egan, M. P., E-mail: kathleen.kraemer@bc.edu, E-mail: sloan@astro.cornell.edu, E-mail: wood@mso.anu.edu.au, E-mail: michael.p.egan@nga.mil [National Geospatial Intelligence Agency, 7500 GEOINT Drive, Springfield, VA 22150 (United States)

2017-01-10

We have used the Infrared Spectrograph (IRS) on the Spitzer Space Telescope to observe stars in the Small Magellanic Cloud (SMC) selected from the Point Source Catalog of the Midcourse Space Experiment (MSX). We concentrate on the dust properties of the oxygen-rich evolved stars. The dust composition has smaller contributions from alumina compared to the Galaxy. This difference may arise from the lower metallicity in the SMC, but it could be a selection effect, as the SMC sample includes more stars that are brighter and thus more massive. The distribution of the SMC stars along the silicate sequence looks more like the Galactic sample of red supergiants than asymptotic giant branch stars (AGBs). While many of the SMC stars are definitively on the AGB, several also show evidence of hot bottom burning. Three of the supergiants show PAH emission at 11.3 μ m. Two other sources show mixed chemistry, with both carbon-rich and oxygen-rich spectral features. One, MSX SMC 134, may be the first confirmed silicate/carbon star in the SMC. The other, MSX SMC 049, is a candidate post-AGB star. MSX SMC 145, previously considered a candidate OH/IR star, is actually an AGB star with a background galaxy at z  = 0.16 along the same line of sight. We consider the overall characteristics of all the MSX sources, the most infrared-bright objects in the SMC, in light of the higher sensitivity and resolution of Spitzer , and compare them with the object types expected from the original selection criteria. This population represents what will be seen in more distant galaxies by the upcoming James Webb Space Telescope ( JWST ). Color–color diagrams generated from the IRS spectra and the mid-infrared filters on JWST show how one can separate evolved stars from young stellar objects (YSOs) and distinguish among different classes of YSOs.

Interleukin-1β modulates smooth muscle cell phenotype to a distinct inflammatory state relative to PDGF-DD via NF-κB-dependent mechanisms.

Science.gov (United States)

Alexander, Matthew R; Murgai, Meera; Moehle, Christopher W; Owens, Gary K

2012-04-02

Smooth muscle cell (SMC) phenotypic modulation in atherosclerosis and in response to PDGF in vitro involves repression of differentiation marker genes and increases in SMC proliferation, migration, and matrix synthesis. However, SMCs within atherosclerotic plaques can also express a number of proinflammatory genes, and in cultured SMCs the inflammatory cytokine IL-1β represses SMC marker gene expression and induces inflammatory gene expression. Studies herein tested the hypothesis that IL-1β modulates SMC phenotype to a distinct inflammatory state relative to PDGF-DD. Genome-wide gene expression analysis of IL-1β- or PDGF-DD-treated SMCs revealed that although both stimuli repressed SMC differentiation marker gene expression, IL-1β distinctly induced expression of proinflammatory genes, while PDGF-DD primarily induced genes involved in cell proliferation. Promoters of inflammatory genes distinctly induced by IL-1β exhibited over-representation of NF-κB binding sites, and NF-κB inhibition in SMCs reduced IL-1β-induced upregulation of proinflammatory genes as well as repression of SMC differentiation marker genes. Interestingly, PDGF-DD-induced SMC marker gene repression was not NF-κB dependent. Finally, immunofluorescent staining of mouse atherosclerotic lesions revealed the presence of cells positive for the marker of an IL-1β-stimulated inflammatory SMC, chemokine (C-C motif) ligand 20 (CCL20), but not the PDGF-DD-induced gene, regulator of G protein signaling 17 (RGS17). Results demonstrate that IL-1β- but not PDGF-DD-induced phenotypic modulation of SMC is characterized by NF-κB-dependent activation of proinflammatory genes, suggesting the existence of a distinct inflammatory SMC phenotype. In addition, studies provide evidence for the possible utility of CCL20 and RGS17 as markers of inflammatory and proliferative state SMCs within atherosclerotic plaques in vivo.

Brain cytoplasmic RNA 1 suppresses smooth muscle differentiation and vascular development in mice.

Science.gov (United States)

Wang, Yung-Chun; Chuang, Ya-Hui; Shao, Qiang; Chen, Jian-Fu; Chen, Shi-You

2018-04-13

The cardiovascular system develops during the early stages of embryogenesis, and differentiation of smooth muscle cells (SMCs) is essential for that process. SMC differentiation is critically regulated by transforming growth factor (TGF)-β/SMAD family member 3 (SMAD3) signaling, but other regulators may also play a role. For example, long noncoding RNAs (lncRNAs) regulate various cellular activities and events, such as proliferation, differentiation, and apoptosis. However, whether long noncoding RNAs also regulate SMC differentiation remains largely unknown. Here, using the murine cell line C3H10T1/2, we found that brain cytoplasmic RNA 1 (BC1) is an important regulator of SMC differentiation. BC1 overexpression suppressed, whereas BC1 knockdown promoted, TGF-β-induced SMC differentiation, as indicated by altered cell morphology and expression of multiple SMC markers, including smooth muscle α-actin (αSMA), calponin, and smooth muscle 22α (SM22α). BC1 appeared to block SMAD3 activity and inhibit SMC marker gene transcription. Mechanistically, BC1 bound to SMAD3 via RNA SMAD-binding elements (rSBEs) and thus impeded TGF-β-induced SMAD3 translocation to the nucleus. This prevented SMAD3 from binding to SBEs in SMC marker gene promoters, an essential event in SMC marker transcription. In vivo , BC1 overexpression in mouse embryos impaired vascular SMC differentiation, leading to structural defects in the artery wall, such as random breaks in the elastic lamina, abnormal collagen deposition on SM fibers, and disorganized extracellular matrix proteins in the media of the neonatal aorta. Our results suggest that BC1 is a suppressor of SMC differentiation during vascular development. © 2018 by The American Society for Biochemistry and Molecular Biology, Inc.

CHARACTERIZING THE POPULATION OF BRIGHT INFRARED SOURCES IN THE SMALL MAGELLANIC CLOUD

International Nuclear Information System (INIS)

Kraemer, K. E.; Sloan, G. C.; Wood, P. R.; Jones, O. C.; Egan, M. P.

2017-01-01

We have used the Infrared Spectrograph (IRS) on the Spitzer Space Telescope to observe stars in the Small Magellanic Cloud (SMC) selected from the Point Source Catalog of the Midcourse Space Experiment (MSX). We concentrate on the dust properties of the oxygen-rich evolved stars. The dust composition has smaller contributions from alumina compared to the Galaxy. This difference may arise from the lower metallicity in the SMC, but it could be a selection effect, as the SMC sample includes more stars that are brighter and thus more massive. The distribution of the SMC stars along the silicate sequence looks more like the Galactic sample of red supergiants than asymptotic giant branch stars (AGBs). While many of the SMC stars are definitively on the AGB, several also show evidence of hot bottom burning. Three of the supergiants show PAH emission at 11.3 μ m. Two other sources show mixed chemistry, with both carbon-rich and oxygen-rich spectral features. One, MSX SMC 134, may be the first confirmed silicate/carbon star in the SMC. The other, MSX SMC 049, is a candidate post-AGB star. MSX SMC 145, previously considered a candidate OH/IR star, is actually an AGB star with a background galaxy at z  = 0.16 along the same line of sight. We consider the overall characteristics of all the MSX sources, the most infrared-bright objects in the SMC, in light of the higher sensitivity and resolution of Spitzer , and compare them with the object types expected from the original selection criteria. This population represents what will be seen in more distant galaxies by the upcoming James Webb Space Telescope ( JWST ). Color–color diagrams generated from the IRS spectra and the mid-infrared filters on JWST show how one can separate evolved stars from young stellar objects (YSOs) and distinguish among different classes of YSOs.

Discovery of new planetary nebulae in the Small Magellanic Cloud

International Nuclear Information System (INIS)

Drašković, D.; Reid, W. A.; Parker, Q. A.; Stupar, M.

2016-01-01

We present six new planetary nebulae (PNe) discovered in the Small Magellanic Cloud (SMC) from deep UK Schmidt telescope (UKST) narrow band Ha and broad-band short- red “SR” continuum images and confirmed spectroscopically. These 6 preliminary discoveries provide a 6% increase to the previously known SMC PN population of ∼⃒100. Once spectroscopic follow-up of all our newly identified candidates is complete, we expect to increase the total number of known SMC PNe by up to 50%. This will permit a significant improvement to determination of the SMC PN luminosity function (PNLF) and enable further insights into the chemical evolution and kinematics of the SMC PN population. (paper)

Robust Sliding Mode Control Based on GA Optimization and CMAC Compensation for Lower Limb Exoskeleton

Directory of Open Access Journals (Sweden)

Yi Long

2016-01-01

Full Text Available A lower limb assistive exoskeleton is designed to help operators walk or carry payloads. The exoskeleton is required to shadow human motion intent accurately and compliantly to prevent incoordination. If the user’s intention is estimated accurately, a precise position control strategy will improve collaboration between the user and the exoskeleton. In this paper, a hybrid position control scheme, combining sliding mode control (SMC with a cerebellar model articulation controller (CMAC neural network, is proposed to control the exoskeleton to react appropriately to human motion intent. A genetic algorithm (GA is utilized to determine the optimal sliding surface and the sliding control law to improve performance of SMC. The proposed control strategy (SMC_GA_CMAC is compared with three other types of approaches, that is, conventional SMC without optimization, optimal SMC with GA (SMC_GA, and SMC with CMAC compensation (SMC_CMAC, all of which are employed to track the desired joint angular position which is deduced from Clinical Gait Analysis (CGA data. Position tracking performance is investigated with cosimulation using ADAMS and MATLAB/SIMULINK in two cases, of which the first case is without disturbances while the second case is with a bounded disturbance. The cosimulation results show the effectiveness of the proposed control strategy which can be employed in similar exoskeleton systems.

CHARACTERIZING MAGNETOHYDRODYNAMIC TURBULENCE IN THE SMALL MAGELLANIC CLOUD

International Nuclear Information System (INIS)

Burkhart, Blakesley; Stanimirovic, Snezana; Lazarian, A.; Kowal, Grzegorz

2010-01-01

We investigate the nature and spatial variations of turbulence in the Small Magellanic Cloud (SMC) by applying several statistical methods on the neutral hydrogen (H I) column density image of the SMC and a database of isothermal numerical simulations. By using the third and fourth statistical moments we derive the spatial distribution of the sonic Mach number (M s ) across the SMC. We find that about 90% of the H I in the SMC is subsonic or transonic. However, edges of the SMC 'bar' have M s ∼4 and may be tracing shearing or turbulent flows. Using numerical simulations we also investigate how the slope of the spatial power spectrum depends on both sonic and Alfven Mach numbers. This allows us to gauge the Alfven Mach number of the SMC and conclude that its hydrodynamic pressure dominates over the magnetic pressure. The trans-Alfvenic nature of the H I gas in the SMC is also highlighted by the bispectrum, a three-point correlation function which characterizes the level of non-Gaussianity in wave modes. We find that the bispectrum of the SMC H I column density displays similar large-scale correlations as numerical simulations; however, it has localized enhancements of correlations. In addition, we find a break in correlations at a scale of ∼160 pc. This may be caused by numerous expanding shells of a similar size.

Effectiveness of Seasonal Malaria Chemoprevention in Children under Ten Years of Age in Senegal: A Stepped-Wedge Cluster-Randomised Trial.

Directory of Open Access Journals (Sweden)

Badara Cissé

2016-11-01

Full Text Available Seasonal Malaria Chemoprevention (SMC with sulfadoxine-pyrimethamine (SP plus amodiaquine (AQ, given each month during the transmission season, is recommended for children living in areas of the Sahel where malaria transmission is highly seasonal. The recommendation for SMC is currently limited to children under five years of age, but, in many areas of seasonal transmission, the burden in older children may justify extending this age limit. This study was done to determine the effectiveness of SMC in Senegalese children up to ten years of age.SMC was introduced into three districts over three years in central Senegal using a stepped-wedge cluster-randomised design. A census of the population was undertaken and a surveillance system was established to record all deaths and to record all cases of malaria seen at health facilities. A pharmacovigilance system was put in place to detect adverse drug reactions. Fifty-four health posts were randomised. Nine started implementation of SMC in 2008, 18 in 2009, and a further 18 in 2010, with 9 remaining as controls. In the first year of implementation, SMC was delivered to children aged 3-59 months; the age range was then extended for the latter two years of the study to include children up to 10 years of age. Cluster sample surveys at the end of each transmission season were done to measure coverage of SMC and the prevalence of parasitaemia and anaemia, to monitor molecular markers of drug resistance, and to measure insecticide-treated net (ITN use. Entomological monitoring and assessment of costs of delivery in each health post and of community attitudes to SMC were also undertaken. About 780,000 treatments were administered over three years. Coverage exceeded 80% each month. Mortality, the primary endpoint, was similar in SMC and control areas (4.6 and 4.5 per 1000 respectively in children under 5 years and 1.3 and 1.2 per 1000 in children 5-9 years of age; the overall mortality rate ratio [SMC: no SMC

Positive sliding mode control for blood glucose regulation

Science.gov (United States)

Menani, Karima; Mohammadridha, Taghreed; Magdelaine, Nicolas; Abdelaziz, Mourad; Moog, Claude H.

2017-11-01

Biological systems involving positive variables as concentrations are some examples of so-called positive systems. This is the case of the glycemia-insulinemia system considered in this paper. To cope with these physical constraints, it is shown that a positive sliding mode control (SMC) can be designed for glycemia regulation. The largest positive invariant set (PIS) is obtained for the insulinemia subsystem in open and closed loop. The existence of a positive SMC for glycemia regulation is shown here for the first time. Necessary conditions to design the sliding surface and the discontinuity gain are derived to guarantee a positive SMC for the insulin dynamics. SMC is designed to be positive everywhere in the largest closed-loop PIS of plasma insulin system. Two-stage SMC is employed; the last stage SMC2 block uses the glycemia error to design the desired insulin trajectory. Then the plasma insulin state is forced to track the reference via SMC1. The resulting desired insulin trajectory is the required virtual control input of the glycemia system to eliminate blood glucose (BG) error. The positive control is tested in silico on type-1 diabetic patients model derived from real-life clinical data.

MicroRNAs dynamically remodel gastrointestinal smooth muscle cells.

Directory of Open Access Journals (Sweden)

Chanjae Park

2011-04-01

Full Text Available Smooth muscle cells (SMCs express a unique set of microRNAs (miRNAs which regulate and maintain the differentiation state of SMCs. The goal of this study was to investigate the role of miRNAs during the development of gastrointestinal (GI SMCs in a transgenic animal model. We generated SMC-specific Dicer null animals that express the reporter, green fluorescence protein, in a SMC-specific manner. SMC-specific knockout of Dicer prevented SMC miRNA biogenesis, causing dramatic changes in phenotype, function, and global gene expression in SMCs: the mutant mice developed severe dilation of the intestinal tract associated with the thinning and destruction of the smooth muscle (SM layers; contractile motility in the mutant intestine was dramatically decreased; and SM contractile genes and transcriptional regulators were extensively down-regulated in the mutant SMCs. Profiling and bioinformatic analyses showed that SMC phenotype is regulated by a complex network of positive and negative feedback by SMC miRNAs, serum response factor (SRF, and other transcriptional factors. Taken together, our data suggest that SMC miRNAs are required for the development and survival of SMCs in the GI tract.

Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families.

Directory of Open Access Journals (Sweden)

Jessica J R Hudson

2011-02-01

Full Text Available The SMC5-6 protein complex is involved in the cellular response to DNA damage. It is composed of 6-8 polypeptides, of which Nse1, Nse3 and Nse4 form a tight sub-complex. MAGEG1, the mammalian ortholog of Nse3, is the founding member of the MAGE (melanoma-associated antigen protein family and Nse4 is related to the EID (E1A-like inhibitor of differentiation family of transcriptional repressors.Using site-directed mutagenesis, protein-protein interaction analyses and molecular modelling, we have identified a conserved hydrophobic surface on the C-terminal domain of Nse3 that interacts with Nse4 and identified residues in its N-terminal domain that are essential for interaction with Nse1. We show that these interactions are conserved in the human orthologs. Furthermore, interaction of MAGEG1, the mammalian ortholog of Nse3, with NSE4b, one of the mammalian orthologs of Nse4, results in transcriptional co-activation of the nuclear receptor, steroidogenic factor 1 (SF1. In an examination of the evolutionary conservation of the Nse3-Nse4 interactions, we find that several MAGE proteins can interact with at least one of the NSE4/EID proteins.We have found that, despite the evolutionary diversification of the MAGE family, the characteristic hydrophobic surface shared by all MAGE proteins from yeast to humans mediates its binding to NSE4/EID proteins. Our work provides new insights into the interactions, evolution and functions of the enigmatic MAGE proteins.

A Domain-Specific Programming Language for Secure Multiparty Computation

DEFF Research Database (Denmark)

Nielsen, Janus Dam; Schwartzbach, Michael Ignatieff

2007-01-01

We present a domain-specific programming language for Secure Multiparty Computation (SMC). Information is a resource of vital importance and considerable economic value to individuals, public administration, and private companies. This means that the confidentiality of information is crucial...... on secret values and results are only revealed according to specific protocols. We identify the key linguistic concepts of SMC and bridge the gap between high-level security requirements and low-level cryptographic operations constituting an SMC platform, thus improving the efficiency and security of SMC...

Type 2 diabetes impairs venous, but not arterial smooth muscle cell function: Possible role of differential RhoA activity

Energy Technology Data Exchange (ETDEWEB)

Riches, Kirsten [Division of Cardiovascular and Diabetes Research, Leeds Institute of Genetics, Health and Therapeutics (LIGHT), University of Leeds, Leeds (United Kingdom); Multidisciplinary Cardiovascular Research Centre (MCRC), University of Leeds, Leeds (United Kingdom); Warburton, Philip [Division of Cardiovascular and Diabetes Research, Leeds Institute of Genetics, Health and Therapeutics (LIGHT), University of Leeds, Leeds (United Kingdom); O’Regan, David J. [Multidisciplinary Cardiovascular Research Centre (MCRC), University of Leeds, Leeds (United Kingdom); Department of Cardiac Surgery, The Yorkshire Heart Centre, Leeds General Infirmary, Leeds (United Kingdom); Turner, Neil A. [Division of Cardiovascular and Diabetes Research, Leeds Institute of Genetics, Health and Therapeutics (LIGHT), University of Leeds, Leeds (United Kingdom); Multidisciplinary Cardiovascular Research Centre (MCRC), University of Leeds, Leeds (United Kingdom); Porter, Karen E., E-mail: medkep@leeds.ac.uk [Division of Cardiovascular and Diabetes Research, Leeds Institute of Genetics, Health and Therapeutics (LIGHT), University of Leeds, Leeds (United Kingdom); Multidisciplinary Cardiovascular Research Centre (MCRC), University of Leeds, Leeds (United Kingdom)

2014-04-15

Background/purpose: Coronary heart disease is the leading cause of morbidity in patients with type 2 diabetes mellitus (T2DM), frequently resulting in a requirement for coronary revascularization using the internal mammary artery (IMA) or saphenous vein (SV). Patency rates of SV grafts are inferior to IMA and further impaired by T2DM whilst IMA patencies appear similar in both populations. Smooth muscle cells (SMC) play a pivotal role in graft integration; we therefore examined the phenotype and proliferative function of IMA- and SV-SMC isolated from non-diabetic (ND) patients or those diagnosed with T2DM. Methods/materials: SMC were cultured from fragments of SV or IMA. Morphology was analyzed under light microscopy (spread cell area measurements) and confocal microscopy (F-actin staining). Proliferation was analyzed by cell counting. Levels of RhoA mRNA, protein and activity were measured by real-time RT-PCR, western blotting and G-LISA respectively. Results: IMA-SMC from T2DM and ND patients were indistinguishable in both morphology and function. By comparison, SV-SMC from T2DM patients exhibited significantly larger spread cell areas (1.5-fold increase, P < 0.05), truncated F-actin fibers and reduced proliferation (33% reduction, P < 0.05). Furthermore, lower expression and activity of RhoA were observed in SV-SMC of T2DM patients (37% reduction in expression, P < 0.05 and 43% reduction in activity, P < 0.01). Conclusions: IMA-SMC appear impervious to phenotypic modulation by T2DM. In contrast, SV-SMC from T2DM patients exhibit phenotypic and functional changes accompanied by reduced RhoA activity. These aberrancies may be epigenetic in nature, compromising SMC plasticity and SV graft adaptation in T2DM patients. Summary: The internal mammary artery (IMA) is the conduit of choice for bypass grafting and is generally successful in all patients, including those with type 2 diabetes (T2DM). By contrast, saphenous vein (SV) is inferior to IMA and furthermore

The role of cohesin genes in the meiosis of male house mouse

OpenAIRE

Šebestová, Lenka

2015-01-01

Cohesin genes play an important role in cell division. They ensure proper chromosome segregation during mitosis and meiosis. This study is focused on the role of cohesin genes during meiosis in male house mouse (Mus musculus). At first, this study introduces key processes of mammalian meiosis. Next, the structure of cohesin complex is described; it consists of a heterodimer SMC proteins - SMC3 and SMC1α or SMC1β, which are enclosed to the ring by cleavable subunit RAD21, RAD21L or REC8. Fourt...

Multiple facets of sialomucin complex/MUC4, a membrane mucin and erbb2 ligand, in tumors and tissues (Y2K update).

Science.gov (United States)

Carraway, K L; Price-Schiavi, S A; Komatsu, M; Idris, N; Perez, A; Li, P; Jepson, S; Zhu, X; Carvajal, M E; Carraway, C A

2000-01-01

Sialomucin complex (SMC, MUC4) is a high Mr glycoprotein heterodimer, composed of mucin (ASGP-1) and transmembrane (ASGP-2) subunits. ASGP-2 contains two EGF-like domains and acts as an intramembrane ligand for the receptor tyrosine kinase ErbB2. Transfection studies with SMC DNAs showed that SMC expression could markedly reduce both cell-cell and cell-matrix interactions in vitro and increase the growth of primary tumors and the formation of metastatic foci of human A375 melanoma cells as xenotransplants in nude mice, possibly through the ability to suppress apoptosis. SMC is expressed in most vulnerable epithelia as a protective agent, which is found in both membrane and soluble forms at luminal surfaces and secreted into fluids such as milk and tears. SMC appears to be constitutively expressed by most accessible epithelia, notable exceptions being the mammary gland and uterine luminal epithelium, in which it is tightly regulated during pregnancy. Down-regulation at the luminal uterine surface appears necessary for blastocyst implantation. TGF-b is a potent repressor of SMC expression in the mammary gland and uterus, though by different mechanisms. These combined results suggest that SMC has multiple functions in epithelia and is tightly regulated in those tissues where its special functions are required.

Soil moisture decline due to afforestation across the Loess Plateau, China

Science.gov (United States)

Jia, Xiaoxu; Shao, Ming'an; Zhu, Yuanjun; Luo, Yi

2017-03-01

The Loess Plateau of China is a region with one of the most severe cases of soil erosion in the world. Since the 1950s, there has been afforestation measure to control soil erosion and improve ecosystem services on the plateau. However, the introduction of exotic tree species (e.g., R. pseudoacacia, P. tabulaeformis and C. korshinskii) and high-density planting has had a negative effect on soil moisture content (SMC) in the region. Any decrease in SMC could worsen soil water shortage in both the top and deep soil layers, further endangering the sustainability of the fragile ecosystem. This study analyzed the variations in SMC following the conversion of croplands into forests in the Loess Plateau. SMC data within the 5-m soil profile were collected at 50 sites in the plateau region via field survey, long-term in-situ observations and documented literature. The study showed that for the 50 sites, the depth-averaged SMC was much lower under forest than under cropland. Based on in-situ measurements of SMC in agricultural plots and C. korshinskii plots in 2004-2014, SMC in the 0-4 m soil profile in both plots declined significantly (p resources demands in the Loess Plateau.

Enrichment of antibiotic resistance genes in soil receiving composts derived from swine manure, yard wastes, or food wastes, and evidence for multiyear persistence of swine Clostridium spp.

Science.gov (United States)

Scott, Andrew; Tien, Yuan-Ching; Drury, Craig F; Reynolds, W Daniel; Topp, Edward

2018-03-01

The impact of amendment with swine manure compost (SMC), yard waste compost (YWC), or food waste compost (FWC) on the abundance of antibiotic resistance genes in soil was evaluated. Following a commercial-scale application of the composts in a field experiment, soils were sampled periodically for a decade, and archived air-dried. Soil DNA was extracted and gene targets quantified by qPCR. Compared with untreated control soil, all 3 amendment types increased the abundance of gene targets for up to 4 years postapplication. The abundance of several gene targets was much higher in soil amended with SMC than in soil receiving either YWC or FWC. The gene target ermB remained higher in the SMC treatment for a decade postapplication. Clostridia were significantly more abundant in the SMC-amended soil throughout the decade following application. Eight percent of Clostridium spp. isolates from the SMC treatment carried ermB. Overall, addition of organic amendments to soils has the potential to increase the abundance of antibiotic resistance genes. Amendments of fecal origin, such as SMC, will in addition entrain bacteria carrying antibiotic resistance genes. Environmentally recalcitrant clostridia, and the antibiotic resistance genes that they carry, will persist for many years under field conditions following the application of SMC.

Understanding the Relative Contributions of and Critical Enzymes for the Three Pathways for Intracrine Metabolism of Testicular Androgens in Advanced Prostate Cancer

Science.gov (United States)

2017-10-01

Peroxisomal Enzymes: Cytisine-linked Isoflavonoids as Inhibitors of Hydroxysteroid 17-beta-dehydrogenase-4 (HSD17B4) Journal: Org Biomol Chem Volume...J. Chem. 2010, 88, 1233–1239; c) R. A. Valiulin, T. M. Arisco, A. G. Kutateladze, J. Org . Chem. 2011, 76, 1319–1332; d) P. J. Cremins, S. T...Saengchantara, T. W. Wallace, Tetrahedron 1987, 43, 3075–3082; e) R. P. Hsung, J. Org . Chem. 1997, 62, 7904–7905. [11] a) M. Von Strandtmann, M. P. Cohen, J

The role of soil moisture on the coevolution of soil and vegetation in mountain grasslands

Science.gov (United States)

Bertoldi, Giacomo; Claudia, Notarnicola; Brenner, Johannes; Castelli, Mariapina; Greifeneder, Felix; Niedrist, Georg; Seeber, Julia; Tappeiner, Ulrike

2016-04-01

One of the key variables controlling the organization of vegetation and the coevolution of soils and landforms is soil moisture content (SMC). For this reason, understanding the controls on the spatial and temporal patterns of SMC is essential to predict how perturbations in vegetation and climate will affect mountain ecosystem functioning. In this contribution, we focus on the dynamic of surface SMC of water-limited alpine grasslands in the Long Term Ecological Research area Mazia Valley in the European Alps. We analyze the impacts of different land managements (meadows versus pastures) and its relationships with climate and topography. The area has been equipped since 2009 with a network of more than 20 stations, measuring SMC and climatic variables and with two eddy-covariance stations, measuring surface fluxes over meadows and pastures. Monthly biomass production data have been collected and detailed soil and spatial soil moisture surveys are available. Moreover, high spatial resolution SMC maps have been derived from satellites Synthetic Aperture Radar Radar (SAR) images (Sentinel 1 and RADARSAT2 images). Both ground surveys and remote sensing observations show persistent landscape-level patterns. Meadows, in general located in flatter areas, tend to be wetter. This leads to higher vegetation productivity and to the development of soils with higher water holding capacity, thus to a positive feedback on SMC. In contrast, pastures, located on steeper slopes with lower vegetation density and higher soil erosion, tend to be drier, leading to a negative feedback on SMC and soil development. This co-evolution of land cover and SMC leads therefore to persistent spatial patterns. In order to understand quantitatively such linked interactions, a sensitivity analysis has been performed with the GEOtop hydrological model. Results show how both abiotic (mainly slope and elevation) and anthropogenic (irrigation and soil management) factors exert a significant control on

Perceptions of HIV and Safe Male Circumcision in High HIV Prevalence Fishing Communities on Lake Victoria, Uganda.

Directory of Open Access Journals (Sweden)

Paul E Nevin

Full Text Available In 2010, the Uganda Ministry of Health introduced its Safe Male Circumcision (SMC strategy for HIV prevention with the goal of providing 4.2 million voluntary medical male circumcisions by 2015. Fishing communities, where HIV prevalence is approximately 3-5 times higher than the national average, have been identified as a key population needing targeted HIV prevention services by the National HIV Prevention Strategy. This study aimed to understand perceptions of HIV and identify potential barriers and facilitators to SMC in fishing communities along Lake Victoria.We conducted 8 focus group discussions, stratified by sex and age, with 67 purposefully sampled participants in 4 communities in Kalangala District, Uganda.There was universal knowledge of the availability of SMC services, but males reported high uptake in the community while females indicated that it is low. Improved hygiene, disease prevention, and improved sexual performance and desirability were reported facilitators. Barriers included a perceived increase in SMC recipients' physiological libido, post-surgical abstinence, lost income during convalescence, and lengthier recovery due to occupational hazards. Both males and females reported concerns about spousal fidelity during post-SMC abstinence. Reported misconceptions and community-held cultural beliefs include fear that foreskins are sold after their removal, the belief that a SMC recipient's first sexual partner after the procedure should not be his spouse, and the belief that vaginal fluids aid circumcision wound healing.Previous outreach efforts have effectively reached these remote communities, where availability and health benefits of SMC are widely understood. However, community-specific intervention strategies are needed to address the barriers identified in this study. We recommend the development of targeted counseling, outreach, and communication strategies to address barriers, misconceptions, and community-held beliefs

Dust in the small Magellanic cloud. 1: Interstellar polarization and extinction data

Science.gov (United States)

Magalhaes, A. M.; Rodrigues, C. V.; Coyne, C. V.; Piirola, V.

1996-01-01

The typical extinction curve for the Small Magellanic Cloud (SMC), in contrast to that for the Galaxy, has no bump at 2175 A and has a steeper rise into the far ultraviolet. For the Galaxy the interpretation of the extinction and, therefore, the dust content of the interstellar medium has been greatly assisted by measurements of the wavelength dependence of the polarization. For the SMC no such measurements existed. Therefore, to further elucidate the dust properties in the SMC we have for the first time measured linear polarization with five colors in the optical region of the spectrum for a sample of reddened stars. For two of these stars, for which there were no existing UV spectrophotometric measurements, but for which we measured a relatively large polarization, we have also obtained data from the International Ultraviolet Explorer (IUE) in order to study the extinction. We also attempt to correlate the SMC extinction and polarization data. The main results are: the wavelength of maximum polarization, lambda(sub max), in the SMC is typically smaller than that in the Galaxy; however, AZC 456, which shows the UV extinction bump, has a lambda(sub max) typical of that in the Galaxy, but its polarization curve is narrower and its bump is shifted to shorter wavelengths as compared to the Galaxy; and from an analysis of both the extinction and polarization data it appears that the SMC has typically smaller grains than those in the Galaxy. The absence of the extinction bump in the SMC has generally been thought to imply a lower carbon abundance in the SMC compared to the Galaxy. We interpret our results to mean that te size distribution of the interstellar grains, and not only the carbon abundance, is different in the SMC as compared to the Galaxy. In Paper 2 we present dust model fits to these observations.

Satellite medical centers project

Science.gov (United States)

Aggarwal, Arvind

2002-08-01

World class health care for common man at low affordable cost: anywhere, anytime The project envisages to set up a national network of satellite Medical centers. Each SMC would be manned by doctors, nurses and technicians, six doctors, six nurses, six technicians would be required to provide 24 hour cover, each SMC would operate 24 hours x 7 days. It would be equipped with the Digital telemedicine devices for capturing clinical patient information and investigations in the form of voice, images and data and create an audiovisual text file - a virtual Digital patient. Through the broad band connectivity the virtual patient can be sent to the central hub, manned by specialists, specialists from several specialists sitting together can view the virtual patient and provide a specialized opinion, they can see the virtual patient, see the examination on line through video conference or even PCs, talk to the patient and the doctor at the SMC and controlle capturing of information during examination and investigations of the patient at the SMC - thus creating a virtual Digital consultant at the SMC. Central hub shall be connected to the doctors and consultants in remote locations or tertiary care hospitals any where in the world, thus creating a virtual hub the hierarchical system shall provide upgradation of knowledge to thedoctors in central hub and smc and thus continued medical education and benefit the patient thru the world class treatment in the smc located at his door step. SMC shall be set up by franchisee who shall get safe business opportunity with high returns, patients shall get Low cost user friendly worldclass health care anywhere anytime, Doctors can get better meaningful selfemplyment with better earnings, flexibility of working time and place. SMC shall provide a wide variety of services from primary care to world class Global consultation for difficult patients.

Effects of spent mushroom compost application on the physicochemical properties of a degraded soil

Directory of Open Access Journals (Sweden)

İ. Gümüş

2017-11-01

Full Text Available Under field and laboratory conditions, the application of organic amendments has generally shown an improvement in soil physicochemical properties. Here, spent mushroom compost (SMC is proposed as a suitable organic amendment for soil structure restoration. Our study assessed the impact of SMC on the physicochemical properties of a weak-structured and physically degraded soil. The approach involved the establishment of a pot experiment with SMC applications into soil (control, 0.5, 1, 2, 4 and 8 %. Soils were incubated at field capacity (−33 kPa for 21, 42, and 62 days under laboratory conditions. SMC applications into the soil significantly increased the aggregate stability (AS and decreased the modulus of rupture. The application of SMC at rates of 1, 2, 4, and 8 % significantly increased the total nitrogen and soil organic carbon contents of the degraded soil at all incubation periods (p < 0.05. The results obtained in this study indicate that the application of SMC can improve soil physicochemical properties, which may benefit farmers, land managers, and mushroom growers.

Effects of spent mushroom compost application on the physicochemical properties of a degraded soil

Science.gov (United States)

Gümüş, İlknur; Şeker, Cevdet

2017-11-01

Under field and laboratory conditions, the application of organic amendments has generally shown an improvement in soil physicochemical properties. Here, spent mushroom compost (SMC) is proposed as a suitable organic amendment for soil structure restoration. Our study assessed the impact of SMC on the physicochemical properties of a weak-structured and physically degraded soil. The approach involved the establishment of a pot experiment with SMC applications into soil (control, 0.5, 1, 2, 4 and 8 %). Soils were incubated at field capacity (-33 kPa) for 21, 42, and 62 days under laboratory conditions. SMC applications into the soil significantly increased the aggregate stability (AS) and decreased the modulus of rupture. The application of SMC at rates of 1, 2, 4, and 8 % significantly increased the total nitrogen and soil organic carbon contents of the degraded soil at all incubation periods (p < 0.05). The results obtained in this study indicate that the application of SMC can improve soil physicochemical properties, which may benefit farmers, land managers, and mushroom growers.

Soil Moisture Content Estimation Based on Sentinel-1 and Auxiliary Earth Observation Products. A Hydrological Approach.

Science.gov (United States)

Alexakis, Dimitrios D; Mexis, Filippos-Dimitrios K; Vozinaki, Anthi-Eirini K; Daliakopoulos, Ioannis N; Tsanis, Ioannis K

2017-06-21

A methodology for elaborating multi-temporal Sentinel-1 and Landsat 8 satellite images for estimating topsoil Soil Moisture Content (SMC) to support hydrological simulation studies is proposed. After pre-processing the remote sensing data, backscattering coefficient, Normalized Difference Vegetation Index (NDVI), thermal infrared temperature and incidence angle parameters are assessed for their potential to infer ground measurements of SMC, collected at the top 5 cm. A non-linear approach using Artificial Neural Networks (ANNs) is tested. The methodology is applied in Western Crete, Greece, where a SMC gauge network was deployed during 2015. The performance of the proposed algorithm is evaluated using leave-one-out cross validation and sensitivity analysis. ANNs prove to be the most efficient in SMC estimation yielding R² values between 0.7 and 0.9. The proposed methodology is used to support a hydrological simulation with the HEC-HMS model, applied at the Keramianos basin which is ungauged for SMC. Results and model sensitivity highlight the contribution of combining Sentinel-1 SAR and Landsat 8 images for improving SMC estimates and supporting hydrological studies.

PDGF-DD, a novel mediator of smooth muscle cell phenotypic modulation, is upregulated in endothelial cells exposed to atherosclerosis-prone flow patterns.

Science.gov (United States)

Thomas, James A; Deaton, Rebecca A; Hastings, Nicole E; Shang, Yueting; Moehle, Christopher W; Eriksson, Ulf; Topouzis, Stavros; Wamhoff, Brian R; Blackman, Brett R; Owens, Gary K

2009-02-01

Platelet-derived growth factor (PDGF)-BB is a well-known smooth muscle (SM) cell (SMC) phenotypic modulator that signals by binding to PDGF alphaalpha-, alphabeta-, and betabeta-membrane receptors. PDGF-DD is a recently identified PDGF family member, and its role in SMC phenotypic modulation is unknown. Here we demonstrate that PDGF-DD inhibited expression of multiple SMC genes, including SM alpha-actin and SM myosin heavy chain, and upregulated expression of the potent SMC differentiation repressor gene Kruppel-like factor-4 at the mRNA and protein levels. On the basis of the results of promoter-reporter assays, changes in SMC gene expression were mediated, at least in part, at the level of transcription. Attenuation of the SMC phenotypic modulatory activity of PDGF-DD by pharmacological inhibitors of ERK phosphorylation and by a small interfering RNA to Kruppel-like factor-4 highlight the role of these two pathways in this process. PDGF-DD failed to repress SM alpha-actin and SM myosin heavy chain in mouse SMCs lacking a functional PDGF beta-receptor. Importantly, PDGF-DD expression was increased in neointimal lesions in the aortic arch region of apolipoprotein C-deficient (ApoE(-/-)) mice. Furthermore, human endothelial cells exposed to an atherosclerosis-prone flow pattern, as in vascular regions susceptible to the development of atherosclerosis, exhibited a significant increase in PDGF-DD expression. These findings demonstrate a novel activity for PDGF-DD in SMC biology and highlight the potential contribution of this molecule to SMC phenotypic modulation in the setting of disturbed blood flow.

Structure of the Elastin-Contractile Units in the Thoracic Aorta and How Genes That Cause Thoracic Aortic Aneurysms and Dissections Disrupt This Structure.

Science.gov (United States)

Karimi, Ashkan; Milewicz, Dianna M

2016-01-01

The medial layer of the aorta confers elasticity and strength to the aortic wall and is composed of alternating layers of smooth muscle cells (SMCs) and elastic fibres. The SMC elastin-contractile unit is a structural unit that links the elastin fibres to the SMCs and is characterized by the following: (1) layers of elastin fibres that are surrounded by microfibrils; (2) microfibrils that bind to the integrin receptors in focal adhesions on the cell surface of the SMCs; and (3) SMC contractile filaments that are linked to the focal adhesions on the inner side of the membrane. The genes that are altered to cause thoracic aortic aneurysms and aortic dissections encode proteins involved in the structure or function of the SMC elastin-contractile unit. Included in this gene list are the genes encoding protein that are structural components of elastin fibres and microfibrils, FBN1, MFAP5, ELN, and FBLN4. Also included are genes that encode structural proteins in the SMC contractile unit, including ACTA2, which encodes SMC-specific α-actin and MYH11, which encodes SMC-specific myosin heavy chain, along with MYLK and PRKG1, which encode kinases that control SMC contraction. Finally, mutations in the gene encoding the protein linking integrin receptors to the contractile filaments, FLNA, also predispose to thoracic aortic disease. Thus, these data suggest that functional SMC elastin-contractile units are important for maintaining the structural integrity of the aorta. Copyright © 2016 Canadian Cardiovascular Society. Published by Elsevier Inc. All rights reserved.

Mission Operations and Information Management Area Spacecraft Monitoring and Control Working Group

Science.gov (United States)

Lokerson, Donald C. (Editor)

2005-01-01

Working group goals for this year are: Goal 1. Due to many review comments the green books will be updated and available for re-review by CCSDS. Submission of green books to CCSDS for approval. Goal 2.Initial set of 4 new drafts of the red books as following: SM&C protocol: update with received comments. SM&C common services: update with received comments and expand the service specification. SM&C core services: update with received comments and expand the service the information model. SM&C time services: (target objective): produce initial draft following template of core services.

Fibulin-2 is present in murine vascular lesions and is important for smooth muscle cell migration

DEFF Research Database (Denmark)

Ström, A.; Olin, A. I.; Aspberg, A.

2006-01-01

/hyaluronan complexes, an ECM network that has been suggested to be important during tissue repair. In this study we have analysed the presence of fibulin-2 in two different models of murine vascular lesions. We have also examined how the fibulin-2/versican network influences SMC migration. Methods: Presence of fibulin......Objective: The vascular extracellular matrix (ECM) can affect smooth muscle cell (SMC) adhesion, migration and proliferation-events that are important during the atherosclerotic process. Fibulin-2 is a member of the ECM protein family of fibulins and has been found to cross-link versican...... and is upregulated during SMC phenotypic modulation in cell culture. Moreover, treatments with peptides that block the interaction between versican and fibulin-2 inhibit SMC migration in vitro. Conclusions: Fibulin-2 can be produced by SMC as a response to injury and may participate in the ECM organisation...

Activation of the Ca2+/calcineurin/NFAT2 pathway controls smooth muscle cell differentiation

International Nuclear Information System (INIS)

Larrieu, Daniel; Thiebaud, Pierre; Duplaa, Cecile; Sibon, Igor; Theze, Nadine; Lamaziere, Jean-Marie Daniel

2005-01-01

Cellular mechanisms controlling smooth muscle cells (SMCs) phenotypic modulation are largely unknown. Intracellular Ca 2+ movements are essential to ensure SMC functions; one of the roles of Ca 2+ is to regulate calcineurin, which in turn induces nuclear localization of the nuclear factor of activated T-cell (NFAT). In order to investigate, during phenotypic differentiation of SMCs, the effect of calcineurin inhibition on NFAT 2 nuclear translocation, we used a culture model of SMC differentiation in serum-free conditions. We show that the treatment of cultured SMC with the calcineurin inhibitor cyclosporine A induced their dedifferentiation while preventing their differentiation. These findings suggest that nuclear translocation of NFAT 2 is dependent of calcineurin activity during the in vitro SMC differentiation kinetic and that the nuclear presence of NFAT 2 is critical in the acquisition and maintenance of SMC differentiation

A Sliding Mode Control-Based on a RBF Neural Network for Deburring Industry Robotic Systems

Directory of Open Access Journals (Sweden)

Yong Tao

2016-01-01

Full Text Available A sliding mode control method based on radial basis function (RBF neural network is proposed for the deburring of industry robotic systems. First, a dynamic model for deburring the robot system is established. Then, a conventional SMC scheme is introduced for the joint position tracking of robot manipulators. The RBF neural network based sliding mode control (RBFNN-SMC has the ability to learn uncertain control actions. In the RBFNN-SMC scheme, the adaptive tuning algorithms for network parameters are derived by a Koski function algorithm to ensure the network convergences and enacts stable control. The simulations and experimental results of the deburring robot system are provided to illustrate the effectiveness of the proposed RBFNN-SMC control method. The advantages of the proposed RBFNN-SMC method are also evaluated by comparing it to existing control schemes.

Magnetic Resonance Volumetry: Prediction of Subjective Memory Complaints and Mild Cognitive Impairment, and Associations with Genetic and Cardiovascular Risk Factors

Directory of Open Access Journals (Sweden)

Sigbjørn Rogne

2016-11-01

Full Text Available Background/Aims: Subjective memory complaints (SMC are strong predictors of mild cognitive impairment (MCI and subsequent Alzheimer’s disease. Our aims were to see if fully automated cerebral MR volume measurements could distinguish subjects with SMC and MCI from controls, and if probable parental late-onset Alzheimer’s disease (LOAD, apolipoprotein E ε4 genotype, total plasma homocysteine, and cardiovascular risk factors were associated with MR volumetric findings. Methods: 198 stroke-free subjects comprised the control (n = 58, the SMC (n = 25 and the MCI (n = 115 groups. Analysis of covariance and receiver operating characteristic curve was used to see if MR volumetry distinguished subjects with SMC and MCI from controls. Results: Subjects with SMC and MCI had significantly larger lateral ventricles and smaller hippocampal volumes than controls. The area under the curve in subjects with SMC and MCI compared to that of controls was less than 0.68 for all volumes of intracranial structures. There was an interaction between sex and probable parental LOAD for hippocampal volume, with a significant association between probable parental LOAD and hippocampal volume in women. Conclusions: Fully automated MR volumetry can distinguish subjects with SMC and MCI from controls in a general population, but insufficiently to assume a clear clinical role. Research on sporadic LOAD might benefit from a sex-specific search for genetic risk factors.

A tidally stripped stellar component of the Magellanic bridge

Energy Technology Data Exchange (ETDEWEB)

Nidever, David L.; Monachesi, Antonela; Bell, Eric F. [Department of Astronomy, University of Michigan, Ann Arbor, MI 48104 (United States); Majewski, Steven R.; Beaton, Rachael L. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904-4325 (United States); Muñoz, Ricardo R., E-mail: dnidever@umich.edu, E-mail: rmunoz@das.uchile.cl [Departamento de Astronomía, Universidad de Chile, Casilla 36-D, Santiago (Chile)

2013-12-20

Deep photometry of the Small Magellanic Cloud (SMC) stellar periphery (R = 4°, 4.2 kpc) is used to study its line-of-sight depth with red clump (RC) stars. The RC luminosity function is affected little by young (≲1 Gyr) blue-loop stars in these regions because their main-sequence counterparts are not observed in the color-magnitude diagrams. The SMCs eastern side is found to have a large line-of-sight depth (∼23 kpc) while the western side has a much shallower depth (∼10 kpc), consistent with previous photographic plate photometry results. We use a model SMC RC luminosity function to deconvolve the observed RC magnitudes and construct the density function in distance for our fields. Three of the eastern fields show a distance bimodality with one component at the 'systemic' ∼67 kpc SMC distance and a second component at ∼55 kpc. Our data are not reproduced well by the various extant Magellanic Cloud and Stream simulations. However, the models predict that the known H I Magellanic Bridge (stretching from the SMC eastward toward the Large Magellanic Cloud, LMC) has a decreasing distance with angle from the SMC and should be seen in both the gaseous and stellar components. From comparison with these models, we conclude that the most likely explanation for our newly identified ∼55 kpc stellar structure in the eastern SMC is a stellar counterpart of the H I Magellanic Bridge that was tidally stripped from the SMC ∼200 Myr ago during a close encounter with the LMC. This discovery has important implications for microlensing surveys of the SMC.

Characterization of putative receptors specific for quercetin on bovine aortic smooth-muscle cells

International Nuclear Information System (INIS)

Yu, S.C.; Becker, C.G.

1986-01-01

The authors have reported that tobacco glycoprotein (TGP), rutin-bovine serum albumin conjugates (R-BSA), quercetin, and chlorogenic acid are mitogenic for bovine aortic smooth-muscle cells (SMC). To investigate whether there are binding sites or receptors for these polyphenol-containing molecules on SMC, the authors have synthesized 125 I-labeled rutin-bovine serum albumin ([ 125 I]R-BSA) of high specific activity (20 Ci/mmol). SMC were isolated from a bovine thoracic aorta and maintained in Eagle's minimum essential medium with 10% calf serum in culture. These SMC at early subpassages were suspended (3-5 x 10 7 cells/ml) in phosphate-buffered saline and incubated with [ 125 I]R-BSA (10 pmol) in the presence or absence of 200-fold unlabeled R-BSA, TGP, BSA, rutin, quercetin or related polyphenols, and catecholamines. Binding of [ 125 I]R-BSA to SMC was found to be reproducible and the radioligand was displaced by R-BSA, and also by TGP, rutin, quercetin, and chlorogenic acid, but not by BSA, ellagic acid, naringin, hesperetin, dopamine, epinephrine, or isoproterenol. The binding was saturable, reversible, and pH-dependent. These results demonstrate the presence of specific binding sites for quercetinon arterial SMC

A new fuzzy-disturbance observer-enhanced sliding controller for vibration control of a train-car suspension with magneto-rheological dampers

Science.gov (United States)

Nguyen, Sy Dzung; Choi, Seung-Bok; Nguyen, Quoc Hung

2018-05-01

Semi-active train-car suspensions are always impacted negatively by uncertainty and disturbance (UAD). In order to deal with this, we propose a novel optimal fuzzy disturbance observer-enhanced sliding mode controller (FDO-SMC) for magneto-rheological damper (MRD)-based semi-active train-car suspensions subjected to UAD whose variability rate may be high but bounded. The two main parts of the FDO-SMC are an adaptive sliding mode controller (ad-SMC) and an optimal fuzzy disturbance observer (op-FDO). As the first step, the initial structures of the sliding mode controller (SMC) and disturbance observer (DO) are built. Adaptive update laws for the SMC and DO are then set up synchronously via Lyapunov stability analysis. Subsequently, an optimal fuzzy system (op-FS) is designed to fully implement a parameter constraint mechanism so as to guarantee the system stability converging to the desired state even if the UAD variability rate increases in a given range. As a result, both the ad-SMC and op-FDO are formulated. It is shown from the comparative work with existing controllers that the proposed method provides the best vibration control capability with relatively low consumed power.

Condensin HEAT subunits required for DNA repair, kinetochore/centromere function and ploidy maintenance in fission yeast.

Directory of Open Access Journals (Sweden)

Xingya Xu

Full Text Available Condensin, a central player in eukaryotic chromosomal dynamics, contains five evolutionarily-conserved subunits. Two SMC (structural maintenance of chromosomes subunits contain ATPase, hinge, and coiled-coil domains. One non-SMC subunit is similar to bacterial kleisin, and two other non-SMC subunits contain HEAT (similar to armadillo repeats. Here we report isolation and characterization of 21 fission yeast (Schizosaccharomyces pombe mutants for three non-SMC subunits, created using error-prone mutagenesis that resulted in single-amino acid substitutions. Beside condensation, segregation, and DNA repair defects, similar to those observed in previously isolated SMC and cnd2 mutants, novel phenotypes were observed for mutants of HEAT-repeats containing Cnd1 and Cnd3 subunits. cnd3-L269P is hypersensitive to the microtubule poison, thiabendazole, revealing defects in kinetochore/centromere and spindle assembly checkpoints. Three cnd1 and three cnd3 mutants increased cell size and doubled DNA content, thereby eliminating the haploid state. Five of these mutations reside in helix B of HEAT repeats. Two non-SMC condensin subunits, Cnd1 and Cnd3, are thus implicated in ploidy maintenance.

Surfactant-assisted pretreatment and enzymatic hydrolysis of spent mushroom compost for the production of sugars.

Science.gov (United States)

Kapu, N U S; Manning, M; Hurley, T B; Voigt, J; Cosgrove, D J; Romaine, C P

2012-06-01

Spent mushroom compost (SMC), a byproduct of commercial mushroom cultivation, poses serious environmental problems that have hampered the growth of this important agro-industry. In an effort to develop new applications for SMC, we explored its use as a feedstock for bioethanol production. SMC constitutes approximately 30%w/w polysaccharides, 66% of which is glucan. Following dilute-acid pretreatment and enzymatic hydrolysis, both in the presence of PEG 6000, 97% of glucan and 44% of xylan in SMC were converted into the corresponding monosaccharides. Incorporation of PEG 6000 reduced the cellulase requirement by 77%. Zwittergent 3-12 and 3-14 also significantly increased the efficacy of acid pretreatment and enzymatic hydrolysis. The use of SMC in bioethanol production represents a potential mitigation solution for the critical environmental issues associated with the stockpiling of the major byproduct of the mushroom industry. Copyright © 2012 Elsevier Ltd. All rights reserved.

Polymer stabilization of the smectic C-alpha* liquid crystal phase—Over tenfold thermal stabilization by confining networks of photo-polymerized reactive mesogens

International Nuclear Information System (INIS)

Labeeb, A.; Gleeson, H. F.; Hegmann, T.

2015-01-01

The smectic C*-alpha (SmC α *) phase is one of the sub-phases of ferroelectric liquid crystals that has drawn much interest due to its electro-optical properties and ultrafast switching. Generally observed above the ferroelectric SmC* phase in temperature, the SmC α * commonly shows only very narrow phase temperature range of a few degree Celsius. To broaden the SmC α * phase, polymer stabilization was investigated for thermal phase stabilization. Two different reactive monomers were tested in three mixtures, and all three broadened the temperature range of the SmC α * phase from 3 °C to 39 °C. The current reversal method was used to determine the phase existence versus temperature. Moreover, the texture and network structure was studied by polarized optical microscopy and scanning electron microscopy, with the latter revealing the confinement of the smectic layer structure within the porous polymer network

Population I Cepheids and understanding star formation history of the Small Magellanic Cloud

International Nuclear Information System (INIS)

Joshi, Yogesh Chandra; Joshi, Santosh; Mohanty, Auro Prasad

2016-01-01

In this paper, we study the age and spatial distributions of Cepheids in the Small Magellanic Cloud (SMC) as a function of their ages using data from the OGLE III photometric catalogue. A period - age relation derived for Classical Cepheids in the Large Magellanic Cloud (LMC) has been used to find the ages of Cepheids. The age distribution of the SMC Classical Cepheids is found to have a peak at log(Age) = 8.40 ± 0.10 which suggests that a major star formation event might have occurred in the SMC about 250 ± 50 Myr ago. It is believed that this star forming burst had been triggered by close interactions of the SMC with the LMC and/or the Milky Way. A comparison of the observed spatial distributions of the Cepheids and open star clusters has also been carried out to study the star formation scenario in the SMC. (paper)

The Three-dimensional Structure of the Small Magellanic Cloud

Science.gov (United States)

Subramanian, Smitha; Subramaniam, Annapurni

2012-01-01

The three-dimensional structure of the inner Small Magellanic Cloud (SMC) is investigated using the red clump (RC) stars and the RR Lyrae stars (RRLS), which represent the intermediate-age and the old stellar populations of a galaxy. The V- and I-band photometric data from the OGLE III catalog are used for our study. The mean dereddened I 0 magnitude of the RC stars and the RRLS are used to study the relative positions of the different regions in the SMC with respect to the mean SMC distance. This shows that the northeastern part of the SMC is closer to us. The line-of-sight depth (front to back distance) across the SMC is estimated using the dispersion in the I 0 magnitudes of both the RC stars and the RRLS and found to be large (~14 kpc) for both populations. The similarity in their depth distribution suggests that both of these populations occupy a similar volume of the SMC. The surface density distribution and the radial density profile of the RC stars suggest that they are more likely to be distributed in a nearly spheroidal system. The tidal radius estimated for the SMC system is ~7-12 kpc. An elongation along the NE-SW direction is seen in the surface density map of the RC stars. The surface density distribution of the RRLS in the SMC is nearly circular. Based on all of the above results the observed structure of the SMC, in which both the RC stars and RRLS are distributed, is approximated as a triaxial ellipsoid. The parameters of the ellipsoid are obtained using the inertia tensor analysis. We estimated the axes ratio, inclination of the longest axis with the line of sight (i), and the position angle (phi) of the longest axis of the ellipsoid on the sky from the analysis of the RRLS. The analysis of the RC stars with the assumption that they are extended up to a depth of 3.5 times the sigma (width of dereddened I 0 magnitude distribution, corrected for intrinsic spread and observational errors) was also found to give similar axes ratio and orientation

Resveratrol blocks interleukin-18-EMMPRIN cross-regulation and smooth muscle cell migration

OpenAIRE

Venkatesan, Balachandar; Valente, Anthony J.; Reddy, Venkatapuram Seenu; Siwik, Deborah A.; Chandrasekar, Bysani

2009-01-01

Vascular smooth muscle cell (SMC) migration is an important mechanism in atherogenesis and postangioplasty arterial remodeling. Previously, we demonstrated that the proinflammatory cytokine interleukin (IL)-18 is a potent inducer of SMC migration. Since extracellular matrix metalloproteinase inducer (EMMPRIN) stimulates ECM degradation and facilitates cell migration, we investigated whether IL-18 and EMMPRIN regulate each other's expression, whether their cross talk induces SMC migration, and...

Effect of pH, Temperature, and Chemicals on the Endoglucanases and β-Glucosidases from the Thermophilic Fungus Myceliophthora heterothallica F.2.1.4. Obtained by Solid-State and Submerged Cultivation

Directory of Open Access Journals (Sweden)

Vanessa de Cássia Teixeira da Silva

2016-01-01

Full Text Available This work reports endoglucanase and beta-glucosidase production by the thermophilic fungus Myceliophthora heterothallica in solid-state (SSC and submerged (SmC cultivation. Wheat bran and sugarcane bagasse were used for SSC and cardboard for SmC. Highest endoglucanase production in SSC occurred after 192 hours: 1,170.6 ± 0.8 U/g, and in SmC after 168 hours: 2,642 ± 561 U/g. The endoglucanases and beta-glucosidases produced by both cultivation systems showed slight differences concerning their optimal pH and temperature. The number of endoglucanases was also different: six isoforms in SSC and ten in SmC. Endoglucanase activity remained above 50% after incubation between pH 3.0 and 9.0 for 24 h for both cultivation systems. The effect of several chemicals displayed variation between SSC and SmC isoenzymes. Manganese activated the enzymes from SmC but inhibited those from SSC. For β-glucosidases, maximum production on SmC was 244 ± 48 U/g after 168 hours using cardboard as carbon source. In SSC maximum production reached 10.9 ± 0.3 U/g after 240 h with 1 : 1 wheat bran and sugarcane bagasse. Manganese exerted a significant activation on SSC β-glucosidases, and glucose inhibited the enzymes from both cultivation systems. FeCl3 exerted the strongest inhibition for endoglucanases and β-glucosidases.

Experimental study on effect of dexamethasone to the in-stent restenosis after vascular intervention

International Nuclear Information System (INIS)

Wang Jianbo; Yang Jianyong; Chen Wei; Zhuang Wenquan; Li Jiaping; Zhang Longjuan

2007-01-01

Objective: To evaluate the effect of dexamethasone to the cultured rat thoracic aortic smooth muscle cells (SMC) in vitro, and explore the role on it's prevention and cure for the in-stent restenosis after vascular intervention. Methods: The rat thoracic aortic SMC were harvested and cultured for six to ten passages. The cultured SMC were synchronized and then restimutated to enter the cell cycle, and treated with incremental concentrations of dexamethasone or without dexamethasone as control. The proliferative assay was performed with MTT method in the different time points after treatment. RT-PCR was performed to assay the level of proliferating cell nuclear antigen (PCNA) mRNA. Results: 1. Dexamethasone progressively inhibited rat aortic SMC proliferation in a concentration-dependent fashion. The A value was statistically significant for different concentrations (F=36.02, P -6 and 10 -5 mol/L (P=0.065) or between 10 -11 mol/L and control group (P 0.567). 2. RT-PCR suggested dexamethasone significantly decreased rat aortic SMC PCNA mRNA transcription in a concentration-dependent fashion. Statistical analysis indicated F=15.407 and P -9 or 10 -11 mol/L groups by post hoc analysis. Conclusions: Dexamethasone inhibits rat aortic SMC proliferation in a concentration- dependent fashion. The data suggest that effective action concentration is 10 -7 mol/L with persistent time up to 96 hours or more. Dexamethasone may play the inhibit role to SMC at lower concentration with prolonging action time. (authors)

THE MID-INFRARED PERIOD-LUMINOSITY RELATIONS FOR THE SMALL MAGELLANIC CLOUD CEPHEIDS DERIVED FROM SPITZER ARCHIVAL DATA

International Nuclear Information System (INIS)

Ngeow, Chow-Choong; Kanbur, Shashi M.

2010-01-01

In this paper, we derive the Spitzer IRAC band period-luminosity (P-L) relations for the Small Magellanic Cloud (SMC) Cepheids, by matching the Spitzer archival SAGE-SMC data with the OGLE-III SMC Cepheids. We find that the 3.6 μm and 4.5 μm band P-L relations can be better described using two P-L relations with a break period at log(P) = 0.4: this is consistent with similar results at optical wavelengths for SMC P-L relations. The 5.8 μm and 8.0 μm band P-L relations do not extend to sufficiently short periods to enable a similar detection of a slope change at log(P) = 0.4. The slopes of the SMC P-L relations, for log(P) > 0.4, are consistent with their Large Magellanic Cloud counterparts that were derived from a similar data set. They are also in agreement with those obtained from a small sample of Galactic Cepheids with parallax measurements.

Tube Model Predictive Control with an Auxiliary Sliding Mode Controller

Directory of Open Access Journals (Sweden)

Miodrag Spasic

2016-07-01

Full Text Available This paper studies Tube Model Predictive Control (MPC with a Sliding Mode Controller (SMC as an auxiliary controller. It is shown how to calculate the tube widths under SMC control, and thus how much the constraints of the nominal MPC have to be tightened in order to achieve robust stability and constraint fulfillment. The analysis avoids the assumption of infinitely fast switching in the SMC controller.

Endothelial and Smooth Muscle Cell Interaction via FoxM1 Signaling Mediates Vascular Remodeling and Pulmonary Hypertension.

Science.gov (United States)

Dai, Zhiyu; Zhu, Maggie M; Peng, Yi; Jin, Hua; Machireddy, Narsa; Qian, Zhijian; Zhang, Xianming; Zhao, You-Yang

2018-04-17

Angioproliferative vasculopathy is a hallmark of pulmonary arterial hypertension (PAH). However, little is known how endothelial cell (EC) and smooth muscle cell (SMC) crosstalk regulates the angioproliferative vascular remodeling. We aimed to investigate the role of EC and SMC interaction and underlying signaling pathways in PH development. SMC-specific Foxm1 or Cxcr4 knockout mice, EC-specific Foxm1 or Egln1 knockout mice, as well as EC-specific Egln1/Cxcl12 double knockout mice were used to assess the role of FoxM1 on SMC proliferation and PH. Lung tissues and cells from PAH patients were employed to validate clinical relevance. FoxM1 inhibitor Thiostrepton was used in Sugen 5416/hypoxia- and monocrotaline-challenged rats. FoxM1 expression was markedly upregulated in lungs and pulmonary arterial SMCs of idiopathic PAH patients and 4 discrete PH rodent models. Mice with SMC- (but not EC-) specific deletion of Foxm1 were protected from hypoxia- or Sugen 5416/hypoxia-induced PH. The upregulation of FoxM1 in SMCs induced by multiple EC-derived factors (PDGF-B, CXCL12, ET-1 and MIF) mediated SMC proliferation. Genetic deletion of endothelial Cxcl12 in Egln1Tie2Cre mice or loss of its cognate receptor Cxcr4 in SMCs in hypoxia-treated mice inhibited FoxM1 expression, SMC proliferation and PH. Accordingly, pharmacological inhibition of FoxM1 inhibited severe PH in both Sugen 5416/hypoxia and monocrotaline-challenged rats. Multiple factors derived from dysfunctional ECs induced FoxM1 expression in SMCs and activated FoxM1-dependent SMC proliferation which contributes to pulmonary vascular remodeling and PH. Thus, targeting FoxM1 signaling represents a novel strategy for treatment of IPAH.

On the Nature of Ultra-faint Dwarf Galaxy Candidates. I. DES1, Eridanus III, and Tucana V

Science.gov (United States)

Conn, Blair C.; Jerjen, Helmut; Kim, Dongwon; Schirmer, Mischa

2018-01-01

We use deep Gemini/GMOS-S g, r photometry to study the three ultra-faint dwarf galaxy candidates DES1, Eridanus III (Eri III), and Tucana V (Tuc V). Their total luminosities, M V (DES1) = ‑1.42 ± 0.50 and M V (Eri III) = ‑2.07 ± 0.50, and mean metallicities, [{Fe}/{{H}}]=-{2.38}-0.19+0.21 and [{Fe}/{{H}}]=-{2.40}-0.12+0.19, are consistent with them being ultra-faint dwarf galaxies, as they fall just outside the 1σ confidence band of the luminosity–metallicity relation for Milky Way satellite galaxies. However, their positions in the size–luminosity relation suggest that they are star clusters. Interestingly, DES1 and Eri III are at relatively large Galactocentric distances, with DES1 located at {D}{GC}=74+/- 4 {kpc} and Eri III at {D}{GC}=91+/- 4 {kpc}. In projection, both objects are in the tail of gaseous filaments trailing the Magellanic Clouds and have similar 3D separations from the Small Magellanic Cloud (SMC): {{Δ }}{D}{SMC,{DES}1}=31.7 kpc and {{Δ }}{D}{SMC,{Eri}{III}}=41.0 kpc, respectively. It is plausible that these stellar systems are metal-poor SMC satellites. Tuc V represents an interesting phenomenon in its own right. Our deep photometry at the nominal position of Tuc V reveals a low-level excess of stars at various locations across the GMOS field without a well-defined center. An SMC Northern Overdensity–like isochrone would be an adequate match to the Tuc V color–magnitude diagram, and the proximity to the SMC (12.°1 {{Δ }}{D}{SMC,{Tuc}{{V}}}=13 kpc) suggests that Tuc V is either a chance grouping of stars related to the SMC halo or a star cluster in an advanced stage of dissolution.

Modeling the Impact of Uganda's Safe Male Circumcision Program: Implications for Age and Regional Targeting.

Science.gov (United States)

Kripke, Katharine; Vazzano, Andrea; Kirungi, William; Musinguzi, Joshua; Opio, Alex; Ssempebwa, Rhobbinah; Nakawunde, Susan; Kyobutungi, Sheila; Akao, Juliet N; Magala, Fred; Mwidu, George; Castor, Delivette; Njeuhmeli, Emmanuel

2016-01-01

Uganda aims to provide safe male circumcision (SMC) to 80% of men ages 15-49 by 2016. To date, only 2 million men have received SMC of the 4.2 million men required. In response to age and regional trends in SMC uptake, the country sought to re-examine its targets with respect to age and subnational region, to assess the program's progress, and to refine the implementation approach. The Decision Makers' Program Planning Tool, Version 2.0 (DMPPT 2.0), was used in conjunction with incidence projections from the Spectrum/AIDS Impact Module (AIM) to conduct this analysis. Population, births, deaths, and HIV incidence and prevalence were used to populate the model. Baseline male circumcision prevalence was derived from the 2011 AIDS Indicator Survey. Uganda can achieve the most immediate impact on HIV incidence by circumcising men ages 20-34. This group will also require the fewest circumcisions for each HIV infection averted. Focusing on men ages 10-19 will offer the greatest impact over a 15-year period, while focusing on men ages 15-34 offers the most cost-effective strategy over the same period. A regional analysis showed little variation in cost-effectiveness of scaling up SMC across eight regions. Scale-up is cost-saving in all regions. There is geographic variability in program progress, highlighting two regions with low baseline rates of circumcision where additional efforts will be needed. Focusing SMC efforts on specific age groups and regions may help to accelerate Uganda's SMC program progress. Policy makers in Uganda have already used model outputs in planning efforts, proposing males ages 10-34 as a priority group for SMC in the 2014 application to the Global Fund's new funding model. As scale-up continues, the country should also consider a greater effort to expand SMC in regions with low MC prevalence.

Modeling the Impact of Uganda's Safe Male Circumcision Program: Implications for Age and Regional Targeting.

Directory of Open Access Journals (Sweden)

Katharine Kripke

Full Text Available Uganda aims to provide safe male circumcision (SMC to 80% of men ages 15-49 by 2016. To date, only 2 million men have received SMC of the 4.2 million men required. In response to age and regional trends in SMC uptake, the country sought to re-examine its targets with respect to age and subnational region, to assess the program's progress, and to refine the implementation approach.The Decision Makers' Program Planning Tool, Version 2.0 (DMPPT 2.0, was used in conjunction with incidence projections from the Spectrum/AIDS Impact Module (AIM to conduct this analysis. Population, births, deaths, and HIV incidence and prevalence were used to populate the model. Baseline male circumcision prevalence was derived from the 2011 AIDS Indicator Survey. Uganda can achieve the most immediate impact on HIV incidence by circumcising men ages 20-34. This group will also require the fewest circumcisions for each HIV infection averted. Focusing on men ages 10-19 will offer the greatest impact over a 15-year period, while focusing on men ages 15-34 offers the most cost-effective strategy over the same period. A regional analysis showed little variation in cost-effectiveness of scaling up SMC across eight regions. Scale-up is cost-saving in all regions. There is geographic variability in program progress, highlighting two regions with low baseline rates of circumcision where additional efforts will be needed.Focusing SMC efforts on specific age groups and regions may help to accelerate Uganda's SMC program progress. Policy makers in Uganda have already used model outputs in planning efforts, proposing males ages 10-34 as a priority group for SMC in the 2014 application to the Global Fund's new funding model. As scale-up continues, the country should also consider a greater effort to expand SMC in regions with low MC prevalence.

Engineering blood vessels through micropatterned co-culture of vascular endothelial and smooth muscle cells on bilayered electrospun fibrous mats with pDNA inoculation.

Science.gov (United States)

Liu, Yaowen; Lu, Jinfu; Li, Huinan; Wei, Jiaojun; Li, Xiaohong

2015-01-01

Although engineered blood vessels have seen important advances during recent years, proper mechanical strength and vasoactivity remain unsolved problems. In the current study, micropatterned fibrous mats were created to load smooth muscle cells (SMC), and a co-culture with endothelial cells (EC) was established through overlaying on an EC-loaded flat fibrous mat to mimic the layered structure of a blood vessel. A preferential distribution of SMC was determined in the patterned regions throughout the fibrous scaffolds, and aligned fibers in the patterned regions provided topological cues to guide the orientation of SMC with intense actin filaments and extracellular matrix (ECM) production in a circumferential direction. Plasmid DNA encoding basic fibroblast growth factors and vascular endothelial growth factor were integrated into electrospun fibers as biological cues to promote SMC infiltration into fibrous mats, and the viability and ECM production of both EC and SMC. The layered fibrous mats with loaded EC and SMC were wrapped into a cylinder, and engineered vessels were obtained with compact EC and SMC layers after co-culture for 3 months. Randomly oriented ECM productions of EC formed a continuous endothelium covering the entire lumenal surface, and a high alignment of ECM was shown in the circumferential direction of SMC layers. The tensile strength, strain at failure and suture retention strength were higher than those of the human femoral artery, and the burst pressure and radial compliance were in the same range as the human saphenous vein, indicating potential as blood vessel substitutes for transplantation in vivo. Thus, the establishment of topographical cues and biochemical signals in fibrous scaffolds demonstrates advantages in modulating cellular behavior and organization found in complex multicellular tissues. Copyright © 2014 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

Comparison between SAR Soil Moisture Estimates and Hydrological Model Simulations over the Scrivia Test Site

Directory of Open Access Journals (Sweden)

Alberto Pistocchi

2013-10-01

Full Text Available In this paper, the results of a comparison between the soil moisture content (SMC estimated from C-band SAR, the SMC simulated by a hydrological model, and the SMC measured on ground are presented. The study was carried out in an agricultural test site located in North-west Italy, in the Scrivia river basin. The hydrological model used for the simulations consists of a one-layer soil water balance model, which was found to be able to partially reproduce the soil moisture variability, retaining at the same time simplicity and effectiveness in describing the topsoil. SMC estimates were derived from the application of a retrieval algorithm, based on an Artificial Neural Network approach, to a time series of ENVISAT/ASAR images acquired over the Scrivia test site. The core of the algorithm was represented by a set of ANNs able to deal with the different SAR configurations in terms of polarizations and available ancillary data. In case of crop covered soils, the effect of vegetation was accounted for using NDVI information, or, if available, for the cross-polarized channel. The algorithm results showed some ability in retrieving SMC with RMSE generally <0.04 m3/m3 and very low bias (i.e., <0.01 m3/m3, except for the case of VV polarized SAR images: in this case, the obtained RMSE was somewhat higher than 0.04 m3/m3 (≤0.058 m3/m3. The algorithm was implemented within the framework of an ESA project concerning the development of an operative algorithm for the SMC retrieval from Sentinel-1 data. The algorithm should take into account the GMES requirements of SMC accuracy (≤5% in volume, spatial resolution (≤1 km and timeliness (3 h from observation. The SMC estimated by the SAR algorithm, the SMC estimated by the hydrological model, and the SMC measured on ground were found to be in good agreement. The hydrological model simulations were performed at two soil depths: 30 and 5 cm and showed that the 30 cm simulations indicated, as expected, SMC

Expression of TGF-β in Fractures Fixed by Nitinol Swan-like Memory Compressive Connectors

Science.gov (United States)

Li, M.; Zhang, C. C.; Xu, S. G.; Fu, Q. G.

2011-07-01

In this article, the effect of internal fixation of a Nitinol swan-like memory compressive connector (SMC) on the temporal expression of transforming growth factor-β (TGF-β) at fracture sites is evaluated. Specimens were collected from 35 New Zealand rabbits modeled for bilateral humeral fracture fixed with either SMC or stainless dynamic compression plate (DCP). Five rabbits each were killed at day 1, 3, 7, 14, 21, 28, and 56. The local positive staining potency, positive area ratio, and positive index of TGF-β were measured using an immunohistochemistry approach (EnVision) in combination with a computerized image analysis system. TGF-β staining was seen in mesenchymal cells, osteoblasts, chondrocytes, and in the extracellular matrix of fractures fixed in both the SMC and the DCP samples without a significant difference in staining at both the early stages (days 1 and 3) and day 56. A higher TGF-β content was observed in the fractures fixed with SMC when compared to that of DCP from day 7 to 28. As a conclusion, TGF-β is highly expressed in fractures fixed with SMC during chondrogenesis stage and entochondrostosis stage. Finally, the mechanism of how SMC promoting synthesis and secretion of TGF-β in the process of fracture healing has been discussed.

Allium White Rot Suppression with Composts and Trichoderma viride in Relation to Sclerotia Viability.

Science.gov (United States)

Coventry, E; Noble, R; Mead, A; Marin, F R; Perez, J A; Whipps, J M

2006-09-01

ABSTRACT Allium white rot (AWR) is a serious disease of Allium spp. caused by the sclerotium-forming fungus Sclerotium cepivorum. This work has examined the effects of onion waste compost (OWC) and spent mushroom compost (SMC), with and without Trichoderma viride S17A, on sclerotia viability and AWR in glasshouse and field experiments. Incorporation of OWC into soil reduced the viability of sclerotia and the incidence of AWR on onion plants in glasshouse pot bioassays, whereas SMC or T. viride S17A only reduced incidence of AWR. In two field trials, OWC reduced sclerotia viability and was as effective in reducing AWR as a fungicide (Folicur, a.i. tebuconazole). Field application of SMC had no effect on sclerotia viability and did not control AWR. However, the addition of T. viride S17A to SMC facilitated proliferation of T. viride S17A in the soil and increased the healthy onion bulb yield. The results indicate two mechanisms for the suppression of AWR: (i) reduction in the soil population of viable sclerotia, which may be due to volatile sulfur compounds detected in OWC but absent in SMC, and (ii) prevention of infection of onion plants from sclerotia following amendment of soil with OWC, SMC, or T. viride S17A.

Myostatin, a profibrotic factor and the main inhibitor of striated muscle mass, is present in the penile and vascular smooth muscle.

Science.gov (United States)

Kovanecz, I; Masouminia, M; Gelfand, R; Vernet, D; Rajfer, J; Gonzalez-Cadavid, N F

2017-09-01

Myostatin is present in striated myofibers but, except for myometrial cells, has not been reported within smooth muscle cells (SMC). We investigated in the rat whether myostatin is present in SMC within the penis and the vascular wall and, if so, whether it is transcriptionally expressed and associated with the loss of corporal SMC occurring in certain forms of erectile dysfunction (ED). Myostatin protein was detected by immunohistochemistry/fluorescence and western blots in the perineal striated muscles, and also in the SMC of the penile corpora, arteries and veins, and aorta. Myostatin was found in corporal SMC cultures, and its transcriptional expression (and its receptor) was shown there by DNA microarrays. Myostatin protein was measured by western blots in the penile shaft of rats subjected to bilateral cavernosal nerve resection (BCNR), that were left untreated, or treated (45 days) with muscle-derived stem cells (MDSC), or concurrent daily low-dose sildenafil. Myostatin was not increased by BCNR (compared with sham operated animals), but over expressed after treatment with MDSC. This was reduced by concurrent sildenafil. The presence of myostatin in corporal and vascular SMC, and its overexpression in the corpora by MDSC therapy, may have relevance for the stem cell treatment of corporal fibrosis and ED.

THE THREE-DIMENSIONAL STRUCTURE OF THE SMALL MAGELLANIC CLOUD

International Nuclear Information System (INIS)

Subramanian, Smitha; Subramaniam, Annapurni

2012-01-01

The three-dimensional structure of the inner Small Magellanic Cloud (SMC) is investigated using the red clump (RC) stars and the RR Lyrae stars (RRLS), which represent the intermediate-age and the old stellar populations of a galaxy. The V- and I-band photometric data from the OGLE III catalog are used for our study. The mean dereddened I 0 magnitude of the RC stars and the RRLS are used to study the relative positions of the different regions in the SMC with respect to the mean SMC distance. This shows that the northeastern part of the SMC is closer to us. The line-of-sight depth (front to back distance) across the SMC is estimated using the dispersion in the I 0 magnitudes of both the RC stars and the RRLS and found to be large (∼14 kpc) for both populations. The similarity in their depth distribution suggests that both of these populations occupy a similar volume of the SMC. The surface density distribution and the radial density profile of the RC stars suggest that they are more likely to be distributed in a nearly spheroidal system. The tidal radius estimated for the SMC system is ∼7-12 kpc. An elongation along the NE-SW direction is seen in the surface density map of the RC stars. The surface density distribution of the RRLS in the SMC is nearly circular. Based on all of the above results the observed structure of the SMC, in which both the RC stars and RRLS are distributed, is approximated as a triaxial ellipsoid. The parameters of the ellipsoid are obtained using the inertia tensor analysis. We estimated the axes ratio, inclination of the longest axis with the line of sight (i), and the position angle (φ) of the longest axis of the ellipsoid on the sky from the analysis of the RRLS. The analysis of the RC stars with the assumption that they are extended up to a depth of 3.5 times the sigma (width of dereddened I 0 magnitude distribution, corrected for intrinsic spread and observational errors) was also found to give similar axes ratio and orientation

SwissProt search result: AK110012 [KOME

Lifescience Database Archive (English)

Full Text Available ulfate proteoglycan 6) (Chromosome segregation protein SmcD) (Bamacan) (Basement membrane-associated chondroitin proteoglycan) (Mad member-interacting protein 1) SMC3_MOUSE 1e-14 ...

SwissProt search result: AK105135 [KOME

Lifescience Database Archive (English)

Full Text Available ulfate proteoglycan 6) (Chromosome segregation protein SmcD) (Bamacan) (Basement membrane-associated chondroitin proteoglycan) (Mad member-interacting protein 1) SMC3_MOUSE 3e-61 ...

SwissProt search result: AK065733 [KOME

Lifescience Database Archive (English)

Full Text Available lfate proteoglycan 6) (Chromosome segregation protein SmcD) (Bamacan) (Basement membrane-associated chondroitin proteoglycan) (Mad member-interacting protein 1) SMC3_MOUSE 4e-18 ...

SwissProt search result: AK242597 [KOME

Lifescience Database Archive (English)

Full Text Available lfate proteoglycan 6) (Chromosome segregation protein SmcD) (Bamacan) (Basement membrane-associated chondroitin proteoglycan) (Mad member-interacting protein 1) SMC3_MOUSE 5e-19 ...

SwissProt search result: AK103514 [KOME

Lifescience Database Archive (English)

Full Text Available lfate proteoglycan 6) (Chromosome segregation protein SmcD) (Bamacan) (Basement membrane-associated chondroitin proteoglycan) (Mad member-interacting protein 1) SMC3_MOUSE 1e-33 ...

SwissProt search result: AK120333 [KOME

Lifescience Database Archive (English)

Full Text Available lfate proteoglycan 6) (Chromosome segregation protein SmcD) (Bamacan) (Basement membrane-associated chondroitin proteoglycan) (Mad member-interacting protein 1) SMC3_MOUSE 2e-18 ...

SwissProt search result: AK064293 [KOME

Lifescience Database Archive (English)

Full Text Available ulfate proteoglycan 6) (Chromosome segregation protein SmcD) (Bamacan) (Basement membrane-associated chondroitin proteoglycan) (Mad member-interacting protein 1) SMC3_MOUSE 2e-15 ...

Models of Tidally Induced Gas Filaments in the Magellanic Stream

Science.gov (United States)

Pardy, Stephen A.; D’Onghia, Elena; Fox, Andrew J.

2018-04-01

The Magellanic Stream and Leading Arm of H I that stretches from the Large and Small Magellanic Clouds (LMC and SMC) and over 200° of the Southern sky is thought to be formed from multiple encounters between the LMC and SMC. In this scenario, most of the gas in the Stream and Leading Arm is stripped from the SMC, yet recent observations have shown a bifurcation of the Trailing Arm that reveals LMC origins for some of the gas. Absorption measurements in the Stream also reveal an order of magnitude more gas than in current tidal models. We present hydrodynamical simulations of the multiple encounters between the LMC and SMC at their first pass around the Milky Way, assuming that the Clouds were more extended and gas-rich in the past. Our models create filamentary structures of gas in the Trailing Stream from both the LMC and SMC. While the SMC trailing filament matches the observed Stream location, the LMC filament is offset. In addition, the total observed mass of the Stream in these models is underestimated by a factor of four when the ionized component is accounted for. Our results suggest that there should also be gas stripped from both the LMC and SMC in the Leading Arm, mirroring the bifurcation in the Trailing Stream. This prediction is consistent with recent measurements of spatial variation in chemical abundances in the Leading Arm, which show that gas from multiple sources is present, although its nature is still uncertain.

Disruption of TGF-β signaling in smooth muscle cell prevents flow-induced vascular remodeling

Energy Technology Data Exchange (ETDEWEB)

Gao, Fu [Department of Vascular Surgery, Peking University People’s Hospital, Beijing (China); Chambon, Pierre [Institut de Génétique et de Biologie Moléculaire et Cellulaire (CNRS UMR7104, INSERM U596, ULP, Collége de France) and Institut Clinique de la Souris, ILLKIRCH, Strasbourg (France); Tellides, George [Department of Surgery, Interdepartmental Program in Vascular Biology and Therapeutics, Yale University School of Medicine, New Haven, CT (United States); Kong, Wei [Department of Physiology and Pathophysiology, Basic Medical College of Peking University, Beijing (China); Zhang, Xiaoming, E-mail: rmygxgwk@163.com [Department of Vascular Surgery, Peking University People’s Hospital, Beijing (China); Li, Wei [Department of Vascular Surgery, Peking University People’s Hospital, Beijing (China)

2014-11-07

Highlights: • TGF-β signaling in SMC contributes to the flow-induced vascular remodeling. • Disruption of TGF-β signaling in SMC can prevent this process. • Targeting SM-specific Tgfbr2 could be a novel therapeutic strategy for vascular remodeling. - Abstract: Transforming growth factor-β (TGF-β) signaling has been prominently implicated in the pathogenesis of vascular remodeling, especially the initiation and progression of flow-induced vascular remodeling. Smooth muscle cells (SMCs) are the principal resident cells in arterial wall and are critical for arterial remodeling. However, the role of TGF-β signaling in SMC for flow-induced vascular remodeling remains unknown. Therefore, the goal of our study was to determine the effect of TGF-β pathway in SMC for vascular remodeling, by using a genetical smooth muscle-specific (SM-specific) TGF-β type II receptor (Tgfbr2) deletion mice model. Mice deficient in the expression of Tgfbr2 (MyhCre.Tgfbr2{sup f/f}) and their corresponding wild-type background mice (MyhCre.Tgfbr2{sup WT/WT}) underwent partial ligation of left common carotid artery for 1, 2, or 4 weeks. Then the carotid arteries were harvested and indicated that the disruption of Tgfbr2 in SMC provided prominent inhibition of vascular remodeling. And the thickening of carotid media, proliferation of SMC, infiltration of macrophage, and expression of matrix metalloproteinase (MMP) were all significantly attenuated in Tgfbr2 disruption mice. Our study demonstrated, for the first time, that the TGF-β signaling in SMC plays an essential role in flow-induced vascular remodeling and disruption can prevent this process.

Lessons in ambivalence: The Shanghai Municipal Council's opium policies, 1906-1917.

Science.gov (United States)

Zhang, Yong-An; Du, Yilun

2016-11-01

Shanghai was considered to be a "capital of opium" in modern China, hence the history of opium in the city has received significant attention. In the Shanghai International Settlement, where Chinese and foreigners lived as neighbours, drugs were considered by the administration as both "trouble maker", and important financial resource. This paper explores how the Shanghai Municipal Council (SMC), the most senior governing body in the settlement, used its position to maximize political and economic profit from the trade and consumption of opium. The paper is based on documentary analysis of records of the SMC board meetings and other related material stored at Shanghai Municipal Archives. Interpretive approaches were used to analyze the shifting SMC strategies on opium consumption, the competing power relations and the way they were negotiated between actors with a stake in the region, including semi-colonialism and world systems analysis. With the dual purpose of preventing damage and enhancing municipal management, the SMC introduced a licensing system permitting the consumption and trade of drugs. However, the anti-opium policies of the late Qing government and the Anglo-Chinese 10 Year Agreement meant SMC had to shut down opium "houses" (opium dens) and "shops" (for the sale of opium to be consumed off the premises). Over almost a decade, the SMC shifted emphasis from political regulation of a social, recreational practice to maximizing financial benefit. In the process, SMC made full use of the opportunities it gained from a period of ambivalent Chinese and British power relations and local community rule. Copyright © 2016 Elsevier B.V. All rights reserved.

THE TIDAL ORIGIN OF THE MAGELLANIC STREAM AND THE POSSIBILITY OF A STELLAR COUNTERPART

Energy Technology Data Exchange (ETDEWEB)

Diaz, Jonathan D.; Bekki, Kenji, E-mail: jdiaz@ast.cam.ac.uk [ICRAR, M468, University of Western Australia, 35 Stirling Highway, Crawley, Western Australia, 6009 (Australia)

2012-05-01

We present an N-body model that reproduces the morphology and kinematics of the Magellanic Stream (MS), a vast neutral hydrogen (H I) structure that trails behind the Large and Small Magellanic Clouds (LMC and SMC, respectively) in their orbit about the Milky Way (MW). After investigating 8 Multiplication-Sign 10{sup 6} possible orbits consistent with the latest proper motions, we adopt an orbital history in which the LMC and SMC have only recently become a strongly interacting binary pair. We find that their first close encounter {approx}2 Gyr ago provides the necessary tidal forces to disrupt the disk of the SMC and thereby create the MS. The model also reproduces the on-sky bifurcation of the two filaments of the MS, and we suggest that a bound association with the MW is required to reproduce the bifurcation. Additional H I structures are created during the tidal evolution of the SMC disk, including the Magellanic Bridge, the 'Counter-Bridge', and two branches of leading material. Insights into the chemical evolution of the LMC are also provided, as a substantial fraction of the material stripped away from the SMC is engulfed by the LMC. Lastly, we compare three different N-body realizations of the stellar component of the SMC, which we model as a pressure-supported spheroid motivated by recent kinematical observations. We find that an extended spheroid is better able to explain the stellar periphery of the SMC, and the tidal evolution of the spheroid may imply the existence of a stellar stream akin to the gaseous MS.

3D Representative Volume Element Reconstruction of Fiber Composites via Orientation Tensor and Substructure Features

Energy Technology Data Exchange (ETDEWEB)

Li, Yi; Chen, Wei; Xu, Hongyi; Jin, Xuejun

2016-01-01

To provide a seamless integration of manufacturing processing simulation and fiber microstructure modeling, two new stochastic 3D microstructure reconstruction methods are proposed for two types of random fiber composites: random short fiber composites, and Sheet Molding Compounds (SMC) chopped fiber composites. A Random Sequential Adsorption (RSA) algorithm is first developed to embed statistical orientation information into 3D RVE reconstruction of random short fiber composites. For the SMC composites, an optimized Voronoi diagram based approach is developed for capturing the substructure features of SMC chopped fiber composites. The proposed methods are distinguished from other reconstruction works by providing a way of integrating statistical information (fiber orientation tensor) obtained from material processing simulation, as well as capturing the multiscale substructures of the SMC composites.

A Hybrid Scheme Motion Controller by Sliding Mode and Two-Degree-of-Freedom Controls to Minimize the Chattering

Directory of Open Access Journals (Sweden)

Chiu-Keng Lai

2014-01-01

Full Text Available Sliding mode control (SMC is rapped for the chattering due to high gain control. However, high gain control causes the system robust. For developing a system with robustness of SMC, a servo motor motion controller combining the two-degree-of-freedom (2DOF system and SMC is proposed. The discussed motion type is point-to-point control with the constraint of trapezoid velocity profile. SMC is designed to guide the motor motion to follow a predefined trail, and the inner 2DOF system is used to compensate the deterioration due to the adoption of load observer. The proposed hybrid system is realized on a PC-based motion controller, and the validness is verified by simulation and experimental results.

A Sliding Mode Control-based on a RBF Neural Network for Deburring Industry Robotic Systems

OpenAIRE

Tao, Yong; Zheng, Jiaqi; Lin, Yuanchang

2016-01-01

A sliding mode control method based on radial basis function (RBF) neural network is proposed for the deburring of industry robotic systems. First, a dynamic model for deburring the robot system is established. Then, a conventional SMC scheme is introduced for the joint position tracking of robot manipulators. The RBF neural network based sliding mode control (RBFNN-SMC) has the ability to learn uncertain control actions. In the RBFNN-SMC scheme, the adaptive tuning algorithms for network par...

Societal marketing concept and spirituality in the workplace theory: finding the common ground

Directory of Open Access Journals (Sweden)

Anselmo Ferreira Vasconcelos

Full Text Available This paper suggests that there exist many theoretical linkages between the societal marketing concept (SMC and spirituality in the workplace (SWP theory. Thus, it is reviewed the literature of both SMC and the emerging field of SWP theory in order to find unexplored commonalities between them. As a result, it acknowledges that SMC broached a new perspective in marketing discipline regarding that it added sizeable social and ethical responsibility to the marketer's role. Most importantly, it posits that the common ground between SMC and SWP theory is, in large measure, the moral reasoning. Overall, this study expands McKee's work (2003 on theoretical intersections between marketing and the spirituality philosophy or paradigm. Rather, it proposes that there is a clear evidence of theoretical overlapping in some constructs, namely, employees, work, workplace, quality of life, ethics, corporate citizenship, and social responsibility. In addition, it is also proposed that SMC-driven organizations are poised to embrace an overall spiritual orientation - whether they have not already done it.

Interstellar Gas-phase Element Depletions in the Small Magellanic Cloud: A Guide to Correcting for Dust in QSO Absorption Line Systems

Energy Technology Data Exchange (ETDEWEB)

Jenkins, Edward B. [Princeton University Observatory, Princeton, NJ 08544-1001 (United States); Wallerstein, George, E-mail: ebj@astro.princeton.edu, E-mail: walleg@u.washington.edu [University of Washington, Seattle, Dept. of Astronomy, Seattle, WA 98195-1580 (United States)

2017-04-01

We present data on the gas-phase abundances for 9 different elements in the interstellar medium of the Small Magellanic Cloud (SMC), based on the strengths of ultraviolet absorption features over relevant velocities in the spectra of 18 stars within the SMC. From this information and the total abundances defined by the element fractions in young stars in the SMC, we construct a general interpretation on how these elements condense into solid form onto dust grains. As a group, the elements Si, S, Cr, Fe, Ni, and Zn exhibit depletion sequences similar to those in the local part of our Galaxy defined by Jenkins. The elements Mg and Ti deplete less rapidly in the SMC than in the Milky Way, and Mn depletes more rapidly. We speculate that these differences might be explained by the different chemical affinities to different existing grain substrates. For instance, there is evidence that the mass fractions of polycyclic aromatic hydrocarbons in the SMC are significantly lower than those in the Milky Way. We propose that the depletion sequences that we observed for the SMC may provide a better model for interpreting the element abundances in low-metallicity Damped Lyman Alpha (DLA) and sub-DLA absorption systems that are recorded in the spectra of distant quasars and gamma-ray burst afterglows.

In vivo proton dosimetry using a MOSFET detector in an anthropomorphic phantom with tissue inhomogeneity.

Science.gov (United States)

Kohno, Ryosuke; Hotta, Kenji; Matsubara, Kana; Nishioka, Shie; Matsuura, Taeko; Kawashima, Mitsuhiko

2012-03-08

When in vivo proton dosimetry is performed with a metal-oxide semiconductor field-effect transistor (MOSFET) detector, the response of the detector depends strongly on the linear energy transfer. The present study reports a practical method to correct the MOSFET response for linear energy transfer dependence by using a simplified Monte Carlo dose calculation method (SMC). A depth-output curve for a mono-energetic proton beam in polyethylene was measured with the MOSFET detector. This curve was used to calculate MOSFET output distributions with the SMC (SMC(MOSFET)). The SMC(MOSFET) output value at an arbitrary point was compared with the value obtained by the conventional SMC(PPIC), which calculates proton dose distributions by using the depth-dose curve determined by a parallel-plate ionization chamber (PPIC). The ratio of the two values was used to calculate the correction factor of the MOSFET response at an arbitrary point. The dose obtained by the MOSFET detector was determined from the product of the correction factor and the MOSFET raw dose. When in vivo proton dosimetry was performed with the MOSFET detector in an anthropomorphic phantom, the corrected MOSFET doses agreed with the SMC(PPIC) results within the measurement error. To our knowledge, this is the first report of successful in vivo proton dosimetry with a MOSFET detector.

The VMC survey - XXVI. Structure of the Small Magellanic Cloud from RR Lyrae stars

Science.gov (United States)

Muraveva, T.; Subramanian, S.; Clementini, G.; Cioni, M.-R. L.; Palmer, M.; van Loon, J. Th.; Moretti, M. I.; de Grijs, R.; Molinaro, R.; Ripepi, V.; Marconi, M.; Emerson, J.; Ivanov, V. D.

2018-01-01

We present results from the analysis of 2997 fundamental mode RR Lyrae variables located in the Small Magellanic Cloud (SMC). For these objects, near-infrared time series photometry from the VISTA survey of the Magellanic Clouds system (VMC) and visual light curves from the OGLE IV (Optical Gravitational Lensing Experiment IV) survey are available. In this study, the multi-epoch Ks-band VMC photometry was used for the first time to derive intensity-averaged magnitudes of the SMC RR Lyrae stars. We determined individual distances to the RR Lyrae stars from the near-infrared period-absolute magnitude-metallicity (PM_{K_s}Z) relation, which has some advantages in comparison with the visual absolute magnitude-metallicity (MV-[Fe/H]) relation, such as a smaller dependence of the luminosity on interstellar extinction, evolutionary effects and metallicity. The distances we have obtained were used to study the three-dimensional structure of the SMC. The distribution of the SMC RR Lyrae stars is found to be ellipsoidal. The actual line-of-sight depth of the SMC is in the range 1-10 kpc, with an average depth of 4.3 ± 1.0 kpc. We found that RR Lyrae stars in the eastern part of the SMC are affected by interactions of the Magellanic Clouds. However, we do not see a clear bimodality observed for red clump stars, in the distribution of RR Lyrae stars.

Effects of Anodal High-Definition Transcranial Direct Current Stimulation on Bilateral Sensorimotor Cortex Activation During Sequential Finger Movements: An fNIRS Study.

Science.gov (United States)

Muthalib, Makii; Besson, Pierre; Rothwell, John; Ward, Tomas; Perrey, Stephane

2016-01-01

Transcranial direct current stimulation (tDCS) is a non-invasive electrical brain stimulation technique that can modulate cortical neuronal excitability and activity. This study utilized functional near infrared spectroscopy (fNIRS) neuroimaging to determine the effects of anodal high-definition (HD)-tDCS on bilateral sensorimotor cortex (SMC) activation. Before (Pre), during (Online), and after (Offline) anodal HD-tDCS (2 mA, 20 min) targeting the left SMC, eight healthy subjects performed a simple finger sequence (SFS) task with their right or left hand in an alternating blocked design (30-s rest and 30-s SFS task, repeated five times). In order to determine the level of bilateral SMC activation during the SFS task, an Oxymon MkIII fNIRS system was used to measure from the left and right SMC, changes in oxygenated (O2Hb) and deoxygenated (HHb) haemoglobin concentration values. The fNIRS data suggests a finding that compared to the Pre condition both the "Online" and "Offline" anodal HD-tDCS conditions induced a significant reduction in bilateral SMC activation (i.e., smaller decrease in HHb) for a similar motor output (i.e., SFS tap rate). These findings could be related to anodal HD-tDCS inducing a greater efficiency of neuronal transmission in the bilateral SMC to perform the same SFS task.

Kinetics of vein graft hyperplasia

International Nuclear Information System (INIS)

Zwolak, R.M.; Adams, M.C.; Clowes, A.W.

1986-01-01

Human aortocoronary vein grafts fail due to accelerated occlusive disease. The possibility that this is related to cellular hyperplasia was investigated in a rabbit model where kinetics of vein graft thickening, endothelial (EC) repair, and smooth muscle cell (SMC) proliferation were measured from 2 days to 24 weeks after implanting jugular vein segments in the carotid artery. Immediately after graft placement focal EC denudation was observed. These defects were repaired within 1 week and did not recur. By 4 weeks intimal area had increased 30 fold from 0.028 +/- 0.004 to 0.705 +/- 0.021 mm 2 , and a 24 weeks was 0.93 +/- 0.21 mm 2 . This response did not produce a reduction in graft lumen area. EC and SMC thymidine-labeling index were measured by en face and cross-section autoradiography after injection of 3 H-thymidine and perfusion fixation. Despite rapid EC surface repair EC labeling index remained elevated and only returned to normal levels at 12 weeks; SMC labeling was 10 fold greater than baseline even at 24 weeks (0.22% vs 0.02%). SMC mass demonstrated morphometrically increased between 2 and 12 weeks. Intimal thickening in vein grafts is due to SMC proliferation and develops after the EC layer has been restored. In contrast, intimal SMC proliferate in damaged arteries when the EC layer is absent and cease when the EC layer is regenerated

The MRI study of the sphincter muscle complex in congenital anorectal malformations

International Nuclear Information System (INIS)

Tang Shaotao; Mao Yongzhong; Wang Yong; Dong Ning; Ruan Qinglan; Peng Zhenjun; Kong Xiangquan; Liu Dingxi

2007-01-01

Objective: To evaluate the development of the sphincter muscle complex (SMC) and defecation function in pediatric patients with congenital anorectal malformations (ARM). Methods: A total of 64 children underwent MRI, among whom 39 were patients with ARM, and the others were patients without ARM undergoing MRI because of other dieases. The dimensions of the SMC in different planes were evaluated with different sequences and coils. The relationship between the SMC development and the defecation function was investigated. Results: In control group, the absolute value of SMC width was (3.63 ± 0.22)mm, which had a high correlation with age (r=0.998, P 0.05). The SMCs in intermediate ARM patients [muscle index (MI)=0.47 ± 0.05] and low ARM patients (MI=0.49 ± 0.05) were well developed. The SMCs in a portion of patients with high ARM (MI=0.28 ± 0.06) were poorly developed, when MI≤0.18, anorectal contraction pressure was significantly lower (t=3.55, P 0.18[(0.85 ± 0.20) vs (2.24 ± 1.02) kPa]. The length of anal canal with high-pressure[(10.88 ± 3.64) vs (20.26 ± 4.34)mm] was shorter (t= 5.18, P 0.18, the anorectal angle was less than 90 degrees, and normal continent function was found in 21 of 23 cases (91%). Conclusion: MRI can be employed to evaluate the development of SMC in patients with ARM, MI was an objective criteria to evaluate the development of SMC. When MI≤0.18, maldevelopment of SMC will be highly suspected. (authors)

Functional vascular smooth muscle cells derived from human induced pluripotent stem cells via mesenchymal stem cell intermediates

Science.gov (United States)

Bajpai, Vivek K.; Mistriotis, Panagiotis; Loh, Yuin-Han; Daley, George Q.; Andreadis, Stelios T.

2012-01-01

Aims Smooth muscle cells (SMC) play an important role in vascular homeostasis and disease. Although adult mesenchymal stem cells (MSC) have been used as a source of contractile SMC, they suffer from limited proliferation potential and culture senescence, particularly when originating from older donors. By comparison, human induced pluripotent stem cells (hiPSC) can provide an unlimited source of functional SMC for autologous cell-based therapies and for creating models of vascular disease. Our goal was to develop an efficient strategy to derive functional, contractile SMC from hiPSC. Methods and results We developed a robust, stage-wise, feeder-free strategy for hiPSC differentiation into functional SMC through an intermediate stage of multipotent MSC, which could be coaxed to differentiate into fat, bone, cartilage, and muscle. At this stage, the cells were highly proliferative and displayed higher clonogenic potential and reduced senescence when compared with parental hair follicle mesenchymal stem cells. In addition, when exposed to differentiation medium, the myogenic proteins such as α-smooth muscle actin, calponin, and myosin heavy chain were significantly upregulated and displayed robust fibrillar organization, suggesting the development of a contractile phenotype. Indeed, tissue constructs prepared from these cells exhibited high levels of contractility in response to receptor- and non-receptor-mediated agonists. Conclusion We developed an efficient stage-wise strategy that enabled hiPSC differentiation into contractile SMC through an intermediate population of clonogenic and multipotent MSC. The high yield of MSC and SMC derivation suggests that our strategy may facilitate an acquisition of the large numbers of cells required for regenerative medicine or for studying vascular disease pathophysiology. PMID:22941255

Monitoring soil moisture patterns in alpine meadows using ground sensor networks and remote sensing techniques

Science.gov (United States)

Bertoldi, Giacomo; Brenner, Johannes; Notarnicola, Claudia; Greifeneder, Felix; Nicolini, Irene; Della Chiesa, Stefano; Niedrist, Georg; Tappeiner, Ulrike

2015-04-01

Soil moisture content (SMC) is a key factor for numerous processes, including runoff generation, groundwater recharge, evapotranspiration, soil respiration, and biological productivity. Understanding the controls on the spatial and temporal variability of SMC in mountain catchments is an essential step towards improving quantitative predictions of catchment hydrological processes and related ecosystem services. The interacting influences of precipitation, soil properties, vegetation, and topography on SMC and the influence of SMC patterns on runoff generation processes have been extensively investigated (Vereecken et al., 2014). However, in mountain areas, obtaining reliable SMC estimations is still challenging, because of the high variability in topography, soil and vegetation properties. In the last few years, there has been an increasing interest in the estimation of surface SMC at local scales. On the one hand, low cost wireless sensor networks provide high-resolution SMC time series. On the other hand, active remote sensing microwave techniques, such as Synthetic Aperture Radars (SARs), show promising results (Bertoldi et al. 2014). As these data provide continuous coverage of large spatial extents with high spatial resolution (10-20 m), they are particularly in demand for mountain areas. However, there are still limitations related to the fact that the SAR signal can penetrate only a few centimeters in the soil. Moreover, the signal is strongly influenced by vegetation, surface roughness and topography. In this contribution, we analyse the spatial and temporal dynamics of surface and root-zone SMC (2.5 - 5 - 25 cm depth) of alpine meadows and pastures in the Long Term Ecological Research (LTER) Area Mazia Valley (South Tyrol - Italy) with different techniques: (I) a network of 18 stations; (II) field campaigns with mobile ground sensors; (III) 20-m resolution RADARSAT2 SAR images; (IV) numerical simulations using the GEOtop hydrological model (Rigon et al

Hierarchical sliding mode control for under-actuated cranes design, analysis and simulation

CERN Document Server

Qian, Dianwei

2015-01-01

This book reports on the latest developments in sliding mode overhead crane control, presenting novel research ideas and findings on sliding mode control (SMC), hierarchical SMC and compensator design-based hierarchical sliding mode. The results, which were previously scattered across various journals and conference proceedings, are now presented in a systematic and unified form. The book will be of interest to researchers, engineers and graduate students in control engineering and mechanical engineering who want to learn the methods and applications of SMC.

Cognitive-behavioral therapy for psychogenic nonepileptic seizures

Science.gov (United States)

Goldstein, L.H.; Chalder, T.; Chigwedere, C.; Khondoker, M.R.; Moriarty, J.; Toone, B.K.; Mellers, J.D.C.

2010-01-01

Objective: To compare cognitive-behavioral therapy (CBT) and standard medical care (SMC) as treatments for psychogenic nonepileptic seizures (PNES). Methods: Our randomized controlled trial (RCT) compared CBT with SMC in an outpatient neuropsychiatric setting. Sixty-six PNES patients were randomized to either CBT (plus SMC) or SMC alone, scheduled to occur over 4 months. PNES diagnosis was established by video-EEG telemetry for most patients. Exclusion criteria included comorbid history of epilepsy, <2 PNES/month, and IQ <70. The primary outcome was seizure frequency at end of treatment and at 6-month follow-up. Secondary outcomes included 3 months of seizure freedom at 6-month follow-up, measures of psychosocial functioning, health service use, and employment. Results: In an intention-to-treat analysis, seizure reduction following CBT was superior at treatment end (group × time interaction p < 0.0001; large to medium effect sizes). At follow-up, the CBT group tended to be more likely to have experienced 3 months of seizure freedom (odds ratio 3.125, p = 0.086). Both groups improved in some health service use measures and on the Work and Social Adjustment Scale. Mood and employment status showed no change. Conclusions: Our findings suggest that cognitive-behavioral therapy is more effective than standard medical care alone in reducing seizure frequency in PNES patients. Classification of evidence: This study provides Class III evidence that CBT in addition to SMC, as compared to SMC alone, significantly reduces seizure frequency in patients with PNES (change in median monthly seizure frequency: baseline to 6 months follow-up, CBT group, 12 to 1.5; SMC alone group, 8 to 5). GLOSSARY AED = antiepileptic drug; CBT = cognitive-behavioral therapy; CI = confidence interval; DSM-IV = Diagnostic and Statistical Manual of Mental Disorders, 4th edition; HADS = Hospital Anxiety and Depression Scale; IQR = interquartile range; ITT = intention-to-treat; OR = odds ratio; PNES

Modeling the Impact of Uganda’s Safe Male Circumcision Program: Implications for Age and Regional Targeting

Science.gov (United States)

Kripke, Katharine; Vazzano, Andrea; Kirungi, William; Musinguzi, Joshua; Opio, Alex; Ssempebwa, Rhobbinah; Nakawunde, Susan; Kyobutungi, Sheila; Akao, Juliet N.; Magala, Fred; Mwidu, George; Castor, Delivette

2016-01-01

Background Uganda aims to provide safe male circumcision (SMC) to 80% of men ages 15–49 by 2016. To date, only 2 million men have received SMC of the 4.2 million men required. In response to age and regional trends in SMC uptake, the country sought to re-examine its targets with respect to age and subnational region, to assess the program’s progress, and to refine the implementation approach. Methods and Findings The Decision Makers’ Program Planning Tool, Version 2.0 (DMPPT 2.0), was used in conjunction with incidence projections from the Spectrum/AIDS Impact Module (AIM) to conduct this analysis. Population, births, deaths, and HIV incidence and prevalence were used to populate the model. Baseline male circumcision prevalence was derived from the 2011 AIDS Indicator Survey. Uganda can achieve the most immediate impact on HIV incidence by circumcising men ages 20–34. This group will also require the fewest circumcisions for each HIV infection averted. Focusing on men ages 10–19 will offer the greatest impact over a 15-year period, while focusing on men ages 15–34 offers the most cost-effective strategy over the same period. A regional analysis showed little variation in cost-effectiveness of scaling up SMC across eight regions. Scale-up is cost-saving in all regions. There is geographic variability in program progress, highlighting two regions with low baseline rates of circumcision where additional efforts will be needed. Conclusion Focusing SMC efforts on specific age groups and regions may help to accelerate Uganda’s SMC program progress. Policy makers in Uganda have already used model outputs in planning efforts, proposing males ages 10–34 as a priority group for SMC in the 2014 application to the Global Fund’s new funding model. As scale-up continues, the country should also consider a greater effort to expand SMC in regions with low MC prevalence. PMID:27410234

Losses Approximation for Soft Magnetic Composites Based on a Homogenized Equivalent Conductivity

Directory of Open Access Journals (Sweden)

X. Ren

2016-09-01

Full Text Available Soft magnetic composites (SMC are a promising alternative to laminated steel in many Electrical Engineering applications. This is largely owing to their low level of eddy current losses. The electromagnetic behavior of SMC in electromagnetic devices cannot be easily predicted using standard numerical techniques such as the finite element method, mostly due to the computational cost required to model the material microstructure. Another difficulty lies in the high property contrast between the matrix and the inclusions. In this paper we propose a homogenization strategy to define the equivalent electromagnetic properties of SMC. For components made of SMC, the equivalent conductivity and permeability can be determined. These equivalent properties can be used to calculate eddy current losses or introduced into structural analysis tools to design electromagnetic devices.

ORF Alignment: NC_006814 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available chemistry Of Atp-Driven Dimerization And Dna ... Stimulated Activation Of Smc Atpases. pdb|1XEW|X Cha...in ... X, Structural Biochemistry Of Atp-Driven Dimerization ... And Dna Stimulated Activation Of Smc Atpase

Formation of the Small Magellanic Cloud: ancient major merger as a solution to the kinematical differences between old stars and HI gas

OpenAIRE

Bekki, Kenji; Chiba, Masashi

2008-01-01

Recent observations of the Small Magellanic Cloud (SMC) have revealed that the HI gas shows a significant amount of rotation (V_c 60 km/s), while no or little rotation is evident for the old stellar populations. We suggest that this unique kinematical difference between these components in the SMC can be caused by a major merger event which occurred in the early stage of the SMC formation. Our simulations show that dissipative dwarf-dwarf merging can transform two gas-rich dwarf irregulars in...

Vascular smooth muscle modulates endothelial control of vasoreactivity via reactive oxygen species production through myoendothelial communications.

Directory of Open Access Journals (Sweden)

Marie Billaud

Full Text Available BACKGROUND: Endothelial control of vascular smooth muscle plays a major role in the resulting vasoreactivity implicated in physiological or pathological circulatory processes. However, a comprehensive understanding of endothelial (EC/smooth muscle cells (SMC crosstalk is far from complete. Here, we have examined the role of gap junctions and reactive oxygen species (ROS in this crosstalk and we demonstrate an active contribution of SMC to endothelial control of vasomotor tone. METHODOLOGY/PRINCIPAL FINDINGS: In small intrapulmonary arteries, quantitative RT-PCR, Western Blot analyses and immunofluorescent labeling evidenced connexin (Cx 37, 40 and 43 in EC and/or SMC. Functional experiments showed that the Cx-mimetic peptide targeted against Cx 37 and Cx 43 ((37,43Gap27 (1 reduced contractile and calcium responses to serotonin (5-HT simultaneously recorded in pulmonary arteries and (2 abolished the diffusion in SMC of carboxyfluorescein-AM loaded in EC. Similarly, contractile and calcium responses to 5-HT were decreased by superoxide dismutase and catalase which, catabolise superoxide anion and H(2O(2, respectively. Both Cx- and ROS-mediated effects on the responses to 5-HT were reversed by L-NAME, a NO synthase inhibitor or endothelium removal. Electronic paramagnetic resonance directly demonstrated that 5-HT-induced superoxide anion production originated from the SMC. Finally, whereas 5-HT increased NO production, it also decreased cyclic GMP content in isolated intact arteries. CONCLUSIONS/SIGNIFICANCE: These data demonstrate that agonist-induced ROS production in SMC targeting EC via myoendothelial gap junctions reduces endothelial NO-dependent control of pulmonary vasoreactivity. Such SMC modulation of endothelial control may represent a signaling pathway controlling vasoreactivity under not only physiological but also pathological conditions that often implicate excessive ROS production.

Adaptive pacing, cognitive behaviour therapy, graded exercise, and specialist medical care for chronic fatigue syndrome: a cost-effectiveness analysis.

Directory of Open Access Journals (Sweden)

Paul McCrone

Full Text Available The PACE trial compared the effectiveness of adding adaptive pacing therapy (APT, cognitive behaviour therapy (CBT, or graded exercise therapy (GET, to specialist medical care (SMC for patients with chronic fatigue syndrome. This paper reports the relative cost-effectiveness of these treatments in terms of quality adjusted life years (QALYs and improvements in fatigue and physical function.Resource use was measured and costs calculated. Healthcare and societal costs (healthcare plus lost production and unpaid informal care were combined with QALYs gained, and changes in fatigue and disability; incremental cost-effectiveness ratios (ICERs were computed.SMC patients had significantly lower healthcare costs than those receiving APT, CBT and GET. If society is willing to value a QALY at £30,000 there is a 62.7% likelihood that CBT is the most cost-effective therapy, a 26.8% likelihood that GET is most cost effective, 2.6% that APT is most cost-effective and 7.9% that SMC alone is most cost-effective. Compared to SMC alone, the incremental healthcare cost per QALY was £18,374 for CBT, £23,615 for GET and £55,235 for APT. From a societal perspective CBT has a 59.5% likelihood of being the most cost-effective, GET 34.8%, APT 0.2% and SMC alone 5.5%. CBT and GET dominated SMC, while APT had a cost per QALY of £127,047. ICERs using reductions in fatigue and disability as outcomes largely mirrored these findings.Comparing the four treatments using a health care perspective, CBT had the greatest probability of being the most cost-effective followed by GET. APT had a lower probability of being the most cost-effective option than SMC alone. The relative cost-effectiveness was even greater from a societal perspective as additional cost savings due to reduced need for informal care were likely.

A comparative genomics screen identifies a Sinorhizobium meliloti 1021 sodM-like gene strongly expressed within host plant nodules

Directory of Open Access Journals (Sweden)

Queiroux Clothilde

2012-05-01

Full Text Available Abstract Background We have used the genomic data in the Integrated Microbial Genomes system of the Department of Energy’s Joint Genome Institute to make predictions about rhizobial open reading frames that play a role in nodulation of host plants. The genomic data was screened by searching for ORFs conserved in α-proteobacterial rhizobia, but not conserved in closely-related non-nitrogen-fixing α-proteobacteria. Results Using this approach, we identified many genes known to be involved in nodulation or nitrogen fixation, as well as several new candidate genes. We knocked out selected new genes and assayed for the presence of nodulation phenotypes and/or nodule-specific expression. One of these genes, SMc00911, is strongly expressed by bacterial cells within host plant nodules, but is expressed minimally by free-living bacterial cells. A strain carrying an insertion mutation in SMc00911 is not defective in the symbiosis with host plants, but in contrast to expectations, this mutant strain is able to out-compete the S. meliloti 1021 wild type strain for nodule occupancy in co-inoculation experiments. The SMc00911 ORF is predicted to encode a “SodM-like” (superoxide dismutase-like protein containing a rhodanese sulfurtransferase domain at the N-terminus and a chromate-resistance superfamily domain at the C-terminus. Several other ORFs (SMb20360, SMc01562, SMc01266, SMc03964, and the SMc01424-22 operon identified in the screen are expressed at a moderate level by bacteria within nodules, but not by free-living bacteria. Conclusions Based on the analysis of ORFs identified in this study, we conclude that this comparative genomics approach can identify rhizobial genes involved in the nitrogen-fixing symbiosis with host plants, although none of the newly identified genes were found to be essential for this process.

A novel monocyclic triterpenoid and a norsesquaterpenol from the aerial parts of Suaeda monoica Forssk. ex J.F. Gmel with cell proliferative potential

Directory of Open Access Journals (Sweden)

Mansour S. Al-Said

2017-11-01

Full Text Available Suaeda monoica Forssk. ex J.F. Gmel (Chenopodiaceae, a mangrove herb, is distributed in tropical Africa, Arabian Peninsula, India, Pakistan, Palestine and Jordan. The plant parts are used to treat sore throat, hepatitis, wounds, rheumatism, paralysis, asthma, snakebites, skin disease and ulcer. Two new phytoconstituents characterized as 13,17-octahydropentalene-4,4,10,23-tetramethyl-17,21-diisopropyl-tetradecahydrocyclo-[a]-phenanthrene-(14, 20(23, 21(30-trien-5α-ol (SMC-3 and [1,4,4-trimethyl-cyclopent-1(5-enyl]-9,10,17,21-tetramethyl-9α-ol-16α (17α-epoxy heptadecan-6,10-dione (SMC-4 belong to the class norsesquaterpenol and monocyclic triterpenoid, respectively, along with two known compounds 3-epi-lupeol (SMC-1 and 4-cyclopentylpyrocatechol (SMC-2 have been isolated from the ethanol extract of aerial parts of S. monoica using normal and reverse phase column as well as planar chromatography. The spectroscopic studies including 1D, 2D NMR (DEPT, COSY, HMBC and HSQC aided by EIMS mass and IR spectra were used to establish their structures. All the four compounds were tested for cytotoxicity on cultured HepG2 cells and for cell proliferation activities. The results revealed no cytotoxicity even at highest (6.25–50 μg/ml dose of all the four compounds. The compound SMC-1 showed prominent cell proliferative activity as compared to other SMC compounds.

Migration of supervisory machine control architectures

NARCIS (Netherlands)

Graaf, B.; Weber, S.; Deursen, van A.; Nord, R.; Medvidovic, N.; Krikhaar, R.; Stafford, J.; Bosch, J.

2005-01-01

In this position paper, we discuss a first step towards an approach for the migration of supervisory machine control (SMC) architectures. This approach is based on the identification of SMC concerns and the definition of corresponding transformation rules.

Somatomedin C deficiency in Asian sisters.

OpenAIRE

McGraw, M E; Price, D A; Hill, D J

1986-01-01

Two sisters of Asian origin showed typical clinical and biochemical features of primary somatomedin C (SM-C) deficiency (Laron dwarfism). Abnormalities of SM-C binding proteins were observed, one sister lacking the high molecular weight (150 Kd) protein.

Spectral types, color indices, and abundances for Cepheids in the Magellanic Clouds and the Galaxy

International Nuclear Information System (INIS)

Laney, C.D.

1982-01-01

Accurate MK spectral types have been obtained for 58 Cepheids in the Galaxy and the Magellanic Clouds form 121 spectrograms. Simultaneous uvbyβ photometry has been obtained with many of the spectrograms. The spectra of galactic and LMC Cepheids are found to be very similar, and Cepheids in both systems appear to obey the same (B-V) 0 vs. spectral type relation. The low E(B-V) values of Feltz and McNamara (1980) and certain other recent authors are confirmed. The spectra of SMC Cepheids show slightly weaker metal lines, and SMC Cepheids average about 1.3 subclasses earlier in spectral type than LMC and galactic Cepheids at the same value of (B-V) 0 . Spectral types of LMC and SMC Cepheids at minimum light are found to be later than those reported by Feast (1974) when luminosity effects are allowed for. Curves of growth have been constructed for 7 SMC Cepheids, 5 LMC Cepheids, and 13 Milky Way Cepheids and spectral standards. Comparison indicates that [Fe/H]/sub LMC/ = -0.06 +/- 0.10 and [Fe/H]/sub SMC/ = -0.50 +/- 0.08

Association between subjective memory complaints and health care utilisation: a three-year follow up

DEFF Research Database (Denmark)

Waldorff, Frans Boch; Siersma, Volkert; Waldemar, Gunhild

2009-01-01

their general practitioner and reporting subjective memory complaints (SMC). METHODS: This study was conducted as a prospective cohort survey in general practice with three-year follow-up. Selected health care utilisation or costs relative to SMC adjusted for potential confounders were analyzed in a two......BACKGROUND: Subjective memory complaints (SMC) are common among elderly patients and little is know about the association between SMC and health care utilisation. Thus, the aim of this study was to investigate health care utilisation during a three-year follow-up among elderly patients consulting......-part model where the incidence of use of a selected health care service were analyzed separately from the quantity of use for those that use the service. The former analyzed in a Poisson regression approach, the latter in a generalized linear regression model. RESULTS: A total 758 non-nursing home residents...

Control Law Design for Twin Rotor MIMO System with Nonlinear Control Strategy

Directory of Open Access Journals (Sweden)

M. Ilyas

2016-01-01

Full Text Available Modeling of complex air vehicles is a challenging task due to high nonlinear behavior and significant coupling effect between rotors. Twin rotor multi-input multioutput system (TRMS is a laboratory setup designed for control experiments, which resembles a helicopter with unstable, nonlinear, and coupled dynamics. This paper focuses on the design and analysis of sliding mode control (SMC and backstepping controller for pitch and yaw angle control of main and tail rotor of the TRMS under parametric uncertainty. The proposed control strategy with SMC and backstepping achieves all mentioned limitations of TRMS. Result analysis of SMC and backstepping control schemes elucidates that backstepping provides efficient behavior with the parametric uncertainty for twin rotor system. Chattering and oscillating behaviors of SMC are removed with the backstepping control scheme considering the pitch and yaw angle for TRMS.

Cellulase production by white-rot basidiomycetous fungi: solid-state versus submerged cultivation

DEFF Research Database (Denmark)

Bentil, Joseph A.; Thygesen, Anders; Mensah, Moses

2018-01-01

fungi for improved enzyme expression, as well as on-site approaches for production of enzyme blends for industrial biomass conversion. The quantitative comparisons made have implications for selection of the most appropriate cultivation method for WRB fungi for attaining maximal cellulase production....... on different biomass residues in SSC or SmC systems. Although some variation in cellulase production yields have been reported for certain substrates, the analysis convincingly shows that SmC is generally more efficient than SSC for obtaining high cellulase production yields and high cellulase production rates......) or submerged cultivation (SmC) systems. In this review, we quantitatively assess the data available in the literature on cellulase production yields by WRB fungi cultivated by SSC or SmC. The review also assesses cellulolytic enzyme production rates and enzyme recovery when WRB fungi are cultivated...

Sliding mode control of dissolved oxygen in an integrated nitrogen removal process in a sequencing batch reactor (SBR).

Science.gov (United States)

Muñoz, C; Young, H; Antileo, C; Bornhardt, C

2009-01-01

This paper presents a sliding mode controller (SMC) for dissolved oxygen (DO) in an integrated nitrogen removal process carried out in a suspended biomass sequencing batch reactor (SBR). The SMC performance was compared against an auto-tuning PI controller with parameters adjusted at the beginning of the batch cycle. A method for cancelling the slow DO sensor dynamics was implemented by using a first order model of the sensor. Tests in a lab-scale reactor showed that the SMC offers a better disturbance rejection capability than the auto-tuning PI controller, furthermore providing reasonable performance in a wide range of operation. Thus, SMC becomes an effective robust nonlinear tool to the DO control in this process, being also simple from a computational point of view, allowing its implementation in devices such as industrial programmable logic controllers (PLCs).

The Growth Opportunities For SMC?

DEFF Research Database (Denmark)

Madsen, Erik Strøjer; Smith, Valdemar; Bentzen, Jan Børsen

2006-01-01

The extensive empirical literature on the validity of Gibrat's law does not in general verify the law as it finds that firms' growth rates are negatively correlated with both firm size and age. However, some studies find that Gibrat's law holds for sub-samples of firms such as large firms or firms...

Effects of spent mushroom compost on quality and productivity of ...

African Journals Online (AJOL)

SMC), which is a waste product of mushroom processing through a year, on greenhouse cucumber growth as an organic matter source for the soil. The effects of SMC on several yield related characteristics, such as total yield, fruit width, fruit ...

Scientific misconduct: also an issue in nursing science?

NARCIS (Netherlands)

Fierz, K.; Gennaro, S.; Dierickx, K.; Achterberg, T. van; Morin, K.H.; Geest, S. de

2014-01-01

PURPOSE: Scientific misconduct (SMC) is an increasing concern in nursing science. This article discusses the prevalence of SMC, risk factors and correlates of scientific misconduct in nursing science, and highlights interventional approaches to foster good scientific conduct. METHODS: Using the

A probabilistic map of the human ventral sensorimotor cortex using electrical stimulation.

Science.gov (United States)

Breshears, Jonathan D; Molinaro, Annette M; Chang, Edward F

2015-08-01

The human ventral sensorimotor cortex (vSMC) is involved in facial expression, mastication, and swallowing, as well as the dynamic and highly coordinated movements of human speech production. However, vSMC organization remains poorly understood, and previously published population-driven maps of its somatotopy do not accurately reflect the variability across individuals in a quantitative, probabilistic fashion. The goal of this study was to describe the responses to electrical stimulation of the vSMC, generate probabilistic maps of function in the vSMC, and quantify the variability across individuals. Photographic, video, and stereotactic MRI data of intraoperative electrical stimulation of the vSMC were collected for 33 patients undergoing awake craniotomy. Stimulation sites were converted to a 2D coordinate system based on anatomical landmarks. Motor, sensory, and speech stimulation responses were reviewed and classified. Probabilistic maps of stimulation responses were generated, and spatial variance was quantified. In 33 patients, the authors identified 194 motor, 212 sensory, 61 speech-arrest, and 27 mixed responses. Responses were complex, stereotyped, and mostly nonphysiological movements, involving hand, orofacial, and laryngeal musculature. Within individuals, the presence of oral movement representations varied; however, the dorsal-ventral order was always preserved. The most robust motor responses were jaw (probability 0.85), tongue (0.64), lips (0.58), and throat (0.52). Vocalizations were seen in 6 patients (0.18), more dorsally near lip and dorsal throat areas. Sensory responses were spatially dispersed; however, patients' subjective reports were highly precise in localization within the mouth. The most robust responses included tongue (0.82) and lips (0.42). The probability of speech arrest was 0.85, highest 15-20 mm anterior to the central sulcus and just dorsal to the sylvian fissure, in the anterior precentral gyrus or pars opercularis. The

AGE DETERMINATION OF SIX INTERMEDIATE-AGE SMALL MAGELLANIC CLOUD STAR CLUSTERS WITH HST/ACS

International Nuclear Information System (INIS)

Glatt, Katharina; Kayser, Andrea; Grebel, Eva K.; Sabbi, Elena; Gallagher, John S. III; Harbeck, Daniel; Nota, Antonella; Sirianni, Marco; Clementini, Gisella; Tosi, Monica; Koch, Andreas; Da Costa, Gary

2008-01-01

We present a photometric analysis of the star clusters Lindsay 1, Kron 3, NGC 339, NGC 416, Lindsay 38, and NGC 419 in the Small Magellanic Cloud (SMC), observed with the Hubble Space Telescope Advanced Camera for Surveys (ACS) in the F555W and F814W filters. Our color-magnitude diagrams (CMDs) extend ∼3.5 mag deeper than the main-sequence turnoff points, deeper than any previous data. Cluster ages were derived using three different isochrone models: Padova, Teramo, and Dartmouth, which are all available in the ACS photometric system. Fitting observed ridgelines for each cluster, we provide a homogeneous and unique set of low-metallicity, single-age fiducial isochrones. The cluster CMDs are best approximated by the Dartmouth isochrones for all clusters, except for NGC 419 where the Padova isochrones provided the best fit. Using Dartmouth isochrones we derive ages of 7.5 ± 0.5 Gyr (Lindsay 1), 6.5 ± 0.5 Gyr (Kron 3), 6 ± 0.5 Gyr (NGC 339), 6 ± 0.5 Gyr (NGC 416), and 6.5 ± 0.5 Gyr (Lindsay 38). The CMD of NGC 419 shows several main-sequence turnoffs, which belong to the cluster and to the SMC field. We thus derive an age range of 1.2-1.6 Gyr for NGC 419. We confirm that the SMC contains several intermediate-age populous star clusters with ages unlike those of the Large Magellanic Cloud and the Milky Way. Interestingly, our intermediate-age star clusters have a metallicity spread of ∼0.6 dex, which demonstrates that the SMC does not have a smooth, monotonic age-metallicity relation. We find an indication for centrally-concentrated blue straggler star candidates in NGC 416, while these are not present for the other clusters. Using the red clump magnitudes, we find that the closest cluster, NGC 419 (∼50 kpc), and the farthest cluster, Lindsay 38 (∼67 kpc), have a relative distance of ∼17 kpc, which confirms the large depth of the SMC. The three oldest SMC clusters (NGC 121, Lindsay 1, and Kron 3) lie in the northwestern part of the SMC, while the youngest

Which Factors Enhance Positive Drug Reimbursement Recommendation in Scotland? A Retrospective Analysis 2006-2013 : A retrospective analysis 2006-2013

NARCIS (Netherlands)

Charokopou, Mata; Majer, Istvan M; Raad, Johan de; Broekhuizen, Stefan; Postma, Maarten; Heeg, Bart

2015-01-01

OBJECTIVES: To identify the factors that influence the Scottish Medicines Consortium (SMC) in deciding whether to accept pharmaceutical technologies for use within the Scottish health care system. METHODS: A database of SMC submissions between 2006 and 2013 was created, containing a range of

Sortilin mediates vascular calcification via its recruitment into extracellular vesicles

DEFF Research Database (Denmark)

Goettsch, Claudia; Hutscheson, JD; Aikawa, M

2016-01-01

obscure. Here, we have demonstrated that sortilin is a key regulator of smooth muscle cell (SMC) calcification via its recruitment to extracellular vesicles. Sortilin localized to calcifying vessels in human and mouse atheromata and participated in formation of microcalcifications in SMC culture. Sortilin...

Subjective memory complaints in general practice predicts future dementia: a 4-year follow-up study

DEFF Research Database (Denmark)

Waldorff, Frans Boch; Vogel, Asmus Mejling; Siersma, Volkert Dirk

2012-01-01

Many older patients in general practice have subjective memory complaints (SMC); however, not all share this information with their general practitioner (GP). The association between SMC and future cognitive decline or dementia is not clear, especially in a general practice population. The aim...

Performance comparison of secure comparison protocols

NARCIS (Netherlands)

Kerschbaum, F.; Biswas, D.; Hoogh, de S.J.A.

2009-01-01

Secure multiparty computation (SMC) has gained tremendous importance with the growth of the Internet and e-commerce, where mutually untrusted parties need to jointly compute a function of their private inputs. However, SMC protocols usually have very high computational complexities, rendering them

Gene expression profiling of resting and activated vascular smooth muscle cells by serial analysis of gene expression and clustering analysis

NARCIS (Netherlands)

Beauchamp, Nicholas J.; van Achterberg, Tanja A. E.; Engelse, Marten A.; Pannekoek, Hans; de Vries, Carlie J. M.

2003-01-01

Migration and proliferation of vascular smooth muscle cells (SMCs) are key events in atherosclerosis. However, little is known about alterations in gene expression upon transition of the quiescent, contractile SMC to the proliferative SMC. We performed serial analysis of gene expression (SAGE) of

29 CFR 790.4 - Liability of employer; effect of contract, custom, or practice.

Science.gov (United States)

2010-07-01

... all time spent in active or inactive duties which such employees are engaged to perform (Armour & Co..., section 1: Senate Report, pp. 41, 42, 46-49; Conference Report, pp. 12, 13; statements of Senator Wiley... included in computing hours worked. 20 20 Senate Report, pp. 46-49; Conference Report, pp. 12, 13...

Morphology and metallicity of the Small Magellanic Cloud using RRab stars

Science.gov (United States)

Deb, Sukanta; Singh, Harinder P.; Kumar, Subhash; Kanbur, Shashi M.

2015-05-01

We present a study of three-dimensional structure of the Small Magellanic Cloud (SMC). The V- and I-band light curves of the fundamental mode RR Lyrae (RRab) stars obtained by the Optical Gravitational Lensing Experiment-III project were utilized in order to comprehend the SMC structure. The [Fe/H]-P-φ31 relation of Jurcsik & Kovacs is exploited to obtain the metallicities. From the three-dimensional RRab distance distributions, north-east arm and main body of the galaxy are identified. Combining metallicities with spatial distribution of these tracers, no radial metallicity gradient in the SMC has been detected. Dividing the entire sample into three parts: north-eastern, central and south-western, we find that the central part has a significantly larger line of sight depth as compared to rest of the parts, indicating that the SMC may have a bulge. Results obtained from the I-band data seem to be reliable and were further substantiated using the Smolec relation. Distribution of SMC RRab stars was modelled as a triaxial ellipsoid. Errors in structural parameters of the SMC ellipsoid were obtained from Monte Carlo simulations. We estimated the axes ratios of the galaxy as 1.00 ± 0.000: 1.310 ± 0.029: 8.269 ± 0.934, the inclination of the longest axis with line of sight i = 2.265° ± 0.784° and the position angle of the line of nodes θlon = 74.307° ± 0.509° from the variance weighted I-band determinations.

New limits on the population of normal and millisecond pulsars in the Large and Small Magellanic Clouds

Science.gov (United States)

Ridley, J. P.; Lorimer, D. R.

2010-07-01

We model the potentially observable populations of normal and millisecond radio pulsars in the Large and Small Magellanic Clouds (LMC and SMC, respectively) where the known population currently stands at 19 normal radio pulsars. Taking into account the detection thresholds of previous surveys, and assuming optimal period and luminosity distributions based on studies of Galactic pulsars, we estimate that there are (1.79 +/- 0.20) × 104 and (1.09 +/- 0.16) × 104 normal pulsars in the LMC and SMC, respectively. When we attempt to correct for beaming effects, and the fraction of high-velocity pulsars which escape the clouds, we estimate birth rates in both the LMC and SMC to be comparable and in the range of 0.5-1 pulsars per century. Although higher than estimates for the rate of core-collapse supernovae in the clouds, these pulsar birth rates are consistent with historical supernova observations in the past 300 yr. A substantial population of active radio pulsars (of the order of a few hundred thousand) has escaped the LMC and SMC and populates the local intergalactic medium. For the millisecond pulsar (MSP) population, the lack of any detections from current surveys leads to respective upper limits (at the 95 per cent confidence level) of 15000 for the LMC and 23000 for the SMC. Several MSPs could be detected by a currently ongoing survey of the SMC with improved time and frequency resolution using the Parkes multibeam system. Giant-pulse emitting neutron stars could also be seen by this survey.

Molecular cytogenetic characterization of mosaicism for a small supernumerary marker chromosome derived from chromosome 8 or r(8(::p12→q13.1:: associated with phenotypic abnormalities

Directory of Open Access Journals (Sweden)

Chih-Ping Chen

2016-12-01

Conclusion: Mosaic sSMC(8 derived from r(8(::p12→q13.1:: can present phenotypic abnormalities. Chromosome 8q12 duplication syndrome should be included in differential diagnosis when an sSMC(8 contains 8q12.2 and CHD7.

Multicolor optical polarimetry of reddened stars in the small Magellanic cloud

International Nuclear Information System (INIS)

Magalhaes, A.M.; Coyne, G.V.; Piirola, V.; Rodrigues, C.V.

1989-01-01

First results of an on-going program to determine the wavelength dependence of the interstellar optical polarization of reddened stars in the Small Magellanic Cloud (SMC) are presented. IUE observations of reddened stars in the SMC (Bouchet et al. 1985) generally show marked differences in the extinction law as compared to both the Galaxy and the Large Megallanic Cloud. The aim here is to determine the wavelength dependence of the optical linear polarization in the direction of several such stars in the SMC in order to further constrain the dust composition and size distribution in that galaxy

Determination of 3D magnetic reluctivity tensor of soft magnetic composite material

International Nuclear Information System (INIS)

Guo Youguang; Zhu Jianguo; Lin Zhiwei; Zhong Jinjiang; Lu Haiyan; Wang Shuhong

2007-01-01

Soft magnetic composite (SMC) materials are especially suitable for construction of electrical machines with complex structures and three-dimensional (3D) magnetic fluxes. In the design and optimization of such 3D flux machines, the 3D vector magnetic properties of magnetic materials should be properly determined, modeled, and applied for accurate calculation of the magnetic field distribution, parameters, and performance. This paper presents the measurement of 3D vector magnetic properties and determination of 3D reluctivity tensor of SMC. The reluctivity tensor is a key factor for accurate numerical analysis of magnetic field in a 3D flux SMC motor

Cytokine-induced differentiation of multipotent adult progenitor cells into functional smooth muscle cells.

Science.gov (United States)

Ross, Jeffrey J; Hong, Zhigang; Willenbring, Ben; Zeng, Lepeng; Isenberg, Brett; Lee, Eu Han; Reyes, Morayma; Keirstead, Susan A; Weir, E Kenneth; Tranquillo, Robert T; Verfaillie, Catherine M

2006-12-01

Smooth muscle formation and function are critical in development and postnatal life. Hence, studies aimed at better understanding SMC differentiation are of great importance. Here, we report that multipotent adult progenitor cells (MAPCs) isolated from rat, murine, porcine, and human bone marrow demonstrate the potential to differentiate into cells with an SMC-like phenotype and function. TGF-beta1 alone or combined with PDGF-BB in serum-free medium induces a temporally correct expression of transcripts and proteins consistent with smooth muscle development. Furthermore, SMCs derived from MAPCs (MAPC-SMCs) demonstrated functional L-type calcium channels. MAPC-SMCs entrapped in fibrin vascular molds became circumferentially aligned and generated force in response to KCl, the L-type channel opener FPL64176, or the SMC agonists 5-HT and ET-1, and exhibited complete relaxation in response to the Rho-kinase inhibitor Y-27632. Cyclic distention (5% circumferential strain) for 3 weeks increased responses by 2- to 3-fold, consistent with what occurred in neonatal SMCs. These results provide evidence that MAPC-SMCs are phenotypically and functionally similar to neonatal SMCs and that the in vitro MAPC-SMC differentiation system may be an ideal model for the study of SMC development. Moreover, MAPC-SMCs may lend themselves to tissue engineering applications.

Contraction of gut smooth muscle cells assessed by fluorescence imaging

Directory of Open Access Journals (Sweden)

Yohei Tokita

2015-03-01

Full Text Available Here we discuss the development of a novel cell imaging system for the evaluation of smooth muscle cell (SMC contraction. SMCs were isolated from the circular and longitudinal muscular layers of mouse small intestine by enzymatic digestion. SMCs were stimulated by test agents, thereafter fixed in acrolein. Actin in fixed SMCs was stained with phalloidin and cell length was determined by measuring diameter at the large end of phalloidin-stained strings within the cells. The contractile response was taken as the decrease in the average length of a population of stimulated-SMCs. Various mediators and chemically identified compounds of daikenchuto (DKT, pharmaceutical-grade traditional Japanese prokinetics, were examined. Verification of the integrity of SMC morphology by phalloidin and DAPI staining and semi-automatic measurement of cell length using an imaging analyzer was a reliable method by which to quantify the contractile response. Serotonin, substance P, prostaglandin E2 and histamine induced SMC contraction in concentration-dependent manner. Two components of DKT, hydroxy-α-sanshool and hydroxy-β-sanshool, induced contraction of SMCs. We established a novel cell imaging technique to evaluate SMC contractility. This method may facilitate investigation into SMC activity and its role in gastrointestinal motility, and may assist in the discovery of new prokinetic agents.

The chemical composition of three planetary nebulae in the Magellanic clouds

International Nuclear Information System (INIS)

Dufour, R.J.; Killen, R.M.

1977-01-01

Emission-line intensities in the planetary nebulae Henize 67 in the Small Magellanic Cloud (SMC) and Henize 97 and 153 in the LMC along with the small SMC H II regions Henize 9, 61, and 81 were measured from photographic image-tube spectra taken with the 1.5 m telescope at Cerro Tololo. The relative abundances of H, He, N, O, Ne, S, and Ar in the nebulae were estimated and compared with the compositions of galactic planetary nebulae and previously studied H II regions in the Clouds. The results show that (1) the N/O ratios in the planetary nebulae are substantially higher than found in the H II regions of each Cloud; (2) He/H approx. = 0.18 in the SMC planetary nebula, but seems normal (approx.0.10) in the two LMC planetaries; and (3) the compositions of the three small SMC H II regions are similar to that of larger SMC H II regions studied previously. It is concluded that the N/H values in the shells of planetary nebulae may not depend on the metal content of the progenitor star as much as recent theoretical models suggest and that the N content of the gas in the Magellanic Clouds arises primarily from sources other than planetary nebulae

Spatial Variations of Turbulent Properties of Neutral Hydrogen Gas in the Small Magellanic Cloud Using Structure-function Analysis

Energy Technology Data Exchange (ETDEWEB)

Nestingen-Palm, David; Stanimirović, Snežana; González-Casanova, Diego F.; Babler, Brian [Astronomy Department, University of Wisconsin-Madison, 475 North Charter Street, Madison, WI 53706-1582 (United States); Jameson, Katherine; Bolatto, Alberto, E-mail: sstanimi@astro.wisc.edu [Astronomy Department and Laboratory for Millimeter-wave Astronomy, University of Maryland, College Park, MD 20742 (United States)

2017-08-10

We investigate spatial variations of turbulent properties in the Small Magellanic Cloud (SMC) by using neutral hydrogen (H i) observations. With the goal of testing the importance of stellar feedback on H i turbulence, we define central and outer SMC regions based on the star formation rate (SFR) surface density, as well as the H i integrated intensity. We use the structure function and the velocity channel analysis to calculate the power-law index ( γ ) for both underlying density and velocity fields in these regions. In all cases, our results show essentially no difference in γ between the central and outer regions. This suggests that H i turbulent properties are surprisingly homogeneous across the SMC when probed at a resolution of 30 pc. Contrary to recent suggestions from numerical simulations, we do not find a significant change in γ due to stellar feedback as traced by the SFR surface density. This could be due to the stellar feedback being widespread over the whole of the SMC, but more likely due to a large-scale gravitational driving of turbulence. We show that the lack of difference between central and outer SMC regions cannot be explained by the high optical depth H I.

Safe male circumcision in Botswana: tension between traditional practices and biomedical marketing.

Science.gov (United States)

Katisi, Masego; Daniel, Marguerite

2015-01-01

Botswana has been running Safe Male Circumcision (SMC) since 2009 and has not yet met its target. Donors like the US Centers for Disease Control and Prevention and Africa Comprehensive HIV/AIDS Partnership (funded by the Gates Foundation) in collaboration with Botswana's Ministry of Health have invested much to encourage HIV-negative men to circumcise. Demand creation strategies make use of media and celebrities. The objective of this paper is to explore responses to SMC in relation to circumcision as part of traditional initiation practices. More specifically, we present the views of two communities in Botswana on SMC consultation processes, implementation procedures and campaign strategies. The methods used include participant observation, in-depth interviews with key stakeholders (donors, implementers and Ministry officials), community leaders and men in the community. We observe that consultation with traditional leaders was done in a seemingly superficial, non-participatory manner. While SMC implementers reported pressure to deliver numbers to the World Health Organization, traditional leaders promoted circumcision through their routine traditional initiation ceremonies at breaks of two-year intervals. There were conflicting views on public SMC demand creation campaigns in relation to the traditional secrecy of circumcision. In conclusion, initial cooperation of local chiefs and elders turned into resistance.

Anaphase onset before complete DNA replication with intact checkpoint responses

DEFF Research Database (Denmark)

Torres-Rosell, Jordi; De Piccoli, Giacomo; Cordon-Preciado, Violeta

2007-01-01

Cellular checkpoints prevent mitosis in the presence of stalled replication forks. Whether checkpoints also ensure the completion of DNA replication before mitosis is unknown. Here, we show that in yeast smc5-smc6 mutants, which are related to cohesin and condensin, replication is delayed, most...

Modulation of gap junctional intercellular communication between human smooth muscle cells by leukocyte-derived growth factors and cytokines in relation to atherogenesis

NARCIS (Netherlands)

Mensink, A.

1997-01-01

In this thesis, the effect of leukocyte-derived growth factors and cytokines on GJIC between SMC was investigated. GJIC is regarded as an important mechanism in the control of cell growth, cell differentiation and tissue homeostasis. Disturbance of SMC growth control is regarded to be a

Comparison of the fractional power motor with cores made of various magnetic materials

Directory of Open Access Journals (Sweden)

Gmyrek Zbigniew

2017-12-01

Full Text Available The optimization of the motor cores, coupled with new core shapes as well as powering the motor at high frequency are the primary reasons for the use of new materials. The utilization of new materials, like SMC (soft magnetic composite, reduce the core loss and/or provide quasi-isotropic core’s properties in any magnetization direction. Moreover, the use of SMC materials allows for avoiding degradation of the material portions, resulting from punching process, thereby preventing the deterioration of operating parameters of the motor. The authors examine the impact of technological parameters on the properties of a new type of SMC material and analyze the possibility of its use as the core of the fractional power motor. The result of the work is an indication of the shape of the rotor core made of a new SMC material to achieve operational parameters similar to those that have a motor with a core made of laminations.

Comparison of the fractional power motor with cores made of various magnetic materials

Science.gov (United States)

Gmyrek, Zbigniew; Lefik, Marcin; Cavagnino, Andrea; Ferraris, Luca

2017-12-01

The optimization of the motor cores, coupled with new core shapes as well as powering the motor at high frequency are the primary reasons for the use of new materials. The utilization of new materials, like SMC (soft magnetic composite), reduce the core loss and/or provide quasi-isotropic core's properties in any magnetization direction. Moreover, the use of SMC materials allows for avoiding degradation of the material portions, resulting from punching process, thereby preventing the deterioration of operating parameters of the motor. The authors examine the impact of technological parameters on the properties of a new type of SMC material and analyze the possibility of its use as the core of the fractional power motor. The result of the work is an indication of the shape of the rotor core made of a new SMC material to achieve operational parameters similar to those that have a motor with a core made of laminations.

Large-scale delivery of seasonal malaria chemoprevention to children under 10 in Senegal: an economic analysis

Science.gov (United States)

Pitt, Catherine; Ndiaye, Mouhamed; Conteh, Lesong; Sy, Ousmane; Hadj Ba, El; Cissé, Badara; Gomis, Jules F; Gaye, Oumar; Ndiaye, Jean-Louis

2017-01-01

Abstract Seasonal Malaria Chemoprevention (SMC) is recommended for children under 5 in the Sahel and sub-Sahel. The burden in older children may justify extending the age range, as has been done effectively in Senegal. We examine costs of door-to-door SMC delivery to children up to 10 years by community health workers (CHWs). We analysed incremental financial and economic costs at district level and below from a health service perspective. We examined project accounts and prospectively collected data from 405 CHWs, 46 health posts, and 4 district headquarters by introducing questionnaires in advance and completing them after each monthly implementation round. Affordability was explored by comparing financial costs of SMC to relevant existing health expenditure levels. Costs were disaggregated by administration month and by health service level. We used linear regression models to identify factors associated with cost variation between health posts. The financial cost to administer SMC to 180 000 children over one malaria season, reaching ∼93% of children with all three intended courses of SMC was $234 549 (constant 2010 USD) or $0.50 per monthly course administered. Excluding research–participation incentives, the financial cost was $0.32 per resident (all ages) in the catchment area, which is 1.2% of Senegal’s general government expenditure on health per capita. Economic costs were 18.7% higher than financial costs at $278 922 or $0.59 per course administered and varied widely between health posts, from $0.38 to $2.74 per course administered. Substantial economies of scale across health posts were found, with the smallest health posts incurring highest average costs per monthly course administered. SMC for children up to 10 is likely to be affordable, particularly where it averts substantial curative care costs. Estimates of likely costs and cost-effectiveness of SMC in other contexts must account for variation in average costs across delivery months

Adenovirus-assisted lipofection: efficient in vitro gene transfer of luciferase and cytosine deaminase to human smooth muscle cells.

Science.gov (United States)

Kreuzer, J; Denger, S; Reifers, F; Beisel, C; Haack, K; Gebert, J; Kübler, W

1996-07-01

Smooth muscle cells (SMC) are a central cell type involved in multiple processes of coronary artery diseases including restenosis and therefore are major target cells for different aspects of gene transfer. Previous attempts to transfect primary arterial cells using different techniques like liposomes, CaPO4 and electroporation resulted in only low transfection efficiency. The development of recombinant adenoviruses dramatically improved the delivery of foreign genes into different cell types including SMC. However, cloning and identification of recombinants remain difficult and time-consuming techniques. The present study demonstrates that a complex consisting of reporter plasmid encoding firefly luciferase (pLUC), polycationic liposomes and replication-deficient adenovirus was able to yield very high in vitro transfection of primary human smooth muscle cells under optimized conditions. The technique of adenovirus-assisted lipofection (AAL) increases transfer and expression of plasmid DNA in human smooth muscle cells in vitro up to 1000-fold compared to lipofection. To verify the applicability of AAL for gene transfer into human smooth muscle cells we studied a gene therapy approach to suppress proliferation of SMC in vitro, using the prokaryotic cytosine deaminase gene (CD) which enables transfected mammalian cells to deaminate 5-fluorocytosine (5-FC) to the highly toxic 5-fluorouracil (5-FU). The effect of a transient CD expression on RNA synthesis was investigated by means of a cotransfection with a RSV-CD expression plasmid and the luciferase reporter plasmid. Western blot analysis demonstrated high expression of CD protein in transfected SMC. Cotransfected SMC demonstrated two-fold less luciferase activity in the presence of 5-FC (5 mmol/l) after 48 h compared to cells transfected with a non-CD coding plasmid. The data demonstrate that a transient expression of CD could be sufficient to reduce the capacity of protein synthesis in human SMC. This simple and

Dynamic and diverse changes in the functional properties of vascular smooth muscle cells in pulmonary hypertension.

Science.gov (United States)

Stenmark, Kurt R; Frid, Maria G; Graham, Brian B; Tuder, Rubin M

2018-03-15

Pulmonary hypertension (PH) is the end result of interaction between pulmonary vascular tone and a complex series of cellular and molecular events termed 'vascular remodelling'. The remodelling process, which can involve the entirety of pulmonary arterial vasculature, almost universally involves medial thickening, driven by increased numbers and hypertrophy of its principal cellular constituent, smooth muscle cells (SMCs). It is noted, however that SMCs comprise heterogeneous populations of cells, which can exhibit markedly different proliferative, inflammatory, and extracellular matrix production changes during remodelling. We further consider that these functional changes in SMCs of different phenotype and their role in PH are dynamic and may undergo significant changes over time (which we will refer to as cellular plasticity); no single property can account for the complexity of the contribution of SMC to pulmonary vascular remodelling. Thus, the approaches used to pharmacologically manipulate PH by targeting the SMC phenotype(s) must take into account processes that underlie dominant phenotypes that drive the disease. We present evidence for time- and location-specific changes in SMC proliferation in various animal models of PH; we highlight the transient nature (rather than continuous) of SMC proliferation, emphasizing that the heterogenic SMC populations that reside in different locations along the pulmonary vascular tree exhibit distinct responses to the stresses associated with the development of PH. We also consider that cells that have often been termed 'SMCs' may arise from many origins, including endothelial cells, fibroblasts and resident or circulating progenitors, and thus may contribute via distinct signalling pathways to the remodelling process. Ultimately, PH is characterized by long-lived, apoptosis-resistant SMC. In line with this key pathogenic characteristic, we address the acquisition of a pro-inflammatory phenotype by SMC that is essential

HERschel key program heritage: A far-infrared source catalog for the Magellanic Clouds

International Nuclear Information System (INIS)

Seale, Jonathan P.; Meixner, Margaret; Sewiło, Marta; Babler, Brian; Engelbracht, Charles W.; Misselt, Karl; Montiel, Edward; Gordon, Karl; Roman-Duval, Julia; Hony, Sacha; Okumura, Koryo; Panuzzo, Pasquale; Sauvage, Marc; Boyer, Martha L.; Chen, C.-H. Rosie; Indebetouw, Remy; Matsuura, Mikako; Oliveira, Joana M.; Loon, Jacco Th. van; Srinivasan, Sundar

2014-01-01

Observations from the HERschel Inventory of the Agents of Galaxy Evolution (HERITAGE) have been used to identify dusty populations of sources in the Large and Small Magellanic Clouds (LMC and SMC). We conducted the study using the HERITAGE catalogs of point sources available from the Herschel Science Center from both the Photodetector Array Camera and Spectrometer (PACS; 100 and 160 μm) and Spectral and Photometric Imaging Receiver (SPIRE; 250, 350, and 500 μm) cameras. These catalogs are matched to each other to create a Herschel band-merged catalog and then further matched to archival Spitzer IRAC and MIPS catalogs from the Spitzer Surveying the Agents of Galaxy Evolution (SAGE) and SAGE-SMC surveys to create single mid- to far-infrared (far-IR) point source catalogs that span the wavelength range from 3.6 to 500 μm. There are 35,322 unique sources in the LMC and 7503 in the SMC. To be bright in the FIR, a source must be very dusty, and so the sources in the HERITAGE catalogs represent the dustiest populations of sources. The brightest HERITAGE sources are dominated by young stellar objects (YSOs), and the dimmest by background galaxies. We identify the sources most likely to be background galaxies by first considering their morphology (distant galaxies are point-like at the resolution of Herschel) and then comparing the flux distribution to that of the Herschel Astrophysical Terahertz Large Area Survey (ATLAS) survey of galaxies. We find a total of 9745 background galaxy candidates in the LMC HERITAGE images and 5111 in the SMC images, in agreement with the number predicted by extrapolating from the ATLAS flux distribution. The majority of the Magellanic Cloud-residing sources are either very young, embedded forming stars or dusty clumps of the interstellar medium. Using the presence of 24 μm emission as a tracer of star formation, we identify 3518 YSO candidates in the LMC and 663 in the SMC. There are far fewer far-IR bright YSOs in the SMC than the LMC

HERschel key program heritage: A far-infrared source catalog for the Magellanic Clouds

Energy Technology Data Exchange (ETDEWEB)

Seale, Jonathan P.; Meixner, Margaret; Sewiło, Marta [The Johns Hopkins University, Department of Physics and Astronomy, 366 Bloomberg Center, 3400 N. Charles Street, Baltimore, MD 21218 (United States); Babler, Brian [Department of Astronomy, 475 North Charter St., University of Wisconsin, Madison, WI 53706 (United States); Engelbracht, Charles W.; Misselt, Karl; Montiel, Edward [Steward Observatory, University of Arizona, 933 North Cherry Ave., Tucson, AZ 85721 (United States); Gordon, Karl; Roman-Duval, Julia [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Hony, Sacha; Okumura, Koryo; Panuzzo, Pasquale; Sauvage, Marc [CEA, Laboratoire AIM, Irfu/SAp, Orme des Merisiers, F-91191 Gif-sur-Yvette (France); Boyer, Martha L. [Observational Cosmology Laboratory, Code 665, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Chen, C.-H. Rosie [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Indebetouw, Remy [National Radio Astronomy Observatory, 520 Edgemont Road Charlottesville, VA 22903 (United States); Matsuura, Mikako [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Oliveira, Joana M.; Loon, Jacco Th. van [School of Physical and Geographical Sciences, Lennard-Jones Laboratories, Keele University, Staffordshire ST5 5BG (United Kingdom); Srinivasan, Sundar [UPMC-CNRS UMR7095, Institute d' Astrophysique de Paris, F-75014 Paris (France); and others

2014-12-01

Observations from the HERschel Inventory of the Agents of Galaxy Evolution (HERITAGE) have been used to identify dusty populations of sources in the Large and Small Magellanic Clouds (LMC and SMC). We conducted the study using the HERITAGE catalogs of point sources available from the Herschel Science Center from both the Photodetector Array Camera and Spectrometer (PACS; 100 and 160 μm) and Spectral and Photometric Imaging Receiver (SPIRE; 250, 350, and 500 μm) cameras. These catalogs are matched to each other to create a Herschel band-merged catalog and then further matched to archival Spitzer IRAC and MIPS catalogs from the Spitzer Surveying the Agents of Galaxy Evolution (SAGE) and SAGE-SMC surveys to create single mid- to far-infrared (far-IR) point source catalogs that span the wavelength range from 3.6 to 500 μm. There are 35,322 unique sources in the LMC and 7503 in the SMC. To be bright in the FIR, a source must be very dusty, and so the sources in the HERITAGE catalogs represent the dustiest populations of sources. The brightest HERITAGE sources are dominated by young stellar objects (YSOs), and the dimmest by background galaxies. We identify the sources most likely to be background galaxies by first considering their morphology (distant galaxies are point-like at the resolution of Herschel) and then comparing the flux distribution to that of the Herschel Astrophysical Terahertz Large Area Survey (ATLAS) survey of galaxies. We find a total of 9745 background galaxy candidates in the LMC HERITAGE images and 5111 in the SMC images, in agreement with the number predicted by extrapolating from the ATLAS flux distribution. The majority of the Magellanic Cloud-residing sources are either very young, embedded forming stars or dusty clumps of the interstellar medium. Using the presence of 24 μm emission as a tracer of star formation, we identify 3518 YSO candidates in the LMC and 663 in the SMC. There are far fewer far-IR bright YSOs in the SMC than the LMC

Integrative pathway dissection of molecular mechanisms of moxLDL-induced vascular smooth muscle phenotype transformation

Directory of Open Access Journals (Sweden)

Karagiannis George S

2013-01-01

Full Text Available Abstract Background Atherosclerosis (AT is a chronic inflammatory disease characterized by the accumulation of inflammatory cells, lipoproteins and fibrous tissue in the walls of arteries. AT is the primary cause of heart attacks and stroke and is the leading cause of death in Western countries. To date, the pathogenesis of AT is not well-defined. Studies have shown that the dedifferentiation of contractile and quiescent vascular smooth muscle cells (SMC to the proliferative, migratory and synthetic phenotype in the intima is pivotal for the onset and progression of AT. To further delineate the mechanisms underlying the pathogenesis of AT, we analyzed the early molecular pathways and networks involved in the SMC phenotype transformation. Methods Quiescent human coronary artery SMCs were treated with minimally-oxidized LDL (moxLDL, for 3 hours and 21 hours, respectively. Transcriptomic data was generated for both time-points using microarrays and was subjected to pathway analysis using Gene Set Enrichment Analysis, GeneMANIA and Ingenuity software tools. Gene expression heat maps and pathways enriched in differentially expressed genes were compared to identify functional biological themes to elucidate early and late molecular mechanisms of moxLDL-induced SMC dedifferentiation. Results Differentially expressed genes were found to be enriched in cholesterol biosynthesis, inflammatory cytokines, chemokines, growth factors, cell cycle control and myogenic contraction themes. These pathways are consistent with inflammatory responses, cell proliferation, migration and ECM production, which are characteristic of SMC dedifferentiation. Furthermore, up-regulation of cholesterol synthesis and dysregulation of cholesterol metabolism was observed in moxLDL-induced SMC. These observations are consistent with the accumulation of cholesterol and oxidized cholesterol esters, which induce proinflammatory reactions during atherogenesis. Our data implicate for the

Evaluation on the effects of P. ostreatus spent mushroom compost ...

African Journals Online (AJOL)

Realization in minimizing production cost for in vitro culture had brought to a study on application of P. ostreatus spent mushroom compost (SMC). Sterile nodal explants was inoculated on different treatments with 15 replicates each. Treatments were MS medium supplemented with different concentrations of SMC (1 and 2 ...

75 FR 56533 - Privacy Act System of Records

Science.gov (United States)

2010-09-16

... Union (NTEU) space assignment policy. In the event of an emergency, the SMC staff will devise a... and contractors following the FCC/National Treasury Union (NTEU) space assignment policy. In the event of an emergency, the SMC staff will devise a ``Reconstitution Plan'' in which they will extract...

75 FR 63198 - In the Matter of Certain Connecting Devices (“Quick Clamps”) for Use With Modular Compressed Air...

Science.gov (United States)

2010-10-14

... review, particularly the sub-issues of (a) whether the SMC old- style clamp is generally rectangular and... submissions responses to the following queries, with supporting citations to the evidentiary record: 1. Is the ID's finding that the SMC old-style clamp is not ``generally rectangular'' contrary to the Court's...

Determinants of Male Circumcision for HIV/AIDS Prevention in East ...

African Journals Online (AJOL)

Safe Male Circumcision (SMC) is one the effective strategies for reducing HIV transmission. The paper examines factors associated with SMC for HIV prevention, based on 4,979 males from East Central Uganda. Data were analysed using chi-squared tests and multinomial logistic regression. Older males aged 31 years ...

Sliding-mode control of single input multiple output DC-DC converter

Science.gov (United States)

Zhang, Libo; Sun, Yihan; Luo, Tiejian; Wan, Qiyang

2016-10-01

Various voltage levels are required in the vehicle mounted power system. A conventional solution is to utilize an independent multiple output DC-DC converter whose cost is high and control scheme is complicated. In this paper, we design a novel SIMO DC-DC converter with sliding mode controller. The proposed converter can boost the voltage of a low-voltage input power source to a controllable high-voltage DC bus and middle-voltage output terminals, which endow the converter with characteristics of simple structure, low cost, and convenient control. In addition, the sliding mode control (SMC) technique applied in our converter can enhance the performances of a certain SIMO DC-DC converter topology. The high-voltage DC bus can be regarded as the main power source to the high-voltage facility of the vehicle mounted power system, and the middle-voltage output terminals can supply power to the low-voltage equipment on an automobile. In the respect of control algorithm, it is the first time to propose the SMC-PID (Proportion Integration Differentiation) control algorithm, in which the SMC algorithm is utilized and the PID control is attended to the conventional SMC algorithm. The PID control increases the dynamic ability of the SMC algorithm by establishing the corresponding SMC surface and introducing the attached integral of voltage error, which endow the sliding-control system with excellent dynamic performance. At last, we established the MATLAB/SIMULINK simulation model, tested performance of the system, and built the hardware prototype based on Digital Signal Processor (DSP). Results show that the sliding mode control is able to track a required trajectory, which has robustness against the uncertainties and disturbances.

Arsenic interferes with the signaling transduction pathway of T cell receptor activation by increasing basal and induced phosphorylation of Lck and Fyn in spleen cells

International Nuclear Information System (INIS)

Soto-Pena, Gerson A.; Vega, Libia

2008-01-01

Arsenic is known to produce inhibition as well as induction of immune cells proliferative responses depending on the doses as one of its mechanisms of immunotoxicity. Here we evaluate the effect of arsenic exposure on the activation of splenic mononuclear cells (SMC) in male CD57BL6N mice. Intra-gastric exposure to arsenic (as sodium arsenite) for 30 days (1, 0.1, or 0.01 mg/kg/day), reduced the proportion of CD4+ cells and the CD4+/CD8+ ratio in the spleen, increasing the proportion of CD11b+ cells. Arsenic exposure did not modify the proportion of B cells. SMC showed an increased level of phosphorylation of lck and fyn kinases (first kinases associated to TCR complex when activated). Although normal levels of apoptosis were observed on freshly isolated SMC, an increase in apoptotic cells related with the increase in phosphorylation of lck and fyn was observed when SMC were activated with Concanavalin-A (Con-A). Arsenic exposure reduced the proliferative response of SMC to Con-A, and also reduced secretion of IL-2, IL-6, IL-12 and IFNγ. No effect was observed on IL-4, and IL-10 secretion. The same effects were observed when SMC of exposed animals were activated with anti-CD3/CD28 antibodies for 24 h, but these effects were transitory since a recovery, up to control levels or even higher, were observed after 72 h of stimulation. This study demonstrates that repeated and prolonged exposure to arsenic alters cell populations and produces functional changes depending on the specific activation pathway, and could be related with the phosphorylation status of lck and fyn kinases

Numerical analysis of free-surface flows by using OpenFOAM

International Nuclear Information System (INIS)

Uzawa, Ken; Watanabe, Tadashi; Nishida, Akemi; Takemiya, Hiroshi

2010-01-01

Laminar and turbulent free-surface flows induced by three-dimensional dam break are numerically investigated. It is found that a Second-order Moment Closure (SMC) model is in good agreement with experimental results. An eddy viscosity model becomes less effective because the turbulent dissipation rate is overestimated in the eddy viscosity model. The impact on a vertical wall resulting from a dam break flow is also investigated. The maximum pressure on the wall in the SMC model is higher than that in the laminar model, whereas averaged pressure on the wall in the SMC model is lower than that in the laminar model. (author)

A proposal for standardized data models and exchange information protocols applicable in centralized metering systems

OpenAIRE

Rodríguez Cardona, Cristian Fernando; Calvache Vallejo, Bayron Andrés; Caicedo Bravo, Eduardo Francisco

2017-01-01

Resumen En Latinoamérica las estrategias de reducción de pérdidas no técnicas de energía han impulsado la implementación de los sistemas de medición centralizada (SMC). Los SMC, además de incluir las funciones básicas de un sistema AMI, se caracterizan por integrar la medida de múltiples usuarios dentro de una caja diseñada para su instalación en postes, con el fin de restringir el acceso de los usuarios al medidor de energía. En la actualidad la mayoría de los equipos SMC disponibles comerci...

Doxazosin blocks the angiotensin II-induced smooth muscle cell DNA synthesis in the media, but not in the neointima of the rat carotid artery after balloon injury

NARCIS (Netherlands)

van Kleef, E. M.; Smits, J. F.; Schwartz, S. M.; Daemen, M. J.

1996-01-01

Infusion of angiotensin II (AngII) during the third and fourth week after balloon injury of the left common carotid artery of the rat induces smooth muscle cell (SMC) DNA synthesis. In this study we wanted to investigate whether alpha 1-adrenoreceptors are involved in AngII-induced SMC DNA synthesis

The conspicuous absence of normal graphite grains in the small magellanic cloud

International Nuclear Information System (INIS)

Bromage, G.E.; Nandy, K.

1983-05-01

The simplest dust model that accurately predicts the normal Galactic interstellar extinction, also fits the normal SMC curve derived from visible and IUE observations. Only one parameter value is different: the usual graphite contribution is at least a factor of seven weaker in the SMC. Some possible explanations are discussed. (author)

Physically-based modeling of topographic effects on spatial evapotranspiration and soil moisture patterns through radiation and wind

Directory of Open Access Journals (Sweden)

M. Liu

2012-02-01

Full Text Available In this paper, simulations with the Soil Water Atmosphere Plant (SWAP model are performed to quantify the spatial variability of both potential and actual evapotranspiration (ET, and soil moisture content (SMC caused by topography-induced spatial wind and radiation differences. To obtain the spatially distributed ET/SMC patterns, the field scale SWAP model is applied in a distributed way for both pointwise and catchment wide simulations. An adapted radiation model from r.sun and the physically-based meso-scale wind model METRAS PC are applied to obtain the spatial radiation and wind patterns respectively, which show significant spatial variation and correlation with aspect and elevation respectively. Such topographic dependences and spatial variations further propagate to ET/SMC. A strong spatial, seasonal-dependent, scale-relevant intra-catchment variability in daily/annual ET and less variability in SMC can be observed from the numerical experiments. The study concludes that topography has a significant effect on ET/SMC in the humid region where ET is a energy limited rather than water availability limited process. It affects the spatial runoff generation through spatial radiation and wind, therefore should be applied to inform hydrological model development. In addition, the methodology used in the study can serve as a general method for physically-based ET estimation for data sparse regions.

Selective cognitive impairment and tall stature due to chromosome 19 supernumerary ring.

Science.gov (United States)

Melis, Daniela; Genesio, Rita; Del Giudice, Ennio; Taurisano, Roberta; Mormile, Angela; D'Elia, Federica; Conti, Anna; Imperati, Floriana; Andria, Generoso; Nitsch, Lucio

2012-01-01

Small supernumerary marker chromosomes (sSMC) occur with a frequency of approximately 0.4 per 1000 newborns and are more frequent in the population with mental retardation and/or with dysmorphic signs. Small supernumerary chromosome rings (sSCR) usually occur as apart of a mosaic karyotype (Liehr et al., 2004). Chromosome 19 supernumerary rings are very rare. Almost all cases of sSMC19 have been reported on Thomas Liehr's website (http://www.med.uni-jena.de/fish/sSMC/19.htm#Start19). Of these cases, 14 were with phenotypic abnormalities and a clear characterization of the sSMC; two cases were suitable for comparison with our case with regard to their genetic content, but not with regard to the structure ofthe sSMC (Manvelyan et al., 2008). The phenotype, associated with partial trisomy 19q, includes facial dysmorphism, growth and mental retardation, macrocephaly, heart malformation and anomalies of the genitourinary and gastrointestinal tracts. The phenotype associated with partial trisomy 19p is characterized by dysmorphic features, severe mental retardation, abnormalities of brain morphology and anomalies of the fingers (Tercanli et al., 2000; Qorri et al., 2002; Novelli et al., 2005; Vraneković et al., 2008). Herein, we report the phenotype and molecular cytogenetic analysis in a patient with the smallest de-novo constitutional ring extended from the p12 to q12 region of chromosome 19.

Quantitative magnetotail characteristics of different magnetospheric states

Directory of Open Access Journals (Sweden)

M. A. Shukhtina

2004-03-01

Full Text Available Quantitative relationships allowing one to compute the lobe magnetic field, flaring angle and tail radius, and to evaluate magnetic flux based on solar wind/IMF parameters and spacecraft position are obtained for the middle magnetotail, X=(–15,–35RE, using 3.5 years of simultaneous Geotail and Wind spacecraft observations. For the first time it was done separately for different states of magnetotail including the substorm onset (SO epoch, the steady magnetospheric convection (SMC and quiet periods (Q. In the explored distance range the magnetotail parameters appeared to be similar (within the error bar for Q and SMC states, whereas at SO their values are considerably larger. In particular, the tail radius is larger by 1–3 RE at substorm onset than during Q and SMC states, for which the radius value is close to previous magnetopause model values. The calculated lobe magnetic flux value at substorm onset is ~1GWb, exceeding that at Q (SMC states by ~50%. The model magnetic flux values at substorm onset and SMC show little dependence on the solar wind dynamic pressure and distance in the tail, so the magnetic flux value can serve as an important discriminator of the state of the middle magnetotail. Key words. Magnetospheric physics (solar windmagnetosphere- interactions, magnetotail, storms and substorms

Smooth Muscle Specific Overexpression of p22phox Potentiates Carotid Artery Wall Thickening in Response to Injury

Directory of Open Access Journals (Sweden)

Michael R. Manogue

2015-01-01

Full Text Available We hypothesized that transgenic mice overexpressing the p22phox subunit of the NADPH oxidase selectively in smooth muscle (Tgp22smc would exhibit an exacerbated response to transluminal carotid injury compared to wild-type mice. To examine the role of reactive oxygen species (ROS as a mediator of vascular injury, the injury response was quantified by measuring wall thickness (WT and cross-sectional wall area (CSWA of the injured and noninjured arteries in both Tgp22smc and wild-type animals at days 3, 7, and 14 after injury. Akt, p38 MAPK, and Src activation were evaluated at the same time points using Western blotting. WT and CSWA following injury were significantly greater in Tgp22smc mice at both 7 and 14 days after injury while noninjured contralateral carotids were similar between groups. Apocynin treatment attenuated the injury response in both groups and rendered the response similar between Tgp22smc mice and wild-type mice. Following injury, carotid arteries from Tgp22smc mice demonstrated elevated activation of Akt at day 3, while p38 MAPK and Src activation was elevated at day 7 compared to wild-type mice. Both increased activation and temporal regulation of these signaling pathways may contribute to enhanced vascular growth in response to injury in this transgenic model of elevated vascular ROS.

Stakeholder Management Capability and Performance in Brazilian Cooperatives

Directory of Open Access Journals (Sweden)

Yeda Maria Pereira Pavão

2015-09-01

Full Text Available Objective – The aim of this paper is to relate Stakeholder Management Capability (SMC to economic-financial and social-environmental performance. Design/methodology/approach – Data collection occurred in 26 states and the Federal District of Brazil. There was validation of 171 questionnaires answered at the strategic and tactical levels in the context of cooperatives in 13 sectors of Brazil’s economy. Structural equation modeling was used as an application to verify the data with the use of exploratory and confirmatory factor analysis. Findings – The results made it possible to verify the relationship between SMC and the social and environmental performance. The coefficient found for the relationship between SMC and economicfinancial performance also had a positive effect. Practical implications – The research results provide evidence that SMC is directly related to the economic-financial and socialenvironmental performance of cooperative organizations. SMC may also contribute to the analytical process of organizations from the statistical dimension and an applied empirical structure. Originality/value – The model reached support in both relationships with significant values, demonstrating that the dimensions and scales used to measure it were satisfactory, validating the proposed model. This finding demonstrates that these organizations have the skills to meet the requirements of and manage stakeholders, even if one person plays different roles, i.e. the cooperative member, which is basically the owner, supplier, consumer and customer.

Selection of soil hydraulic properties in a land surface model using remotely-sensed soil moisture and surface temperature

Science.gov (United States)

Shellito, P. J.; Small, E. E.; Gutmann, E. D.

2013-12-01

Synoptic-scale weather is heavily influenced by latent and sensible heating from the land surface. The partitioning of available energy between these two fluxes as well as the distribution of moisture throughout the soil column is controlled by a unique set of soil hydraulic properties (SHPs) at every location. Weather prediction systems, which use coupled land surface and atmospheric models in their forecasts, must therefore be parameterized with estimates of SHPs. Currently, land surface models (LSMs) obtain SHP values by assuming a correlation exists between SHPs and the soil type, which the USDA maps in 12 classes. This method is spurious because texture is only one control of many that affects SHPs. Alternatively, SHPs can be obtained by calibrating them within the framework of an LSM. Because remotely-sensed data have the potential for continent-wide application, there is a critical need to understand their specific role in calibration efforts and the extent to which such calibrated SHPs can improve model simulations. This study focuses on SHP calibration with soil moisture content (SMC) and land surface temperature (Ts), data that are available from the SMOS and MODIS satellite missions, respectively. The scientific goals of this study are: (1) What is the model performance tradeoff between weighting SMC and Ts differently during the calibration process? (2) What can the tradeoff between calibration using in-situ and remotely-sensed SMC reveal about SHP scaling? (3) How are these relationships influenced by climatic regime and vegetation type? (4) To what extent can calibrated SHPs improve model performance over that of texture-based SHPs? Model calibrations are carried out within the framework of the Noah LSM using the Shuffled Complex Evolution Metropolis (SCEM-UA) algorithm in five different climatic regimes. At each site, a five-dimensional parameter space of SHPs is searched to find the location that minimizes the difference between observed and

Elemental and isotope behavior of macromolecular organic matter from CM chondrites during hydrous pyrolysis

Science.gov (United States)

Oba, Y.; Naraoka, H.

2009-08-01

A new insight into carbon and hydrogen isotope variations of insoluble organic matter (IOM) is provided from seven CM chondrites, including Murchison and six Antarctic meteorites (Y-791198, Y-793321, A-881280, A-881334, A-881458 and B-7904) as well as Murchison IOM residues after hydrous pyrolysis at 270-330 °C for 72 h. Isotopic compositions of bulk carbon (δ13Cbulk) and hydrogen (δD) of the seven IOMs vary widely, ranging from -15.1 to -7.6‰ and +133 to +986‰, respectively. Intramolecular carboxyl carbon (δ13CCOOH) is more enriched in 13C by 7.5 -11‰ than bulk carbon. After hydrous pyrolysis of Murchison IOM at 330 °C, H/C ratio, δ13Cbulk, δ13CCOOH, and δD values decrease by up to 0.31, 3.5‰, 5.5‰, and 961‰, respectively. The O/C ratio increases from 0.22 to 0.46 at 270 °C and to 0.25 at 300 °C, and decreases to 0.10 at 330 °C. δ13Cbulk- δD cross plot of Murchison IOM and its pyrolysis residues shows an isotopic sequence. Of the six Antarctic IOMs, A-881280, A-881458, Y-791198 and B-7904 lie on or near the isotopic sequence depending on the degree of hydrous and/or thermal alteration, while A-881334 and Y-793321 consist of another distinct isotope group. A δ13Cbulk-δ13CCOOH cross-plot of IOMs, including Murchison pyrolysis residues, has a positive correlation between them, implying that the oxidation process to produce carboxyls is similar among all IOMs. These isotope distributions reflect various degree of alteration on the meteorite parent bodies and/or difference in original isotopic compositions before the parent body processes.

Induction of CTGF by TGF-β1 in normal and radiation enteritis human smooth muscle cells: Smad/Rho balance and therapeutic perspectives

International Nuclear Information System (INIS)

Haydont, Valerie; Mathe, Denis; Bourgier, Celine; Abdelali, Jalil; Aigueperse, Jocelyne; Bourhis, Jean; Vozenin-Brotons, Marie-Catherine

2005-01-01

Background and purpose: Transforming Growth Factor β1 (TGF-β1) and its downstream effector Connective Tissue Growth Factor (CTGF/CCN2), are well known fibrogenic activators and we previously showed that the Rho/ROCK pathway controls CTGF expression in intestinal smooth muscle cells isolated from patients with delayed radiation enteritis. The aim of the present work was to investigate the balance between Smad and Rho signalling pathways in the TGF-β1 CTGF induction and modulation of radiation-induced fibrogenic differentiation after addition of pravastatin, an inhibitor of Rho isoprenylation. Patients and methods: Primary human smooth muscle cells isolated from normal (N-SMC) or radiation enteritis (RE-SMC) biopsies were incubated with TGF-β1 (10 ng/ml). Induction of CTGF, as well as nucleo-cytoplasmic distribution of phospho-Smad2/3, Smad2/3 and Smad4 were analysed by Western blot and immunocytochemistry. Smad DNA binding was assessed by EMSA and Rho activation was measured by pull-down assay. Results: After TGF-β1 addition, Smads were translocated to the nucleus in both cell types. Nuclear accumulation of Smad as well as their DNA-binding activity were higher in N-SMC than in RE-SMC, whereas the opposite was observed for Rho activation, suggesting a main involvement of Rho pathway in sustained fibrogenic differentiation. This hypothesis was further supported by the antifibrotic effect observed in vitro after cell treatment with pravastatin (i.e. decreased expression of CTGF, TGF-β1 and Collagen Iα2). Conclusions: Our results suggest that TGF-β1-induced CTGF transactivation mainly depends on the Smad pathway in N-SMC, whereas in RE-SMC, Smad and Rho pathways are involved. Inhibition of Rho activity by pravastatin alters fibrogenic differentiation in vitro which opens up new therapeutic perspectives

From genetics to response to injury: vascular smooth muscle cells in aneurysms and dissections of the ascending aorta.

Science.gov (United States)

Michel, Jean-Baptiste; Jondeau, Guillaume; Milewicz, Dianna M

2018-03-15

Vascular smooth muscle cells (vSMCs) play a crucial role in both the pathogenesis of Aneurysms and Dissections of the ascending thoracic aorta (TAAD) in humans and in the associated adaptive compensatory responses, since thrombosis and inflammatory processes are absent in the majority of cases. Aneurysms and dissections share numerous characteristics, including aetiologies and histopathological alterations: vSMC disappearance, medial areas of mucoid degeneration, and extracellular matrix (ECM) breakdown. Three aetiologies predominate in TAAD in humans: (i) genetic causes in heritable familial forms, (ii) an association with bicuspid aortic valves, and (iii) a sporadic degenerative form linked to the aortic aging process. Genetic forms include mutations in vSMC genes encoding for molecules of the ECM or the TGF-β pathways, or participating in vSMC tone. On the other hand, aneurysms and dissections, whatever their aetiologies, are characterized by an increase in wall permeability leading to transmural advection of plasma proteins which could interact with vSMCs and ECM components. In this context, blood-borne plasminogen appears to play an important role, because its outward convection through the wall is increased in TAAD, and it could be converted to active plasmin at the vSMC membrane. Active plasmin can induce vSMC disappearance, proteolysis of adhesive proteins, activation of MMPs and release of TGF-β from its ECM storage sites. Conversely, vSMCs could respond to aneurysmal biomechanical and proteolytic injury by an epigenetic phenotypic switch, including constitutional overexpression and nuclear translocation of Smad2 and an increase in antiprotease and ECM protein synthesis. In contrast, such an epigenetic phenomenon is not observed in dissections. In this context, dysfunction of proteins involved in vSMC tone are interesting to study, particularly in interaction with plasma protein transport through the wall and TGF-β activation, to establish the

Surface soil moisture retrievals from remote sensing: Current status, products & future trends

Science.gov (United States)

Petropoulos, George P.; Ireland, Gareth; Barrett, Brian

Advances in Earth Observation (EO) technology, particularly over the last two decades, have shown that soil moisture content (SMC) can be measured to some degree or other by all regions of the electromagnetic spectrum, and a variety of techniques have been proposed to facilitate this purpose. In this review we provide a synthesis of the efforts made during the last 20 years or so towards the estimation of surface SMC exploiting EO imagery, with a particular emphasis on retrievals from microwave sensors. Rather than replicating previous overview works, we provide a comprehensive and critical exploration of all the major approaches employed for retrieving SMC in a range of different global ecosystems. In this framework, we consider the newest techniques developed within optical and thermal infrared remote sensing, active and passive microwave domains, as well as assimilation or synergistic approaches. Future trends and prospects of EO for the accurate determination of SMC from space are subject to key challenges, some of which are identified and discussed within. It is evident from this review that there is potential for more accurate estimation of SMC exploiting EO technology, particularly so, by exploring the use of synergistic approaches between a variety of EO instruments. Given the importance of SMC in Earth's land surface interactions and to a large range of applications, one can appreciate that its accurate estimation is critical in addressing key scientific and practical challenges in today's world such as food security, sustainable planning and management of water resources. The launch of new, more sophisticated satellites strengthens the development of innovative research approaches and scientific inventions that will result in a range of pioneering and ground-breaking advancements in the retrievals of soil moisture from space.

Intraarterial beta irradiation induces smooth muscle cell apoptosis and reduces medial cellularity in a hypercholesterolemic rabbit restenosis model

International Nuclear Information System (INIS)

Verin, Vitali; Popowski, Youri; Bochaton-Piallat, Marie-Luce; Belenger, Jacques; Urban, Philip; Neuville, Pascal; Redard, Mireille; Costa, Manuel; Celetta, Giuseppe; Gabbiani, Giulio

2000-01-01

Purpose: Ionizing radiation has been shown to be a powerful inhibitor of neointimal hyperplasia following arterial injury in several animal models of post-percutaneous transluminal coronary angioplasty (post-PTCA) restenosis. This was previously shown to be associated with a reduction in smooth muscle cell (SMC) mitotic activity. This study evaluated the effect of intraarterial beta irradiation on the arterial wall SMC density and apoptosis. Methods and Materials: Twenty-five carotid and 7 iliac arteries of hypercholesterolemic New Zealand white rabbits were injured using the Baumgartner technique. The impact of an 18 Gy beta radiation dose administered after balloon injury was studied and compared to a nonirradiated injured control group. The medial SMC density as well as the percentage of apoptotic cells were determined at 8 days, 21 days, and 6 weeks after injury using an automated computer-based software. Apoptotic cells were identified using in situ end-labeling of fragmented DNA. Results: The values for medial apoptosis in control vs. irradiated arteries were: 0.014 ± 0.023 vs. 0.23 ± 0.28%, p = NS, at 8 days; 0.012 ± 0.018 vs. 0.07 ± 0.07%, p = 0.05, at 21 days; and 0 ± 0 vs. 0.16 ± 0.11%, p = 0.03, at 6 weeks. The overall incidence of medial apoptotic cells at all time points was 0.01 ± 0.017 vs. 0.13 ± 0.14% in controls and irradiated arteries respectively, p = 0.004. Medial SMC density was significantly decreased in irradiated arteries in comparison with controls (p < 0.01 at all time-points). Conclusions: Intraarterial beta irradiation stimulates medial SMC apoptosis in balloon-injured arteries. This, together with a decrease in SMC mitotic activity, contributes to a decrease in the arterial wall cellularity

Epigenetic regulation of vascular smooth muscle cell proliferation and neointima formation by histone deacetylase inhibition.

Science.gov (United States)

Findeisen, Hannes M; Gizard, Florence; Zhao, Yue; Qing, Hua; Heywood, Elizabeth B; Jones, Karrie L; Cohn, Dianne; Bruemmer, Dennis

2011-04-01

Proliferation of smooth muscle cells (SMC) in response to vascular injury is central to neointimal vascular remodeling. There is accumulating evidence that histone acetylation constitutes a major epigenetic modification for the transcriptional control of proliferative gene expression; however, the physiological role of histone acetylation for proliferative vascular disease remains elusive. In the present study, we investigated the role of histone deacetylase (HDAC) inhibition in SMC proliferation and neointimal remodeling. We demonstrate that mitogens induce transcription of HDAC 1, 2, and 3 in SMC. Short interfering RNA-mediated knockdown of either HDAC 1, 2, or 3 and pharmacological inhibition of HDAC prevented mitogen-induced SMC proliferation. The mechanisms underlying this reduction of SMC proliferation by HDAC inhibition involve a growth arrest in the G(1) phase of the cell cycle that is due to an inhibition of retinoblastoma protein phosphorylation. HDAC inhibition resulted in a transcriptional and posttranscriptional regulation of the cyclin-dependent kinase inhibitors p21(Cip1) and p27(Kip). Furthermore, HDAC inhibition repressed mitogen-induced cyclin D1 mRNA expression and cyclin D1 promoter activity. As a result of this differential cell cycle-regulatory gene expression by HDAC inhibition, the retinoblastoma protein retains a transcriptional repression of its downstream target genes required for S phase entry. Finally, we provide evidence that these observations are applicable in vivo by demonstrating that HDAC inhibition decreased neointima formation and expression of cyclin D1 in a murine model of vascular injury. These findings identify HDAC as a critical component of a transcriptional cascade regulating SMC proliferation and suggest that HDAC might play a pivotal role in the development of proliferative vascular diseases, including atherosclerosis and in-stent restenosis.

The impact of social marketing campaigns on reducing mental health stigma: Results from the 2009-2014 Time to Change programme.

Science.gov (United States)

Sampogna, G; Bakolis, I; Evans-Lacko, S; Robinson, E; Thornicroft, G; Henderson, C

2017-02-01

In England, during 2009-2014 the 'Time to Change' anti-stigma programme has included a social marketing campaign (SMC) using mass media channels, social media and social contact events but the efficacy of such approach has not been evaluated yet. The target population included people aged between mid-twenties/mid-forties, from middle-income groups. Participants were recruited through an online market research panel, before and after each burst of the campaign (with a mean number of unique participants per each burst: 956.9±170.2). Participants completed an online questionnaire evaluating knowledge [Mental Health Knowledge Schedule (MAKS)]; attitudes [Community Attitudes toward Mental Illness (CAMI)]; and behaviours [Reported and Intended Behaviour Scale (RIBS)]. Socio-demographic data and level of awareness of the SMC were also collected. A total of 10,526 people were interviewed. An increasing usage of the SMC-media channels as well as of the level of awareness of SMC was found (Psocial media may represent an effective strategy to challenge stigma. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

Sliding-Mode Control of a Charger/Discharger DC/DC Converter for DC-Bus Regulation in Renewable Power Systems

Directory of Open Access Journals (Sweden)

Sergio Ignacio Serna-Garcés

2016-03-01

Full Text Available Stand-alone power systems based on renewable energy sources are used to replace generators based on fossil fuels. Those renewable power systems also require Energy Storage Devices (ESD interfaced by a charger/discharger power converter, which consist of a bidirectional DC/DC converter, and a DC bus. This paper proposes a single sliding-mode controller (SMC for the charger/discharger DC/DC converter to provide a stable DC bus voltage in any operation condition: charging or discharging the ESD, or even without any power exchange between the ESD and the DC bus. Due to the non-linear nature of the power converter, the SMC parameters are adapted on-line to ensure global stability in any operation condition. Such stability of the adaptive SMC is mathematically demonstrated using analytical expressions for the transversality, reachability and equivalent control conditions. Moreover, a design procedure for the adaptive SMC parameters is provided in order to ensure the dynamic response required for the correct operation of the load. Finally, simulations and experimental tests validate the proposed controller and design procedure.

Sliding Mode Controller and Lyapunov Redesign Controller to Improve Microgrid Stability: A Comparative Analysis with CPL Power Variation

Directory of Open Access Journals (Sweden)

Eklas Hossain

2017-11-01

Full Text Available To mitigate the microgrid instability despite the presence of dense Constant Power Load (CPL loads in the system, a number of compensation techniques have already been gone through extensive research, proposed, and implemented around the world. In this paper, a storage based load side compensation technique is used to enhance stability of microgrids. Besides adopting this technique here, Sliding Mode Controller (SMC and Lyapunov Redesign Controller (LRC, two of the most prominent nonlinear control techniques, are individually implemented to control microgrid system stability with desired robustness. CPL power is then varied to compare robustness of these two control techniques. This investigation revealed the better performance of the LRC system compared to SMC to retain stability in microgrid with dense CPL load. All the necessary results are simulated in Matlab/Simulink platform for authentic verification. Reasons behind inferior SMC performance and ways to mitigate that are also discussed. Finally, the effectiveness of SMC and LRC systems to attain stability in real microgrids is verified by numerical analysis.

Delivering SSA Capabilities to the Warfighter

Science.gov (United States)

van Weezendonk, J.; Sherk, J.; Ryan, T.; McGuire, R.

The Space Superiority Systems Wing at the Space and Missile Center (SMC/SY) equips US forces with Offensive Counterspace (OCS), Defensive Counterspace (DCS), and Space Situation Awareness (SSA) systems that further enhance space superiority. The Technology Division (SYT) mission is to identify, develop, and transition cutting-edge technologies to the warfighter. SYT invests in the most relevant technologies for SSA, DCS and OCS that enhance SMC/SY's portfolio. This presentation will provide an overview of the SMC/SY SSA Technology being worked and highlights several key programs. The presentation will also highlight how the SMC/SY SSA efforts fit into to a Space Superiority Architecture. SYT executes its own Space Control Technology program line and leverages technologies from various DoD and national laboratories, Federally Funded Research and Development Companies, national agencies, industry and academia to accomplish their mission. The portions of the SY FY06 SSA portfolio that will be discussed are: Precision Metrics, Star Sensor Studies, Multi-mission Deployable Optical System, Intelligent Agent Data Fusion efforts, ESSA ACTD and the GReAT tech demo.

Evolutionary Genetic Analysis Uncovers Multiple Species with Distinct Habitat Preferences and Antibiotic Resistance Phenotypes in the Stenotrophomonas maltophilia Complex

Directory of Open Access Journals (Sweden)

Luz E. Ochoa-Sánchez

2017-08-01

Full Text Available The genus Stenotrophomonas (Gammaproteobacteria has a broad environmental distribution. Stenotrophomonas maltophilia is its best known species because it is a globally emerging, multidrug-resistant (MDR, opportunistic pathogen. Members of this species are known to display high genetic, ecological and phenotypic diversity, forming the so-called S. maltophilia complex (Smc. Heterogeneous resistance and virulence phenotypes have been reported for environmental Smc isolates of diverse ecological origin. We hypothesized that this heterogeneity could be in part due to the potential lumping of several cryptic species in the Smc. Here we used state-of-the-art phylogenetic and population genetics methods to test this hypothesis based on the multilocus dataset available for the genus at pubmlst.org. It was extended with sequences from complete and draft genome sequences to assemble a comprehensive set of reference sequences. This framework was used to analyze 108 environmental isolates obtained in this study from the sediment and water column of four rivers and streams in Central Mexico, affected by contrasting levels of anthropogenic pollution. The aim of the study was to identify species in this collection, defined as genetically cohesive sequence clusters, and to determine the extent of their genetic, ecological and phenotypic differentiation. The multispecies coalescent, coupled with Bayes factor analysis was used to delimit species borders, together with population genetic structure analyses, recombination and gene flow estimates between sequence clusters. These analyses consistently revealed that the Smc contains at least 5 significantly differentiated lineages: S. maltophilia and Smc1 to Smc4. Only S. maltophilia was found to be intrinsically MDR, all its members expressing metallo-β-lactamases (MBLs. The other Smc lineages were not MDR and did not express MBLs. We also obtained isolates related to S. acidaminiphila, S. humi and S. terrae. They

Divergent effects of 17-β-estradiol on human vascular smooth muscle and endothelial cell function diminishes TNF-α-induced neointima formation

International Nuclear Information System (INIS)

Nintasen, Rungrat; Riches, Kirsten; Mughal, Romana S.; Viriyavejakul, Parnpen; Chaisri, Urai; Maneerat, Yaowapa; Turner, Neil A.; Porter, Karen E.

2012-01-01

Highlights: ► TNF-α augments neointimal hyperplasia in human saphenous vein. ► TNF-α induces detrimental effects on endothelial and smooth muscle cell function. ► Estradiol exerts modulatory effects on TNF-induced vascular cell functions. ► The modulatory effects of estradiol are discriminatory and cell-type specific. -- Abstract: Coronary heart disease (CHD) is a condition characterized by increased levels of proinflammatory cytokines, including tumor necrosis factor-α (TNF-α). TNF-α can induce vascular endothelial cell (EC) and smooth muscle cell (SMC) dysfunction, central events in development of neointimal lesions. The reduced incidence of CHD in young women is believed to be due to the protective effects of estradiol (E2). We therefore investigated the effects of TNF-α on human neointima formation and SMC/EC functions and any modulatory effects of E2. Saphenous vein (SV) segments were cultured in the presence of TNF-α (10 ng/ml), E2 (2.5 nM) or both in combination. Neointimal thickening was augmented by incubation with TNF-α, an effect that was abolished by co-culture with E2. TNF-α increased SV–SMC proliferation in a concentration-dependent manner that was optimal at 10 ng/ml (1.5-fold increase), and abolished by E2 at all concentrations studied (1–50 nM). Surprisingly, E2 itself at low concentrations (1 and 5 nM) stimulated SV–SMC proliferation to a level comparable to that of TNF-α alone. SV–EC migration was significantly impaired by TNF-α (42% of control), and co-culture with E2 partially restored the ability of SV–EC to migrate and repair the wound. In contrast, TNF-α increased SV–SMC migration by 1.7-fold, an effect that was completely reversed by co-incubation with E2. Finally, TNF-α potently induced ICAM-1 and VCAM-1 expression in both SV–EC and SV–SMC. However there was no modulation by E2 in either cell-type. In conclusion, TNF-α induced SV neointima formation, increased SMC proliferation and migration, impaired

Discovery and Characterization of a Caustic Crossing Microlensing Event in the Small Magellanic Cloud

International Nuclear Information System (INIS)

Alcock, C.; Allsman, R.A.; Alves, D.; Axelrod, T.S.; Becker, A.C.; Bennett, D.P.; Cook, K.H.; Drake, A.J.; Freeman, K.C.; Griest, K.; King, L.J.; Lehner, M.J.; Marshall, S.L.

1999-01-01

We present photometric observations and analysis of the second microlensing event detected toward the Small Magellanic Cloud (SMC), MACHO Alert 98-SMC-1. This event was detected early enough to allow intensive observation of the light curve. These observations revealed 98-SMC-1 to be the first caustic crossing binary microlensing event toward the Magellanic Clouds to be discovered in progress. Frequent coverage of the evolving light curve allowed an accurate prediction for the date of the source crossing out of the lens caustic structure. The caustic crossing temporal width, along with the angular size of the source star, measures the proper motion of the lens with respect to the source and thus allows an estimate of the location of the lens. Lenses located in the Galactic halo would have a velocity projected to the SMC of v∼1500 kms -1 , while an SMC lens would typically have v∼60 kms -1 . The event light curve allows us to obtain a unique fit to the parameters of the binary lens and to estimate the proper motion of the lensing system. We have performed a joint fit to the MACHO/GMAN data presented here, including recent EROS data of this event from Afonso and collaborators. These joint data are sufficient to constrain the time t * for the lens to move an angle equal to the source angular radius: t * =0.116±0.010 days. We estimate a radius for the lensed source of R * =1.1±0.1 R circle-dot from its unblended color and magnitude. This yields a projected velocity of v=76±10 kms -1 . Only 0.12% of halo lenses would be expected to have a v value at least as small as this, while 38% of SMC lenses would be expected to have v as large as this. This implies that the lensing system is more likely to reside in the SMC than in the Galactic halo. Similar observations of future Magellanic Cloud microlensing events will help to determine the contribution of MACHOS to the Galaxy's dark halo. copyright copyright 1999. The American Astronomical Society

NEW OPTICAL REDDENING MAPS OF THE LARGE AND SMALL MAGELLANIC CLOUDS

International Nuclear Information System (INIS)

Haschke, Raoul; Grebel, Eva K.; Duffau, Sonia

2011-01-01

We present new reddening maps of the Small Magellanic Cloud (SMC) and Large Magellanic Cloud (LMC) based on the data of the third phase of the Optical Gravitational Lensing Experiment (OGLE III). We have used two different methods to derive optical reddening maps. We adopt a theoretical mean unreddened color for the red clump (RC) in the SMC and LMC, respectively. We subdivide the photometric data for both Clouds into subfields and calculate the difference between the observed RC position and the theoretical value for each field, which provides us with the reddening value in (V - I). Furthermore, reddening values are obtained for 13490 LMC RR Lyrae ab and 1529 SMC RR Lyrae ab stars covering the whole OGLE III region of the Magellanic Clouds (MCs). The observed colors (V - I) of the RR Lyrae stars are compared with the color from the absolute magnitudes. The absolute magnitude of each RR Lyrae star is computed using its period and metallicity derived from Fourier decomposition of its light curve. In general, we find a low and uniform reddening distribution in both MCs. The RC method indicates a mean reddening of the LMC of E(V - I) = 0.09 ± 0.07 mag, while for the SMC E(V - I) = 0.04 ± 0.06 mag is obtained. With RR Lyrae stars a median value of E(V - I) = 0.11 ± 0.06 mag for the LMC and E(V - I) = 0.07 ± 0.06 mag for the SMC is found. The LMC shows very low reddening in the bar region, whereas the reddening in the star-forming leading edge and 30 Doradus is considerably higher. In the SMC, three pronounced regions with higher reddening are visible. Two are located along the bar, while the highest reddening is found in the star-forming wing of the SMC. In general, the regions with higher reddening are in good spatial agreement with infrared reddening maps as well as with reddening estimations of other studies. The position-dependent reddening values from the RC method are available via the German Astrophysical Virtual Observatory interface.

Predictive ability of severe rainfall events over Catalonia for the year 2008

Science.gov (United States)

Comellas, A.; Molini, L.; Parodi, A.; Sairouni, A.; Llasat, M. C.; Siccardi, F.

2011-07-01

This paper analyses the predictive ability of quantitative precipitation forecasts (QPF) and the so-called "poor-man" rainfall probabilistic forecasts (RPF). With this aim, the full set of warnings issued by the Meteorological Service of Catalonia (SMC) for potentially-dangerous events due to severe precipitation has been analysed for the year 2008. For each of the 37 warnings, the QPFs obtained from the limited-area model MM5 have been verified against hourly precipitation data provided by the rain gauge network covering Catalonia (NE of Spain), managed by SMC. For a group of five selected case studies, a QPF comparison has been undertaken between the MM5 and COSMO-I7 limited-area models. Although MM5's predictive ability has been examined for these five cases by making use of satellite data, this paper only shows in detail the heavy precipitation event on the 9-10 May 2008. Finally, the "poor-man" rainfall probabilistic forecasts (RPF) issued by SMC at regional scale have also been tested against hourly precipitation observations. Verification results show that for long events (>24 h) MM5 tends to overestimate total precipitation, whereas for short events (≤24 h) the model tends instead to underestimate precipitation. The analysis of the five case studies concludes that most of MM5's QPF errors are mainly triggered by very poor representation of some of its cloud microphysical species, particularly the cloud liquid water and, to a lesser degree, the water vapor. The models' performance comparison demonstrates that MM5 and COSMO-I7 are on the same level of QPF skill, at least for the intense-rainfall events dealt with in the five case studies, whilst the warnings based on RPF issued by SMC have proven fairly correct when tested against hourly observed precipitation for 6-h intervals and at a small region scale. Throughout this study, we have only dealt with (SMC-issued) warning episodes in order to analyse deterministic (MM5 and COSMO-I7) and probabilistic (SMC

Quantitative magnetotail characteristics of different magnetospheric states

Directory of Open Access Journals (Sweden)

M. A. Shukhtina

2004-03-01

Full Text Available Quantitative relationships allowing one to compute the lobe magnetic field, flaring angle and tail radius, and to evaluate magnetic flux based on solar wind/IMF parameters and spacecraft position are obtained for the middle magnetotail, X=(–15,–35R_E, using 3.5 years of simultaneous Geotail and Wind spacecraft observations. For the first time it was done separately for different states of magnetotail including the substorm onset (SO epoch, the steady magnetospheric convection (SMC and quiet periods (Q. In the explored distance range the magnetotail parameters appeared to be similar (within the error bar for Q and SMC states, whereas at SO their values are considerably larger. In particular, the tail radius is larger by 1–3 R_E at substorm onset than during Q and SMC states, for which the radius value is close to previous magnetopause model values. The calculated lobe magnetic flux value at substorm onset is ~1GWb, exceeding that at Q (SMC states by ~50%. The model magnetic flux values at substorm onset and SMC show little dependence on the solar wind dynamic pressure and distance in the tail, so the magnetic flux value can serve as an important discriminator of the state of the middle magnetotail.

Key words. Magnetospheric physics (solar windmagnetosphere- interactions, magnetotail, storms and substorms

Telomerase Reverse Transcriptase Deficiency Prevents Neointima Formation Through Chromatin Silencing of E2F1 Target Genes.

Science.gov (United States)

Endorf, Elizabeth B; Qing, Hua; Aono, Jun; Terami, Naoto; Doyon, Geneviève; Hyzny, Eric; Jones, Karrie L; Findeisen, Hannes M; Bruemmer, Dennis

2017-02-01

Aberrant proliferation of smooth muscle cells (SMC) in response to injury induces pathological vascular remodeling during atherosclerosis and neointima formation. Telomerase is rate limiting for tissue renewal and cell replication; however, the physiological role of telomerase in vascular diseases remains to be determined. The goal of the present study was to determine whether telomerase reverse transcriptase (TERT) affects proliferative vascular remodeling and to define the molecular mechanism by which TERT supports SMC proliferation. We first demonstrate high levels of TERT expression in replicating SMC of atherosclerotic and neointimal lesions. Using a model of guidewire-induced arterial injury, we demonstrate decreased neointima formation in TERT-deficient mice. Studies in SMC isolated from TERT-deficient and TERT overexpressing mice with normal telomere length established that TERT is necessary and sufficient for cell proliferation. TERT deficiency did not induce a senescent phenotype but resulted in G1 arrest albeit hyperphosphorylation of the retinoblastoma protein. This proliferative arrest was associated with stable silencing of the E2F1-dependent S-phase gene expression program and not reversed by ectopic overexpression of E2F1. Finally, chromatin immunoprecipitation and accessibility assays revealed that TERT is recruited to E2F1 target sites and promotes chromatin accessibility for E2F1 by facilitating the acquisition of permissive histone modifications. These data indicate a previously unrecognized role for TERT in neointima formation through epigenetic regulation of proliferative gene expression in SMC. © 2016 American Heart Association, Inc.

Shape Memory Composite Hybrid Hinge

Science.gov (United States)

Fang, Houfei; Im, Eastwood; Lin, John; Scarborough, Stephen

2012-01-01

There are two conventional types of hinges for in-space deployment applications. The first type is mechanically deploying hinges. A typical mechanically deploying hinge is usually composed of several tens of components. It is complicated, heavy, and bulky. More components imply higher deployment failure probability. Due to the existence of relatively moving components among a mechanically deploying hinge, it unavoidably has microdynamic problems. The second type of conventional hinge relies on strain energy for deployment. A tape-spring hinge is a typical strain energy hinge. A fundamental problem of a strain energy hinge is that its deployment dynamic is uncontrollable. Usually, its deployment is associated with a large impact, which is unacceptable for many space applications. Some damping technologies have been experimented with to reduce the impact, but they increased the risks of an unsuccessful deployment. Coalescing strain energy components with shape memory composite (SMC) components to form a hybrid hinge is the solution. SMCs are well suited for deployable structures. A SMC is created from a high-performance fiber and a shape memory polymer resin. When the resin is heated to above its glass transition temperature, the composite becomes flexible and can be folded or packed. Once cooled to below the glass transition temperature, the composite remains in the packed state. When the structure is ready to be deployed, the SMC component is reheated to above the glass transition temperature, and it returns to its as-fabricated shape. A hybrid hinge is composed of two strain energy flanges (also called tape-springs) and one SMC tube. Two folding lines are placed on the SMC tube to avoid excessive strain on the SMC during folding. Two adapters are used to connect the hybrid hinge to its adjacent structural components. While the SMC tube is heated to above its glass transition temperature, a hybrid hinge can be folded and stays at folded status after the temperature

Direct Torque Control With Feedback Linearization for Induction Motor Drives

DEFF Research Database (Denmark)

Lascu, Cristian; Jafarzadeh, Saeed; Fadali, Sami M.

2017-01-01

This paper describes a direct-torque-controlled (DTC) induction motor (IM) drive that employs feedback linearization and sliding-mode control (SMC). A new feedback linearization approach is proposed, which yields a decoupled linear IM model with two state variables: torque and stator flux magnitude....... This intuitive linear model is used to implement a DTC-type controller that preserves all DTC advantages and eliminates its main drawback, the flux and torque ripple. Robust, fast, and ripple-free control is achieved by using SMC with proportional control in the vicinity of the sliding surface. SMC assures...... in simulations. The sliding controller is compared with a linear DTC scheme with and without feedback linearization. Extensive experimental results for a sensorless IM drive validate the proposed solution....

PSO based neuro fuzzy sliding mode control for a robot manipulator

Directory of Open Access Journals (Sweden)

M. Vijay

2017-05-01

Full Text Available This paper presents the control strategy of two degrees of freedom (2DOF rigid robot manipulator based on the coupling of artificial neuro fuzzy inference system (ANFIS with sliding mode control (SMC. Initially SMC with proportional integral derivative (PID sliding surface is adapted to control the robot manipulator. The parameters of the sliding surface are obtained by minimizing a quadratic performance indices using particle swarm optimization (PSO. Variations of SMC i.e. boundary sliding mode control (BSMC and boundary sliding mode control with PID sliding surface (PIDBSMC are developed for optimized performance index. Finally an ANFIS adaptive controller is proposed to generate the adaptive control signal and found to be more robust with regard to disturbances in input torque.

Estudio de cúmulos estelares de la Nube Menor de Magallanes: fotometría de Washington de 14 cúmulos de edad intermedia

Science.gov (United States)

Piatti, A. E.; Clariá, J. J.; Bica, E.; Geisler, D.; Ahumada, A. V.; Girardi, L.

We present CCD photometry in the Washington system C and T1 bands of 14 star clusters of the Small Magellanic Cloud (SMC). We determine ages and metallicities using theoretical isochrones, the T1 parameter and the Red Giant Standard method. Excepting IC 1708, all the observed clusters are aged between 1 and 6.3 Gyr, while their metallicities ([Fe/H]) range be- tween -0.7 and -1.4. Two important cluster formation episodes in the SMC, dated at 2 Gyr and 5 Gyr ago, were detected. During approximately the first 4 Gyr in the SMC lifetime, the cluster formation rate turned out to be constant. A detailed version of this work can be seen in Piatti et al. (2011, MNRAS, 417, 1559). FULL TEXT IN SPANISH

DUAL STATE-PARAMETER UPDATING SCHEME ON A CONCEPTUAL HYDROLOGIC MODEL USING SEQUENTIAL MONTE CARLO FILTERS

Science.gov (United States)

Noh, Seong Jin; Tachikawa, Yasuto; Shiiba, Michiharu; Kim, Sunmin

Applications of data assimilation techniques have been widely used to improve upon the predictability of hydrologic modeling. Among various data assimilation techniques, sequential Monte Carlo (SMC) filters, known as "particle filters" provide the capability to handle non-linear and non-Gaussian state-space models. This paper proposes a dual state-parameter updating scheme (DUS) based on SMC methods to estimate both state and parameter variables of a hydrologic model. We introduce a kernel smoothing method for the robust estimation of uncertain model parameters in the DUS. The applicability of the dual updating scheme is illustrated using the implementation of the storage function model on a middle-sized Japanese catchment. We also compare performance results of DUS combined with various SMC methods, such as SIR, ASIR and RPF.

A Comparative Review of Marketing Authorization Decisions in Switzerland, the EU, and the USA.

Science.gov (United States)

Dalla Torre Di Sanguinetto, Simon; Heinonen, Esa; Antonov, Janine; Bolte, Claus

2018-01-01

In this study we compared Swissmedic's (SMC's) regulatory marketing authorization decisions to those of the US Food and Drug Administration (FDA) and European drug regulatory authorities (EU). We investigated the overall similarity of the regulatory decisions, approval, and postmarketing withdrawal rates in the 3 jurisdictions. In case regulatory decisions diverged, we analyzed the reasons for rejection of marketing authorization applications (MAAs). The study comprises 255 new molecular entity (NME) MAAs assessed by SMC by the EU and FDA between 2005 through 2014. Study parameters included the regulatory decision, postmarketing withdrawal rates, and the official reasons for rejection. Regulatory decisions converged to a high degree among all 3 agencies (between 84% and 90%). SMC's average approval rate (84%) was slightly lower than those of the FDA (87%) and the EU (91%). Postmarketing withdrawal rates were generally low (4%-5%) but were 3 to 5 times higher when decisions among the drug regulatory authorities (DRAs) diverged. SMC's primary grounds for rejection were lack of efficacy (45%) and safety (40%). The 3 investigated DRAs adhere largely to the same scientific principles and regulatory guidelines; therefore, remaining disparities ought to be considered in a cultural, legal and public health priority context.

Serum Amino Acid Profiles in Normal Subjects and in Patients with or at Risk of Alzheimer Dementia.

Science.gov (United States)

Corso, Gaetano; Cristofano, Adriana; Sapere, Nadia; la Marca, Giancarlo; Angiolillo, Antonella; Vitale, Michela; Fratangelo, Roberto; Lombardi, Teresa; Porcile, Carola; Intrieri, Mariano; Di Costanzo, Alfonso

2017-01-01

Abnormalities in the plasma amino acid profile have been reported in Alzheimer disease (AD), but no data exist for the prodromal phase characterized by subjective memory complaint (SMC). It was our aim to understand if serum amino acid levels change along the continuum from normal to AD, and to identify possible diagnostic biomarkers. Serum levels of 15 amino acids and 2 organic acids were determined in 4 groups of participants - 29 with probable AD, 18 with mild cognitive impairment (MCI), 24 with SMC, and 46 cognitively healthy subjects (HS) - by electrospray tandem mass spectrometry. Glutamate, aspartate, and phenylalanine progressively decreased, while citrulline, argi-ninosuccinate, and homocitrulline progressively increased, from HS over SMC and MCI to AD. The panel including these 6 amino acids and 4 ratios (glutamate/citrulline, citrulline/phenylalanine, leucine plus isoleucine/phenylalanine, and arginine/phenylalanine) discriminated AD from HS with about 96% accuracy. Other panels including 20 biomarkers discriminated SMC or MCI from AD or HS with an accuracy ranging from 88 to 75%. Amino acids contribute to a characteristic metabotype during the progression of AD along the continuum from health to frank dementia, and their monitoring in elderly individuals might help to detect at-risk subjects.

Tree-based server-middleman-client architecture: improving scalability and reliability for voting-based network games in ad hoc wireless networks

Science.gov (United States)

Guo, Y.; Fujinoki, H.

2006-10-01

The concept of a new tree-based architecture for networked multi-player games was proposed by Matuszek to improve scalability in network traffic at the same time to improve reliability. The architecture (we refer it as "Tree-Based Server- Middlemen-Client architecture") will solve the two major problems in ad-hoc wireless networks: frequent link failures and significance in battery power consumption at wireless transceivers by using two new techniques, recursive aggregation of client messages and subscription-based propagation of game state. However, the performance of the TBSMC architecture has never been quantitatively studied. In this paper, the TB-SMC architecture is compared with the client-server architecture using simulation experiments. We developed an event driven simulator to evaluate the performance of the TB-SMC architecture. In the network traffic scalability experiments, the TB-SMC architecture resulted in less than 1/14 of the network traffic load for 200 end users. In the reliability experiments, the TB-SMC architecture improved the number of successfully delivered players' votes by 31.6, 19.0, and 12.4% from the clientserver architecture at high (failure probability of 90%), moderate (50%) and low (10%) failure probability.

Animal model for angiotensin II effects in the internal anal sphincter smooth muscle: mechanism of action.

Science.gov (United States)

Fan, Ya-Ping; Puri, Rajinder N; Rattan, Satish

2002-03-01

Effect of ANG II was investigated in in vitro smooth muscle strips and in isolated smooth muscle cells (SMC). Among different species, rat internal and sphincter (IAS) smooth muscle showed significant and reproducible contraction that remained unmodified by different neurohumoral inhibitors. The AT(1) antagonist losartan but not AT(2) antagonist PD-123319 antagonized ANG II-induced contraction of the IAS smooth muscle and SMC. ANG II-induced contraction of rat IAS smooth muscle and SMC was attenuated by tyrosine kinase inhibitors genistein and tyrphostin, protein kinase C (PKC) inhibitor H-7, Ca(2+) channel blocker nicardipine, Rho kinase inhibitor Y-27632 or p(44/42) mitogen-activating protein kinase (MAPK(44/42)) inhibitor PD-98059. Combinations of nicardipine and H-7, Y-27632, and PD-98059 caused further attenuation of the ANG II effects. Western blot analyses revealed the presence of both AT(1) and AT(2) receptors. We conclude that ANG II causes contraction of rat IAS smooth muscle by the activation of AT(1) receptors at the SMC and involves multiple intracellular pathways, influx of Ca(2+), and activation of PKC, Rho kinase, and MAPK(44/42).

Respons Agronomi Tiga Varietas Ubi Kayu pada Berbagai Tingkat Kadar Air Tanah

Directory of Open Access Journals (Sweden)

Suwarto

2018-04-01

Full Text Available Cassava has been cultivated in almost the all region of Indonesia as a raw material of food, feed, and industries. The productivity of cassava was varied among the region due to the variation of varieties used and growth environment, especially rainfall or water availability. Water deficit or drought stress will decrease the growth and yield of cassava. Selecting tolerant variety to drought will be important to get high productivity. An experimental pot in the greenhouse has been conducted to know the growth and yield response to drought. Three varieties of cassava i.e Adira-1, Gajah, and Mangu were planted in the pot at three level of soil moisture content (SMC 4060, 6080, and 80100% of field capacity (FC. The cassava growth traits were influenced by SMC starting at 6 weeks after planting (WAP for a number of leaves, at 8 WAP for stem girth, at 10 WAP for plant height, at 14 WAP for lobus width, and 15 WAP for lobus length. Root, stem, and leaves dry weight in the SMC of 4060% FC were 64.4; 43.98, and 31.19% of the dry weight in 8000% FC. Roots yield in the soil moisture content of 4060% FC decreased by 76.2% and in the SMC of 4060%, FC decreased by 38.4% compared to in the SMC of 80100% FC. The water use efficiency and roots yield of Gajah variety were highest.

Comparison study of human brain response to acupuncture stimulation vs finger tapping task by using real time fMRI

International Nuclear Information System (INIS)

Wang Wei; Zhu Fang; Qi Jianpin; Xia Yeling; Xia Liming; Wang Chengyuan

2002-01-01

Objective: To characterize the central nervous system reaction on acupuncture stimulations of ZUSANLI (S36) and YANGLINGQUAN (G34) by using real time imaging processing (RTIP) functional magnetic resonance imaging. Methods: Functional MR imaging was performed in 17 healthy volunteers with 2 paradigms: acupuncture at acu-points of ZUSANLI (S36 and YANGLINGQUAN (G34) (on the right side) and control stimulations (right finger tapping). Correlation coefficient (CC) of ROI was detected including bilateral sensorimotor area (SMC), pre-motor cortex (PMC), and supplementary motor area (SMA). Only the ROI in which CC ≥ 0.6 and range exceeded 4 pixels was counted as an activated area. Fisher's exact test was performed to analyze the data in SAS software package. Results: In tapping finger task, 16 subjects obtained functional MR images satisfactorily except 1 subjects, and 8 of SMC R , 8 of PMC R , 9 of SMA, 16 of SMC L , and 9 of PMC L were activated. In acupuncture task, 3 subjects were eliminated for gross motion artifacts, there were 6 of SMC R , 10 of PMC R , 8 of SMA, 11 of SMC L , and 10 of PMC L were activated in the rest 14 subjects. Fisher's exact test (2-Tail) (P> 0.05) showed that there was no significant difference in ROI activated by two kinds of stimulus. Conclusion: Real time fMRI was very useful in exploring acupuncture mechanisms. However, its value in practice still requires further study and synthetic appraise integrating clinical acupuncture effect

In-depth evaluation of commercially available human vascular smooth muscle cells phenotype: Implications for vascular tissue engineering

Energy Technology Data Exchange (ETDEWEB)

Timraz, Sara B.H., E-mail: sara.timraz@kustar.ac.ae [Department of Biomedical Engineering, Khalifa University, PO Box 127788, Abu Dhabi (United Arab Emirates); Farhat, Ilyas A.H., E-mail: ilyas.farhat@outlook.com [Department of Applied Mathematics and Sciences, Khalifa University, PO Box 127788, Abu Dhabi (United Arab Emirates); Alhussein, Ghada, E-mail: ghada.alhussein@kustar.ac.ae [Department of Biomedical Engineering, Khalifa University, PO Box 127788, Abu Dhabi (United Arab Emirates); Christoforou, Nicolas, E-mail: nicolas.christoforou@kustar.ac.ae [Department of Biomedical Engineering, Khalifa University, PO Box 127788, Abu Dhabi (United Arab Emirates); Department of Biomedical Engineering, Duke University, Durham, NC 27708 (United States); Teo, Jeremy C.M., E-mail: jeremy.teo@kustar.ac.ae [Department of Biomedical Engineering, Khalifa University, PO Box 127788, Abu Dhabi (United Arab Emirates)

2016-05-01

In vitro research on vascular tissue engineering has extensively used isolated primary human or animal smooth muscle cells (SMC). Research programs that lack such facilities tend towards commercially available primary cells sources. Here, we aim to evaluate the capacity of commercially available human SMC to maintain their contractile phenotype, and determine if dedifferentiation towards the synthetic phenotype occurs in response to conventional cell culture and passaging without any external biochemical or mechanical stimuli. Lower passage SMC adopted a contractile phenotype marked by a relatively slower proliferation rate, higher expression of proteins of the contractile apparatus and smoothelin, elongated morphology, and reduced deposition of collagen types I and III. As the passage number increased, migratory capacity was enhanced, average cell speed, total distance and net distance travelled increased up to passage 8. Through the various assays, corroborative evidence pinpoints SMC at passage 7 as the transition point between the contractile and synthetic phenotypes, while passage 8 distinctly and consistently exhibited characteristics of synthetic phenotype. This knowledge is particularly useful in selecting SMC of appropriate passage number for the target vascular tissue engineering application, for example, a homeostatic vascular graft for blood vessel replacement versus recreating atherosclerotic blood vessel model in vitro. - Highlights: • Ability of human smooth muscle cells to alter phenotype in culture is evaluated. • Examined the effect of passaging human smooth muscle cells on phenotype. • Phenotype is assessed based on morphology, proliferation, markers, and migration. • Multi-resolution assessment methodology, single-cell and cell-population. • Lower and higher passages than P7 adopted a contractile and synthetic phenotype respectively.

In-depth evaluation of commercially available human vascular smooth muscle cells phenotype: Implications for vascular tissue engineering

International Nuclear Information System (INIS)

Timraz, Sara B.H.; Farhat, Ilyas A.H.; Alhussein, Ghada; Christoforou, Nicolas; Teo, Jeremy C.M.

2016-01-01

In vitro research on vascular tissue engineering has extensively used isolated primary human or animal smooth muscle cells (SMC). Research programs that lack such facilities tend towards commercially available primary cells sources. Here, we aim to evaluate the capacity of commercially available human SMC to maintain their contractile phenotype, and determine if dedifferentiation towards the synthetic phenotype occurs in response to conventional cell culture and passaging without any external biochemical or mechanical stimuli. Lower passage SMC adopted a contractile phenotype marked by a relatively slower proliferation rate, higher expression of proteins of the contractile apparatus and smoothelin, elongated morphology, and reduced deposition of collagen types I and III. As the passage number increased, migratory capacity was enhanced, average cell speed, total distance and net distance travelled increased up to passage 8. Through the various assays, corroborative evidence pinpoints SMC at passage 7 as the transition point between the contractile and synthetic phenotypes, while passage 8 distinctly and consistently exhibited characteristics of synthetic phenotype. This knowledge is particularly useful in selecting SMC of appropriate passage number for the target vascular tissue engineering application, for example, a homeostatic vascular graft for blood vessel replacement versus recreating atherosclerotic blood vessel model in vitro. - Highlights: • Ability of human smooth muscle cells to alter phenotype in culture is evaluated. • Examined the effect of passaging human smooth muscle cells on phenotype. • Phenotype is assessed based on morphology, proliferation, markers, and migration. • Multi-resolution assessment methodology, single-cell and cell-population. • Lower and higher passages than P7 adopted a contractile and synthetic phenotype respectively.

A New Approach to Simulate Groundwater Table Dynamics and Its Validation in China

Science.gov (United States)

Lv, M.; Lu, H.; Dan, L.; Yang, K.

2017-12-01

The groundwater has very important role in hydrology-climate-human activity interaction. But the groundwater table dynamics currently is not well simulated in global-scale land surface models. Meanwhile, almost all groundwater schemes are adopting a specific yield method to estimate groundwater table, in which how to determine the proper specific yield value remains a big challenge. In this study, we developed a Soil Moisture Correlation (SMC) method to simulate groundwater table dynamics. We coupled SMC with a hydrological model (named as NEW) and compared it with the original model in which a specific yield method is used (named as CTL). Both NEW and CTL were tested in Tangnaihai Subbasin of Yellow River and Jialingjiang Subbasin along Yangtze River, where underground water is less impacted by human activities. The simulated discharges by NEW and CTL are compared against gauge observations. The comparison results reveal that after calibration both models are able to reproduce the discharge well. However, there is no parameter needed to be calibrated for SMC. It indicates that SMC method is more efficient and easy-to-use than the specific yield method. Since there is no direct groundwater table observation in these two basins, simulated groundwater table were compared with a global data set provided by Fan et al. (2013). Both NEW and CTL estimate lower depths than Fan does. Moreover, when comparing the variation of terrestrial water storage (TWS) derived from NEW with that observed by GRACE, good agreements were confirmed. It demonstrated that SMC method is able to reproduce groundwater level dynamics reliably.

THE SPITZER SPECTROSCOPIC SURVEY OF THE SMALL MAGELLANIC CLOUD (S4MC): PROBING THE PHYSICAL STATE OF POLYCYCLIC AROMATIC HYDROCARBONS IN A LOW-METALLICITY ENVIRONMENT

International Nuclear Information System (INIS)

Sandstrom, Karin M.; Bolatto, Alberto D.; Bot, Caroline; Draine, B. T.; Ingalls, James G.; Israel, Frank P.; Tielens, A. G. G. M.; Jackson, James M.; Leroy, Adam K.; Li, Aigen; Rubio, Mónica; Simon, Joshua D.; Smith, J. D. T.; Stanimirović, Snežana; Van Loon, Jacco Th.

2012-01-01

We present results of mid-infrared spectroscopic mapping observations of six star-forming regions in the Small Magellanic Cloud (SMC) from the Spitzer Spectroscopic Survey of the SMC (S 4 MC). We detect the mid-IR emission from polycyclic aromatic hydrocarbons (PAHs) in all of the mapped regions, greatly increasing the range of environments where PAHs have been spectroscopically detected in the SMC. We investigate the variations of the mid-IR bands in each region and compare our results to studies of the PAH bands in the SINGS sample and in a sample of low-metallicity starburst galaxies. PAH emission in the SMC is characterized by low ratios of the 6-9 μm features relative to the 11.3 μm feature and weak 8.6 and 17.0 μm features. Interpreting these band ratios in the light of laboratory and theoretical studies, we find that PAHs in the SMC tend to be smaller and less ionized than those in higher metallicity galaxies. Based on studies of PAH destruction, we argue that a size distribution shifted toward smaller PAHs cannot be the result of processing in the interstellar medium, but instead reflects differences in the formation of PAHs at low metallicity. Finally, we discuss the implications of our observations for our understanding of the PAH life-cycle in low-metallicity galaxies—namely that the observed deficit of PAHs may be a consequence of PAHs forming with smaller average sizes and therefore being more susceptible to destruction under typical interstellar medium conditions.

THE SPITZER SPECTROSCOPIC SURVEY OF THE SMALL MAGELLANIC CLOUD (S{sup 4}MC): PROBING THE PHYSICAL STATE OF POLYCYCLIC AROMATIC HYDROCARBONS IN A LOW-METALLICITY ENVIRONMENT

Energy Technology Data Exchange (ETDEWEB)

Sandstrom, Karin M. [Max Planck Institut fuer Astronomie, D-69117 Heidelberg (Germany); Bolatto, Alberto D. [Department of Astronomy and Laboratory for Millimeter-wave Astronomy, University of Maryland, College Park, MD 20742 (United States); Bot, Caroline [Universite de Strasbourg, Observatoire Astronomique de Strasbourg, F-67000 Strasbourg (France); Draine, B. T. [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Ingalls, James G. [Spitzer Science Center, California Institute of Technology, Pasadena, CA 91125 (United States); Israel, Frank P.; Tielens, A. G. G. M. [Sterrewacht Leiden, Leiden University, 2300 RA Leiden (Netherlands); Jackson, James M. [Institute for Astrophysical Research, Boston University, Boston, MA 02215 (United States); Leroy, Adam K. [National Radio Astronomy Observatory, Charlottesville, VA 22903 (United States); Li, Aigen [Department of Physics and Astronomy, University of Missouri, Columbia, MO 65213 (United States); Rubio, Monica [Departamento de Astronomia, Universidad de Chile, Casilla 36-D, Santiago (Chile); Simon, Joshua D. [Observatories of the Carnegie Institution of Washington, Pasadena, CA 91101 (United States); Smith, J. D. T. [Ritter Astrophysical Research Center, University of Toledo, Toledo, OH 43603 (United States); Stanimirovic, Snezana [Department of Astronomy, University of Wisconsin, Madison, Madison, WI 53703 (United States); Van Loon, Jacco Th., E-mail: sandstrom@mpia.de [Astrophysics Group, Lennard-Jones Laboratories, Keele University, Staffordshire ST5 5BG (United Kingdom)

2012-01-01

We present results of mid-infrared spectroscopic mapping observations of six star-forming regions in the Small Magellanic Cloud (SMC) from the Spitzer Spectroscopic Survey of the SMC (S{sup 4}MC). We detect the mid-IR emission from polycyclic aromatic hydrocarbons (PAHs) in all of the mapped regions, greatly increasing the range of environments where PAHs have been spectroscopically detected in the SMC. We investigate the variations of the mid-IR bands in each region and compare our results to studies of the PAH bands in the SINGS sample and in a sample of low-metallicity starburst galaxies. PAH emission in the SMC is characterized by low ratios of the 6-9 {mu}m features relative to the 11.3 {mu}m feature and weak 8.6 and 17.0 {mu}m features. Interpreting these band ratios in the light of laboratory and theoretical studies, we find that PAHs in the SMC tend to be smaller and less ionized than those in higher metallicity galaxies. Based on studies of PAH destruction, we argue that a size distribution shifted toward smaller PAHs cannot be the result of processing in the interstellar medium, but instead reflects differences in the formation of PAHs at low metallicity. Finally, we discuss the implications of our observations for our understanding of the PAH life-cycle in low-metallicity galaxies-namely that the observed deficit of PAHs may be a consequence of PAHs forming with smaller average sizes and therefore being more susceptible to destruction under typical interstellar medium conditions.

Small supernumerary marker chromosome causing partial trisomy 6p in a child with craniosynostosis.

Science.gov (United States)

Villa, Olaya; Del Campo, Miguel; Salido, Marta; Gener, Blanca; Astier, Laura; Del Valle, Jesús; Gallastegui, Fátima; Pérez-Jurado, Luis A; Solé, Francesc

2007-05-15

We report on a child with a small supernumerary marker chromosome (sSMC) causing partial trisomy 6p. The child showed a phenotype consisting of neonatal craniosynostosis, microcephaly, and borderline developmental delay. By molecular techniques the sSMC has been shown to contain approximately 16 Mb of genomic DNA from 6p21.1 to 6cen, being de novo and of maternal origin.

Fibrinolytic activity is associated with presence of cystic media degeneration in aneurysms of the ascending aorta

OpenAIRE

Borges , Luciano F; Gomez , Delphine; Quintana , Mercedes; Leclercq , Anne; Touat , Ziad; Jondeau , Guillaume; Meilhac , Olivier; Jandrot-Perrus , Martine; Gutierrez , Paulo Sampaio; Freymuller , Edna; Vranckx , Roger; Michel , Jean-Baptiste

2010-01-01

Abstract Aims Thoracic Ascending Aortic Aneurysms (TAA) are characterized by elastic fibre breakdown and cystic medial degeneration within the aortic media, associated with progressive SMC rarefaction. The TGF-?/Smad2 signaling pathway is involved in this process. Since pericellular fibrinolytic system activation is able to degrade adhesive proteins, activate MMPs, induce SMC disappearance and increase the bio-availability of TGF-?, we explored the plasminergic system in TAA. ...

The key role of shared participation in changing occupational self-efficacy through stress management courses

OpenAIRE

Füllemann, Désirée; Jenny, Gregor J; Brauchli, Rebecca; Bauer, Georg F

2015-01-01

This study is the first that longitudinally examined change in occupational self-efficacy (OSE) through individual and shared participation in occupational stress management courses (SMC). Applying the framework of social cognitive theory (Bandura, 1986, Social foundations of thought and action: A social cognitive theory. Englewood Cliffs, NJ: Prentice-Hall), we assumed that participation in SMC facilitates OSE perceptions. We further assumed that the psychosocial environment promotes change ...

Effectiveness of Pelvic Physiotherapy in Children With Functional Constipation Compared With Standard Medical Care.

Science.gov (United States)

van Engelenburg-van Lonkhuyzen, Marieke L; Bols, Esther M J; Benninga, Marc A; Verwijs, Wim A; de Bie, Rob A

2017-01-01

Functional constipation (FC) is a common childhood problem often related to pelvic floor muscle dysfunction. We compared the effectiveness of pelvic physiotherapy (PPT) vs standard medical care (SMC) in children with FC. We performed a multicenter randomized controlled trial of 53 children (age, 5-16 y) with FC according to the Rome III criteria, at hospitals in The Netherlands from December 2009 to May 2014. Group allocation was concealed using a central computer system. SMC consisted of education, toilet training, and laxatives (n = 26), whereas PPT included SMC plus specific physiotherapeutic interventions (n = 27). Results were obtained from written reports from the subjects' pediatricians and parents. The primary outcome was absence of FC, according to Rome III criteria, after a 6-month follow-up period. Secondary outcomes were global perceived effect (range, 1-9; success was defined as a score ≥ 8), numeric rating scales assessing quality of life (parent and child; scale, 1-10), and the strengths and difficulties questionnaire (SDQ). Treatment was effective for 92.3% of the children receiving PPT and for 63.0% of the children receiving SMC (adjusted odds ratio for success of PPT, 11.7; 95% confidence interval, 1.8-78.3) (P = .011). Significantly more children undergoing PPT stopped using laxatives (adjusted odds ratio, 6.5; 95% confidence interval, 1.6-26.4) (P = .009). Treatment success (based on global perceived effect) was achieved for 88.5% of subjects receiving PPT vs 33.3% of subjects receiving SMC) (P children (P = .028). Results from the SDQ did not differ significantly between groups (P = .78). In a randomized controlled trial of children with FC, PPT was more effective than SMC on all outcomes measured, with the exception of findings from the SDQ. PPT should be considered as a treatment option for FC in children 5-16 years old. Dutch Clinical Trial Registration no: NL30551.068.09. Copyright © 2017 AGA Institute. Published by Elsevier Inc

Age determination of 15 old to intermediate-age small Magellanic cloud star clusters

International Nuclear Information System (INIS)

Parisi, M. C.; Clariá, J. J.; Piatti, A. E.; Geisler, D.; Leiton, R.; Carraro, G.; Costa, E.; Grocholski, A. J.; Sarajedini, A.

2014-01-01

We present color-magnitude diagrams in the V and I bands for 15 star clusters in the Small Magellanic Cloud (SMC) based on data taken with the Very Large Telescope (VLT, Chile). We selected these clusters from our previous work, wherein we derived cluster radial velocities and metallicities from calcium II infrared triplet (CaT) spectra also taken with the VLT. We discovered that the ages of six of our clusters have been appreciably underestimated by previous studies, which used comparatively small telescopes, graphically illustrating the need for large apertures to obtain reliable ages of old and intermediate-age SMC star clusters. In particular, three of these clusters, L4, L6, and L110, turn out to be among the oldest SMC clusters known, with ages of 7.9 ± 1.1, 8.7 ± 1.2, and 7.6 ± 1.0 Gyr, respectively, helping to fill a possible 'SMC cluster age gap'. Using the current ages and metallicities from Parisi et al., we analyze the age distribution, age gradient, and age-metallicity relation (AMR) of a sample of SMC clusters measured homogeneously. There is a suggestion of bimodality in the age distribution but it does not show a constant slope for the first 4 Gyr, and we find no evidence for an age gradient. Due to the improved ages of our cluster sample, we find that our AMR is now better represented in the intermediate/old period than we had derived in Parisi et al., where we simply took ages available in the literature. Additionally, clusters younger than ∼4 Gyr now show better agreement with the bursting model of Pagel and Tautvaišienė, but we confirm that this model is not a good representation of the AMR during the intermediate/old period. A more complicated model is needed to explain the SMC chemical evolution in that period.

MEAN AGE GRADIENT AND ASYMMETRY IN THE STAR FORMATION HISTORY OF THE SMALL MAGELLANIC CLOUD

International Nuclear Information System (INIS)

Cignoni, M.; Cole, A. A.; Tosi, M.; Gallagher, J. S.; Sabbi, E.; Anderson, J.; Nota, A.; Grebel, E. K.

2013-01-01

We derive the star formation history (SFH) in four regions of the Small Magellanic Cloud (SMC) using the deepest VI color-magnitude diagrams (CMDs) ever obtained for this galaxy. The images were obtained with the Advanced Camera for Surveys on board the Hubble Space Telescope (HST) and are located at projected distances of 0.°5-2° from the SMC center, probing the main body and the wing of the galaxy. We derived the SFHs of the four fields using two independent procedures to fit synthetic CMDs to the data. We compare the SFHs derived here with our earlier results for the SMC bar to create a deep pencil-beam survey of the global history of the central SMC. We find in all the six fields observed with HST a slow star formation (SF) pace from 13 to 5-7 Gyr ago, followed by a ≈2-3 times higher activity. This is remarkable because dynamical models do not predict a strong influence of either the Large Magellanic Cloud (LMC) or the Milky Way at that time. The level of the intermediate-age SF rate enhancement systematically increases toward the center, resulting in a gradient in the mean age of the population, with the bar fields being systematically younger than the outer ones. SF over the most recent 500 Myr is strongly concentrated in the bar, the only exception being the area of the SMC wing. The strong current activity of the latter is likely driven by interaction with the LMC. At a given age, there is no significant difference in metallicity between the inner and outer fields, implying that metals are well mixed throughout the SMC. The age-metallicity relations we infer from our best-fitting models are monotonically increasing with time, with no evidence of dips. This may argue against the major merger scenario proposed by Tsujimoto and Bekki in 2009, although a minor merger cannot be ruled out

Hydrologic feasibility of artificial forestation in the semi-arid Loess Plateau of China

Science.gov (United States)

Jin, T. T.; Fu, B. J.; Liu, G. H.; Wang, Z.

2011-08-01

Hydrologic viability, in terms of moisture availability, is fundamental to ecosystem sustainability in arid and semi-arid regions. In this study, we examine the spatial distribution and after-planting variations of soil moisture content (SMC) in black locust tree (Robinia pseudoacacia L.) plantings in the Loess Plateau of China at a regional scale. Thirty sites (5 to 45 yr old) were selected, spanning an area of 300 km by 190 km in the northern region of the Shaanxi Province. The SMC was measured to a depth of 100 cm at intervals of 10 cm. Geographical, topographic and vegetation information was recorded, and soil organic matter was evaluated. The results show that, at the regional scale, SMC spatial variability was most highly correlated with rainfall. The negative relationship between the SMC at a depth of 20-50 cm and the stand age was stronger than at other depths, although this relationship was not significant at a 5 % level. Watershed analysis shows that the after-planting SMC variation differed depending upon precipitation. The SMC of plantings in areas receiving sufficient precipitation (e.g., mean annual precipitation (MAP) of 617 mm) may increase with stand age due to improvements in soil water-holding capacity and water-retention abilities after planting. For areas experiencing water shortages (e.g., MAP = 509 mm), evapotranspiration may cause planting soils to dry within the first 20 yr of growth. It is expected that, as arid and semi-arid plantings age, evapotranspiration will decrease, and the soil profile may gradually recover. In extremely dry areas (e.g., MAP = 352 mm), the variation in after-planting SMC with stand age was found to be negligible. The MAP can be used as an index to divide the study area into different ecological regions. Afforestation may sequentially exert positive, negative and negligible effects on SMCs with a decrease in the MAP. Therefore, future restoration measures should correspond to the local climate conditions, and the

[Effects of Three Industrial Organic Wastes as Amendments on Plant Growth and the Biochemical Properties of a Pb/Zn Mine Tailings].

Science.gov (United States)

Peng, Xi-zhu; Yang, Sheng-xiang; Li, Feng-mei; Cao, Jian-bing; Peng, Qing-jing

2016-01-15

A field trial was conducted in an abandoned Pb/Zn mine tailings to evaluate the effectiveness of three industrial wastes [sweet sorghum vinasse (SSV), medicinal herb residues (MHR) and spent mushroom compost (SMC)] as organic amendments on plant growth, soil nutrients and enzyme activities, and heavy metal concentrations in plant tissues and the mine tailings. (1) The main findings were as follows: (1) The mean concentrations of diethylene-triamine-pentaacetic acid (DTPA)-extractable Cd, Cu, Pb and Zn in SSV, MHR and SMC treatments decreased by 24.2%-27.3%, 45.7%-48.3%, 18.0%-20.9% and 10.1%-14.2% as compared to the control tailings. When compared to the control tailings, the mean values of organic matter, ammonium-N and available P in SSV, MHR and SMC treatments increased by 2.27-2.32, 12.4-12.8 and 4.04-4.74 times, respectively. Similarly, the addition of SSV, MHR and SMC significantly enhanced soil enzyme activities (dehydrogenase, beta-glucosidase, urease and phosphatase), being 5.51-6.37, 1.72-1.96, 6.32-6.62 and 2.35-2.62 times higher than those in the control tailings. (2) The application of these wastes promoted seed germination and seedling growth. The vegetation cover reached 84%, 79% and 86% at SSV, MHR and SMC subplots. For Lolium perenne and Cynodon dactylon, the addition of SSV, MHR and SMC led to significant increases in the shoot biomass yields with 4.2-5.6 and 15.7-17.3 times greater than those in the tailings. Moreover, the addition of SSV, MHR and SMC significantly reduced the concentrations of Cd, Cu, Pb and Zn in the shoots of L. perenne and C. dactylon in comparison with the control tailings. (3) Pearson's correlation coefficients showed that the vegetation cover and biomass were positively correlated with soil nutrient elements and enzyme activities. Significant negative correlations were observed between DTPA-extractable metal concentrations and vegetation cover and biomass. The metal concentrations in plants were positively correlated with

Edge restenosis: impact of low dose irradiation on cell proliferation and ICAM-1 expression

Directory of Open Access Journals (Sweden)

Hannekum Andreas

2006-07-01

Full Text Available Abstract Background Low dose irradiation (LDI of uninjured segments is the consequence of the suggestion of many authors to extend the irradiation area in vascular brachytherapy to minimize the edge effect. Atherosclerosis is a general disease and the uninjured segment close to the intervention area is often atherosclerotic as well, consisting of neointimal smooth muscle cells (SMC and quiescent monocytes (MC. The current study imitates this complex situation in vitro and investigates the effect of LDI on proliferation of SMC and expression of intercellular adhesion molecule-1 (ICAM-1 in MC. Methods Plaque tissue from advanced primary stenosing lesions of human coronary arteries (9 patients, age: 61 ± 7 years was extracted by local or extensive thrombendarterectomy. SMC were isolated and identified by positive reaction with smooth muscle α-actin. MC were isolated from buffy coat leukocytes using the MACS cell isolation kit. For identification of MC flow-cytometry analysis of FITC-conjugated CD68 and CD14 (FACScan was applied. SMC and MC were irradiated using megavoltage photon irradiation (CLINAC2300 C/D, VARIAN, USA of 6 mV at a focus-surface distance of 100 cm and a dose rate of 6 Gy min-1 with single doses of 1 Gy, 4 Gy, and 10 Gy. The effect on proliferation of SMC was analysed at day 10, 15, and 20. Secondly, total RNA of MC was isolated 1 h, 2 h, 3 h, and 4 h after irradiation and 5 μg of RNA was used in standard Northern blot analysis with ICAM-1 cDNA-probes. Results Both inhibitory and stimulatory effects were detected after irradiation of SMC with a dose of 1 Gy. At day 10 and 15 a significant antiproliferative effect was found; at day 20 after irradiation cell proliferation was significantly stimulated. Irradiation with 4 Gy and 10 Gy caused dose dependent inhibitory effects at day 10, 15, and 20. Expression of ICAM-1 in human MC was neihter inhibited nor stimulated by LDI. Conclusion Thus, the stimulatory effect of LDI on SMC

Ca II TRIPLET SPECTROSCOPY OF SMALL MAGELLANIC CLOUD RED GIANTS. I. ABUNDANCES AND VELOCITIES FOR A SAMPLE OF CLUSTERS

International Nuclear Information System (INIS)

Parisi, M. C.; Claria, J. J.; Grocholski, A. J.; Geisler, D.; Sarajedini, A.

2009-01-01

We have obtained near-infrared spectra covering the Ca II triplet lines for a large number of stars associated with 16 Small Magellanic Cloud (SMC) clusters using the VLT + FORS2. These data compose the largest available sample of SMC clusters with spectroscopically derived abundances and velocities. Our clusters span a wide range of ages and provide good areal coverage of the galaxy. Cluster members are selected using a combination of their positions relative to the cluster center as well as their location in the color-magnitude diagram, abundances, and radial velocities (RVs). We determine mean cluster velocities to typically 2.7 km s -1 and metallicities to 0.05 dex (random errors), from an average of 6.4 members per cluster. By combining our clusters with previously published results, we compile a sample of 25 clusters on a homogeneous metallicity scale and with relatively small metallicity errors, and thereby investigate the metallicity distribution, metallicity gradient, and age-metallicity relation (AMR) of the SMC cluster system. For all 25 clusters in our expanded sample, the mean metallicity [Fe/H] = -0.96 with σ = 0.19. The metallicity distribution may possibly be bimodal, with peaks at ∼-0.9 dex and -1.15 dex. Similar to the Large Magellanic Cloud (LMC), the SMC cluster system gives no indication of a radial metallicity gradient. However, intermediate age SMC clusters are both significantly more metal-poor and have a larger metallicity spread than their LMC counterparts. Our AMR shows evidence for three phases: a very early (>11 Gyr) phase in which the metallicity reached ∼-1.2 dex, a long intermediate phase from ∼10 to 3 Gyr in which the metallicity only slightly increased, and a final phase from 3 to 1 Gyr ago in which the rate of enrichment was substantially faster. We find good overall agreement with the model of Pagel and Tautvaisiene, which assumes a burst of star formation at 4 Gyr. Finally, we find that the mean RV of the cluster system

Predictive ability of severe rainfall events over Catalonia for the year 2008

Directory of Open Access Journals (Sweden)

A. Comellas

2011-07-01

Full Text Available This paper analyses the predictive ability of quantitative precipitation forecasts (QPF and the so-called "poor-man" rainfall probabilistic forecasts (RPF. With this aim, the full set of warnings issued by the Meteorological Service of Catalonia (SMC for potentially-dangerous events due to severe precipitation has been analysed for the year 2008. For each of the 37 warnings, the QPFs obtained from the limited-area model MM5 have been verified against hourly precipitation data provided by the rain gauge network covering Catalonia (NE of Spain, managed by SMC. For a group of five selected case studies, a QPF comparison has been undertaken between the MM5 and COSMO-I7 limited-area models. Although MM5's predictive ability has been examined for these five cases by making use of satellite data, this paper only shows in detail the heavy precipitation event on the 9–10 May 2008. Finally, the "poor-man" rainfall probabilistic forecasts (RPF issued by SMC at regional scale have also been tested against hourly precipitation observations. Verification results show that for long events (>24 h MM5 tends to overestimate total precipitation, whereas for short events (≤24 h the model tends instead to underestimate precipitation. The analysis of the five case studies concludes that most of MM5's QPF errors are mainly triggered by very poor representation of some of its cloud microphysical species, particularly the cloud liquid water and, to a lesser degree, the water vapor. The models' performance comparison demonstrates that MM5 and COSMO-I7 are on the same level of QPF skill, at least for the intense-rainfall events dealt with in the five case studies, whilst the warnings based on RPF issued by SMC have proven fairly correct when tested against hourly observed precipitation for 6-h intervals and at a small region scale.

Throughout this study, we have only dealt with (SMC-issued warning episodes in order to analyse deterministic (MM5 and COSMO-I7

Divergent effects of 17-{beta}-estradiol on human vascular smooth muscle and endothelial cell function diminishes TNF-{alpha}-induced neointima formation

Energy Technology Data Exchange (ETDEWEB)

Nintasen, Rungrat [Division of Cardiovascular Medicine, Leeds Institute of Genetics, Health and Therapeutics, University of Leeds, Leeds LS2 9JT (United Kingdom); Multidisciplinary Cardiovascular Research Center (MCRC), University of Leeds, Leeds LS2 9JT (United Kingdom); Department of Tropical Pathology, Faculty of Tropical Medicine, Mahidol University (Thailand); Riches, Kirsten; Mughal, Romana S. [Division of Cardiovascular Medicine, Leeds Institute of Genetics, Health and Therapeutics, University of Leeds, Leeds LS2 9JT (United Kingdom); Multidisciplinary Cardiovascular Research Center (MCRC), University of Leeds, Leeds LS2 9JT (United Kingdom); Viriyavejakul, Parnpen; Chaisri, Urai; Maneerat, Yaowapa [Department of Tropical Pathology, Faculty of Tropical Medicine, Mahidol University (Thailand); Turner, Neil A. [Division of Cardiovascular Medicine, Leeds Institute of Genetics, Health and Therapeutics, University of Leeds, Leeds LS2 9JT (United Kingdom); Multidisciplinary Cardiovascular Research Center (MCRC), University of Leeds, Leeds LS2 9JT (United Kingdom); Porter, Karen E., E-mail: medkep@leeds.ac.uk [Division of Cardiovascular Medicine, Leeds Institute of Genetics, Health and Therapeutics, University of Leeds, Leeds LS2 9JT (United Kingdom); Multidisciplinary Cardiovascular Research Center (MCRC), University of Leeds, Leeds LS2 9JT (United Kingdom)

2012-04-20

Highlights: Black-Right-Pointing-Pointer TNF-{alpha} augments neointimal hyperplasia in human saphenous vein. Black-Right-Pointing-Pointer TNF-{alpha} induces detrimental effects on endothelial and smooth muscle cell function. Black-Right-Pointing-Pointer Estradiol exerts modulatory effects on TNF-induced vascular cell functions. Black-Right-Pointing-Pointer The modulatory effects of estradiol are discriminatory and cell-type specific. -- Abstract: Coronary heart disease (CHD) is a condition characterized by increased levels of proinflammatory cytokines, including tumor necrosis factor-{alpha} (TNF-{alpha}). TNF-{alpha} can induce vascular endothelial cell (EC) and smooth muscle cell (SMC) dysfunction, central events in development of neointimal lesions. The reduced incidence of CHD in young women is believed to be due to the protective effects of estradiol (E2). We therefore investigated the effects of TNF-{alpha} on human neointima formation and SMC/EC functions and any modulatory effects of E2. Saphenous vein (SV) segments were cultured in the presence of TNF-{alpha} (10 ng/ml), E2 (2.5 nM) or both in combination. Neointimal thickening was augmented by incubation with TNF-{alpha}, an effect that was abolished by co-culture with E2. TNF-{alpha} increased SV-SMC proliferation in a concentration-dependent manner that was optimal at 10 ng/ml (1.5-fold increase), and abolished by E2 at all concentrations studied (1-50 nM). Surprisingly, E2 itself at low concentrations (1 and 5 nM) stimulated SV-SMC proliferation to a level comparable to that of TNF-{alpha} alone. SV-EC migration was significantly impaired by TNF-{alpha} (42% of control), and co-culture with E2 partially restored the ability of SV-EC to migrate and repair the wound. In contrast, TNF-{alpha} increased SV-SMC migration by 1.7-fold, an effect that was completely reversed by co-incubation with E2. Finally, TNF-{alpha} potently induced ICAM-1 and VCAM-1 expression in both SV-EC and SV-SMC. However there

Propiedades químicas de estrellas del campo de la Nube Menor de Magallanes

Science.gov (United States)

Parisi, M. C.; Geisler, D.; Clariá, J. J.; Carraro, G.; Villanova, S.; Marcionni, N.; Sarajedini, A.; Grocholski, A. J.

2015-08-01

In this paper we analyze the chemical properties of 400 red giant stars belonging to 15 areas spread over the Small Magellanic Cloud (SMC). Metallicities were determined from the equivalent widths of the CaII triplet lines, measured on spectra obtained with the FORS2 instrument at the Very Large Telescope located on Paranal (Chile). We add to this sample other 350 red giant stars previously investigated by our group using the same technique. Using this extended sample, we analyze and discuss the metallicity distribution and the possible existence of a metallicity gradient among the field stars of the SMC. We also compare our results to the chemical properties inferred for the corresponding 30 star clusters of the SMC, whose metallicities have been determined in a homogeneous scale.

Analysis of an ACC System for Sliding Mode and MPC under Transitional Manoeuvers

Directory of Open Access Journals (Sweden)

Zeeshan Ali Memon

2012-10-01

Full Text Available Two different control algorithms, sliding mode and MPC (Model Predictive Control are employed to analyse the performance of a linear vehicle model equipped with an ACC (Adaptive Cruise Control system. Both controllers are analysed under critical TM (Transitional Maneuvers to investigate their suitability for the ACC system. The simulation results, for the same scenario, from both controllers\\' approach have been compared. The results show that the MPC is more robust than the SMC (Sliding Model Controller. The results show that the SMC algorithm is not suitable for the proposed vehicle model. The shortcomings of the SMC have been highlighted and the comparisons are made with the previous studies. The proposed approach can be useful for the selection of the appropriate controller for the given application.

Privacy-Preserving Matching of Spatial Datasets with Protection against Background Knowledge

DEFF Research Database (Denmark)

Ghinita, Gabriel; Vicente, Carmen Ruiz; Shang, Ning

2010-01-01

should be disclosed. Previous research efforts focused on private matching for relational data, and rely either on spaceembedding or on SMC techniques. Space-embedding transforms data points to hide their exact attribute values before matching is performed, whereas SMC protocols simulate complex digital...... circuits that evaluate the matching condition without revealing anything else other than the matching outcome. However, existing solutions have at least one of the following drawbacks: (i) they fail to protect against adversaries with background knowledge on data distribution, (ii) they compromise privacy...... by returning large amounts of false positives and (iii) they rely on complex and expensive SMC protocols. In this paper, we introduce a novel geometric transformation to perform private matching on spatial datasets. Our method is efficient and it is not vulnerable to background knowledge attacks. We consider...

Sliding mode control-based linear functional observers for discrete-time stochastic systems

Science.gov (United States)

Singh, Satnesh; Janardhanan, Sivaramakrishnan

2017-11-01

Sliding mode control (SMC) is one of the most popular techniques to stabilise linear discrete-time stochastic systems. However, application of SMC becomes difficult when the system states are not available for feedback. This paper presents a new approach to design a SMC-based functional observer for discrete-time stochastic systems. The functional observer is based on the Kronecker product approach. Existence conditions and stability analysis of the proposed observer are given. The control input is estimated by a novel linear functional observer. This approach leads to a non-switching type of control, thereby eliminating the fundamental cause of chatter. Furthermore, the functional observer is designed in such a way that the effect of process and measurement noise is minimised. Simulation example is given to illustrate and validate the proposed design method.

Magellanic Clouds Cepheids: Thorium Abundances

Directory of Open Access Journals (Sweden)

Yeuncheol Jeong

2018-03-01

Full Text Available The analysis of the high-resolution spectra of 31 Magellanic Clouds Cepheid variables enabled the identification of thorium lines. The abundances of thorium were found with spectrum synthesis method. The calculated thorium abundances exhibit correlations with the abundances of other chemical elements and atmospheric parameters of the program stars. These correlations are similar for both Clouds. The correlations of iron abundances of thorium, europium, neodymium, and yttrium relative to the pulsational periods are different in the Large Magellanic Cloud (LMC and the Small Magellanic Cloud (SMC, namely the correlations are negative for LMC and positive or close to zero for SMC. One of the possible explanations can be the higher activity of nucleosynthesis in SMC with respect to LMC in the recent several hundred million years.

Feasibility, safety and effectiveness of combining home based malaria management and seasonal malaria chemoprevention in children less than 10 years in Senegal

DEFF Research Database (Denmark)

Tine, Roger C K; Ndour, Cheikh T; Faye, Babacar

2014-01-01

Home-based management of malaria (HMM) may improve access to diagnostic testing and treatment with artemisinin combination therapy (ACT). In the Sahel region, seasonal malaria chemoprevention (SMC) is now recommended for the prevention of malaria in children. It is likely that combinations...... of antimalarial interventions can reduce the malaria burden. This study assessed the feasibility, effectiveness and safety of combining SMC and HMM delivered by community health workers (CHWs)....

[The sequential use of local vacuum magnetotherapy and papaverine electrophoresis with sinusoidal modulated currents in impotence].

Science.gov (United States)

Karpukhin, I V; Bogomol'nyĭ, V A

1997-01-01

105 patients with chronic nonspecific prostatitis were examined and treated with papaverin electrophoresis using sinusoidal modulated currents (SMC) and local vacuum magnetotherapy (LVMT). Papaverin SMC electrophoresis and LVMT stimulated cavernous circulation. The highest stimulation was achieved at successive use of LVMT and the electrophoresis. LVMT followed by the electrophoresis maintained good cavernous circulation for 5-6 hours after the procedure in the course of which several spontaneous erections were observed.

Subtype-Specific Tumor-Associated Fibroblasts Contribute to the Pathogenesis of Uterine Leiomyoma.

Science.gov (United States)

Wu, Xin; Serna, Vanida A; Thomas, Justin; Qiang, Wenan; Blumenfeld, Michael L; Kurita, Takeshi

2017-12-15

Recent genomic studies have identified subtypes of uterine leiomyoma (LM) with distinctive genetic alterations. Here, we report the elucidation of the biological characteristics of the two most prevalent uterine leiomyoma subtypes, MED12-mutant (MED12-LM) and HMGA2-overexpressing (HMGA2-LM) uterine leiomyomas. Because each tumor carries only one genetic alteration, both subtypes are considered to be monoclonal. Approximately 90% of cells in HMGA2-uterine leiomyoma were smooth muscle cells (SMC) with HMGA2 overexpression. In contrast, MED12-LM consisted of similar numbers of SMC and non-SMC, which were mostly tumor-associated fibroblasts (TAF). Paradoxically, TAF carried no mutations in MED12, suggesting an interaction between SMC and TAF to coordinate their growth. The higher amount of extracellular matrix in MED12-LM than HMGA2-LM was partially due to the high concentration of collagen-producing TAF. SMC growth in a xenograft assay was driven by progesterone in both uterine leiomyoma subtypes. In contrast, TAF in MED12-LM proliferated in response to estradiol, whereas progesterone had no effect. The high concentration of estrogen-responsive TAF in MED12-LM explains the inconsistent discoveries between in vivo and in vitro studies on the mitogenic effect of estrogen and raises questions regarding the accuracy of previous studies utilizing MED12-LM cell culture. In addition, the differential effects of estradiol and progesterone on these uterine leiomyoma subtypes emphasize the importance of subtypes and genotypes in designing nonsurgical therapeutic strategies for uterine leiomyoma. Cancer Res; 77(24); 6891-901. ©2017 AACR . ©2017 American Association for Cancer Research.

Aid cutoff threatens condom program in Pakistan.

Science.gov (United States)

Barron, T

1991-01-01

The Pressler Amendment, a law prohibiting US assistance to any country that does not sign the UN Nuclear Nonproliferation Treaty, is forcing USAID to shut down its highly successful Social Marketing of Contraceptives (SMC) program in Pakistan. Adopted in 1985, the amendment calls for an end of funding for projects in Pakistan as of fiscal year 1991, since the country has refused to sign the treaty. Only previously committed funds have kept SMC running, but it may soon have a close shop. The cutoff comes at an especially inopportune time--just when SMC had begun to make an impact. Introduced 5 years ago, Sathi condoms (the project's main product) account for 2/3 of all condoms used in Pakistan. Sales jumped from 30 million in 1978 to 74 million last year. SMC administrators explain that the country has a vast potential for social marketing. But because of the cutoff in aid, the program will exhaust its supply of condoms by March 1992. The end of the SMC program will mean a serious setback for Pakistan, which already has the 2nd largest population in southern Asia, and which has double the fertility of the most populous country in the region, India. Only 7% of the women in Pakistan rely on a modern method of contraception, compared to 42% in India and 26% in Bangladesh. USAID officials explain that the organization is working with the Pakistani government to find ways to continue funding the program after US funds run out. They add that this development will provide Pakistani Prime Minister Nawaz Sharif an opportunity to demonstrate his stated commitment to curb population growth.

Basally activated nonselective cation currents regulate the resting membrane potential in human and monkey colonic smooth muscle

Science.gov (United States)

Dwyer, Laura; Rhee, Poong-Lyul; Lowe, Vanessa; Zheng, Haifeng; Peri, Lauren; Ro, Seungil; Sanders, Kenton M.

2011-01-01

Resting membrane potential (RMP) plays an important role in determining the basal excitability of gastrointestinal smooth muscle. The RMP in colonic muscles is significantly less negative than the equilibrium potential of K+, suggesting that it is regulated not only by K+ conductances but by inward conductances such as Na+ and/or Ca2+. We investigated the contribution of nonselective cation channels (NSCC) to the RMP in human and monkey colonic smooth muscle cells (SMC) using voltage- and current-clamp techniques. Qualitative reverse transcriptase-polymerase chain reaction was performed to examine potential molecular candidates for these channels among the transient receptor potential (TRP) channel superfamily. Spontaneous transient inward currents and holding currents were recorded in human and monkey SMC. Replacement of extracellular Na+ with equimolar tetraethylammonium or Ca2+ with Mn2+ inhibited basally activated nonselective cation currents. Trivalent cations inhibited these channels. Under current clamp, replacement of extracellular Na+ with N-methyl-d-glucamine or addition of trivalent cations caused hyperpolarization. Three unitary conductances of NSCC were observed in human and monkey colonic SMC. Molecular candidates for basally active NSCC were TRPC1, C3, C4, C7, M2, M4, M6, M7, V1, and V2 in human and monkey SMC. Comparison of the biophysical properties of these TRP channels with basally active NSCC (bINSCC) suggests that TRPM4 and specific TRPC heteromultimer combinations may underlie the three single-channel conductances of bINSCC. In conclusion, these findings suggest that basally activated NSCC contribute to the RMP in human and monkey colonic SMC and therefore may play an important role in determining basal excitability of colonic smooth muscle. PMID:21566016

Adaptive fuzzy-neural-network control for maglev transportation system.

Science.gov (United States)

Wai, Rong-Jong; Lee, Jeng-Dao

2008-01-01

A magnetic-levitation (maglev) transportation system including levitation and propulsion control is a subject of considerable scientific interest because of highly nonlinear and unstable behaviors. In this paper, the dynamic model of a maglev transportation system including levitated electromagnets and a propulsive linear induction motor (LIM) based on the concepts of mechanical geometry and motion dynamics is developed first. Then, a model-based sliding-mode control (SMC) strategy is introduced. In order to alleviate chattering phenomena caused by the inappropriate selection of uncertainty bound, a simple bound estimation algorithm is embedded in the SMC strategy to form an adaptive sliding-mode control (ASMC) scheme. However, this estimation algorithm is always a positive value so that tracking errors introduced by any uncertainty will cause the estimated bound increase even to infinity with time. Therefore, it further designs an adaptive fuzzy-neural-network control (AFNNC) scheme by imitating the SMC strategy for the maglev transportation system. In the model-free AFNNC, online learning algorithms are designed to cope with the problem of chattering phenomena caused by the sign action in SMC design, and to ensure the stability of the controlled system without the requirement of auxiliary compensated controllers despite the existence of uncertainties. The outputs of the AFNNC scheme can be directly supplied to the electromagnets and LIM without complicated control transformations for relaxing strict constrains in conventional model-based control methodologies. The effectiveness of the proposed control schemes for the maglev transportation system is verified by numerical simulations, and the superiority of the AFNNC scheme is indicated in comparison with the SMC and ASMC strategies.

On the synergy of SMAP, AMSR2 AND SENTINEL-1 for retrieving soil moisture

Science.gov (United States)

Santi, E.; Paloscia, S.; Pettinato, S.; Brocca, L.; Ciabatta, L.; Entekhabi, D.

2018-03-01

An algorithm for retrieving soil moisture content (SMC) from synergic use of both active and passive microwave acquisitions is presented. The algorithm takes advantage of the integration of microwave data from SMAP, Sentinel-1 and AMSR2 for overcoming the SMAP radar failure and obtaining a SMC product at enhanced resolution (0.1° × 0.1°) and improved accuracy with respect to the original SMAP radiometric SMC product. A disaggregation technique based on the Smoothing filter based intensity modulation (SFIM) allows combining the radiometric and SAR data. Disaggregated microwave data are used as inputs of an Artificial Neural Networks (ANN) based algorithm, which is able to exploit the synergy between active and passive acquisitions. The algorithm is defined, trained and tested using the SMEX02 experimental dataset and data simulated by forward electromagnetic models based on the Radiative Transfer Theory. Then the algorithm is adapted to satellite data and tested using one year of SMAP, AMSR2 and Sentinel-1 co-located data on a flat agricultural area located in the Po Valley, in northern Italy. Spatially distributed SMC values at 0.1° × 0.1° resolution generated by the Soil Water Balance Model (SWBM) are considered as reference for this purpose. The synergy of SMAP, Sentinel-1 and AMSR2 allowed increasing the correlation between estimated and reference SMC from R ≅ 0.68 of the SMAP based retrieval up to R ≅ 0.86 of the combination SMAP + Sentinel-1 + AMSR2. The corresponding Root Mean Square Error (RMSE) decreased from RMSE ≅ 0.04 m3/m3 to RMSE ≅ 0.024 m3/m3.

Subjective Memory Complaints are Associated with Incident Dementia in Cognitively Intact Older People, but Not in Those with Cognitive Impairment: A 24-Month Prospective Cohort Study.

Science.gov (United States)

Tsutsumimoto, Kota; Makizako, Hyuma; Doi, Takehiko; Hotta, Ryo; Nakakubo, Sho; Makino, Keitaro; Shimada, Hiroyuki; Suzuki, Takao

2017-06-01

Although subjective memory complaints (SMCs) are considered a risk factor for incident dementia in older people, the effect might differ based on cognitive function. The aim of the present study was to investigate whether the effect of SMCs on the incidence of dementia in older people differed based on cognitive function. A 24-month follow-up cohort study. Japanese community. Prospective, longitudinal data for incident dementia were collected for 3,672 participants (mean age: 71.7 years; 46.5% men) for up to 24 months. Baseline measurements included covariates for incident dementia, SMCs, and cognitive function. Associations between SMCs, cognitive impairment, and incident dementia were examined using Cox proportional hazards models. Incidences of dementia in the cognitively intact without SMC, cognitively intact with SMC, cognitive impairment without SMC, and cognitive impairment with SMC groups were 0.3%, 1.8%, 3.4%, and 4.8%, respectively. In the cognitively intact participants, SMCs were associated with a significantly higher risk of dementia (hazard ratio [HR]: 4.95, 95% confidence interval [CI]: 1.52-16.11, p = 0.008). Incident dementia with cognitive impairment was not significantly different based on SMC presence (p = 0.527). Participants with cognitive impairment in multiple domains had a significantly higher risk of incident dementia (HR: 2.07, 95% CI: 1.01-4.24, p = 0.046) CONCLUSION: SMCs were related with dementia in cognitively intact older people, but not in those with cognitive impairment.Multiple domains of cognitive impairment were associated with a higher risk of incident dementia. Copyright © 2017 American Association for Geriatric Psychiatry. Published by Elsevier Inc. All rights reserved.

Memory Complaints Associated with Seeking Clinical Care

Science.gov (United States)

Pires, Carolina; Silva, Dina; Maroco, João; Ginó, Sandra; Mendes, Tiago; Schmand, Ben A.; Guerreiro, Manuela; de Mendonça, Alexandre

2012-01-01

Diagnosis of mild cognitive impairment relies on the presence of memory complaints. However, memory complaints are very frequent in healthy people. The objective of this study was to determine the severity and type of memory difficulties presented by elderly patients who seek for clinical help, as compared to the memory difficulties reported by subjects in the community. Assessment of subjective memory complaints was done with the subjective memory complaints scale (SMC). The mini-mental state examination was used for general cognitive evaluation and the geriatric depression scale for the assessment of depressive symptoms. Eight-hundred and seventy-one nondemented subjects older than 50 years were included. Participants in the clinical setting had a higher total SMC score (10.3 ± 4.2) than those in the community (5.1 ± 3.0). Item 3 of the SMC, Do you ever forget names of family members or friends? contributed significantly more to the variance of the total SMC score in the clinical sample (18%) as compared to the community sample (11%). Forgetting names of family members or friends plays an important role in subjective memory complaints in the clinical setting. This symptom is possibly perceived as particularly worrisome and likely drives people to seek for clinical help. PMID:22536537

Ultraviolet interstellar absorption toward stars in the small Magellanic Cloud. III. THe structure and kinematics of Small Magellanic Cloud

International Nuclear Information System (INIS)

Fitzpatrick, A.L.

1985-01-01

The structure and kinematical properties of the Small Magellanic Cloud (SMC) are investigated by combining ultraviolet data obtained from the International Ultraviolet Explorer (IUE) satellite with existing optical and radio data. The SMC structure is complicated, undoubtedly a result of gravitational interaction with the Milky Way and the Large Magellanic Cloud, and is poorly understood. It has been known for some time that most of the H I in the SMC is concentrated in two complexes at velocities of approximately 134 and 167 km s -1 (heliocentric). Recent 21 cm emission surveys have revealed two additional, widespread H I components at approx.100 and approx.200 km s -1 . With the radio data alone, however, the relative line-of-sight locations of those complexes cannot be determined, nor can the associations of stars with the complexes be deduced. By using the ultraviolet interstellar absorption-line data in conjunction with radio and optical data, the stellar-interstellar kinematical and morphological relationships can be established. We find that in the southwest region of the SMC, most of the stars observed by IUE, including a group with only low-dispersion IUE spectra, are associated with the 134 km s -1 H I complex

Water filtration rate and infiltration/accumulation of low density lipoproteins in 3 different modes of endothelial/smooth muscle cell co-cultures.

Science.gov (United States)

Ding, ZuFeng; Fan, YuBo; Deng, XiaoYan

2009-11-01

Using different endothelial/smooth muscle cell co-culture modes to simulate the intimal structure of blood vessels, the water filtration rate and the infiltration/accumulation of LDL of the cultured cell layers were studied. The three cell culture modes of the study were: (i) The endothelial cell monolayer (EC/Phi); (ii) endothelial cells directly co-cultured on the smooth muscle cell monolayer (EC-SMC); (iii) endothelial cells and smooth muscle cells cultured on different sides of a Millicell-CM membrane (EC/SMC). It was found that under the same condition, the water filtration rate was the lowest for the EC/SMC mode and the highest for the EC/Phi mode, while the infiltration/accumulation of DiI-LDLs was the lowest in the EC/Phi mode and the highest in the EC-SMC mode. It was also found that DiI-LDL infiltration/accumulation in the cultured cell layers increased with the increasing water filtration rate. The results from the in vitro model study therefore suggest that the infiltration/accumulation of the lipids within the arterial wall is positively correlated with concentration polarization of atherogenic lipids, and the integrity of the endothelium plays an important role in the penetration and accumulation of atherogenic lipids in blood vessel walls.

VLT/X-shooter GRBs: Individual extinction curves of star-forming regions★

Science.gov (United States)

Zafar, T.; Watson, D.; Møller, P.; Selsing, J.; Fynbo, J. PU; Schady, P.; Wiersema, K.; Levan, A. J.; Heintz, K. E.; Postigo, A. de Ugarte; D'Elia, V.; Jakobsson, P.; Bolmer, J.; Japelj, J.; Covino, S.; Gomboc, A.; Cano, Z.

2018-05-01

The extinction profiles in Gamma-Ray Burst (GRB) afterglow spectral energy distributions (SEDs) are usually described by the Small Magellanic Cloud (SMC)-type extinction curve. In different empirical extinction laws, the total-to-selective extinction, RV, is an important quantity because of its relation to dust grain sizes and compositions. We here analyse a sample of 17 GRBs (0.34a single or broken power-law together with a parametric extinction law is used to model the individual SEDs. We find 10 cases with significant dust, where the derived extinction, AV, ranges from 0.1-1.0 mag. In four of those, the inferred extinction curves are consistent with the SMC curve. The GRB individual extinction curves have a flat RV distribution with an optimal weighted combined value of RV = 2.61 ± 0.08 (for seven broad coverage cases). The `average GRB extinction curve' is similar to, but slightly steeper than the typical SMC, and consistent with the SMC Bar extinction curve at ˜95% confidence level. The resultant steeper extinction curves imply populations of small grains, where large dust grains may be destroyed due to GRB activity. Another possibility could be that young age and/or lower metallicities of GRBs environments are responsible for the steeper curves.

Lead isotope evolution across the Neoproterozoic boundary between craton and juvenile crust, Bayuda Desert, Sudan

Science.gov (United States)

Evuk, David; Lucassen, Friedrich; Franz, Gerhard

2017-11-01

Metaigneous mafic and ultramafic rocks from the juvenile Neoproterozoic Arabian Nubian Shield (ANS) and the Proterozoic, reworked Saharan Metacraton (SMC) have been analysed for major- and trace elements and Sr, Nd, and Pb isotopes. Most of the rocks are amphibolites metamorphosed at amphibolite facies conditions, some with relicts of a granulite facies stage. The other rocks are metapyroxenites, metagabbros, and some ultramafic rocks. Trace element compositions of the metabasaltic (dominantly tholeiitic) rocks resemble the patterns of island arcs and primitive lavas from continental arcs. Variable Sr and Nd isotope ratios indicate depleted mantle dominance for most of the samples. 207Pb/204Pb signatures distinguish between the influence of high 207Pb/204Pb old SMC crust and depleted mantle signatures of the juvenile ANS crust. The Pb isotope signatures for most metabasaltic rocks, metapyroxenites and metagabbros from SMC indicate an autochthonous formation. The interpretation of the new data together with published evidence from mafic xenoliths on SMC and ophiolite from ANS allows an extrapolation of mantle evolution in time. There are two lines of evolution in the regional mantle, one, which incorporates potential upper crust material during Neoproterozoic, and a second one with a depleted mantle signature since pre-Neoproterozoic that still is present in the Red Sea and Gulf of Aden spreading centres.

Soil microbial community profiles and functional diversity in limestone cedar glades

Science.gov (United States)

Cartwright, Jennifer M.; Dzantor, E. Kudjo; Momen, Bahram

2016-01-01

Rock outcrop ecosystems, such as limestone cedar glades (LCGs), are known for their rare and endemic plant species adapted to high levels of abiotic stress. Soils in LCGs are thin (< 25 cm), soil-moisture conditions fluctuate seasonally between xeric and saturated, and summer soil temperatures commonly exceed 48 °C. The effects of these stressors on soil microbial communities (SMC) remain largely unstudied, despite the importance of SMC-plant interactions in regulating the structure and function of terrestrial ecosystems. SMC profiles and functional diversity were characterized in LCGs using community level physiological profiling (CLPP) and plate-dilution frequency assays (PDFA). Most-probable number (MPN) estimates and microbial substrate-utilization diversity (H) were positively related to soil thickness, soil organic matter (OM), soil water content, and vegetation density, and were diminished in alkaline soil relative to circumneutral soil. Soil nitrate showed no relationship to SMCs, suggesting lack of N-limitation. Canonical correlation analysis indicated strong correlations between microbial CLPP patterns and several physical and chemical properties of soil, primarily temperature at the ground surface and at 4-cm depth, and secondarily soil-water content, enabling differentiation by season. Thus, it was demonstrated that several well-described abiotic determinants of plant community structure in this ecosystem are also reflected in SMC profiles.

Robust chaotic control of Lorenz system by backstepping design

International Nuclear Information System (INIS)

Peng, C.-C.; Chen, C.-L.

2008-01-01

This work presents a robust chaotic control strategy for the Lorenz chaos via backstepping design. Backstepping technique is a systematic tool of control law design to provide Lyapunov stability. The concept of extended system is used such that a continuous sliding mode control (SMC) effort is generated using backstepping scheme. In the proposed control algorithm, an adaptation law is applied to estimate the system parameter and the SMC offers the robustness to model uncertainties and external disturbances so that the asymptotical convergence of tracking error can be achieved. Regarding the SMC, an equivalent control algorithm is chosen based on the selection of Lyapunov stability criterion during backstepping approach. The converging rate of error state is relative to the corresponding dynamics of sliding surface. Numerical simulations demonstrate its advantages to a regulation problem and an orbit tracking problem of the Lorenz chaos

Visualization of Magnetic Flux Distribution at Soft Magnetic Composite(Special Issue to the Asia-Pacific Symposium on Applied Electromagnetics and Mechanics (APSAEM06))

OpenAIRE

Z. W., Lin; J. G., Zhu; Y. G., Guo; J. J., Zhong; W. Y., Yu; Centre for Electrical Machines and Power Electronics, Faculty of Engineering, University of Technology; Centre for Electrical Machines and Power Electronics, Faculty of Engineering, University of Technology; Centre for Electrical Machines and Power Electronics, Faculty of Engineering, University of Technology; Centre for Electrical Machines and Power Electronics, Faculty of Engineering, University of Technology; Baosteel Group Shanghai Iron and Steel Research Institute

2007-01-01

Soft magnetic composite (SMC), as one of soft magnetic materials, is being used increasingly in electromagnetic devices due to its magnetic isotropy, high electrical resistivity and easy formation. This paper presents the magnetic field distribution at the compressing surface of SMC by means of magneto-optical imaging technique. It is found that the flux density is non-uniform inside the sample, even within one particle region. Although there are interactions between neighbouring particles, t...

Sequential Monte Carlo with Highly Informative Observations

OpenAIRE

Del Moral, Pierre; Murray, Lawrence M.

2014-01-01

We propose sequential Monte Carlo (SMC) methods for sampling the posterior distribution of state-space models under highly informative observation regimes, a situation in which standard SMC methods can perform poorly. A special case is simulating bridges between given initial and final values. The basic idea is to introduce a schedule of intermediate weighting and resampling times between observation times, which guide particles towards the final state. This can always be done for continuous-...

Assessment of physical education time and after-school outdoor time in elementary and middle school students in south Mexico City: the dilemma between physical fitness and the adverse health effects of outdoor pollutant exposure.

Science.gov (United States)

Villarreal-Calderón, Anna; Acuña, Hilda; Villarreal-Calderón, Jessica; Garduño, Mónica; Henríquez-Roldán, Carlos F; Calderón-Garcidueñas, Lilian; Valencia-Salazar, Gildardo

2002-01-01

Strategies to promote lifelong physical activity among children are needed to stem the adverse health consequences of inactivity. However, the health effects in growing children of long-term exposure to a polluted atmosphere are of deep concern. The atmosphere of south Mexico City (SMC) is characterized by a complex mixture of air pollutants, including ozone, particulate matter, and aldehydes. Radiological evidence suggests that small-airway disease could be present in clinically healthy, tobacco unexposed SMC children. The aim of this study was to assess, by means of a self-reported questionnaire, the physical education class times, daily outdoor after-school exposure time, and tobacco exposure in students attending public elementary and middle schools in SMC. Additionally, the time each student spent viewing television was assessed, and the authors measured each student's weight and height to determine body mass index (BMI, weight in kg divided by height in m2). The survey included 1,159 students in grades 7-9. The authors identified 2 critical periods of outdoor exposure in SMC children that coincided with significant concentrations of both ozone and particulate matter with diameters less than 10 micrometers (PM10): during school time after 11:00 A.M. and in the after-school outdoor activity period, usually extending from 1:00 P.M. to 6:00 P.M. Thirty-two percent of elementary and 61% of middle school students have physical education classes after 11:00 A.M. Students in SMC spend an average of 19.6 hr/wk outdoors in the after-school period, during which time they are engaged in light to moderate physical activities. Half of the students are exposed to tobacco smoke at home, and 7% of middle school students smoke. On the basis of BMI, 60% of students were classified as undernourished, overweight, or obese. No correlations were found between BMI and time spent viewing TV, time outdoors (on weekdays and weekends), or exposure to environmental tobacco smoke

Meiosis-specific cohesin component, Stag3 is essential for maintaining centromere chromatid cohesion, and required for DNA repair and synapsis between homologous chromosomes.

Science.gov (United States)

Hopkins, Jessica; Hwang, Grace; Jacob, Justin; Sapp, Nicklas; Bedigian, Rick; Oka, Kazuhiro; Overbeek, Paul; Murray, Steve; Jordan, Philip W

2014-07-01

Cohesins are important for chromosome structure and chromosome segregation during mitosis and meiosis. Cohesins are composed of two structural maintenance of chromosomes (SMC1-SMC3) proteins that form a V-shaped heterodimer structure, which is bridged by a α-kleisin protein and a stromal antigen (STAG) protein. Previous studies in mouse have shown that there is one SMC1 protein (SMC1β), two α-kleisins (RAD21L and REC8) and one STAG protein (STAG3) that are meiosis-specific. During meiosis, homologous chromosomes must recombine with one another in the context of a tripartite structure known as the synaptonemal complex (SC). From interaction studies, it has been shown that there are at least four meiosis-specific forms of cohesin, which together with the mitotic cohesin complex, are lateral components of the SC. STAG3 is the only meiosis-specific subunit that is represented within all four meiosis-specific cohesin complexes. In Stag3 mutant germ cells, the protein level of other meiosis-specific cohesin subunits (SMC1β, RAD21L and REC8) is reduced, and their localization to chromosome axes is disrupted. In contrast, the mitotic cohesin complex remains intact and localizes robustly to the meiotic chromosome axes. The instability of meiosis-specific cohesins observed in Stag3 mutants results in aberrant DNA repair processes, and disruption of synapsis between homologous chromosomes. Furthermore, mutation of Stag3 results in perturbation of pericentromeric heterochromatin clustering, and disruption of centromere cohesion between sister chromatids during meiotic prophase. These defects result in early prophase I arrest and apoptosis in both male and female germ cells. The meiotic defects observed in Stag3 mutants are more severe when compared to single mutants for Smc1β, Rec8 and Rad21l, however they are not as severe as the Rec8, Rad21l double mutants. Taken together, our study demonstrates that STAG3 is required for the stability of all meiosis-specific cohesin

Characterization of the interaction between the cohesin subunits Rad21 and SA1/2.

Directory of Open Access Journals (Sweden)

Nenggang Zhang

Full Text Available The cohesin complex is responsible for the fidelity of chromosomal segregation during mitosis. It consists of four core subunits, namely Rad21/Mcd1/Scc1, Smc1, Smc3, and one of the yeast Scc3 orthologs SA1 or SA2. Sister chromatid cohesion is generated during DNA replication and maintained until the onset of anaphase. Among the many proposed models of the cohesin complex, the 'core' cohesin subunits Smc1, Smc3, and Rad21 are almost universally displayed as tripartite ring. However, other than its supportive role in the cohesin ring, little is known about the fourth core subunit SA1/SA2. To gain deeper insight into the function of SA1/SA2 in the cohesin complex, we have mapped the interactive regions of SA2 and Rad21 in vitro and ex vivo. Whereas SA2 interacts with Rad21 through a broad region (301-750 aa, Rad21 binds to SA proteins through two SA-binding motifs on Rad21, namely N-terminal (NT and middle part (MP SA-binding motif, located at 60-81 aa of the N-terminus and 383-392 aa of the MP of Rad21, respectively. The MP SA-binding motif is a 10 amino acid, α-helical motif. Deletion of these 10 amino acids or mutation of three conserved amino acids (L(385, F(389, and T(390 in this α-helical motif significantly hinders Rad21 from physically interacting with SA1/2. Besides the MP SA-binding motif, the NT SA-binding motif is also important for SA1/2 interaction. Although mutations on both SA-binding motifs disrupt Rad21-SA1/2 interaction, they had no apparent effect on the Smc1-Smc3-Rad21 interaction. However, the Rad21-Rad21 dimerization was reduced by the mutations, indicating potential involvement of the two SA-binding motifs in the formation of the two-ring handcuff for chromosomal cohesion. Furthermore, mutant Rad21 proteins failed to significantly rescue precocious chromosome separation caused by depletion of endogenous Rad21 in mitotic cells, further indicating the physiological significance of the two SA-binding motifs of Rad21.

Experimental verification of dose calculation using the simplified Monte Carlo method with an improved initial beam model for a beam-wobbling system

International Nuclear Information System (INIS)

Tansho, Ryohei; Takada, Yoshihisa; Mizutani, Shohei; Kohno, Ryosuke; Hotta, Kenji; Akimoto, Tetsuo; Hara, Yousuke

2013-01-01

A beam delivery system using a single-radius-beam-wobbling method has been used to form a conformal irradiation field for proton radiotherapy in Japan. A proton beam broadened by the beam-wobbling system provides a non-Gaussian distribution of projection angle different in two mutually orthogonal planes with a common beam central axis, at a certain position. However, the conventional initial beam model for dose calculations has been using an approximation of symmetric Gaussian angular distribution with the same variance in both planes (called here a Gaussian model with symmetric variance (GMSV)), instead of the accurate one. We have developed a more accurate initial beam model defined as a non-Gaussian model with asymmetric variance (NonGMAV), and applied it to dose calculations using the simplified Monte Carlo (SMC) method. The initial beam model takes into account the different distances of two beam-wobbling magnets from the iso-center and also the different amplitudes of kick angle given by each magnet. We have confirmed that the calculation using the SMC with NonGMAV reproduced the measured dose distribution formed in air by a mono-energetic proton beam passing through a square aperture collimator better than with the GMSV and with a Gaussian model with asymmetric variance (GMAV) in which different variances of angular distributions are used in the two mutually orthogonal planes. Measured dose distributions in a homogeneous phantom formed by a modulated proton beam passing through a range shifter and an L-shaped range compensator, were consistent with calculations using the SMC with GMAV and NonGMAV, but in disagreement with calculations using the SMC with GMSV. Measured lateral penumbrae in a lateral direction were reproduced better by calculations using the SMC with NonGMAV than by those with GMAV, when an aperture collimator with a smaller opening was used. We found that such a difference can be attributed to the non-Gaussian angular distribution of the

Functional Laterality of Task-Evoked Activation in Sensorimotor Cortex of Preterm Infants: An Optimized 3 T fMRI Study Employing a Customized Neonatal Head Coil.

Directory of Open Access Journals (Sweden)

Lukas Scheef

Full Text Available Functional magnetic resonance imaging (fMRI in neonates has been introduced as a non-invasive method for studying sensorimotor processing in the developing brain. However, previous neonatal studies have delivered conflicting results regarding localization, lateralization, and directionality of blood oxygenation level dependent (BOLD responses in sensorimotor cortex (SMC. Amongst the confounding factors in interpreting neonatal fMRI studies include the use of standard adult MR-coils providing insufficient signal to noise, and liberal statistical thresholds, compromising clinical interpretation at the single subject level.Here, we employed a custom-designed neonatal MR-coil adapted and optimized to the head size of a newborn in order to improve robustness, reliability and validity of neonatal sensorimotor fMRI. Thirteen preterm infants with a median gestational age of 26 weeks were scanned at term-corrected age using a prototype 8-channel neonatal head coil at 3T (Achieva, Philips, Best, NL. Sensorimotor stimulation was elicited by passive extension/flexion of the elbow at 1 Hz in a block design. Analysis of temporal signal to noise ratio (tSNR was performed on the whole brain and the SMC, and was compared to data acquired with an 'adult' 8 channel head coil published previously. Task-evoked activation was determined by single-subject SPM8 analyses, thresholded at p < 0.05, whole-brain FWE-corrected.Using a custom-designed neonatal MR-coil, we found significant positive BOLD responses in contralateral SMC after unilateral passive sensorimotor stimulation in all neonates (analyses restricted to artifact-free data sets = 8/13. Improved imaging characteristics of the neonatal MR-coil were evidenced by additional phantom and in vivo tSNR measurements: phantom studies revealed a 240% global increase in tSNR; in vivo studies revealed a 73% global and a 55% local (SMC increase in tSNR, as compared to the 'adult' MR-coil.Our findings strengthen the

Siliceous mesostructured cellular foams/ poly(3-hydroxybutyrate-co-3-hydroxyhexanoate composite biomaterials for bone regeneration

Directory of Open Access Journals (Sweden)

Yang S

2014-10-01

Full Text Available Shengbing Yang,1,* Shuogui Xu,2,* Panyu Zhou,2,* Jing Wang,3 Honglue Tan,4 Yang Liu,5 TingTing Tang,4 ChangSheng Liu1,3,5 1The State Key Laboratory of Bioreactor Engineering, East China University of Science and Technology, Shanghai, People’s Republic of China; 2Changhai Hospital, Department of Orthopedics, the Second Military Medical University, Shanghai, People’s Republic of China; 3Key Laboratory for Ultrafine Materials of Ministry of Education, East China University of Science and Technology, Shanghai, People’s Republic of China; 4Shanghai Key Laboratory of Orthopedic Implant, Department of Orthopedic Surgery, Shanghai 9th People’s Hospital, Shanghai Jiao Tong University School of Medicine China, Shanghai, People’s Republic of China; 5Engineering Research Center for Biomedical Materials of Ministry of Education, East China University of Science and Technology, Shanghai, People’s Republic of China *These authors contributed equally to this workAbstract: Osteoinductive and biodegradable composite biomaterials for bone regeneration were prepared by combining poly(3-hydroxybutyrate-co-3-hydroxyhexanoate (PHBHHx with siliceous mesostructured cellular foams (SMC, using the porogen leaching method. Surface hydrophilicity, morphology, and recombinant human bone morphogenetic protein 2 adsorption/release behavior of the SMC/PHBHHx scaffolds were analyzed. Results of scanning electron microscopy indicated that the SMC was uniformly dispersed in the PHBHHx scaffolds, and SMC modification scaffolds have an interconnected porous architecture with pore sizes ranging from 200 to 400 µm. The measurements of the water contact angles suggested that the incorporation of SMC into PHBHHx improves the hydrophilicity of the composite. In vitro studies with simulated body fluid show great improvements to bioactivity and biodegradability versus pure PHBHHx scaffolds. Cell adhesion and cell proliferation on the scaffolds was also evaluated, and the new

Research translation to inform national health policies: learning from multiple perspectives in Uganda

Directory of Open Access Journals (Sweden)

Glass Nancy

2011-03-01

Full Text Available Abstract Background Research and evidence can have an impact on policy and practice, resulting in positive outcomes. However, research translation is a complex, dynamic and non-linear process. Although universities in Africa play a major role in generating research evidence, their strategic approaches to influence health policies and decision making are weak. This study was conducted with the aim of understanding the process of translating research into policy in order to guide the strategic direction of Makerere University College of Health Sciences (MakCHS and similar institutions in their quest to influence health outcomes nationally and globally. Methods A case study approach using 30 in-depth interviews with stakeholders involved in two HIV prevention research project was purposively selected. The study sought to analyze the research-to-policy discourses for the prevention of mother-to-child transmission (PMTCT and safe male circumcision (SMC. The analysis sought to identify entry points, strengths and challenges for research-to-policy processes by interviewing three major groups of stakeholders in Uganda – researchers (8, policy makers (12 and media practitioners (12. Results Among the factors that facilitated PMTCT policy uptake and continued implementation were: shared platforms for learning and decision making among stakeholders, implementation pilots to assess feasibility of intervention, the emerging of agencies to undertake operations research and the high visibility of policy benefits to child survival. In contrast, SMC policy processes were stalled for over two years after the findings of the Uganda study was made public. Among other factors, policy makers demanded additional research to assess implementation feasibility of SMC within ordinary health system context. High level leaders also publicly contested the SMC evidence and the underlying values and messages – a situation that reduced the coalition of policy champions

Meiosis-specific cohesin component, Stag3 is essential for maintaining centromere chromatid cohesion, and required for DNA repair and synapsis between homologous chromosomes.

Directory of Open Access Journals (Sweden)

Jessica Hopkins

2014-07-01

Full Text Available Cohesins are important for chromosome structure and chromosome segregation during mitosis and meiosis. Cohesins are composed of two structural maintenance of chromosomes (SMC1-SMC3 proteins that form a V-shaped heterodimer structure, which is bridged by a α-kleisin protein and a stromal antigen (STAG protein. Previous studies in mouse have shown that there is one SMC1 protein (SMC1β, two α-kleisins (RAD21L and REC8 and one STAG protein (STAG3 that are meiosis-specific. During meiosis, homologous chromosomes must recombine with one another in the context of a tripartite structure known as the synaptonemal complex (SC. From interaction studies, it has been shown that there are at least four meiosis-specific forms of cohesin, which together with the mitotic cohesin complex, are lateral components of the SC. STAG3 is the only meiosis-specific subunit that is represented within all four meiosis-specific cohesin complexes. In Stag3 mutant germ cells, the protein level of other meiosis-specific cohesin subunits (SMC1β, RAD21L and REC8 is reduced, and their localization to chromosome axes is disrupted. In contrast, the mitotic cohesin complex remains intact and localizes robustly to the meiotic chromosome axes. The instability of meiosis-specific cohesins observed in Stag3 mutants results in aberrant DNA repair processes, and disruption of synapsis between homologous chromosomes. Furthermore, mutation of Stag3 results in perturbation of pericentromeric heterochromatin clustering, and disruption of centromere cohesion between sister chromatids during meiotic prophase. These defects result in early prophase I arrest and apoptosis in both male and female germ cells. The meiotic defects observed in Stag3 mutants are more severe when compared to single mutants for Smc1β, Rec8 and Rad21l, however they are not as severe as the Rec8, Rad21l double mutants. Taken together, our study demonstrates that STAG3 is required for the stability of all meiosis

Hardware implementation of Lorenz circuit systems for secure chaotic communication applications.

Science.gov (United States)

Chen, Hsin-Chieh; Liau, Ben-Yi; Hou, Yi-You

2013-02-18

This paper presents the synchronization between the master and slave Lorenz chaotic systems by slide mode controller (SMC)-based technique. A proportional-integral (PI) switching surface is proposed to simplify the task of assigning the performance of the closed-loop error system in sliding mode. Then, extending the concept of equivalent control and using some basic electronic components, a secure communication system is constructed. Experimental results show the feasibility of synchronizing two Lorenz circuits via the proposed SMC. 

The AFIT of Today is the Air Force of Tomorrow

Science.gov (United States)

2012-05-11

marketing 5/11/2012 9 The AFIT of today is the Air Force of tomorrow. 1 Air University: The Intellectual and Leadership Center of the Air Force Aim High...Center of the Air Force Aim High…Fly - Fight - Win The AFIT of Today is the Air Force of Tomorrow. LS Accomplishments • Initiated market -based, fee-for...USAFA Swarming Formation Flying Sponsor: SMC Space Traffic Control Iridium and Globalstar Modems Sponsor: AFRL/RV; SMC/ STP CubeSat Plume Detector

Surfactant modified clays’ consistency limits and contact angles

Directory of Open Access Journals (Sweden)

S Akbulut

2012-07-01

Full Text Available This study was aimed at preparing a surfactant modified clay (SMC and researching the effect of surfactants on clays' contact angles and consistency limits; clay was thus modified by surfactants formodifying their engineering properties. Seven surfactants (trimethylglycine, hydroxyethylcellulose  octyl phenol ethoxylate, linear alkylbenzene sulfonic acid, sodium lauryl ether sulfate, cetyl trimethylammonium chloride and quaternised ethoxylated fatty amine were used as surfactants in this study. The experimental results indicated that SMC consistency limits (liquid and plastic limits changedsignificantly compared to those of natural clay. Plasticity index and liquid limit (PI-LL values representing soil class approached the A-line when zwitterion, nonionic, and anionic surfactant percentageincreased. However, cationic SMC became transformed from CH (high plasticity clay to MH (high plasticity silt class soils, according to the unified soil classification system (USCS. Clay modifiedwith cationic and anionic surfactants gave higher and lower contact angles than natural clay, respectively.

Multi-Objective Sliding Mode Control on Vehicle Cornering Stability with Variable Gear Ratio Actuator-Based Active Front Steering Systems

Science.gov (United States)

Ma, Xinbo; Wong, Pak Kin; Zhao, Jing; Xie, Zhengchao

2016-01-01

Active front steering (AFS) is an emerging technology to improve the vehicle cornering stability by introducing an additional small steering angle to the driver’s input. This paper proposes an AFS system with a variable gear ratio steering (VGRS) actuator which is controlled by using the sliding mode control (SMC) strategy to improve the cornering stability of vehicles. In the design of an AFS system, different sensors are considered to measure the vehicle state, and the mechanism of the AFS system is also modelled in detail. Moreover, in order to improve the cornering stability of vehicles, two dependent objectives, namely sideslip angle and yaw rate, are considered together in the design of SMC strategy. By evaluating the cornering performance, Sine with Dwell and accident avoidance tests are conducted, and the simulation results indicate that the proposed SMC strategy is capable of improving the cornering stability of vehicles in practice. PMID:28036037

Stepping motor control processor reference manual. Volume I

International Nuclear Information System (INIS)

Holloway, F.W.; VanArsdall, P.J.; Suski, G.J.; Gant, R.G.; Rash, M.

1980-01-01

This manual is intended to serve several purposes. The first goal is to describe the capabilities and operation of the SMC processor package from an operator or user point of view. Secondly, the manual will describe in some detail the basic hardware elements and how they can be used effectively to implement a step motor control system. Practical information on the use, installation and checkout of the hardware set is presented in the following sections along with programming suggestions. Available related system software is described in this manual for reference and as an aid in understanding the system architecture. Section two presents an overview and operations manual of the SMC processor describing its composition and functional capabilities. Section three contains hardware descriptions in some detail for the LLL-designed hardware used in the SMC processor. Basic theory of operation and important features are explained

Failure Probability Estimation of Wind Turbines by Enhanced Monte Carlo

DEFF Research Database (Denmark)

Sichani, Mahdi Teimouri; Nielsen, Søren R.K.; Naess, Arvid

2012-01-01

This paper discusses the estimation of the failure probability of wind turbines required by codes of practice for designing them. The Standard Monte Carlo (SMC) simulations may be used for this reason conceptually as an alternative to the popular Peaks-Over-Threshold (POT) method. However......, estimation of very low failure probabilities with SMC simulations leads to unacceptably high computational costs. In this study, an Enhanced Monte Carlo (EMC) method is proposed that overcomes this obstacle. The method has advantages over both POT and SMC in terms of its low computational cost and accuracy...... is controlled by the pitch controller. This provides a fair framework for comparison of the behavior and failure event of the wind turbine with emphasis on the effect of the pitch controller. The Enhanced Monte Carlo method is then applied to the model and the failure probabilities of the model are estimated...

Mediational influence of spent mushroom compost on phytoremediation of black-oil hydrocarbon polluted soil and response of Megathyrsus maximus Jacq.

Science.gov (United States)

Asemoloye, Michael Dare; Jonathan, Segun Gbolagade; Jayeola, Adeniyi A; Ahmad, Rafiq

2017-09-15

Ability of a plant to develop different adaptive strategies can also determine its capability for effective soil remediation. In this study, influence of spent mushroom compost (SMC) was tested on the phytoremediation of black oil hydrocarbon polluted soil and the response of Megathyrsus maximus (guinea grass). Studies were carried out in microcosm conditions by mixing different concentration of SMC viz., 10, 20, 30 and 40% in a 5 kg of contaminated soil along with control. Seeds of M. maximus was sown in tray for two weeks and allowed to grow for height of 10 cm and transplanted in to the different experimental pots. Soil nutrient, heavy metal and PAH contents were analyzed before and after the experiment. Ecophysiological and anatomical responses due to the contaminants in the soil by M. Maximus were analyzed after 120 days. Phytomass efficiency, potential photosynthesis (Amax) and contents of chlorophylls (a and b) as well as the total chlorophyll along with anatomical evaluations were recorded. Plant alone (control) reduced the soil heavy metal and PAH contents but further improvements were observed in SMC treatments, similar results were also observed as regards to the plant's phytoremediation efficiency (PE), phytomass and potential photosynthetic rates (m mol O 2  M -2 S -1 ). The plant's root and shoot anatomical responses were enhanced in treatments compared to control, study infers that the treatment enhances the biostimulation and development of adaptive characteristics for M. maximus survival in contaminated soils and promotes its co-degradation of hydrocarbon. SMC supports remediation and as well enhances the anatomical evaluations, we therefore recommend the use of SMC on response of Megathyrsus maximus Jacq for remediation of petrochemical based phytoremediation. Copyright © 2017 Elsevier Ltd. All rights reserved.

How and to what extent does precipitation on multi-temporal scales and soil moisture at different depths determine carbon flux responses in a water-limited grassland ecosystem?

Science.gov (United States)

Fang, Qingqing; Wang, Guoqiang; Xue, Baolin; Liu, Tingxi; Kiem, Anthony

2018-04-23

In water-limited ecosystems, hydrological processes significantly affect the carbon flux. The semi-arid grassland ecosystem is particularly sensitive to variations in precipitation (PRE) and soil moisture content (SMC), but to what extent is not fully understood. In this study, we estimated and analyzed how hydrological variables, especially PRE at multi-temporal scales (diurnal, monthly, phenological-related, and seasonal) and SMC at different soil depths (0-20 cm, 20-40 cm, 40-60 cm, 60-80 cm) affect the carbon flux. For these aims, eddy covariance data were combined with a Vegetation Photosynthesis and Respiration Model (VPRM) to simulate the regional gross primary productivity (GPP), ecosystem respiration (R eco ), and net ecosystem exchange of CO 2 (NEE). Interestingly, carbon flux showed no relationship with diurnal PRE or phenological-related PRE (precipitation in the growing season and non-growing season). However, carbon flux was significantly related to monthly PRE and to seasonal PRE (spring + summer, autumn). The GPP, R eco , and NEE increased in spring and summer but decreased in autumn with increasing precipitation due to the combined effect of salinization in autumn. The GPP, R eco , and NEE were more responsive to SMC at 0-20 cm depth than at deeper depths due to the shorter roots of herbaceous vegetation. The NEE increased with increasing monthly PRE because soil microbes responded more quickly than plants. The NEE significantly decreased with increasing SMC in shallow surface due to a hysteresis effect on water transport. The results of our study highlight the complex processes that determine how and to what extent PRE at multi-temporal scale and SMC at different depths affect the carbon flux response in a water-limited grassland. Copyright © 2018 Elsevier B.V. All rights reserved.

THE VMC SURVEY. XIX. CLASSICAL CEPHEIDS IN THE SMALL MAGELLANIC CLOUD

Energy Technology Data Exchange (ETDEWEB)

Ripepi, V.; Marconi, M. [INAF-Osservatorio Astronomico di Capodimonte, via Moiariello 16, I-80131, Naples (Italy); Moretti, M. I. [IAASARS, National Observatory of Athens, 15236 Penteli (Greece); Clementini, G. [INAF-Osservatorio Astronomico di Bologna, via Ranzani, I-40127, Bologna (Italy); Cioni, M.-R. L. [Universität Potsdam, Institut für Physik und Astronomie, Karl-Liebknecht-Strasse 24/25, D-14476 Potsdam (Germany); Grijs, R. de [Kavli Institute for Astronomy and Astrophysics and Department of Astronomy, Peking University, Yi He Yuan Lu 5, Hai Dian District, Beijing 100871 (China); Emerson, J. P. [School of Physics and Astronomy, Queen Mary University of London, Mile End Road, London E1 4NS (United Kingdom); Groenewegen, M. A. T. [Koninklijke Sterrenwacht van België, Ringlaan 3, B-1180, Brussel (Belgium); Ivanov, V. D. [European Southern Observatory, Karl-Schwarzschild-Strasse 2, D-85748 Garching bei München (Germany); Piatti, A. E., E-mail: ripepi@oacn.inaf.it [Observatorio Astronómico, Universidad Nacional de Córdoba, Laprida 854, 5000, Córdoba (Argentina)

2016-06-01

The “VISTA near-infrared YJK {sub s}  survey of the Magellanic Clouds System” (VMC) is collecting deep K {sub s}-band time-series photometry of pulsating variable stars hosted by the two Magellanic Clouds and their connecting Bridge. In this paper, we present Y , J , K {sub s} light curves for a sample of 4172 Small Magellanic Cloud (SMC) Classical Cepheids (CCs). These data, complemented with literature V values, allowed us to construct a variety of period–luminosity (PL), period–luminosity–color (PLC), and period–Wesenheit (PW) relationships, which are valid for Fundamental (F), First Overtone (FO), and Second Overtone (SO) pulsators. The relations involving the V , J , K {sub s} bands are in agreement with their counterparts in the literature. As for the Y band, to our knowledge, we present the first CC PL, PW, and PLC relations ever derived using this filter. We also present the first near–infrared PL, PW, and PLC relations for SO pulsators to date. We used PW( V , K {sub s}) to estimate the relative SMC–LMC distance and, in turn, the absolute distance to the SMC. For the former quantity, we find a value of Δ μ  = 0.55 ± 0.04 mag, which is in rather good agreement with other evaluations based on CCs, but significantly larger than the results obtained from older population II distance indicators. This discrepancy might be due to the different geometric distributions of young and old tracers in both Clouds. As for the absolute distance to the SMC, our best estimates are μ {sub SMC} = 19.01 ± 0.05 mag and μ {sub SMC} = 19.04 ± 0.06 mag, based on two distance measurements to the LMC which rely on accurate CC and eclipsing Cepheid binary data, respectively.

Training efficiency and transfer success in an extended real-time functional MRI neurofeedback training of the somato-motor cortex of healthy subjects

Directory of Open Access Journals (Sweden)

Tibor eAuer

2015-10-01

Full Text Available This study investigated the level of self-regulation of the somato-motor cortices (SMC attained by an extended functional MRI (fMRI neurofeedback training. Sixteen healthy subjects performed 12 real-time functional magnetic resonance imaging (rt-fMRI neurofeedback training sessions within 4 weeks, involving motor imagery of the dominant right as well as the non-dominant left hand. Target regions of interests in the SMC were individually localized prior to the training by overt finger movements. The feedback signal was defined as the difference between fMRI activation in the contra- and ipsilateral SMC and visually presented to the subjects. Training efficiency was determined by an off-line GLM analysis determining the fMRI percent signal changes in the somato-motor cortex (SMC target areas accomplished during the neurofeedback training. Transfer success was assessed by comparing the pre- and post-training transfer task, i.e. the neurofeedback paradigm without the presentation of the feedback signal. Group results show a distinct increase in feedback performance in the transfer task for the trained group compared to a matched untrained control group, as well as an increase in the time course of the training, indicating an efficient training and a successful transfer. Individual analysis revealed that the training efficiency was not only highly correlated to the transfer success but also predictive. Trainings with at least 12 efficient training runs were associated with a successful transfer outcome. A group analysis of the hemispheric contributions to the feedback performance showed that it is mainly driven by increased fMRI activation in the contralateral SMC, although some individuals relied on ipsilateral deactivation. Training and transfer results showed no difference between left and right hand imagery, with a slight indication of more ipsilateral deactivation in the early right hand trainings.

Improvement of Soil Moisture Retrieval from Hyperspectral VNIR-SWIR Data Using Clay Content Information: From Laboratory to Field Experiments

Directory of Open Access Journals (Sweden)

Rosa Oltra-Carrió

2015-03-01

Full Text Available The aim of this work is to study the constraints and performance of SMC retrieval methodologies in the VNIR (Visible-Near InfraRed and SWIR (ShortWave InfraRed regions (from 0.4 to 2.5 µm when passing from controlled laboratory conditions to field conditions. Five different approaches of signal processing found in literature were considered. Four local criteria are spectral indices (WISOIL, NSMI, NINSOL and NINSON. These indices are the ratios between the spectral reflectances acquired at two specific wavelengths to characterize moisture content in soil. The last criterion is based in the convex hull concept and it is a global method, which is based on the analysis of the full spectral signature of the soil. The database was composed of 464 and 9 spectra, respectively, measured over bare soils in laboratory and in-situ. For each measurement, SMC and texture were well-known and the database was divided in two parts dedicated to calibration and validation steps. The calibration part was used to define the empirical relation between SMC and SMC retrieval approaches, with coefficients of determination (R2 between 0.72 and 0.92. A clay content (CC dependence was detected for the NINSOL and NINSON indices. Consequently, two new criteria were proposed taking into account the CC contribution (NINSOLCC and NINSONCC. The well-marked regression between SMC and global/local indices, and the interest of using the CC, were confirmed during the validation step using laboratory data (R² superior to 0.76 and Root mean square errors inferior to 8.3% m3∙m−3 in all cases and using in-situ data, where WISOIL, NINSOLCC and NINSONCC criteria stand out among the NSMI and CH.

Immunobiological effects of AFB1 and AFB1-FB1 mixture in experimental subchronic mycotoxicoses in rats

International Nuclear Information System (INIS)

Theumer, M.G.; Lopez, A.G.; Masih, D.T.; Chulze, S.N.; Rubinstein, H.R.

2003-01-01

Maize co-contamination with aflatoxin B1 (AFB1) and fumonisin B1 (FB1) is frequently found in several countries. Although the alterations on nutritional and immunologic parameters induced by these mycotoxins, when administered individually, are partially characterised, little is known about the effects induced in animals by a subchronic administration of both toxins mixtures. We have studied the nutritional and immunological alterations induced in rats fed during 90 days with a diet without mycotoxins, containing 40 ppb AFB1, and with a diet containing a mixture of 40 ppb AFB1 and 100 ppm FB1. Animals fed with the mixture of toxins obtained lower body weight than the control ones. The mitogenic response of spleen mononuclear cells (SMC) in vivo was higher in animals fed with AFB1. In in vitro studies, lower proliferations of SMC pre-exposed to AFB1 and to the mixture of toxins were detected. The SMC of animals fed with AFB1 produced lower levels of IL-2, higher of IL-4 and equal levels of IL-10. The SMC of animals fed with both toxins produced higher levels of IL-4, lower of IL-10 and equal levels of IL-2. The SMC preincubated with an AFB1-FB1 mixture produced higher concentrations of IL-4, lower of IL-10 and equal levels of IL-2. The peritoneal macrophages of animals that consumed AFB1 released less H 2 O 2 , while animals fed with the mixture of toxins produced higher levels. In in vitro studies, macrophages pre-exposed to the mixture of toxins released less H 2 O 2 . These results show different immunobiological effects produced by a mixture of mycotoxins in comparison to the individual action of the same toxins

Immunobiological effects of AFB1 and AFB1-FB1 mixture in experimental subchronic mycotoxicoses in rats

Energy Technology Data Exchange (ETDEWEB)

Theumer, M G; Lopez, A G; Masih, D T; Chulze, S N; Rubinstein, H R

2003-04-15

Maize co-contamination with aflatoxin B1 (AFB1) and fumonisin B1 (FB1) is frequently found in several countries. Although the alterations on nutritional and immunologic parameters induced by these mycotoxins, when administered individually, are partially characterised, little is known about the effects induced in animals by a subchronic administration of both toxins mixtures. We have studied the nutritional and immunological alterations induced in rats fed during 90 days with a diet without mycotoxins, containing 40 ppb AFB1, and with a diet containing a mixture of 40 ppb AFB1 and 100 ppm FB1. Animals fed with the mixture of toxins obtained lower body weight than the control ones. The mitogenic response of spleen mononuclear cells (SMC) in vivo was higher in animals fed with AFB1. In in vitro studies, lower proliferations of SMC pre-exposed to AFB1 and to the mixture of toxins were detected. The SMC of animals fed with AFB1 produced lower levels of IL-2, higher of IL-4 and equal levels of IL-10. The SMC of animals fed with both toxins produced higher levels of IL-4, lower of IL-10 and equal levels of IL-2. The SMC preincubated with an AFB1-FB1 mixture produced higher concentrations of IL-4, lower of IL-10 and equal levels of IL-2. The peritoneal macrophages of animals that consumed AFB1 released less H{sub 2}O{sub 2}, while animals fed with the mixture of toxins produced higher levels. In in vitro studies, macrophages pre-exposed to the mixture of toxins released less H{sub 2}O{sub 2}. These results show different immunobiological effects produced by a mixture of mycotoxins in comparison to the individual action of the same toxins.

Platelet-activating factor synthesis and receptor-mediated signaling are downregulated in ovine newborn lungs: relevance in postnatal pulmonary adaptation and persistent pulmonary hypertension of the newborn.

Science.gov (United States)

Renteria, L S; Cruz, E; Ibe, B O

2013-12-01

Platelet-activating factor (PAF) is a phospholipid with a wide range of biological activities. We studied PAF metabolism and PAF receptor (PAFR) signaling in perinatal ovine lungs to understand PAF's role in transition of the perinatal pulmonary hemodynamics and pathophysiology of persistent pulmonary hypertension of the newborn. We hypothesized that downregulation of PAF synthesis with upregulation of PAF catabolism by acetylhydrolase (PAF-Ah) in the newborn lung is needed for fetus-to-newborn pulmonary adaptation. Studies were conducted on fetal and newborn lamb pulmonary arteries (PA), veins (PV) and smooth muscle cells (SMC). PAF metabolism, PAFR binding and cell proliferation were studied by cell culture; gene expression was studied by qPCR. Fetal lungs synthesized 60% more PAF than newborn lungs. Compared with the fetal PVs and SMCs, PAF-Ah activity in newborn was 40-60% greater. PAF-Ah mRNA expression in newborn vessels was different from the expression by fetal PA. PAF-Ah gene clone activity confirmed deletion of hypoxia-sensitive site. PAFR mRNA expression by the PVs and SMC-PV of the fetus and newborn was greater than by corresponding PAs and SMC-PA. Q-PCR study of PAFR expression by the SMC-PV of both groups was greater than SMC-PA. Fetal SMCs bound more PAF than the newborn SMCs. PAFR antagonist, CV-3988, inhibited PAFR binding and DNA synthesis by the fetal SMCs, but augmented binding and DNA synthesis by newborn cells. We show different PAF-PAFR mediated effects in perinatal lungs, suggesting both transcriptional and translational regulation of PAF-Ah and PAFR expression in the perinatal lamb lungs. These indicate that the downregulation of PAF-mediated effects postnatally protects against persistent pulmonary hypertension of the newborn.

Systematic study of muonic atoms in the A = 100 to A = 140 nuclear-mass regions (isotope and isotone shifts) and model-independent precision measurements of ground-state quadrupole moments of odd-A nuclei. Progress report No. 7, October 16, 1981-October 15, 1982

International Nuclear Information System (INIS)

Steffen, R.M.

1982-10-01

Until June 1982 all muonic x-ray experiments were performed at the Stopped Muon Channel (SMC) in experimental area A of LAMPF. The SMC channel, consisting of 3 bending magnets and 21 quadrupole magnets, is specifically designed for a clean muon beam and incorporates a long path for the decay of the pions. Recently a number of long-time experiments (rare decay modes of the muon, etc.) have been assigned to the SMC and running time for the muonic x-ray experiments has become very precious. For these reasons considerable time was spent in the summer of 1982 to study the feasibility of doing muonic experiments at the abandoned Biomed channel which has been designed for pion-irradiation therapy of cancer patients. Since the length of the Biomed channel is short, the available experimental area is close to the production target, and hence the neutron background in the experimental area is intolerably large (about 50 times larger than in the SMC experimental area). To reduce this background, the muonic x-ray detector and counter telescope arrangement was modified and surrounded by a concrete and steel shielding house of 1.5 feet minimum wall thickness. The dimensions of the house were 10' x 14' x 6' (H). The background was thus reduced to an acceptable level, even though the signal-to-noise ratio is still twice as large as in the SMC. Nevertheless, the Biomed channel is now usable for Muonic x-ray experiments that do not involve the observation of muonic x-rays of less than 0.5 MeV energy. The muonic x-ray experiments on 233 U described in this Progress Report have been performed at the Biomed channel

Application and development of the Schwinger multichannel scattering theory and the partial differential equation theory of electron-molecule scattering

Science.gov (United States)

Weatherford, Charles A.

1993-01-01

One version of the multichannel theory for electron-target scattering based on the Schwinger variational principle, the SMC method, requires the introduction of a projection parameter. The role of the projection parameter a is investigated and it is shown that the principal-value operator in the SMC equation is Hermitian regardless of the value of a as long as it is real and nonzero. In a basis that is properly orthonormalizable, the matrix representation of this operator is also Hermitian. The use of such basis is consistent with the Schwinger variational principle because the Lippmann-Schwinger equation automatically builds in the correct boundary conditions. Otherwise, an auxiliary condition needs to be introduced, and Takatsuka and McKoy's original value of a is one of the three possible ways to achieve Hermiticity. In all cases but one, a can be uncoupled from the Hermiticity condition and becomes a free parameter. An equation for a based on the variational stability of the scattering amplitude is derived; its solution has an interesting property that the scattering amplitude from a converged SMC calculation is independent of the choice of a even though the SMC operator itself is a-dependent. This property provides a sensitive test of the convergence of the calculation. For a static-exchange calculation, the convergence requirement only depends on the completeness of the one-electron basis, but for a general multichannel case, the a-invariance in the scattering amplitude requires both the one-electron basis and the N plus 1-electron basis to be complete. The role of a in the SMC equation and the convergence property are illustrated using two examples: e-CO elastic scattering in the static-exchange approximation, and a two-state treatment of the e-H2 Chi(sup 1)Sigma(sub g)(+) yields b(sup 3)Sigma(sub u)(+) excitation.

Roles of calcium and IP3 in impaired colon contractility of rats following multiple organ dysfunction syndrome

Directory of Open Access Journals (Sweden)

C. Zheyu

2007-10-01

Full Text Available The purpose of the present study was to explore changes in rat colon motility, and determine the roles of calcium and inositol (1,4,5-triphosphate (IP3 in colon dysmotility induced by multiple organ dysfunction syndrome (MODS caused by bacteria peritonitis. The number of stools, the contractility of the muscle strips and the length of smooth muscle cells (SMC in the colon, the concentration of calcium and IP3 in SMC, and serum nitric oxide were measured. Number of stools, fecal weight, IP3 concentration in SMC and serum nitric oxide concentration were 0.77 ± 0.52 pellets, 2.51 ± 0.39 g, 4.14 ± 2.07 pmol/tube, and 113.95 ± 37.89 µmol/L, respectively, for the MODS group (N = 11 vs 1.54 ± 0.64 pellets, 4.32 ± 0.57 g, 8.19 ± 3.11 pmol/tube, and 37.42 ± 19.56 µmol/L for the control group (N = 20; P < 0.05. After treatment with 0.1 mM acetylcholine and 0.1 M potassium chloride, the maximum contraction stress of smooth muscle strips, the length of SMC and the changes of calcium concentration were 593 ± 81 and 458 ± 69 g/cm³, 48.1 ± 11.8 and 69.2 ± 15.7 µM, 250 ± 70 and 167 ± 48%, respectively, for the control group vs 321 ± 53 and 284 ± 56 g/cm³, 65.1 ± 18.5 and 87.2 ± 23.7 µM, 127 ± 35 and 112 ± 35% for the MODS group (P < 0.05. Thus, colon contractility was decreased in MODS, a result possibly related to reduced calcium concentration and IP3 in SMC.

Telomerase Inhibition by Everolimus Suppresses Smooth Muscle Cell Proliferation and Neointima Formation Through Epigenetic Gene Silencing.

Science.gov (United States)

Aono, Jun; Ruiz-Rodriguez, Ernesto; Qing, Hua; Findeisen, Hannes M; Jones, Karrie L; Heywood, Elizabeth B; Bruemmer, Dennis

2016-01-01

The present study sought to investigate the mechanisms underlying the mitogenic function of telomerase and to test the hypothesis that everolimus, commonly used on drug-eluting stents, suppresses smooth muscle cells (SMC) proliferation by targeting telomerase. Proliferation of SMC during neointima formation is prevented by drug-eluting stents. Although the replicative capacity of mammalian cells is enhanced by telomerase expression, the contribution of telomerase to the proliferative response underlying neointima formation and its potential role as a pharmacological target remain to be investigated. We first employed constitutive expression of telomerase reverse transcriptase (TERT) in cell systems to study transcriptional mechanisms by which telomerase activates a mitogenic program. Second, overexpression of telomerase in mice provided a model to study the role of telomerase as a drug target for the antiproliferative efficacy of everolimus. Inhibition of neointima formation by everolimus is lost in mice overexpressing TERT, indicating that repression of telomerase confers the antiproliferative efficacy of everolimus. Everolimus reduces TERT expression in SMC through an Ets-1-dependent inhibition of promoter activation. The inhibition of TERT-dependent SMC proliferation by everolimus occurred in the absence of telomere shortening but rather as a result of a G1→S phase arrest. Although everolimus failed to inhibit phosphorylation of the retinoblastoma protein as the gatekeeper of S-phase entry, it potently repressed downstream target genes. Using chromatin immunoprecipitation assays, we finally demonstrate that TERT induces E2F binding to S-phase gene promoters and supports histone acetylation, effects that are inhibited by everolimus and mediate its antiproliferative activity. These results characterize telomerase as a previously unrecognized target for the antiproliferative activity of everolimus. Our studies further identify a novel mitogenic pathway in SMC

Parton distributions from SMC and SLAC data

International Nuclear Information System (INIS)

Ramsey, G.P.

1996-01-01

We have extracted spin-weighted parton distributions in a proton from recent data at CERN and SLAC. The valence, sea quark and Antiquark spin-weighted distributions are determined separately. The data are all consistent with a small to moderate polarized gluon distribution, so that the anomaly term is not significant in the determination of the constituent contributions to the spin of the proton. We have analyzed the consistency of the results obtained from various sets of data and the Biorken sum rule. Although all data are consistent with the sum rule, the polarized distributions from different experiments vary, even with higher order QCD corrections taken into account. Results split into two models, one set implying a large polarized strange sea which violates the positivity bound, and the other set yielding a smaller polarized strange sea. Only further experiments which extract information about the polarized sea will reconcile these differences. We suggest specific experiments which can be performed to determine the size of the polarized sea and gluons

Slow and sustained nitric oxide releasing compounds inhibit multipotent vascular stem cell proliferation and differentiation without causing cell death

International Nuclear Information System (INIS)

Curtis, Brandon M.; Leix, Kyle Alexander; Ji, Yajing; Glaves, Richard Samuel Elliot; Ash, David E.; Mohanty, Dillip K.

2014-01-01

Highlights: • Multipotent vascular stem cells (MVSCs) proliferate and differentiate. • Nitric oxide inhibits proliferation of MVSCs. • Nitric oxide inhibits MVSC differentiation to mesenchymal-like stem cells (MSCs). • Smooth muscle cells (SMCs) neither de-differentiate nor proliferate. - Abstract: Atherosclerosis is the leading cause of cerebral and myocardial infarction. It is believed that neointimal growth common in the later stages of atherosclerosis is a result of vascular smooth muscle cell (SMC) de-differentiation in response to endothelial injury. However, the claims of the SMC de-differentiation theory have not been substantiated by monitoring the fate of mature SMCs in response to such injuries. A recent study suggests that atherosclerosis is a consequence of multipotent vascular stem cell (MVSC) differentiation. Nitric oxide (NO) is a well-known mediator against atherosclerosis, in part because of its inhibitory effect on SMC proliferation. Using three different NO-donors, we have investigated the effects of NO on MVSC proliferation. Results indicate that NO inhibits MVSC proliferation in a concentration dependent manner. A slow and sustained delivery of NO proved to inhibit proliferation without causing cell death. On the other hand, larger, single-burst NO concentrations, inhibits proliferation, with concurrent significant cell death. Furthermore, our results indicate that endogenously produced NO inhibits MVSC differentiation to mesenchymal-like stem cells (MSCs) and subsequently to SMC as well

Patients Carrying 9q31.1-q32 Deletion Share Common Features with Cornelia de Lange Syndrome

Directory of Open Access Journals (Sweden)

Ruixue Cao

2015-01-01

Full Text Available Background: Cornelia de Lange Syndrome (CdLS is a rare but severe clinically heterogeneous developmental disorder characterized by facial dysmorphia, growth and cognitive retardation, and abnormalities of limb development. Objectives: To determine the pathogenesis of a patient with CdLS. Methods: We studied a patient with CdLS by whole exome sequencing, karyotyping and Agilent CGH Array. The results were confirmed by quantitative real-time PCR analysis of the patient and her parents. Further comparison of our patient and cases with partially overlapping deletions retrieved from the literature and databases was undertaken. Results: Whole exome sequencing had excluded the mutation of cohesion genes such as NIPBL,SMC1A and SMC3. The result of karyotyping showed a deletion of chromosome 9q31.1-q32 and the result of Agilent CGH Array further displayed a 12.01-Mb region of deletion at chromosome bands 9q31.1-q32. Reported cases with the deletion of 9q31.1-q32 share similar features with our CdLS patient. One of the genes in the deleted region, SMC2, belongs to the Structural Maintenance of Chromosomes (SMC family and regulates gene expression and DNA repair. Conclusions: Patients carrying the deletion of 9q31.1-q32 showed similar phenotypes with CdLS.

Fluoro-2-deoxy-D-glucose (FDG)-PET in APOEepsilon4 carriers in the Australian population.

Science.gov (United States)

Rimajova, Mira; Lenzo, Nat P; Wu, Jing-Shan; Bates, Kristyn A; Campbell, Andrew; Dhaliwal, Satvinder S; McCarthy, Michael; Rodrigues, Mark; Paton, Athena; Rowe, Christopher; Foster, Jonathan K; Martins, Ralph N

2008-03-01

Apolipoprotein E-epsilon4 (APOEepsilon4) has been associated with increased risk of developing Alzheimer's disease (AD) and regional cerebral glucose hypometabolism, as measured by fluoro-2-deoxy-D-glucose-positron emission tomography (FDG-PET). We report here preliminary data from studies that aim to determine whether cerebral glucose hypometabolism is observed in APOEepsilon4 positive, cognitively intact individuals between the ages of 50 and 80, and whether there is an additional impact of subjective memory complainer (SMC) status on glucose metabolism determined by NeuroStat analysis. FDG-PET was conducted in 30 community dwelling, APOE-epsilon4 carriers without clinical evidence of dementia and objective cognitive impairment as assessed using a neuropsychological battery. Neurological soft-signs (NSS) were also assessed. Glucose hypometabolism was demonstrated in the anterior and posterior cingulate cortex and in the temporal association cortices in APOEepsilon4 carriers compared to the normative NeuroStat database. This pattern was particularly evident in APOEepsilon4 heterozygous individuals. SMC showed hypometabolism in the aforementioned brain regions, whereas non-SMC showed no significant pattern of glucose hypometabolism. FDG-PET with NeuroStat analysis showed that APOEepsilon4 carriers have mild glucose hypometabolism in areas associated with AD. SMC may be associated with AD-related differences in regional cerebral glucose metabolism. These findings are currently being investigated in a larger group of APOEepsilon4 carriers.

The ideal harvest time for seeds of hybrid maize (Zea mays L.) XY335 and ZD958 produced in multiple environments.

Science.gov (United States)

Gu, Riliang; Li, Li; Liang, Xiaolin; Wang, Yanbo; Fan, Tinglu; Wang, Ying; Wang, Jianhua

2017-12-13

To identify the ideal harvest time (IHT) for the seed production of XY335 and ZD958, six seed-related traits were evaluated in seeds harvested at 11 harvest stages in 8 environments. Standard germination (SG), accelerated aging germination (AAG) and cold test germination (CTG) were vigor traits; hundred-seed weight (HSW) and seed moisture content (SMC) were physiological traits; and ≥10 °C accumulated temperature from pollination to harvest (AT10 ph ) was an ecological trait. All the traits were significantly affected by harvest stage. The responses of SG, AAG, CTG and HSW to postponing harvest stage fit quadratic models, while SMC and AT10 ph fit linear models. The IHT (indicated by the last date to reach maximum SG, AAG and CTG) were 57.97 DAP and 56.80 DAP for XY335 and ZD958, respectively. SMC and AT10 ph at IHT were 33.15% and 1234 °C for XY335, and 34.98% and 1226 °C for ZD958, respectively. The period to reach the maximum HSW was 5 days later than the IHT. Compared to HSW and SMC, AT10 ph had a closer relationship to the seed vigor traits. Together with the fact that AT10 ph was less affected by environment, these results suggested that AT10 ph may be a novel indicator for determining the IHT.

Robust coordinated control of a dual-arm space robot

Science.gov (United States)

Shi, Lingling; Kayastha, Sharmila; Katupitiya, Jay

2017-09-01

Dual-arm space robots are more capable of implementing complex space tasks compared with single arm space robots. However, the dynamic coupling between the arms and the base will have a serious impact on the spacecraft attitude and the hand motion of each arm. Instead of considering one arm as the mission arm and the other as the balance arm, in this work two arms of the space robot perform as mission arms aimed at accomplishing secure capture of a floating target. The paper investigates coordinated control of the base's attitude and the arms' motion in the task space in the presence of system uncertainties. Two types of controllers, i.e. a Sliding Mode Controller (SMC) and a nonlinear Model Predictive Controller (MPC) are verified and compared with a conventional Computed-Torque Controller (CTC) through numerical simulations in terms of control accuracy and system robustness. Both controllers eliminate the need to linearly parameterize the dynamic equations. The MPC has been shown to achieve performance with higher accuracy than CTC and SMC in the absence of system uncertainties under the condition that they consume comparable energy. When the system uncertainties are included, SMC and CTC present advantageous robustness than MPC. Specifically, in a case where system inertia increases, SMC delivers higher accuracy than CTC and costs the least amount of energy.

LIX1 regulates YAP1 activity and controls the proliferation and differentiation of stomach mesenchymal progenitors.

Science.gov (United States)

McKey, Jennifer; Martire, Delphine; de Santa Barbara, Pascal; Faure, Sandrine

2016-04-28

Smooth muscle cell (SMC) plasticity maintains the balance between differentiated SMCs and proliferative mesenchymal progenitors, crucial for muscular tissue homeostasis. Studies on the development of mesenchymal progenitors into SMCs have proven useful in identifying molecular mechanisms involved in digestive musculature plasticity in physiological and pathological conditions. Here, we show that Limb Expression 1 (LIX1) molecularly defines the population of mesenchymal progenitors in the developing stomach. Using in vivo functional approaches in the chick embryo, we demonstrate that LIX1 is a key regulator of stomach SMC development. We show that LIX1 is required for stomach SMC determination to regulate the expression of the pro-proliferative gene YAP1 and mesenchymal cell proliferation. However, as stomach development proceeds, sustained LIX1 expression has a negative impact on further SMC differentiation and this is associated with a decrease in YAP1 activity. We demonstrate that expression of LIX1 must be tightly regulated to allow fine-tuning of the transcript levels and state of activation of the pro-proliferative transcriptional coactivator YAP1 to regulate proliferation rates of stomach mesenchymal progenitors and their differentiation. Our data highlight dual roles for LIX1 and YAP1 and provide new insights into the regulation of cell density-dependent proliferation, which is essential for the development and homeostasis of organs.

The first private-hospital based proton therapy center in Korea; Status of the proton therapy center at Samsung Medical Center

International Nuclear Information System (INIS)

Chung, Kwang Zoo; Han, Young Yih; Kim, Jin Sung

2015-01-01

The purpose of this report is to describe the proton therapy system at Samsung Medical Center (SMC-PTS) including the proton beam generator, irradiation system, patient positioning system, patient position verification system, respiratory gating system, and operating and safety control system, and review the current status of the SMC-PTS. The SMC-PTS has a cyclotron (230 MeV) and two treatment rooms: one treatment room is equipped with a multi-purpose nozzle and the other treatment room is equipped with a dedicated pencil beam scanning nozzle. The proton beam generator including the cyclotron and the energy selection system can lower the energy of protons down to 70 MeV from the maximum 230 MeV. The multi-purpose nozzle can deliver both wobbling proton beam and active scanning proton beam, and a multi-leaf collimator has been installed in the downstream of the nozzle. The dedicated scanning nozzle can deliver active scanning proton beam with a helium gas filled pipe minimizing unnecessary interactions with the air in the beam path. The equipment was provided by Sumitomo Heavy Industries Ltd., RayStation from RaySearch Laboratories AB is the selected treatment planning system, and data management will be handled by the MOSAIQ system from Elekta AB. The SMC-PTS located in Seoul, Korea, is scheduled to begin treating cancer patients in 2015

The first private-hospital based proton therapy center in Korea; status of the Proton Therapy Center at Samsung Medical Center.

Science.gov (United States)

Chung, Kwangzoo; Han, Youngyih; Kim, Jinsung; Ahn, Sung Hwan; Ju, Sang Gyu; Jung, Sang Hoon; Chung, Yoonsun; Cho, Sungkoo; Jo, Kwanghyun; Shin, Eun Hyuk; Hong, Chae-Seon; Shin, Jung Suk; Park, Seyjoon; Kim, Dae-Hyun; Kim, Hye Young; Lee, Boram; Shibagaki, Gantaro; Nonaka, Hideki; Sasai, Kenzo; Koyabu, Yukio; Choi, Changhoon; Huh, Seung Jae; Ahn, Yong Chan; Pyo, Hong Ryull; Lim, Do Hoon; Park, Hee Chul; Park, Won; Oh, Dong Ryul; Noh, Jae Myung; Yu, Jeong Il; Song, Sanghyuk; Lee, Ji Eun; Lee, Bomi; Choi, Doo Ho

2015-12-01

The purpose of this report is to describe the proton therapy system at Samsung Medical Center (SMC-PTS) including the proton beam generator, irradiation system, patient positioning system, patient position verification system, respiratory gating system, and operating and safety control system, and review the current status of the SMC-PTS. The SMC-PTS has a cyclotron (230 MeV) and two treatment rooms: one treatment room is equipped with a multi-purpose nozzle and the other treatment room is equipped with a dedicated pencil beam scanning nozzle. The proton beam generator including the cyclotron and the energy selection system can lower the energy of protons down to 70 MeV from the maximum 230 MeV. The multi-purpose nozzle can deliver both wobbling proton beam and active scanning proton beam, and a multi-leaf collimator has been installed in the downstream of the nozzle. The dedicated scanning nozzle can deliver active scanning proton beam with a helium gas filled pipe minimizing unnecessary interactions with the air in the beam path. The equipment was provided by Sumitomo Heavy Industries Ltd., RayStation from RaySearch Laboratories AB is the selected treatment planning system, and data management will be handled by the MOSAIQ system from Elekta AB. The SMC-PTS located in Seoul, Korea, is scheduled to begin treating cancer patients in 2015.

Slow and sustained nitric oxide releasing compounds inhibit multipotent vascular stem cell proliferation and differentiation without causing cell death

Energy Technology Data Exchange (ETDEWEB)

Curtis, Brandon M.; Leix, Kyle Alexander [Department of Chemistry, Central Michigan University, Mount Pleasant, MI 48859 (United States); Ji, Yajing [Department of Biomedical Science and Medicine, Michigan State University, East Lansing, MI 48824 (United States); Glaves, Richard Samuel Elliot [Department of Biology, Central Michigan University, Mount Pleasant, MI 48859 (United States); Ash, David E. [Department of Chemistry, Central Michigan University, Mount Pleasant, MI 48859 (United States); Mohanty, Dillip K., E-mail: Mohan1dk@cmich.edu [Department of Chemistry, Central Michigan University, Mount Pleasant, MI 48859 (United States)

2014-07-18

Highlights: • Multipotent vascular stem cells (MVSCs) proliferate and differentiate. • Nitric oxide inhibits proliferation of MVSCs. • Nitric oxide inhibits MVSC differentiation to mesenchymal-like stem cells (MSCs). • Smooth muscle cells (SMCs) neither de-differentiate nor proliferate. - Abstract: Atherosclerosis is the leading cause of cerebral and myocardial infarction. It is believed that neointimal growth common in the later stages of atherosclerosis is a result of vascular smooth muscle cell (SMC) de-differentiation in response to endothelial injury. However, the claims of the SMC de-differentiation theory have not been substantiated by monitoring the fate of mature SMCs in response to such injuries. A recent study suggests that atherosclerosis is a consequence of multipotent vascular stem cell (MVSC) differentiation. Nitric oxide (NO) is a well-known mediator against atherosclerosis, in part because of its inhibitory effect on SMC proliferation. Using three different NO-donors, we have investigated the effects of NO on MVSC proliferation. Results indicate that NO inhibits MVSC proliferation in a concentration dependent manner. A slow and sustained delivery of NO proved to inhibit proliferation without causing cell death. On the other hand, larger, single-burst NO concentrations, inhibits proliferation, with concurrent significant cell death. Furthermore, our results indicate that endogenously produced NO inhibits MVSC differentiation to mesenchymal-like stem cells (MSCs) and subsequently to SMC as well.

Synergy of EMG patterns in gait as an objective measure of muscle selectivity in children with spastic cerebral palsy.

Science.gov (United States)

Zwaan, Esther; Becher, Jules G; Harlaar, Jaap

2012-01-01

Selective motor control (SMC) is an important determinant of functioning in cerebral palsy (CP). Currently its assessment is based on subjective clinical tests with a low sensitivity. Electromyography (EMG) profiles during gait represent muscle coordination and might be used to assess SMC. EMG measurements during gait were processed into a measure of extensor synergy and thigh synergy. This was obtained in two groups of children with CP, and 30 typically developing children. Extensor synergy in CP was higher (0.95) than in healthy children (0.77), thigh synergy was almost equal in both groups. GMFM scores in the first group of 39 children with CP did not correlate to EMG based synergy measures. In a second group of 38 children with CP, a clear relation of clinical SMC score with extensor synergy was found, but only a weak relation with thigh synergy. Although an extensor synergy was validated at group level, our results present no convincing evidence for the use of EMG during gait to assess SMC in individual subjects with CP. Since gait involves both synergistic and selective contractions, the inherent motor control properties of this task will not allow for an assessment of selectivity comparable to the ability to perform isolated movements. Nevertheless, our results support the sensitive nature of EMG to represent an aberrant motor control in CP. Copyright © 2011 Elsevier B.V. All rights reserved.

Oxygenation decreases elastin secretion from rat ductus arteriosus smooth muscle cells.

Science.gov (United States)

Kawakami, Shoji; Minamisawa, Susumu

2015-08-01

The ductus arteriosus (DA), a fetal arterial connection between the main pulmonary artery and the descending aorta, normally closes immediately after birth. The oxygen concentration in the blood rises after birth, and in the DA this increase in oxygen concentration causes functional closure, which is induced by smooth muscle contraction. Previous studies have demonstrated that hypoxia and/or oxygenation affect vascular remodeling of various vessels. Therefore, we hypothesized that the rise in oxygen concentration would affect the vascular structure of the DA due to production of proteins secreted from DA smooth muscle cells (SMC). Liquid chromatography-tandem mass spectrometry was used to comprehensively investigate the secreted proteins in the supernatant of rat DA SMC harvested under hypoxic conditions (1% oxygen) or under normoxic conditions (21% oxygen). We found that the rise in oxygen concentration reduced the secretion of elastin from DA SMC. On reverse transcription-polymerase chain reaction, the expression of elastin mRNA was not significantly changed in DA SMC from hypoxic to normoxic conditions. Given that elastin forms internal elastic lamina and elastic fibers in the vascular muscle layers, and that a rise in oxygen concentration reduced the secretion of elastin, this suggests that the rise in blood oxygen concentration after birth reduces the secretion of elastin, and therefore may play a role in DA structural remodeling after birth. © 2015 Japan Pediatric Society.

Diverse cellular architecture of atherosclerotic plaque derives from clonal expansion of a few medial SMCs.

Science.gov (United States)

Jacobsen, Kevin; Lund, Marie Bek; Shim, Jeong; Gunnersen, Stine; Füchtbauer, Ernst-Martin; Kjolby, Mads; Carramolino, Laura; Bentzon, Jacob Fog

2017-10-05

Fibrous cap smooth muscle cells (SMCs) protect atherosclerotic lesions from rupturing and causing thrombosis, while other plaque SMCs may have detrimental roles in plaque development. To gain insight into recruitment of different plaque SMCs, we mapped their clonal architecture in aggregation chimeras of eGFP+Apoe-/- and Apoe-/- mouse embryos and in mice with a mosaic expression of fluorescent proteins in medial SMCs that were rendered atherosclerotic by PCSK9-induced hypercholesterolemia. Fibrous caps in aggregation chimeras were found constructed from large, endothelial-aligned layers of either eGFP+ or nonfluorescent SMCs, indicating substantial clonal expansion of a few cells. Similarly, plaques in mice with SMC-restricted Confetti expression showed oligoclonal SMC populations with little intermixing between the progeny of different medial SMCs. Phenotypes comprised both ACTA2+ SMCs in the cap and heterogeneous ACTA2- SMCs in the plaque interior, including chondrocyte-like cells and cells with intracellular lipid and crystalline material. Fibrous cap SMCs were invariably arranged in endothelium-aligned clonal sheets, confirming results in the aggregation chimeras. Analysis of the clonal structure showed that a low number of local medial SMCs partake in atherosclerosis and that single medial SMCs can produce several different SMC phenotypes in plaque. The combined results show that few medial SMCs proliferate to form the entire phenotypically heterogeneous plaque SMC population in murine atherosclerosis.

3D Bioprinting of Heterogeneous Aortic Valve Conduits with Alginate/Gelatin Hydrogels

Science.gov (United States)

Duan, Bin; Hockaday, Laura A.; Kang, Kevin H.; Butcher, Jonathan T.

2013-01-01

Heart valve disease is a serious and growing public health problem for which prosthetic replacement is most commonly indicated. Current prosthetic devices are inadequate for younger adults and growing children. Tissue engineered living aortic valve conduits have potential for remodeling, regeneration, and growth, but fabricating natural anatomical complexity with cellular heterogeneity remain challenging. In the current study, we implement 3D bioprinting to fabricate living alginate/gelatin hydrogel valve conduits with anatomical architecture and direct incorporation of dual cell types in a regionally constrained manner. Encapsulated aortic root sinus smooth muscle cells (SMC) and aortic valve leaflet interstitial cells (VIC) were viable within alginate/gelatin hydrogel discs over 7 days in culture. Acellular 3D printed hydrogels exhibited reduced modulus, ultimate strength, and peak strain reducing slightly over 7-day culture, while the tensile biomechanics of cell-laden hydrogels were maintained. Aortic valve conduits were successfully bioprinted with direct encapsulation of SMC in the valve root and VIC in the leaflets. Both cell types were viable (81.4±3.4% for SMC and 83.2±4.0% for VIC) within 3D printed tissues. Encapsulated SMC expressed elevated alpha-smooth muscle actin when printed in stiff matrix, while VIC expressed elevated vimentin in soft matrix. These results demonstrate that anatomically complex, heterogeneously encapsulated aortic valve hydrogel conduits can be fabricated with 3D bioprinting. PMID:23015540

ADAMTS9-Regulated Pericellular Matrix Dynamics Governs Focal Adhesion-Dependent Smooth Muscle Differentiation

Directory of Open Access Journals (Sweden)

Timothy J. Mead

2018-04-01

Full Text Available Summary: Focal adhesions anchor cells to extracellular matrix (ECM and direct assembly of a pre-stressed actin cytoskeleton. They act as a cellular sensor and regulator, linking ECM to the nucleus. Here, we identify proteolytic turnover of the anti-adhesive proteoglycan versican as a requirement for maintenance of smooth muscle cell (SMC focal adhesions. Using conditional deletion in mice, we show that ADAMTS9, a secreted metalloprotease, is required for myometrial activation during late gestation and for parturition. Through knockdown of ADAMTS9 in uterine SMC, and manipulation of pericellular versican via knockdown or proteolysis, we demonstrate that regulated pericellular matrix dynamics is essential for focal adhesion maintenance. By influencing focal adhesion formation, pericellular versican acts upstream of cytoskeletal assembly and SMC differentiation. Thus, pericellular versican proteolysis by ADAMTS9 balances pro- and anti-adhesive forces to maintain an SMC phenotype, providing a concrete example of the dynamic reciprocity of cells and their ECM. : Mead et al. identify a proteolytic mechanism that actively maintains a pericellular microenvironment conducive to uterine smooth muscle activation prior to parturition. They show that pericellular matrix proteolysis by the secreted metalloprotease ADAMTS9 is crucial for maintenance of focal adhesions in uterine smooth muscle cells, and its absence impairs parturition. Keywords: metalloprotease, extracellular matrix, smooth muscle, proteoglycan, myometrium, parturition, uterus, focal adhesion, proteolysis, interference reflection microscopy

Retinoid-induced expression and activity of an immediate early tumor suppressor gene in vascular smooth muscle cells.

Directory of Open Access Journals (Sweden)

Jeffrey W Streb

2011-04-01

Full Text Available Retinoids are used clinically to treat a number of hyper-proliferative disorders and have been shown in experimental animals to attenuate vascular occlusive diseases, presumably through nuclear receptors bound to retinoic acid response elements (RARE located in target genes. Here, we show that natural or synthetic retinoids rapidly induce mRNA and protein expression of a specific isoform of A-Kinase Anchoring Protein 12 (AKAP12β in cultured smooth muscle cells (SMC as well as the intact vessel wall. Expression kinetics and actinomycin D studies indicate Akap12β is a retinoid-induced, immediate-early gene. Akap12β promoter analyses reveal a conserved RARE mildly induced with atRA in a region that exhibits hyper-acetylation. Immunofluorescence microscopy and protein kinase A (PKA regulatory subunit overlay assays in SMC suggest a physical association between AKAP12β and PKA following retinoid treatment. Consistent with its designation as a tumor suppressor, inducible expression of AKAP12β attenuates SMC growth in vitro. Further, immunohistochemistry studies establish marked decreases in AKAP12 expression in experimentally-injured vessels of mice as well as atheromatous lesions in humans. Collectively, these results demonstrate a novel role for retinoids in the induction of an AKAP tumor suppressor that blocks vascular SMC growth thus providing new molecular insight into how retiniods may exert their anti-proliferative effects in the injured vessel wall.

A vehicle stability control strategy with adaptive neural network sliding mode theory based on system uncertainty approximation

Science.gov (United States)

Ji, Xuewu; He, Xiangkun; Lv, Chen; Liu, Yahui; Wu, Jian

2018-06-01

Modelling uncertainty, parameter variation and unknown external disturbance are the major concerns in the development of an advanced controller for vehicle stability at the limits of handling. Sliding mode control (SMC) method has proved to be robust against parameter variation and unknown external disturbance with satisfactory tracking performance. But modelling uncertainty, such as errors caused in model simplification, is inevitable in model-based controller design, resulting in lowered control quality. The adaptive radial basis function network (ARBFN) can effectively improve the control performance against large system uncertainty by learning to approximate arbitrary nonlinear functions and ensure the global asymptotic stability of the closed-loop system. In this paper, a novel vehicle dynamics stability control strategy is proposed using the adaptive radial basis function network sliding mode control (ARBFN-SMC) to learn system uncertainty and eliminate its adverse effects. This strategy adopts a hierarchical control structure which consists of reference model layer, yaw moment control layer, braking torque allocation layer and executive layer. Co-simulation using MATLAB/Simulink and AMESim is conducted on a verified 15-DOF nonlinear vehicle system model with the integrated-electro-hydraulic brake system (I-EHB) actuator in a Sine With Dwell manoeuvre. The simulation results show that ARBFN-SMC scheme exhibits superior stability and tracking performance in different running conditions compared with SMC scheme.

Adaptive self-management of teams of autonomous vehicles

OpenAIRE

Sloman, M; Asmare, E; Gopalan, A; Lupu, E; Dulay, N

2008-01-01

Unmanned Autonomous Vehicles (UAVs) are increasingly deployed for missions that are deemed dangerous or impractical to perform by humans in many military and disaster scenarios. Collaborating UAVs in a team form a Self- Managed Cell (SMC) with at least one commander. UAVs in an SMC may need to operate independently or in sub- groups, out of contact with the commander and the rest of the team in order to perform specific tasks, but must still be able to eventually synchronise state information...

Hardware Implementation of Lorenz Circuit Systems for Secure Chaotic Communication Applications

Directory of Open Access Journals (Sweden)

Yi-You Hou

2013-02-01

Full Text Available This paper presents the synchronization between the master and slave Lorenz chaotic systems by slide mode controller (SMC-based technique. A proportional-integral (PI switching surface is proposed to simplify the task of assigning the performance of the closed-loop error system in sliding mode. Then, extending the concept of equivalent control and using some basic electronic components, a secure communication system is constructed. Experimental results show the feasibility of synchronizing two Lorenz circuits via the proposed SMC.

Robust Sliding Mode Control of Air Handling Unit for Energy Efficiency Enhancement

Directory of Open Access Journals (Sweden)

Awais Shah

2017-11-01

Full Text Available In order to achieve feasible and copacetic low energy consuming building, a robust and efficient air conditioning system is necessary. Since heating ventilation and air conditioning systems are nonlinear and temperature and humidity are coupled, application of conventional control is inappropriate. A multi-input multi-output nonlinear model is presented. The temperature and humidity of thermal zone are ascendance by the manipulation of the water and air flow rates. A sliding mode controller (SMC is designed to ensure robust performance of air handling unit in the presence of uncertainties. A simple proportional-integral-derivative (PID controller is used as a comparison template to highlight the efficiency of the proposed controller. To accomplish tracking targets, a variety of desired temperature and relative humidity commands (including ramp and combination with sequence of steps are investigated. According to simulation results, SMC transcends the PID controller in terms of settling time, steady state and rise time, which makes SMC more energy efficient.

Walnut and almond oil screw-press extraction at industrial scale: Effects of process parameters on oil yield and quality

Directory of Open Access Journals (Sweden)

M. L. Martínez

2018-01-01

Full Text Available Walnut and almond kernels are highly nutritious mainly due to their high oil contents. In this study, 32 factorial experimental designs were used to optimize processes for oil extraction by screw-pressing at industrial scale. Experimental designs included seed moisture content (SMC, and restriction die (RD as the main processing parameters. Theoretical models were scanned against experimental data in order to optimize oil extraction conditions. The response variables analyzed were oil yield (OY, fine solid content (FC in oil, and oil quality parameters. Fitted models for OY indicated maximum predicted values similar to the highest experimental values. Walnut oil extractions showed a maximum OY (84.5 ± 2.3 % at 7.21% SMC, and 10 mm RD. For almond kernels, maximum OY (71.9 ± 3.5% was obtained at 9.42% SMC, and 12 mm RD. Chemical quality parameters from both oils were in the ranges stated in Codex (FAO/WHO standards for virgin (non-refined oils.

Is there a yet unreported unbalanced chromosomal abnormality without phenotypic consequences in proximal 4p?

Science.gov (United States)

Liehr, T; Bartels, I; Zoll, B; Ewers, E; Mrasek, K; Kosyakova, N; Merkas, M; Hamid, A B; von Eggeling, F; Posorski, N; Weise, A

2011-01-01

Unbalanced chromosomal abnormalities (UBCA) are reported for >50 euchromatic regions of almost all human autosomes. UBCA are comprised of a few megabases of DNA, and carriers are in many cases clinically healthy. Here we report on a partial trisomy of chromosome 4 of the centromere-near region of the short arm of chromosome 4 present as a small supernumerary marker chromosome (sSMC). The sSMC was present in >70% of amnion cells and in 60% of placenta. Further delineation of the size of the duplicated region was done by molecular cytogenetics and array comparative genomic hybridization. Even though the sSMC lead to a partial trisomy of ~9 megabase pairs, a healthy child was born, developing normally at 1 year of age. No comparable cases are available in the literature. Thus, we discuss here the possibility of having found a yet unrecognized chromosomal region subject to UBCA. Copyright © 2010 S. Karger AG, Basel.

Changes in physical, chemical, and microbiological properties during the two-stage co-composting of green waste with spent mushroom compost and biochar.

Science.gov (United States)

Zhang, Lu; Sun, Xiangyang

2014-11-01

This research determined whether the two-stage co-composting can be used to convert green waste (GW) into a useful compost. The GW was co-composted with spent mushroom compost (SMC) (at 0%, 35%, and 55%) and biochar (BC) (at 0%, 20%, and 30%). The combined addition of SMC and BC greatly increased the nutrient contents of the compost product and also improved the compost quality in terms of composting temperature, particle-size distribution, free air space, cation exchange capacity, nitrogen transformation, organic matter degradation, humification, element contents, abundance of aerobic heterotrophs, dehydrogenase activity, and toxicity to germinating seeds. The addition of 35% SMC and 20% BC to GW (dry weight % of initial GW) and the two-stage co-composting technology resulted in the production of the highest quality compost product in only 24 days rather than the 90-270 days required with traditional composting. Copyright © 2014 Elsevier Ltd. All rights reserved.

Walnut and almond oil screw-press extraction at industrial scale: Effects of process parameters on oil yield and quality

International Nuclear Information System (INIS)

Martínez, M. L.; Bordón, M.G.; Bodoira, R. M.; Penci, M.C.; Ribotta, P.D.; Maestri, D.M.

2017-01-01

Walnut and almond kernels are highly nutritious mainly due to their high oil contents. In this study, 32 factorial experimental designs were used to optimize processes for oil extraction by screw-pressing at industrial scale. Experimental designs included seed moisture content (SMC), and restriction die (RD) as the main processing parameters. Theoretical models were scanned against experimental data in order to optimize oil extraction conditions. The response variables analyzed were oil yield (OY), fine solid content (FC) in oil, and oil quality parameters. Fitted models for OY indicated maximum predicted values similar to the highest experimental values. Walnut oil extractions showed a maximum OY (84.5 ± 2.3 %) at 7.21% SMC, and 10 mm RD. For almond kernels, maximum OY (71.9 ± 3.5%) was obtained at 9.42% SMC, and 12 mm RD. Chemical quality parameters from both oils were in the ranges stated in Codex (FAO/WHO) standards for virgin (non-refined) oils. [es

Anomalous temperature dependence of layer spacing of de Vries liquid crystals: Compensation model

Energy Technology Data Exchange (ETDEWEB)

Merkel, K. [Central Mining Institute, Katowice 40-166 (Poland); Kocot, A. [Institute of Physics, Silesian University, Katowice 40-007 (Poland); Vij, J. K., E-mail: jvij@tcd.ie [Department of Electronic and Electrical Engineering, Trinity College, The University of Dublin, Dublin 2 (Ireland); Stevenson, P. J.; Panov, A.; Rodriguez, D. [School of Chemistry and Chemical Engineering, Queens University Belfast, Belfast BT7 1NN, Northern Ireland (United Kingdom)

2016-06-13

Smectic liquid crystals that exhibit temperature independent layer thickness offer technological advantages for their use in displays and photonic devices. The dependence of the layer spacing in SmA and SmC phases of de Vries liquid crystals is found to exhibit distinct features. On entering the SmC phase, the layer thickness initially decreases below SmA to SmC (T{sub A–C}) transition temperature but increases anomalously with reducing temperature despite the molecular tilt increasing. This anomalous observation is being explained quantitatively. Results of IR spectroscopy show that layer shrinkage is caused by tilt of the mesogen's rigid core, whereas the expansion is caused by the chains getting more ordered with reducing temperature. This mutual compensation arising from molecular fragments contributing to the layer thickness differs from the previous models. The orientational order parameter of the rigid core of the mesogen provides direct evidence for de Vries cone model in the SmA phase for the two compounds investigated.

Promotion of biogas plant application in the Mekong Delta of Vietnam

Energy Technology Data Exchange (ETDEWEB)

Nguyen, Vo Chau Ngan

2012-06-11

for locally available materials to be used as additional inputs to pig manure (PM) in biogas plants, water hyacinth (WH) and spent mushroom compost (SMC) were chosen due to their potentials and availability. The testing results showed that codigestion of PM with either WH or SMC maintained the quality and quantity of produced biogas very well. The batch experiments of the PM+WH co-digestion indicated that the more percentage of WH containing in the feeding rate, the more biogas will be produced. The produced biogas was not significantly different between the treatment of 100%PM+0%SMC, of 75%PM+25%SMC, of 50%PM+50%SMC, and of 25%PM+75%SMC. In both of the cases, the produced biogas was in good quality with methane content reaching up to 60%. More significantly, the semi-continuous treatment of 75%PM+25%WH and of 75%PM+25%SMC were in good operation during a 90 consecutive day period without a blockage of the substrate even though the substrate was not agitated. In addition to the high potentials of WH and SMC as the additional materials, the bioslurries from the co-digesters had a positive response to cultivation and aquaculture. In the tests on the growth of leaf mustard fertilized separately with the bio-slurries from the different kinds of co-digestion plants (the plant fed solely with PM, with PM+WH, and with PM+SMC) and inorganic fertilizer (IF), the weight of the plant was not significantly different in the treatment of IF, of PM, and of PM+WH. The weight of the mustard fed with the bio-slurry from the PM+SMC co-digester was bigger than the others. By application of the bio-slurries into the fishpond, the growing weight of the fish was not significantly different from the treatment of PM, of PM+WH, and of PM+SMC. In the study, a new HDPE digester was developed and worked considerably well in the treatment of pig manure at the farming household. The testing results showed that this HDPE digester can make a relatively efficient treatment and produce biogas with

Technetium-99m labeled antisense probes uptake in vascular smooth muscle cells

International Nuclear Information System (INIS)

Zhang, Y.X.; Qin, G.M.; An, R.; Cao, G.X.; Cao, W.; Gao, Z.R.

2002-01-01

In the arterial wall, smooth muscle cells (SMC) normally exist in a quiescent, differentiated state, representing the contractile phenotype. During the development of atherosclerosis SMC change towards the synthetic phenotype going along with proliferation, chemotactic response and increased monocyte binding. The Fas/Fas ligand/caspase death-signaling pathway, Bcl-2 protein family/mitochondria, the tumor suppressive gene p53, and the proto-oncogene c-myc may be activated in atherosclerotic lesions, and mediates vascular apoptosis during the development of atherosclerosis. The atherosclerotic plaques contained 3-4 fold more c-myc mRNA than those in the normal aortic arteries, while increased Bax and Bak coupled with lack/paucity of Bcl-2 and Bcl-xL are associated with SMC apoptosis in advanced lesions. Methods: 1 Oligonucleotide Conjugation: A solution of single stranded amine-derivatized DNA (100-1000μg) was prepared at a concentration of 2 mg/ml in 0.25M sodium bicarbonate, 1 M sodium chloride, 1mM EDTA, pH8.5. Cell uptake studies: 99m Tc- MAG 3 -DNA radioactivity incorporation into porcine coronary smooth muscle cells in the log and plateau phases, respectively, was determined after different times of incubation at 37. The influence of extracellular 99m Tc- MAG 3 -DNA concentration on SMC uptake was also analyzed. [Results] Essentially complete conjugation was achieved by reverse-phase Sep-Pak C18 chromatography analysis. The MAG 3 -DNA was labeled with 99m Tc at room temperature and neutral pH, with a mean labeling efficiency of 80.11%(s.d=2.96%,n=4). The labeled antisense DNA still remained the ability to hybridize with its complementary DNA. After labeling, the stability of the DNA in saline or serum was retained as determined by reverse-phase Sep-Pak C18 chromatography analysis, except a shift at 30 min in serum incubation that suggesting a short time serum protein binding. 99m Tc-MAG 3 -c-myc uptake plateaued at 60 min and was directly proportional to the

Spectroscopic studies of Wolf-Rayet stars. V - Optical spectrophotometry of the emission lines in Small Magellanic Cloud stars

International Nuclear Information System (INIS)

Conti, P.S.; Garmany, C.D.; Massey, P.

1989-01-01

Spectrophotometry of the strongest emission-line features for the eight known WR stars in the SMC is presented. Seven are relatively early WN types; and one is a WO. These are compared to stars of similar spectral types in the Galaxy and the LMC. The hydrogen-burning CNO cycle equilibrium nitrogen abundance with respect to helium appears to be similar to that in WN stars of the Galaxy and LMC even though the SMC objects presumably began their lives with appreciably smaller CNO content. 28 refs

Polycystic ovarian disease: endocrinological parameters with specific reference to growth hormone and somatomedin-C.

Science.gov (United States)

Urdl, W

1988-01-01

Thirty-three women (22-38 years old) with polycystic ovarian disease (PCOD) were included in this study. The criteria for diagnosis were: an LH/FSH ratio greater than 2.0; polycystic ovaries, diagnosed by means of palpation and ultrasound; androgenism and menstrual cycle abnormalities. Using endocrine parameters, we attempted to define distinct forms of PCOD. The patients were placed in three groups according to serum levels of testosterone (T) and 17 alpha-hydroxyprogesterone (17 alpha OHP) and the estrone/androstendione (E1/delta 4A) ratio. Patients in group I (n = 18) had an elevated T level (greater than 1.0 ng/ml) and a 17 alpha OHP level under 4.0 ng/ml. This type of POCD was called the "androgen" type. Patients in group II (n = 7) had normal T- and 17 alpha OHP levels under 4.0 ng/ml and an elevated (E1/delta 4A) ratio. This type of PCOD was called the "estrogen" type. Group III (n = 8) comprised patients with 17 alpha OHP levels over 4.0 ng/ml. This type of PCOD was called the "adrenocortical" type. In two patients of this group, a modified ACTH test revealed late-onset congenital hyperplasia. The endocrine parameters of the patients with PCOD were compared with those of 17 adult without signs of PCOD. Statistical evaluation was done by variance analysis. Women with acromegaly often show signs of androgenism as well as menstrual cycle abnormalities. This may indicate an association between the growth factors human growth hormone (HGH) and somatomedin-C (Sm-C) and the biosynthese and metabolism of steroid hormone. Recent experiments have demonstrated such associations. Our study showed an association between the HGH and Sm-C levels and abnormal steroid hormone concentrations in women with androgen type PCOD (group I). These patients had a significantly decreased HGH level, a significantly decreased HGH/Sm-C ratio, and an increased average Sm-C level. These data suggest that elevated Sm-C levels can, by a negative-feedback mechanism, inhibit pituitary HGH

The VMC survey. XXX. Stellar proper motions in the central parts of the Small Magellanic Cloud

Science.gov (United States)

Niederhofer, F.; Cioni, M.-R. L.; Rubele, S.; Schmidt, T.; Bekki, K.; Grijs, R. de; Emerson, J.; Ivanov, V. D.; Marconi, M.; Oliveira, J. M.; Petr-Gotzens, M. G.; Ripepi, V.; van Loon, J. Th.; Zaggia, S.

2018-05-01

We present the first spatially resolved map of stellar proper motions within the central ( 3.1 × 2.4 kpc) regions of the Small Magellanic Cloud (SMC). The data used for this study encompasses four tiles from the ongoing near-infrared VISTA survey of the Magellanic Clouds system and covers a total contiguous area on the sky of 6.81 deg2. Proper motions have been calculated independently in two dimensions from the spatial offsets in the Ks filter over time baselines between 22 and 27 months. The reflex motions of approximately 33 000 background galaxies are used to calibrate the stellar motions to an absolute scale. The resulting catalog is composed of more than 690 000 stars which have been selected based on their position in the (J - Ks, Ks) color-magnitude diagram. For the median absolute proper motion of the SMC, we find (μαcos(δ), μδ) = (1.087 ± 0.192 (sys.) ± 0.003 (stat.), -1.187 ± 0.008 (sys.) ± 0.003 (stat.)) mas yr-1, consistent with previous studies. Mapping the proper motions as a function of position within the SMC reveals a nonuniform velocity pattern indicative of a tidal feature behind the main body of the SMC and a flow of stars in the south-east moving predominantly along the line-of-sight. Based on observations made with VISTA at the Paranal Observatory under program ID 179.B-2003.

New Soft Magnetic Composites for electromagnetic applications with improved mechanical properties

Science.gov (United States)

Ferraris, Luca; Pošković, Emir; Franchini, Fausto

2016-05-01

The chance to move from 2D to 3D approach in the design of the electrical machines is made possible by the availability of Soft Magnetic Composites (SMC), iron based powders, insulated and pressed to realize shapes otherwise impossible with the traditional lamination sheets technology. Some commercial products are available on the market as "ready to press" powders, which presents good magnetic and energetic properties but are sometimes weak under the mechanical point of view; other products aim at improving this aspect but with considerable process complications and relative cost. The experience of the Authors in the realization of bonded magnets with the adoption of selected organic resins has been partly transferred in the research field of the SMC in order to investigate the possibility to obtain good mechanical properties maintaining the magnetic characteristics of the Insulated Iron Powder Compounds (I.I.P.C.) taken as reference. The paper presents the activity that has been carried out in the realization of SMC mixing iron powders and phenolic resin, in different weight percentages and mold pressures. The obtained results are considered satisfactory under the point of view of the compromise between magnetic and mechanical properties, considering also that the required productive process is simpler. The comparison of the obtained results with those related to commercial products encourages to carry on the research, also because of the reduced cost of the proposed SMC at parity (or better) performance.

A new maximum power point method based on a sliding mode approach for solar energy harvesting

International Nuclear Information System (INIS)

Farhat, Maissa; Barambones, Oscar; Sbita, Lassaad

2017-01-01

Highlights: • Create a simple, easy of implement and accurate V_M_P_P estimator. • Stability analysis of the proposed system based on the Lyapunov’s theory. • A comparative study versus P&O, highlight SMC good performances. • Construct a new PS-SMC algorithm to include the partial shadow case. • Experimental validation of the SMC MPP tracker. - Abstract: This paper presents a photovoltaic (PV) system with a maximum power point tracking (MPPT) facility. The goal of this work is to maximize power extraction from the photovoltaic generator (PVG). This goal is achieved using a sliding mode controller (SMC) that drives a boost converter connected between the PVG and the load. The system is modeled and tested under MATLAB/SIMULINK environment. In simulation, the sliding mode controller offers fast and accurate convergence to the maximum power operating point that outperforms the well-known perturbation and observation method (P&O). The sliding mode controller performance is evaluated during steady-state, against load varying and panel partial shadow (PS) disturbances. To confirm the above conclusion, a practical implementation of the maximum power point tracker based sliding mode controller on a hardware setup is performed on a dSPACE real time digital control platform. The data acquisition and the control system are conducted all around dSPACE 1104 controller board and its RTI environment. The experimental results demonstrate the validity of the proposed control scheme over a stand-alone real photovoltaic system.

Effect of Oxysterol-Induced Apoptosis of Vascular Smooth Muscle Cells on Experimental Hypercholesterolemia

Science.gov (United States)

Perales, Sonia; Alejandre, M. José; Palomino-Morales, Rogelio; Torres, Carolina; Iglesias, Jose; Linares, Ana

2009-01-01

Smooth muscle cells (SMCs) undergo changes related to proliferation and apoptosis in the physiological remodeling of vessels and in diseases such as atherosclerosis and restenosis. Recent studies also have demonstrated the vascular cell proliferation and programmed cell death contribute to changes in vascular architecture in normal development and in disease. The present study was designed to investigate the apoptotic pathways induced by 25-hydroxycholesterol in SMCs cultures, using an in vivo/in vitro cell model in which SMCs were isolated and culture from chicken exposed to an atherogenic cholesterol-rich diet (SMC-Ch) and/or an antiatherogenic fish oil-rich diet (SMC-Ch-FO). Cells were exposed in vitro to 25-hydroxycholesterol to study levels of apoptosis and apoptotic proteins Bcl-2, Bcl-XL and Bax and the expression of bcl-2 and bcl-xL, genes. The quantitative real-time reverse transcriptase-polymerase chain reaction and the Immunoblotting western blot analysis showed that 25-hydroxycholesterol produces apoptosis in SMCs, mediated by a high increase in Bax protein and Bax gene expression. These changes were more marked in SMC-Ch than in SMC-Ch-FO, indicating that dietary cholesterol produces changes in SMCs that make them more susceptible to 25-hydroxycholesterol-mediated apoptosis. Our results suggest that the replacement of a cholesterol-rich diet with a fish oil-rich diet produces some reversal of cholesterol-induced changes in the apoptotic pathways induced by 25-hydroxycholesterol in SMCs cultures, making SMCs more resistant to apoptosis. PMID:19727411

Effect of Oxysterol-Induced Apoptosis of Vascular Smooth Muscle Cells on Experimental Hypercholesterolemia

Directory of Open Access Journals (Sweden)

Sonia Perales

2009-01-01

Full Text Available Smooth muscle cells (SMCs undergo changes related to proliferation and apoptosis in the physiological remodeling of vessels and in diseases such as atherosclerosis and restenosis. Recent studies also have demonstrated the vascular cell proliferation and programmed cell death contribute to changes in vascular architecture in normal development and in disease. The present study was designed to investigate the apoptotic pathways induced by 25-hydroxycholesterol in SMCs cultures, using an in vivo/in vitro cell model in which SMCs were isolated and culture from chicken exposed to an atherogenic cholesterol-rich diet (SMC-Ch and/or an antiatherogenic fish oil-rich diet (SMC-Ch-FO. Cells were exposed in vitro to 25-hydroxycholesterol to study levels of apoptosis and apoptotic proteins Bcl-2, Bcl-XL and Bax and the expression of bcl-2 and bcl-xL, genes. The quantitative real-time reverse transcriptase-polymerase chain reaction and the Immunoblotting western blot analysis showed that 25-hydroxycholesterol produces apoptosis in SMCs, mediated by a high increase in Bax protein and Bax gene expression. These changes were more marked in SMC-Ch than in SMC-Ch-FO, indicating that dietary cholesterol produces changes in SMCs that make them more susceptible to 25-hydroxycholesterol-mediated apoptosis. Our results suggest that the replacement of a cholesterol-rich diet with a fish oil-rich diet produces some reversal of cholesterol-induced changes in the apoptotic pathways induced by 25-hydroxycholesterol in SMCs cultures, making SMCs more resistant to apoptosis.

TNF-α activates death pathway in human aorta smooth muscle cell in the presence of 7-ketocholesterol

International Nuclear Information System (INIS)

Lee, Hyun Sun; Chang, Jong Sun; Baek, Jin Ah; Chung, Mi Yeon; Lee, Han Cheol; Rhim, Byung Yong; Sok, Dai Eun; Rho, Mun-Chual; Kim, Young Kook; Kim, Koanhoi

2005-01-01

This study was undertaken to investigate whether a physiologically compatible concentration of 7-ketocholesterol had any effect on human vascular smooth muscle cells (HVSMCs). We found that 7-ketocholesterol changed the viability of human aorta smooth muscle cells (HAoSMC) not by cytotoxicity but by activation of tumor necrosis factor-α receptor (TNFR)-mediated death. Whereas TNF-α did not affect the viability in the presence of 7α-hydroxycholesterol or cholesterol, the cytokine induced HAoSMC death in the presence of 7-ketocholesterol as detected by morphology, viability, and fragmentation of chromosomal DNA. The HAoSMC death was inhibited by a neutralizing anti-TNF receptor 1 (TNFR1) antibody and by the caspase inhibitors of z-VAD and z-DEVD. Activations of caspase-8 and -3 were detected from dying HAoSMCs. 7-Ketocholesterol inhibited translocation of the nuclear factor κB (NF-κB) subunits of p65 and p50 from the cytosol into the nucleus, increase of NF-κB activity, and expression of caspase-8 homolog Fas ligand interleukin-1-converting enzyme inhibitory protein by TNF-α. We also found that X-chromosome-linked inhibitor of apoptosis protein was degraded in dying HAoSMC. The present study proposes that 7-ketocholesterol would contribute to the disappearance of HVSMC in the atherosclerotic lesions by enhancing receptor-mediated death. This is the first report demonstrating induction of TNF-α-mediated death by oxysterol in cells

Telomerase Inhibition by Everolimus Suppresses Smooth Muscle Cell Proliferation and Neointima Formation Through Epigenetic Gene Silencing

Directory of Open Access Journals (Sweden)

Jun Aono, MD, PhD

2016-01-01

Full Text Available Proliferation of smooth muscle cells (SMCs during neointima formation is prevented by drug-eluting stents. The replicative capacity of mammalian cells is enhanced by telomerase expression; however, the contribution of telomerase to the proliferative response underlying neointima formation and its potential role as a pharmacological target are unknown. The present study investigated the mechanisms underlying the mitogenic function of telomerase, and tested the hypothesis that everolimus, which is commonly used on drug-eluting stents, suppresses SMC proliferation by targeting telomerase. Inhibition of neointima formation by everolimus was lost in mice overexpressing telomerase reverse transcriptase (TERT, indicating that repression of telomerase confers the anti-proliferative efficacy of everolimus. Everolimus reduced TERT expression in SMC through an Ets-1-dependent inhibition of promoter activation. The inhibition of TERT-dependent SMC proliferation by everolimus occurred in the absence of telomere shortening but rather as a result of a G1→S-phase arrest. Although everolimus failed to inhibit phosphorylation of the retinoblastoma protein as the gatekeeper of S-phase entry, it potently repressed downstream target genes. Chromatin immunoprecipitation assays demonstrated that TERT induced E2F binding to S-phase gene promoters and supported histone acetylation. These effects were sensitive to inhibition by everolimus. These results characterize telomerase as a previously unrecognized target for the antiproliferative activity of everolimus, and further identify a novel mitogenic pathway in SMC that depends on the epigenetic activation of S-phase gene promoters by TERT.

Monitor-Based Statistical Model Checking for Weighted Metric Temporal Logic

DEFF Research Database (Denmark)

Bulychev, Petr; David, Alexandre; Larsen, Kim Guldstrand

2012-01-01

We present a novel approach and implementation for ana- lysing weighted timed automata (WTA) with respect to the weighted metric temporal logic (WMTL≤ ). Based on a stochastic semantics of WTAs, we apply statistical model checking (SMC) to estimate and test probabilities of satisfaction with desi......We present a novel approach and implementation for ana- lysing weighted timed automata (WTA) with respect to the weighted metric temporal logic (WMTL≤ ). Based on a stochastic semantics of WTAs, we apply statistical model checking (SMC) to estimate and test probabilities of satisfaction...

STAG2 and Rad21 mammalian mitotic cohesins are implicated in meiosis

OpenAIRE

Prieto, Ignacio; Pezzi, Nieves; Buesa, José M.; Kremer, Leonor; Barthelemy, Isabel; Carreiro, Candelas; Roncal, Fernando; Martínez, Alicia; Gómez, Lucio; Fernández, Raúl; Martínez-A, Carlos; Barbero, José L.

2002-01-01

STAG/SA proteins are specific cohesin complex subunits that maintain sister chromatid cohesion in mitosis and meiosis. Two members of this family, STAG1/SA1 and STAG2/SA2,‡ are classified as mitotic cohesins, as they are found in human somatic cells and in Xenopus laevis as components of the cohesinSA1 and cohesinSA2 complexes, in which the shared subunits are Rad21/SCC1, SMC1 and SMC3 proteins. A recently reported third family member, STAG3, is germinal cell-specific and is a subunit of the ...

Analytical Performance Verification of FCS-MPC Applied to Power Electronic Converters

DEFF Research Database (Denmark)

Novak, Mateja; Dragicevic, Tomislav; Blaabjerg, Frede

2017-01-01

Since the introduction of finite control set model predictive control (FCS-MPC) in power electronics the algorithm has been missing an important aspect that would speed up its implementation in industry: a simple method to verify the algorithm performance. This paper proposes to use a statistical...... model checking (SMC) method for performance evaluation of the algorithm applied to power electronics converters. SMC is simple to implement, intuitive and it requires only an operational model of the system that can be simulated and checked against properties. Device under test for control algorithm...

New 20-cm radio-continuum study of the small Magellanic cloud - part III: Compact Hii regions

Directory of Open Access Journals (Sweden)

Wong G.F.

2012-01-01

Full Text Available We present and discuss a new catalogue of 48 compact Hii regions in the Small Magellanic Cloud (SMC and a newly created deep 1420 MHz (λ=20 cm radio-continuum image of the N19 region located in the southwestern part of the SMC. The new images were created by merging 1420 MHz radiocontinuum archival data from the Australian Telescope Compact Array. The majority of these detected radio compact Hii regions have rather flat spectral indices which indicates, as expected, that the dominant emission mechanism is of thermal nature.

Monitoring antifolate resistance in intermittent preventive therapy for malaria

DEFF Research Database (Denmark)

Venkatesan, Meera; Alifrangis, Michael; Roper, Cally

2013-01-01

Mutations in the Plasmodium falciparum genes Pfdhfr and Pfdhps have rendered sulfadoxine-pyrimethamine (SP) ineffective for malaria treatment in most regions of the world. Yet, SP is efficacious as intermittent preventive therapy in pregnant women (IPTp) and infants (IPTi) and as seasonal malaria...... control in children (SMC). SP-IPTp is being widely implemented in sub-Saharan Africa. SP-IPTi is recommended where the prevalence of SP-resistant malaria parasites is low, whereas SMC is recommended for areas of intense seasonal malaria transmission. The continuing success of these interventions depends...

Growth failure, somatomedin and growth hormone levels in juvenile diabetes mellitus--a pilot study.

Science.gov (United States)

Nash, H

1979-06-01

Growth hormone (hGH) responsiveness to exercise and somatomedin C (SmC) activity were measured in ten children with insulin-deficient diabetes mellitus. Four of the ten children showed a significant degree of growth retardation. Normal SmC activity was found in association with elevated hGH levels. The hypothesis that growth-retarded diabetics have a failure of Sm production despite high hGH levels (analogous to malnutrition and Laron dwarfism) was not substantiated by this study. Chronic deficiency of insulin, itself a somatomedin, may play a major role in diabetic growth failure.

Scalability Dilemma and Statistic Multiplexed Computing — A Theory and Experiment

Directory of Open Access Journals (Sweden)

Justin Yuan Shi

2017-08-01

Full Text Available The For the last three decades, end-to-end computing paradigms, such as MPI (Message Passing Interface, RPC (Remote Procedure Call and RMI (Remote Method Invocation, have been the de facto paradigms for distributed and parallel programming. Despite of the successes, applications built using these paradigms suffer due to the proportionality factor of crash in the application with its size. Checkpoint/restore and backup/recovery are the only means to save otherwise lost critical information. The scalability dilemma is such a practical challenge that the probability of the data losses increases as the application scales in size. The theoretical significance of this practical challenge is that it undermines the fundamental structure of the scientific discovery process and mission critical services in production today. In 1997, the direct use of end-to-end reference model in distributed programming was recognized as a fallacy. The scalability dilemma was predicted. However, this voice was overrun by the passage of time. Today, the rapidly growing digitized data demands solving the increasingly critical scalability challenges. Computing architecture scalability, although loosely defined, is now the front and center of large-scale computing efforts. Constrained only by the economic law of diminishing returns, this paper proposes a narrow definition of a Scalable Computing Service (SCS. Three scalability tests are also proposed in order to distinguish service architecture flaws from poor application programming. Scalable data intensive service requires additional treatments. Thus, the data storage is assumed reliable in this paper. A single-sided Statistic Multiplexed Computing (SMC paradigm is proposed. A UVR (Unidirectional Virtual Ring SMC architecture is examined under SCS tests. SMC was designed to circumvent the well-known impossibility of end-to-end paradigms. It relies on the proven statistic multiplexing principle to deliver reliable service

Fast voxel-level dosimetry for 177Lu labelled peptide treatments

International Nuclear Information System (INIS)

Hippeläinen, E; Tenhunen, M; Sohlberg, A

2015-01-01

In peptide receptor radionuclide therapy (PRRT), voxel-level radiation absorbed dose calculations can be performed using several different methods. Each method has it strengths and weaknesses; however, Monte Carlo (MC) simulation is presently considered the most accurate method at providing absorbed dose distributions. Unfortunately MC simulation is time-consuming and often impractical to carry out in a clinical practice. In this work, a fast semi-Monte Carlo (sMC) absorbed dose calculation method for 177 Lu PRRT dosimetry is presented. The sMC method is based on a local electron absorption assumption and fast photon MC simulations. The sMC method is compared against full MC simulation code built on PENELOPE (vxlPen) using digital phantoms to assess the accuracy of these assumptions.Due to the local electron absorption assumption of sMC, the potential errors in cross-fire dose from electrons and photons emitted by 177 Lu were first evaluated using an ellipsoidal kidney model by comparing vxlPen and sMC. The photon cross-fire dose from background to kidney and kidney to background with varying kidney-to-background activity concentration ratios were calculated. In addition, kidney to kidney photon and electron cross-dose with different kidney to kidney distances were studied. Second, extended cardiac-torso (XCAT) phantoms were created with liver lesions and with realistic activity distributions and tissue densities. The XCAT phantoms were used to simulate SPECT projections and 3D activity distribution images were reconstructed using an OSEM algorithm. Image-based dose rate distributions were calculated using vxlPen and sMC. Total doses and dose rate volume histograms (DrVH) produced by the two methods were compared.The photon cross-fire dose from the kidney increased the background’s absorbed dose by 5% or more up to 5.8 cm distance with 20 : 1 kidney to background activity concentration ratio. On the other hand, the photon cross-fire dose from the background to

Sliding Modes after the First Decade of the 21st Century State of the Art

CERN Document Server

Moreno, Jaime; Iriarte, Rafael

2012-01-01

The book presents the newest results of the major world research groups working in the area of Variable Structure Systems and Sliding Mode Control (VSS/SMC). The research activity of these groups is coordinated by the IEEE Technical Committee on Variable Structure Systems (VSS) and Sliding Modes (SM). The presented results include the reports of the research groups collaborating in a framework of the Unión European Union – México project of Fondo de Cooperación Internacional en Ciencia y Tecnología (FONCICyT) 93302 titled "Automatization and Monitoring of Energy Production Processes via Sliding Mode Control". The book starts with the overview of the sliding mode control concepts and algorithms that were developed and discussed in the last two decades The research papers are combined in three sections: Part I: VSS and SM Algorithms and their Analysis Part II: SMC Design Part III: Applications of VSS and SMC The book will be of interests of engineers, researchers and graduate students working in the area ...

Effect of excessive trichloroisocyanuric acid in swimming pool water on tooth erosion

Directory of Open Access Journals (Sweden)

Chanya Chuenarrom

2014-08-01

Full Text Available The effect of chlorinated water on tooth erosion was studied. Tooth specimens were bathed in a pH cycling system of chlorinated water and artificial saliva under one of the following conditions: I a 4 hour continuous cycle, and II a 1 hour/ day cycle for 4 weeks. Each group was divided into four subgroups for testing in chlorinated water with pH of 2, 3, 4 or 5. Enamel loss and percentage of surface microhardness change (%SMC were measured. After 4 hour, chlorinated water with pH 2, 3, 4 and 5 produced enamel loss of 1.4, 0.4, 0.0 and 0.0 micrometers, and %SMC was reduced by 57.2, 13.7, 2.9 and -0.2% respectively. After 4 weeks, erosion was recorded at 63.3, 1.0, 0.0 and 0.0 micrometers, and %SMC was reduced by 97.2, 52.1, 5.7 and 1.5%, respectively. The study revealed that the pH level of chlorinated water and the duration of exposure are important factors in enamel erosion.

THE MAGELLANIC QUASARS SURVEY. III. SPECTROSCOPIC CONFIRMATION OF 758 ACTIVE GALACTIC NUCLEI BEHIND THE MAGELLANIC CLOUDS

International Nuclear Information System (INIS)

Kozłowski, Szymon; Udalski, Andrzej; Szymański, M. K.; Kubiak, M.; Pietrzyński, G.; Soszyński, I.; Wyrzykowski, Ł.; Ulaczyk, K.; Poleski, R.; Pietrukowicz, P.; Skowron, J.; Onken, Christopher A.; Kochanek, Christopher S.; Meixner, M.; Bonanos, A. Z.

2013-01-01

The Magellanic Quasars Survey (MQS) has now increased the number of quasars known behind the Magellanic Clouds by almost an order of magnitude. All survey fields in the Large Magellanic Cloud (LMC) and 70% of those in the Small Magellanic Cloud (SMC) have been observed. The targets were selected from the third phase of the Optical Gravitational Lensing Experiment (OGLE-III) based on their optical variability, mid-IR, and/or X-ray properties. We spectroscopically confirmed 758 quasars (565 in the LMC and 193 in the SMC) behind the clouds, of which 94% (527 in the LMC and 186 in the SMC) are newly identified. The MQS quasars have long-term (12 yr and growing for OGLE), high-cadence light curves, enabling unprecedented variability studies of quasars. The MQS quasars also provide a dense reference grid for measuring both the internal and bulk proper motions of the clouds, and 50 quasars are bright enough (I ∼< 18 mag) for absorption studies of the interstellar/intergalactic medium of the clouds

Ultrastructural autoradiographic localization of exogenous arachidonic acid in cultured endothelial and smooth muscle cells

International Nuclear Information System (INIS)

Tasca, S.I.; Galis, Z.

1988-01-01

The uptake and intracellular localization of exogenous arachidonic acid (AA) were investigated in cultured endothelial (EC) and smooth muscle cells (SMC) isolated from bovine aorta. The [ 14 C]AA uptake was assessed biochemically and by light and electron microscopic autoradiography. The highest values of silver grain surface density were associated with the mitochondria, lysosomes, and the Golgi apparatus of the EC. The grain linear density was greater on the nuclear envelope than on plasmalemma. On SMC, the grain density was highest on lipid droplets whereas the linear densities of the nuclear envelope and plasmalemma were similar. The share of each subcellular compartment in the AA distribution was estimated as the percentage of the individual silver grain count out of the total cell-associated radioactivity. The results showed that cytoplasm (including endoplasmic reticulum, ribosomes, and small vesicles) made the main contribution followed by the nucleus and at lower values by other organelles. These subcompartments may represent the intracellular sites from which AA could be mobilized for prostanoid synthesis by EC and SMC. (author)

Expression of lectin-like oxidized LDL receptor-1 in smooth muscle cells after vascular injury

International Nuclear Information System (INIS)

Eto, Hideyuki; Miyata, Masaaki; Kume, Noriaki; Minami, Manabu; Itabe, Hiroyuki; Orihara, Koji; Hamasaki, Shuichi; Biro, Sadatoshi; Otsuji, Yutaka; Kita, Toru; Tei, Chuwa

2006-01-01

Lectin-like oxidized LDL receptor-1 (LOX-1) is an oxidized LDL receptor, and its role in restenosis after angioplasty remains unknown. We used a balloon-injury model of rabbit aorta, and reverse transcription-polymerase chain reaction revealed that LOX-1 mRNA expression was modest in the non-injured aorta, reached a peak level 2 days after injury, and remained elevated until 24 weeks after injury. Immunohistochemistry and in situ hybridization showed that LOX-1 was not detected in the media of non-injured aorta but expressed in both medial and neointimal smooth muscle cells (SMC) at 2 and 24 weeks after injury. Low concentrations of ox-LDL (10 μg/mL) stimulated the cultured SMC proliferation, which was inhibited by antisense oligonucleotides of LOX-1 mRNA. Double immunofluorescense staining showed the colocalization of LOX-1 and proliferating cell nuclear antigen in human restenotic lesion. These results suggest that LOX-1 mediates ox-LDL-induced SMC proliferation and plays a role in neointimal formation after vascular injury

Synthesis, characterization and electro-optic properties of novel siloxane liquid crystalline with a large tilt angle

International Nuclear Information System (INIS)

Liao, Chien-Tung; Lee, Jiunn-Yih; Lai, Chiu-Chun

2011-01-01

Research highlights: → In this study we report the synthesis and characterization of new ferroelectric liquid crystal material. → We examined the influence of the addition of a trisiloxane end-group on one side-chain of an achiral alkyl chain on the phase transition. → Finally, the properties of the chiral smectic C (SmC*) phase were measured for target compounds. - Abstract: This paper presents a study of the ferroelectric behavior in low molar mass organosiloxane liquid crystal materials. A few novel series of compounds with a large tilt angle were synthesized, and the mesophases exhibited were compared. The mesophases under discussion were investigated by means of polarizing microscopy (POM), differential scanning calorimetry (DSC), X-ray diffraction (XRD) and electro-optical experiments. The influence of the molecular structure on the occurrence of the chiral smectic C (SmC*) phase was investigated. Finally, the electro-optical properties of the SmC* phase, such as tilt angle, dielectric permittivity and switching behavior were also measured. As a consequence, the correlation between the electro-optical properties and chemical structures of these compounds was investigated.

Crystal Structure of the Cohesin Gatekeeper Pds5 and in Complex with Kleisin Scc1

Directory of Open Access Journals (Sweden)

Byung-Gil Lee

2016-03-01

Full Text Available Sister chromatid cohesion is mediated by cohesin, whose Smc1, Smc3, and kleisin (Scc1 subunits form a ring structure that entraps sister DNAs. The ring is opened either by separase, which cleaves Scc1 during anaphase, or by a releasing activity involving Wapl, Scc3, and Pds5, which bind to Scc1 and open its interface with Smc3. We present crystal structures of Pds5 from the yeast L. thermotolerans in the presence and absence of the conserved Scc1 region that interacts with Pds5. Scc1 binds along the spine of the Pds5 HEAT repeat fold and is wedged between the spine and C-terminal hook of Pds5. We have isolated mutants that confirm the observed binding mode of Scc1 and verified their effect on cohesin by immunoprecipitation and calibrated ChIP-seq. The Pds5 structure also reveals architectural similarities to Scc3, the other large HEAT repeat protein of cohesin and, most likely, Scc2.

Cerebral cortex activation mapping upon electrical muscle stimulation by 32-channel time-domain functional near-infrared spectroscopy.

Science.gov (United States)

Re, Rebecca; Muthalib, Makii; Contini, Davide; Zucchelli, Lucia; Torricelli, Alessandro; Spinelli, Lorenzo; Caffini, Matteo; Ferrari, Marco; Quaresima, Valentina; Perrey, Stephane; Kerr, Graham

2013-01-01

The application of different EMS current thresholds on muscle activates not only the muscle but also peripheral sensory axons that send proprioceptive and pain signals to the cerebral cortex. A 32-channel time-domain fNIRS instrument was employed to map regional cortical activities under varied EMS current intensities applied on the right wrist extensor muscle. Eight healthy volunteers underwent four EMS at different current thresholds based on their individual maximal tolerated intensity (MTI), i.e., 10 % < 50 % < 100 % < over 100 % MTI. Time courses of the absolute oxygenated and deoxygenated hemoglobin concentrations primarily over the bilateral sensorimotor cortical (SMC) regions were extrapolated, and cortical activation maps were determined by general linear model using the NIRS-SPM software. The stimulation-induced wrist extension paradigm significantly increased activation of the contralateral SMC region according to the EMS intensities, while the ipsilateral SMC region showed no significant changes. This could be due in part to a nociceptive response to the higher EMS current intensities and result also from increased sensorimotor integration in these cortical regions.

Thermomechanical Analysis of Shape-Memory Composite Tape Spring

Science.gov (United States)

Yang, H.; Wang, L. Y.

2013-06-01

Intelligent materials and structures have been extensively applied for satellite designs in order to minimize the mass and reduce the cost in the launch of the spacecraft. Elastic memory composites (EMCs) have the ability of high-strain packaging and shape-memory effect, but increase the parts and total weight due to the additional heating system. Shape-memory sandwich structures Li and Wang (J. Intell. Mater. Syst. Struct. 22(14), 1605-1612, 2011) can overcome such disadvantage by using the metal skin acting as the heating element. However, the high strain in the micro-buckled metal skin decreases the deployment efficiency. This paper aims to present an insight into the folding and deployment behaviors of shape-memory composite (SMC) tape springs. A thermomechanical process was analyzed, including the packaging deformation at an elevated temperature, shape frozen at the low temperature and shape recovery after reheating. The result shows that SMC tape springs can significantly decrease the strain concentration in the metal skin, as well as exhibiting excellent shape frozen and recovery behaviors. Additionally, possible failure modes of SMC tape springs were also analyzed.

RAD21L, a novel cohesin subunit implicated in linking homologous chromosomes in mammalian meiosis.

Science.gov (United States)

Lee, Jibak; Hirano, Tatsuya

2011-01-24

Cohesins are multi-subunit protein complexes that regulate sister chromatid cohesion during mitosis and meiosis. Here we identified a novel kleisin subunit of cohesins, RAD21L, which is conserved among vertebrates. In mice, RAD21L is expressed exclusively in early meiosis: it apparently replaces RAD21 in premeiotic S phase, becomes detectable on the axial elements in leptotene, and stays on the axial/lateral elements until mid pachytene. RAD21L then disappears, and is replaced with RAD21. This behavior of RAD21L is unique and distinct from that of REC8, another meiosis-specific kleisin subunit. Remarkably, the disappearance of RAD21L at mid pachytene correlates with the completion of DNA double-strand break repair and the formation of crossovers as judged by colabeling with molecular markers, γ-H2AX, MSH4, and MLH1. RAD21L associates with SMC3, STAG3, and either SMC1α or SMC1β. Our results suggest that cohesin complexes containing RAD21L may be involved in synapsis initiation and crossover recombination between homologous chromosomes.

Photometric metallicity map of the Small Magellanic Cloud

Science.gov (United States)

Choudhury, S.; Subramaniam, A.; Cole, A. A.; Sohn, Y.-J.

2018-04-01

We have created an estimated metallicity map of the Small Magellanic Cloud (SMC) using the Magellanic Cloud Photometric Survey (MCPS) and Optical Gravitational Lensing Experiment (OGLE III) photometric data. This is a first of its kind map of metallicity up to a radius of ˜2.5°. We identify the Red Giant Branch (RGB) in the V, (V - I) colour-magnitude diagrams of small sub-regions of varying sizes in both data sets. We use the slope of the RGB as an indicator of the average metallicity of a sub-region and calibrate the RGB slope to metallicity using available spectroscopic data for selected sub-regions. The average metallicity of the SMC is found to be [Fe/H] = -0.94 dex (σ[Fe/H] = 0.09) from OGLE III and [Fe/H] = -0.95 dex (σ[Fe/H] = 0.08) from MCPS. We confirm a shallow but significant metallicity gradient within the inner SMC up to a radius of 2.5° (-0.045 ± 0.004 to -0.067 ± 0.006 dex deg-1).

The Cognitive and Functional Profile of the elderly that frequent the Community Center for the Elderly in the municipality of Santos, Sao Paulo state

Directory of Open Access Journals (Sweden)

Nathalia Barros de Andrade

2015-03-01

Full Text Available Introduction: The growing population must be accompanied by the promotion of healthy aging and maintain maximum functional capacity. Objective: To understand the cognitive and functional profile of the elderly who take part in the Community Center for the Elderly in Santos, Sao Paulo state. Method: Ninety elderly people were evaluated in this study. The following instruments were used: Social-demographic profile Questionnaire, Socialeconomic Questionnaire, Mini Mental State Examination (MMSE, Subjective Memory Complaint Questionnaire (SMC-Q, Independence in Activities of Daily Living Scale (Katz Scale, and Instrumental Activities of Daily Living Scale (Lawton & Brody. Results: The average age of the elderly was 72.5 years old and the predominant gender was female (95.5%. There was a preponderance of participants from 1 to 4 years of education, and Class C was the predominant economic class. In the MMSE scores, 63.33% of the participants were below of the cutoff established for education, and in the SMC-Q, 71.11% of the elderly presented subjective dysfunction of memory. In the performance of Basic Activities of Daily Living (BADL, 84.44% of the participants are independent. As for the Instrumental Activities of Daily Living (IADL, only 33.33% of the participants are independent. In the statistical analyses between cognitive profile and functional performance, associations were found between MMSE and SMC-Q, MMSE and Lawton & Brody Scale, and SMC-Q and Lawton & Brody Scale. Conclusions: A significant portion of the elderly patrons of the Community Center presents functional decline and cognitive decline.

Subjective memory complaints and cognitive performance in a sample of healthy elderly

Directory of Open Access Journals (Sweden)

Paulo Caramelli

Full Text Available Abstract Memory loss is a major complaint among the elderly population. However, the clinical significance of this symptom is variable and also controversial in the scientific literature. Objective: To compare the cognitive performance of two groups of healthy elderly, one group with and the other without, subjective memory complaints (SMC. Methods: Sixty cognitively intact elderly individuals (39 females and 21 males, aged 69.9±6.3 years and with educational level of 8.5±5.5 years, were included in the study. Participants were submitted to the Mini-Mental State Examination and to the Cornell depression scale in order to rule out global cognitive impairment and depression, respectively. Moreover, they answered the MAC-Q, a questionnaire devised to evaluate subjective impression of memory function. Subsequently, they were submitted to the digit span forward and backward, the Brief Cognitive Screening Battery, and to the Frontal Assessment Battery. Results: Twenty-seven individuals had MAC-Q scores <25 and thus were classified as not having SMC, while 33 had MAC-Q scores ³25 and were considered to have SMC. No differences for age, gender, education and MMSE scores were found between the two groups. The comparison between the performance of the groups of complainers and non-complainers on the different cognitive tests yielded no significant difference, although there was a trend toward non-complainers performing better on incidental memory. Conclusions: The presence of SMC was not associated to objective memory impairment or to other cognitive deficits in this group of elderly individuals.

A dearth of OH/IR stars in the Small Magellanic Cloud

Science.gov (United States)

Goldman, Steven R.; van Loon, Jacco Th.; Gómez, José F.; Green, James A.; Zijlstra, Albert A.; Nanni, Ambra; Imai, Hiroshi; Whitelock, Patricia A.; Groenewegen, Martin A. T.; Oliveira, Joana M.

2018-01-01

We present the results of targeted observations and a survey of 1612-, 1665- and 1667-MHz circumstellar OH maser emission from asymptotic giant branch (AGB) stars and red supergiants (RSGs) in the Small Magellanic Cloud (SMC), using the Parkes and Australia Telescope Compact Array (ATCA) radio telescopes. No clear OH maser emission has been detected in any of our observations targeting luminous, long-period, large-amplitude variable stars, which have been confirmed spectroscopically and photometrically to be mid- to late-M spectral type. These observations have probed 3-4 times deeper than any OH maser survey in the SMC. Using a bootstrapping method with Large Magellanic Cloud (LMC) and Galactic OH/IR star samples and our SMC observation upper limits, we have calculated the likelihood of not detecting maser emission in any of the two sources considered to be the top maser candidates to be less than 0.05 per cent, assuming a similar pumping mechanism as the LMC and Galactic OH/IR sources. We have performed a population comparison of the Magellanic Clouds and used Spitzer IRAC and MIPS photometry to confirm that we have observed all high luminosity SMC sources that are expected to exhibit maser emission. We suspect that, compared to the OH/IR stars in the Galaxy and LMC, the reduction in metallicity may curtail the dusty wind phase at the end of the evolution of the most massive cool stars. We also suspect that the conditions in the circumstellar envelope change beyond a simple scaling of abundances and wind speed with metallicity.

CA II TRIPLET SPECTROSCOPY OF SMALL MAGELLANIC CLOUD RED GIANTS. III. ABUNDANCES AND VELOCITIES FOR A SAMPLE OF 14 CLUSTERS

Energy Technology Data Exchange (ETDEWEB)

Parisi, M. C.; Clariá, J. J.; Marcionni, N. [Observatorio Astronómico, Universidad Nacional de Córdoba, Laprida 854, Córdoba, CP 5000 (Argentina); Geisler, D.; Villanova, S. [Departamento de Astronomía, Universidad de Concepción Casilla 160-C, Concepción (Chile); Sarajedini, A. [Department of Astronomy, University of Florida P.O. Box 112055, Gainesville, FL 32611 (United States); Grocholski, A. J., E-mail: celeste@oac.uncor.edu, E-mail: claria@oac.uncor.edu, E-mail: nmarcionni@oac.uncor.edu, E-mail: dgeisler@astro-udec.cl, E-mail: svillanova@astro-udec.cl, E-mail: ata@astro.ufl.edu, E-mail: grocholski@phys.lsu.edu [Department of Physics and Astronomy, Louisiana State University 202 Nicholson Hall, Tower Drive, Baton Rouge, LA 70803-4001 (United States)

2015-05-15

We obtained spectra of red giants in 15 Small Magellanic Cloud (SMC) clusters in the region of the Ca ii lines with FORS2 on the Very Large Telescope. We determined the mean metallicity and radial velocity with mean errors of 0.05 dex and 2.6 km s{sup −1}, respectively, from a mean of 6.5 members per cluster. One cluster (B113) was too young for a reliable metallicity determination and was excluded from the sample. We combined the sample studied here with 15 clusters previously studied by us using the same technique, and with 7 clusters whose metallicities determined by other authors are on a scale similar to ours. This compilation of 36 clusters is the largest SMC cluster sample currently available with accurate and homogeneously determined metallicities. We found a high probability that the metallicity distribution is bimodal, with potential peaks at −1.1 and −0.8 dex. Our data show no strong evidence of a metallicity gradient in the SMC clusters, somewhat at odds with recent evidence from Ca ii triplet spectra of a large sample of field stars. This may be revealing possible differences in the chemical history of clusters and field stars. Our clusters show a significant dispersion of metallicities, whatever age is considered, which could be reflecting the lack of a unique age–metallicity relation in this galaxy. None of the chemical evolution models currently available in the literature satisfactorily represents the global chemical enrichment processes of SMC clusters.

Increased low-frequency oscillation amplitude of sensorimotor cortex associated with the severity of structural impairment in cervical myelopathy.

Directory of Open Access Journals (Sweden)

Fuqing Zhou

Full Text Available Decreases in metabolites and increased motor-related, but decreased sensory-related activation of the sensorimotor cortex (SMC have been observed in patients with cervical myelopathy (CM using advanced MRI techniques. However, the nature of intrinsic neuronal activity in the SMC, and the relationship between cerebral function and structural damage of the spinal cord in patients with CM are not fully understood. The purpose of this study was to assess intrinsic neuronal activity by calculating the regional amplitude of low frequency fluctuations (ALFF using resting-state functional MRI (rs-fMRI, and correlations with clinical and imaging indices. Nineteen patients and 19 age- and sex-matched healthy subjects underwent rs-fMRI scans. ALFF measurements were performed in the SMC, a key brain network likely to impaired or reorganized patients with CM. Compared with healthy subjects, increased amplitude of cortical low-frequency oscillations (LFO was observed in the right precentral gyrus, right postcentral gyrus, and left supplementary motor area. Furthermore, increased z-ALFF values in the right precentral gyrus and right postcentral gyrus correlated with decreased fractional anisotropy values at the C2 level, which indicated increased intrinsic neuronal activity in the SMC corresponding to the structural impairment in the spinal cord of patients with CM. These findings suggest a complex and diverging relationship of cortical functional reorganization and distal spinal anatomical compression in patients with CM and, thus, add important information in understanding how spinal cord integrity may be a factor in the intrinsic covariance of spontaneous low-frequency fluctuations of BOLD signals involved in cortical plasticity.

Controlling retention, selectivity and magnitude of EOF by segmented monolithic columns consisting of octadecyl and naphthyl monolithic segments--applications to RP-CEC of both neutral and charged solutes.

Science.gov (United States)

Karenga, Samuel; El Rassi, Ziad

2011-04-01

Monolithic capillaries made of two adjoining segments each filled with a different monolith were introduced for the control and manipulation of the electroosmotic flow (EOF), retention and selectivity in reversed phase-capillary electrochromatography (RP-CEC). These columns were called segmented monolithic columns (SMCs) where one segment was filled with a naphthyl methacrylate monolith (NMM) to provide hydrophobic and π-interactions, while the other segment was filled with an octadecyl acrylate monolith (ODM) to provide solely hydrophobic interaction. The ODM segment not only provided hydrophobic interactions but also functioned as the EOF accelerator segment. The average EOF of the SMC increased linearly with increasing the fractional length of the ODM segment. The neutral SMC provided a convenient way for tuning EOF, selectivity and retention in the absence of annoying electrostatic interactions and irreversible solute adsorption. The SMCs allowed the separation of a wide range of neutral solutes including polycyclic aromatic hydrocarbons (PAHs) that are difficult to separate using conventional alkyl-bonded stationary phases. In all cases, the k' of a given solute was a linear function of the fractional length of the ODM or NMM segment in the SMCs, thus facilitating the tailoring of a given SMC to solve a given separation problem. At some ODM fractional length, the fabricated SMC allowed the separation of charged solutes such as peptides and proteins that could not otherwise be achieved on a monolithic column made from NMM as an isotropic stationary phase due to the lower EOF exhibited by this monolith. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Regulation of Metalloprotease Gene Expression in Vibrio vulnificus by a Vibrio harveyi LuxR Homologue

Science.gov (United States)

Shao, Chung-Ping; Hor, Lien-I

2001-01-01

Expression of the Vibrio vulnificus metalloprotease gene, vvp, was turned up rapidly when bacterial growth reached the late log phase. A similar pattern of expression has been found in the metalloprotease gene of Vibrio cholerae, and this has been shown to be regulated by a Vibrio harveyi LuxR-like transcriptional activator. To find out whether a LuxR homologue exists in V. vulnificus, a gene library of this organism was screened by colony hybridization using a probe derived from a sequence that is conserved in various luxR-like genes of vibrios. A gene containing a 618-bp open reading frame was identified and found to be identical to the smcR gene of V. vulnificus reported previously. An isogenic SmcR-deficient (RD) mutant was further constructed by an in vivo allelic exchange technique. This mutant exhibited an extremely low level of vvp transcription compared with that of the parent strain. On the other hand, the cytolysin gene, vvhA, was expressed at a higher level in the RD mutant than in the parent strain during the log phase of growth. These data suggested that SmcR might not only be a positive regulator of the protease gene but might also be involved in negative regulation of the cytolysin gene. Virulence of the RD mutant in either normal or iron-overloaded mice challenged by intraperitoneal injection was comparable to that of the parent strain, indicating that SmcR is not required for V. vulnificus virulence in mice. PMID:11157950

Deficient Circumferential Growth Is the Primary Determinant of Aortic Obstruction Attributable to Partial Elastin Deficiency.

Science.gov (United States)

Jiao, Yang; Li, Guangxin; Korneva, Arina; Caulk, Alexander W; Qin, Lingfeng; Bersi, Matthew R; Li, Qingle; Li, Wei; Mecham, Robert P; Humphrey, Jay D; Tellides, George

2017-05-01

Williams syndrome is characterized by obstructive aortopathy attributable to heterozygous loss of ELN , the gene encoding elastin. Lesions are thought to result primarily from excessive smooth muscle cell (SMC) proliferation and consequent medial expansion, although an initially smaller caliber and increased stiffness of the aorta may contribute to luminal narrowing. The relative contributions of such abnormalities to the obstructive phenotype had not been defined. We quantified determinants of luminal stenosis in thoracic aortas of Eln -/- mice incompletely rescued by human ELN . Moderate obstruction was largely because of deficient circumferential growth, most prominently of ascending segments, despite increased axial growth. Medial thickening was evident in these smaller diameter elastin-deficient aortas, with medial area similar to that of larger diameter control aortas. There was no difference in cross-sectional SMC number between mutant and wild-type genotypes at multiple stages of postnatal development. Decreased elastin content was associated with medial fibrosis and reduced aortic distensibility because of increased structural stiffness but preserved material stiffness. Elastin-deficient SMCs exhibited greater contractile-to-proliferative phenotypic modulation in vitro than in vivo. We confirmed increased medial collagen without evidence of increased medial area or SMC number in a small ascending aorta with thickened media of a Williams syndrome subject. Deficient circumferential growth is the predominant mechanism for moderate obstructive aortic disease resulting from partial elastin deficiency. Our findings suggest that diverse aortic manifestations in Williams syndrome result from graded elastin content, and SMC hyperplasia causing medial expansion requires additional elastin loss superimposed on ELN haploinsufficiency. © 2017 American Heart Association, Inc.

Angiotensin II-induced arterial thickening, fibrosis and stiffening involves elevated arginase function.

Directory of Open Access Journals (Sweden)

Anil Bhatta

Full Text Available Arterial stiffness (AS is an independent risk factor for cardiovascular morbidity/mortality. Smooth muscle cell (SMC proliferation and increased collagen synthesis are key features in development of AS. Arginase (ARG, an enzyme implicated in many cardiovascular diseases, can compete with nitric oxide (NO synthase for their common substrate, L-arginine. Increased arginase can also provide ornithine for synthesis of polyamines via ornithine decarboxylase (ODC and proline/collagen via ornithine aminotransferase (OAT, leading to vascular cell proliferation and collagen formation, respectively. We hypothesized that elevated arginase activity is involved in Ang II-induced arterial thickening, fibrosis, and stiffness and that limiting its activity can prevent these changes.We tested this by studies in mice lacking one copy of the ARG1 gene that were treated with angiotensin II (Ang II, 4 weeks. Studies were also performed in rat aortic Ang II-treated SMC. In WT mice treated with Ang II, we observed aortic stiffening (pulse wave velocity and aortic and coronary fibrosis and thickening that were associated with increases in ARG1 and ODC expression/activity, proliferating cell nuclear antigen, hydroxyproline levels, and collagen 1 protein expression. ARG1 deletion prevented each of these alterations. Furthermore, exposure of SMC to Ang II (1 μM, 48 hrs increased ARG1 expression, ARG activity, ODC mRNA and activity, cell proliferation, collagen 1 protein expression and hydroxyproline content. Treatment with ABH prevented these changes.Arginase 1 is crucially involved in Ang II-induced SMC proliferation and arterial fibrosis and stiffness and represents a promising therapeutic target.

Electrocorticographic activity over sensorimotor cortex and motor function in awake behaving rats.

Science.gov (United States)

Boulay, Chadwick B; Chen, Xiang Yang; Wolpaw, Jonathan R

2015-04-01

Sensorimotor cortex exerts both short-term and long-term control over the spinal reflex pathways that serve motor behaviors. Better understanding of this control could offer new possibilities for restoring function after central nervous system trauma or disease. We examined the impact of ongoing sensorimotor cortex (SMC) activity on the largely monosynaptic pathway of the H-reflex, the electrical analog of the spinal stretch reflex. In 41 awake adult rats, we measured soleus electromyographic (EMG) activity, the soleus H-reflex, and electrocorticographic activity over the contralateral SMC while rats were producing steady-state soleus EMG activity. Principal component analysis of electrocorticographic frequency spectra before H-reflex elicitation consistently revealed three frequency bands: μβ (5-30 Hz), low γ (γ1; 40-85 Hz), and high γ (γ2; 100-200 Hz). Ongoing (i.e., background) soleus EMG amplitude correlated negatively with μβ power and positively with γ1 power. In contrast, H-reflex size correlated positively with μβ power and negatively with γ1 power, but only when background soleus EMG amplitude was included in the linear model. These results support the hypothesis that increased SMC activation (indicated by decrease in μβ power and/or increase in γ1 power) simultaneously potentiates the H-reflex by exciting spinal motoneurons and suppresses it by decreasing the efficacy of the afferent input. They may help guide the development of new rehabilitation methods and of brain-computer interfaces that use SMC activity as a substitute for lost or impaired motor outputs. Copyright © 2015 the American Physiological Society.

Geometry and distance of the Magellanic Clouds from Cepheid variables

Energy Technology Data Exchange (ETDEWEB)

Caldwell, J A.R.; Coulson, I M

1986-01-15

Period, luminosity and colour data on LMC and SMC Cepheids are analysed. A geometrical model for the LMC and the SMC is presented based on the Cepheids. The distance modulus of each Cloud is redetermined and its dependence upon the assumed abundance deficiency in the Clouds is made explicit. New, independent abundances are inferred based on the Cepheids alone, and are found to agree well with the known HII region abundance deficiencies. The luminosity laws in both galaxies, suitably corrected for abundance, are mutually consistent, enabling a 'universal' PLC and PL relation to be obtained which incorporates all the photoelectric data. (author).

Effect of ginger, Paullinia cupana, muira puama and l- citrulline, singly or in combination, on modulation of the inducible nitric oxide- NO-cGMP pathway in rat penile smooth muscle cells.

Science.gov (United States)

Ferrini, Monica G; Garcia, Eduardo; Abraham, Andrea; Artaza, Jorge N; Nguyen, Sabine; Rajfer, Jacob

2018-06-01

COMP-4 is a natural compound-based dietary supplement consisting of the combination of ginger, Paullinia cupana, muira puama and l-citrulline, which when given long-term has been shown in the aged rat to a) upregulate iNOS in the penile smooth muscle cells (SMC), b) reverse the corporal SMC apoptosis and fibrosis associated with corporal veno-occlusive dysfunction (CVOD), and c) improve resulting erectile function. To elucidate the mechanism of how COMP-4 and its individual components modulate the iNOS-cGMP pathway, an in vitro study was conducted using a rat corporal primary SMC culture to determine its effect on NOS, soluble guanylate cyclase (sGC), cGMP and the phosphodiesterase 5 enzyme (PDE5). Primary SMC cultures using the explant technique were initiated by cutting small pieces of corporal tissue from 8 week old Sprague-Dawley rats. The SMC were grown in Dulbecco media with 20% fetal calf serum. The SMC were then incubated with or without COMP-4 (0.69 mg/ml) or its ingredients alone (ginger: 0.225 mg/ml; muira puama, Paullinia cupana and l-citrulline each at 0.9 mg/ml) for up to 24 h mRNA and protein were extracted and used for the determination of NOS, sGC and PDE5 content. cGMP content was determined by ELISA. L-NIL (4 μM) was used as an inhibitor of iNOS activity. Compared to the control values, COMP-4 upregulated expression of cGMP by 85%, induced a 42 fold increase in sGC as well as a 15 fold increase in both iNOS protein and mRNA content while it decreased both PDE5 mRNA and protein content each by about 50%. L-NIL completely inhibited the effect of COMP-4 on cGMP production. When compared with each of the individual four components of COMP-4, it appears that COMP-4 itself had the most profound effect in modulating each one the specific steps within the iNOS-cGMP pathway. This in vitro study demonstrates that COMP-4 is capable of activating the endogenous cellular iNOS-cGMP pathway within the CSM cells, which is theorized to be responsible

The Strange Case of OGLE-SMC-ECL-0277

Czech Academy of Sciences Publication Activity Database

Zasche, P.; Wolf, M.; Vraštil, J.; Fatka, P.; Hornoch, Kamil; Janák, Z.; Janík, J.; Kortusová, Eva; Kurfürst, P.; Kušnirák, Peter; Paunzen, E.; Řezba, Luděk; Votruba, Viktor; Zejda, M.; Zielinski, P.

2017-01-01

Roč. 67, č. 3 (2017), s. 243-255 ISSN 0001-5237 R&D Projects: GA MŠk(CZ) LG15010 Grant - others:GA ČR(CZ) GA15-02112S Institutional support: RVO:67985815 Keywords : binaries eclipsing * stars * fundamental parameters Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 3.043, year: 2016

Sequential loading of cohesin subunits during the first meiotic prophase of grasshoppers.

Directory of Open Access Journals (Sweden)

Ana M Valdeolmillos

2007-02-01

Full Text Available The cohesin complexes play a key role in chromosome segregation during both mitosis and meiosis. They establish sister chromatid cohesion between duplicating DNA molecules during S-phase, but they also have an important role during postreplicative double-strand break repair in mitosis, as well as during recombination between homologous chromosomes in meiosis. An additional function in meiosis is related to the sister kinetochore cohesion, so they can be pulled by microtubules to the same pole at anaphase I. Data about the dynamics of cohesin subunits during meiosis are scarce; therefore, it is of great interest to characterize how the formation of the cohesin complexes is achieved in order to understand the roles of the different subunits within them. We have investigated the spatio-temporal distribution of three different cohesin subunits in prophase I grasshopper spermatocytes. We found that structural maintenance of chromosome protein 3 (SMC3 appears as early as preleptotene, and its localization resembles the location of the unsynapsed axial elements, whereas radiation-sensitive mutant 21 (RAD21 (sister chromatid cohesion protein 1, SCC1 and stromal antigen protein 1 (SA1 (sister chromatid cohesion protein 3, SCC3 are not visualized until zygotene, since they are located in the synapsed regions of the bivalents. During pachytene, the distribution of the three cohesin subunits is very similar and all appear along the trajectories of the lateral elements of the autosomal synaptonemal complexes. However, whereas SMC3 also appears over the single and unsynapsed X chromosome, RAD21 and SA1 do not. We conclude that the loading of SMC3 and the non-SMC subunits, RAD21 and SA1, occurs in different steps throughout prophase I grasshopper meiosis. These results strongly suggest the participation of SMC3 in the initial cohesin axis formation as early as preleptotene, thus contributing to sister chromatid cohesion, with a later association of both RAD21

Acute pyelonephritis in pediatric age: comparative study between power Doppler ultrasound scan and DMSA

International Nuclear Information System (INIS)

Muro, M. D.; Sanguesa, C.; Otero, M. C.; Piqueras, A. I.; Lloret, M. T.

2002-01-01

To evaluate the usefulness of power Doppler (PD) Ultrasound Scan in the study of acute pyelonephritis (APN). To compare ultrasound scan results with those obtained with renal gammagraphy (DMSA). To relate the findings to the clinical criteria and to determine the presence of vesicoureteral reflux (VUR) in the serial micturition cystography (SMC). Prospective study of 92 patients (ages between 1 month and 10 years) with suspected clinical PNA. All children were initially subjected to PD ultrasound scan and DMSA. Those under 3 years old were also subjected to SMC for the study of VUR. PNA in the PD ultrasound scan was manifested by decrease in vascularisation and in the DMSA by decrease in caption in the affected zones. 87 renal units (RU) with PNA foci were detected. Conformity between the PD ultrasound scan and DMSA was 157 RU (92%): 52 positives, 22 negatives with PNA and 83 normal RU. The sensitivities of PD and DMSA were 65.5% and 69.0%. 51 SMC were performed, with VUR being detected in 18 (13 bilateral and 5 unilateral), in which the sensitivities of PD and DMSA were 65.5% and 69.0%. 51 SMC were performed, with VUR being detected in 18 (13 bilateral and 5 unilateral), in which the sensitivities of PD and DMSA were 80% and 85%, respectively. Mode B ultrasound scan and PD can replace DMSA in the initial study of PPNA. It is non-invasive, simple, economical and just as reliable as DMSA in expert hands. it can also postpone by up to 6 months the need to perform DMSA for detection of permanent renal damage. (Author) 22 refs

Acute pyelonephritis in pediatric age: comparative study between power Doppler ultrasound scan and DMSA; Pielonefritis aguda en la edad pediatrica: estudio comparative entre la ecografiapower-Doppler y el DMSA

Energy Technology Data Exchange (ETDEWEB)

Muro, M. D.; Sanguesa, C.; Otero, M. C.; Piqueras, A. I.; Lloret, M. T. [Hospital Infantil Universitario La Fe. Valencia (Spain)

2002-07-01

To evaluate the usefulness of power Doppler (PD) Ultrasound Scan in the study of acute pyelonephritis (APN). To compare ultrasound scan results with those obtained with renal gammagraphy (DMSA). To relate the findings to the clinical criteria and to determine the presence of vesicoureteral reflux (VUR) in the serial micturition cystography (SMC). Prospective study of 92 patients (ages between 1 month and 10 years) with suspected clinical PNA. All children were initially subjected to PD ultrasound scan and DMSA. Those under 3 years old were also subjected to SMC for the study of VUR. PNA in the PD ultrasound scan was manifested by decrease in vascularisation and in the DMSA by decrease in caption in the affected zones. 87 renal units (RU) with PNA foci were detected. Conformity between the PD ultrasound scan and DMSA was 157 RU (92%): 52 positives, 22 negatives with PNA and 83 normal RU. The sensitivities of PD and DMSA were 65.5% and 69.0%. 51 SMC were performed, with VUR being detected in 18 (13 bilateral and 5 unilateral), in which the sensitivities of PD and DMSA were 65.5% and 69.0%. 51 SMC were performed, with VUR being detected in 18 (13 bilateral and 5 unilateral), in which the sensitivities of PD and DMSA were 80% and 85%, respectively. Mode B ultrasound scan and PD can replace DMSA in the initial study of PPNA. It is non-invasive, simple, economical and just as reliable as DMSA in expert hands. it can also postpone by up to 6 months the need to perform DMSA for detection of permanent renal damage. (Author) 22 refs.

Characterization and endocytic internalization of Epith-2 cell surface glycoprotein during the epithelial-to-mesenchymal transition in sea urchin embryos

Directory of Open Access Journals (Sweden)

Norio eWakayama

2013-08-01

Full Text Available The epithelial cells of the sea urchin Hemicentrotus pulcherrimus embryo express an Epith-2, uncharacterized glycoprotein, on the lateral surface. Here, we describe internalization of Epith-2 during mesenchyme formation through the epithelial-to-mesenchymal transition (EMT. Epith-2 was first expressed on the entire egg surface soon after fertilization and on the blastomeres until the 4-cell stage, but was localized to the lateral surface of epithelial cells at and after the 16-cell stage throughout the later developmental period. However, primary (PMC and secondary mesenchyme cells (SMC that ingress by EMT lost Epith-2 from their cell surface by endocytosis during dissociation from the epithelium, which was associated with the appearance of cytoplasmic Epith-2 dots. The cytoplasmic Epith-2 retained a similar relative molecular mass to that of the cell surface immediately after ingression through the early period of the spreading to single cells. Then, Epith-2 was completely lost from the cytoplasm. Tyrosine residues of Epith-2 were phosphorylated. The endocytic retraction of Epith-2 was inhibited by herbimycin A (HA, a protein tyrosine kinase (PTK inhibitor, and suramin, a growth factor receptor (GFR inhibitor, suggesting the involvement of the GFR/PTK (GP signaling pathway. These two GP inhibitors also inhibited PMC and SMC spreading to individual cells after ingression, but the dissociation of PMC and SMC from the epithelium was not inhibited. In suramin-treated embryos, dissociated mesenchyme cells migrated partially by retaining their epithelial morphology. In HA-treated embryos, no mesenchyme cells migrated. Thus, the EMT occurs in relation to internalization of Epith-2 from presumptive PMC and SMC.

Association between Ability Emotional Intelligence and Left Insula during Social Judgment of Facial Emotions.

Science.gov (United States)

Quarto, Tiziana; Blasi, Giuseppe; Maddalena, Chiara; Viscanti, Giovanna; Lanciano, Tiziana; Soleti, Emanuela; Mangiulli, Ivan; Taurisano, Paolo; Fazio, Leonardo; Bertolino, Alessandro; Curci, Antonietta

2016-01-01

The human ability of identifying, processing and regulating emotions from social stimuli is generally referred as Emotional Intelligence (EI). Within EI, Ability EI identifies a performance measure assessing individual skills at perceiving, using, understanding and managing emotions. Previous models suggest that a brain "somatic marker circuitry" (SMC) sustains emotional sub-processes included in EI. Three primary brain regions are included: the amygdala, the insula and the ventromedial prefrontal cortex (vmPFC). Here, our aim was to investigate the relationship between Ability EI scores and SMC activity during social judgment of emotional faces. Sixty-three healthy subjects completed a test measuring Ability EI and underwent fMRI during a social decision task (i.e. approach or avoid) about emotional faces with different facial expressions. Imaging data revealed that EI scores are associated with left insula activity during social judgment of emotional faces as a function of facial expression. Specifically, higher EI scores are associated with greater left insula activity during social judgment of fearful faces but also with lower activity of this region during social judgment of angry faces. These findings indicate that the association between Ability EI and the SMC activity during social behavior is region- and emotion-specific.

Breast cancer and the stromal factor: The "prometastatic healing process" hypothesis

Directory of Open Access Journals (Sweden)

Mario Wernicke

2011-02-01

Full Text Available The correlation between axillary status and several histological features of breast carcinomas has been well established, however stromal changes have rarely been analyzed. Detailed clinicopathological review of 1803 patients with infiltrating breast carcinoma was performed. Stromal myxoid changes (SMC, size (T2-T3: > 2 cm, T1c: 1-2 cm, T1 a-b: < 1cm, fibrotic focus, age, lymphovascular embolizations, tumor infiltrating lymphocytes (TIL, multifocality, histological grade (G, estrogen receptors (ER, progesterone receptors (PR and HER2 were semi-quantitated in two or three grades and correlated to axillary status. SMC3 followed by T2-T3, G3, fibrotic focus, T1c, embolizations, SMC2, TIL2, G2 and multifocality were strongly associated with positive axillary nodes; an inverse association was found with ER+++ and PR+++. Our findings support a critical role of the peritumoral stroma in the development of metastases. These stromal alterations should be remarked in routine pathology reports as they can be easily assessed and provide important information about tumor biology and aggressiveness. They could also become, in a future, the target of novel therapeutics.

Preserving half-metallic surface states in Cr O2 : Insights into surface reconstruction rules

Science.gov (United States)

Deng, Bei; Shi, X. Q.; Chen, L.; Tong, S. Y.

2018-04-01

The issue of whether the half-metallic (HM) nature of Cr O2 could be retained at its surface has been a standing problem under debate for a few decades, but until now is still controversial. Here, based on the density functional theory calculations we show, in startling contrast to the previous theoretical understandings, that the surfaces of Cr O2 favorably exhibit a half-metallic-semiconducting (SmC) transition driven by means of a surface electronic reconstruction largely attributed to the participation of the unexpected local charge carriers (LCCs), which convert the HM double exchange surface state into a SmC superexchange state and in turn, stabilize the surface as well. On the basis of the LCCs model, a new insight into the surface reconstruction rules is attained. Our novel finding not only provided an evident interpretation for the widely observed SmC character of Cr O2 surface, but also offered a novel means to improve the HM surface states for a variety of applications in spintronics and superconductors, and promote the experimental realization of the quantum anomalous Hall effect in half-metal based systems.

Two-Link Flexible Manipulator Control Using Sliding Mode Control Based Linear Matrix Inequality

Science.gov (United States)

Zulfatman; Marzuki, Mohammad; Alif Mardiyah, Nur

2017-04-01

Two-link flexible manipulator is a manipulator robot which at least one of its arms is made of lightweight material and not rigid. Flexible robot manipulator has some advantages over the rigid robot manipulator, such as lighter, requires less power and costs, and to result greater payload. However, suitable control algorithm to maintain the two-link flexible robot manipulator in accurate positioning is very challenging. In this study, sliding mode control (SMC) was employed as robust control algorithm due to its insensitivity on the system parameter variations and the presence of disturbances when the system states are sliding on a sliding surface. SMC algorithm was combined with linear matrix inequality (LMI), which aims to reduce the effects of chattering coming from the oscillation of the state during sliding on the sliding surface. Stability of the control algorithm is guaranteed by Lyapunov function candidate. Based on simulation works, SMC based LMI resulted in better performance improvements despite the disturbances with significant chattering reduction. This was evident from the decline of the sum of squared tracking error (SSTE) and the sum of squared of control input (SSCI) indexes respectively 25.4% and 19.4%.

Bone morphogenetic protein-induced MSX1 and MSX2 inhibit myocardin-dependent smooth muscle gene transcription.

Science.gov (United States)

Hayashi, Ken'ichiro; Nakamura, Seiji; Nishida, Wataru; Sobue, Kenji

2006-12-01

During the onset and progression of atherosclerosis, the vascular smooth muscle cell (VSMC) phenotype changes from differentiated to dedifferentiated, and in some cases, this change is accompanied by osteogenic transition, resulting in vascular calcification. One characteristic of dedifferentiated VSMCs is the down-regulation of smooth muscle cell (SMC) marker gene expression. Bone morphogenetic proteins (BMPs), which are involved in the induction of osteogenic gene expression, are detected in calcified vasculature. In this study, we found that the BMP2-, BMP4-, and BMP6-induced expression of Msx transcription factors (Msx1 and Msx2) preceded the down-regulation of SMC marker expression in cultured differentiated VSMCs. Either Msx1 or Msx2 markedly reduced the myocardin-dependent promoter activities of SMC marker genes (SM22alpha and caldesmon). We further investigated interactions between Msx1 and myocardin/serum response factor (SRF)/CArG-box motif (cis element for SRF) using coimmunoprecipitation, gel-shift, and chromatin immunoprecipitation assays. Our results showed that Msx1 or Msx2 formed a ternary complex with SRF and myocardin and inhibited the binding of SRF or SRF/myocardin to the CArG-box motif, resulting in inhibition of their transcription.

Bone Morphogenetic Protein-Induced Msx1 and Msx2 Inhibit Myocardin-Dependent Smooth Muscle Gene Transcription▿

Science.gov (United States)

Hayashi, Ken'ichiro; Nakamura, Seiji; Nishida, Wataru; Sobue, Kenji

2006-01-01

During the onset and progression of atherosclerosis, the vascular smooth muscle cell (VSMC) phenotype changes from differentiated to dedifferentiated, and in some cases, this change is accompanied by osteogenic transition, resulting in vascular calcification. One characteristic of dedifferentiated VSMCs is the down-regulation of smooth muscle cell (SMC) marker gene expression. Bone morphogenetic proteins (BMPs), which are involved in the induction of osteogenic gene expression, are detected in calcified vasculature. In this study, we found that the BMP2-, BMP4-, and BMP6-induced expression of Msx transcription factors (Msx1 and Msx2) preceded the down-regulation of SMC marker expression in cultured differentiated VSMCs. Either Msx1 or Msx2 markedly reduced the myocardin-dependent promoter activities of SMC marker genes (SM22α and caldesmon). We further investigated interactions between Msx1 and myocardin/serum response factor (SRF)/CArG-box motif (cis element for SRF) using coimmunoprecipitation, gel-shift, and chromatin immunoprecipitation assays. Our results showed that Msx1 or Msx2 formed a ternary complex with SRF and myocardin and inhibited the binding of SRF or SRF/myocardin to the CArG-box motif, resulting in inhibition of their transcription. PMID:17030628

Fatigue during breast cancer radiotherapy: an initial randomized study of cognitive-behavioral therapy plus hypnosis.

Science.gov (United States)

Montgomery, Guy H; Kangas, Maria; David, Daniel; Hallquist, Michael N; Green, Sheryl; Bovbjerg, Dana H; Schnur, Julie B

2009-05-01

The study purpose was to test the effectiveness of a psychological intervention combining cognitive-behavioral therapy and hypnosis (CBTH) to treat radiotherapy-related fatigue. Women (n = 42) scheduled for breast cancer radiotherapy were randomly assigned to receive standard medical care (SMC) (n = 20) or a CBTH intervention (n = 22) in addition to SMC. Participants assigned to receive CBTH met individually with a clinical psychologist. CBTH participants received training in hypnosis and CBT. Participants assigned to the SMC control condition did not meet with a study psychologist. Fatigue was measured on a weekly basis by using the fatigue subscale of the Functional Assessment of Chronic Illness Therapy (FACIT) and daily using visual analogue scales. Multilevel modeling indicated that for weekly FACIT fatigue data, there was a significant effect of the CBTH intervention on the rate of change in fatigue (p < .05), such that on average, CBTH participants' fatigue did not increase over the course of treatment, whereas control group participants' fatigue increased linearly. Daily data corroborated the analyses of weekly data. The results suggest that CBTH is an effective means for controlling and potentially preventing fatigue in breast cancer radiotherapy patients.

Neuroprotective effect of S-allyl-l-cysteine derivatives against endoplasmic reticulum stress-induced cytotoxicity is independent of calpain inhibition.

Science.gov (United States)

Imai, Toru; Kosuge, Yasuhiro; Saito, Hiroaki; Uchiyama, Taketo; Wada, Taira; Shimba, Shigeki; Ishige, Kumiko; Miyairi, Shinichi; Makishima, Makoto; Ito, Yoshihisa

2016-03-01

S-allyl-l-cysteine (SAC) is known to have neuroprotective properties. We synthesized various SAC derivatives and tested their effects on endoplasmic reticulum stress-induced neurotoxicity in cultured hippocampal neurons (HPNs). Among the compounds tested, S-propyl-l-cysteine (SPC) exhibited the strongest neuroprotective activity in HPNs, followed by S-ethyl-l-cysteine (SEC) and S-methyl-l-cysteine (SMC). Unlike SAC and SMC, SPC and SEC did not have inhibitory activity on μ-calpain, suggesting that the mechanism underlying the protective activity of SPC and SEC differs from that of SAC. Copyright © 2016 Japanese Pharmacological Society. Production and hosting by Elsevier B.V. All rights reserved.

Second Order Sliding Mode Control of the Coupled Tanks System

Directory of Open Access Journals (Sweden)

Fayiz Abu Khadra

2015-01-01

Full Text Available Four classes of second order sliding mode controllers (2-SMC have been successfully applied to regulate the liquid level in the second tank of a coupled tanks system. The robustness of these classes of 2-SMC is investigated and their performances are compared with a first order controller to show the merits of these controllers. The effectiveness of these controllers is verified through computer simulations. Comparison between the controllers is based on the time domain performance measures such as rise time, settling time, and the integral absolute error. Results showed that controllers are able to regulate the liquid level with small differences in their performance.

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ion ... SMC protein, putative [Staphylococcus epidermidis RP62A] ... Length = 198 ... Query: 3 ... YLKSIDAIGFKSFADHT...NVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGAKM 62 ... YLKSIDAIGFKSFADHT...NVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGAKM Sbjct: 1 ... YLKSIDAIGFKSFADHTNVQFDKGVTAIVGPNGSGKSNITDA

Deep Chandra Survey of the Small Magellanic Cloud. II. Timing Analysis of X-Ray Pulsars

Energy Technology Data Exchange (ETDEWEB)

Hong, JaeSub; Antoniou, Vallia; Zezas, Andreas; Drake, Jeremy J.; Plucinsky, Paul P. [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Haberl, Frank [Max-Planck-Institut für extraterrestrische Physik, Giessenbach straße, D-85748 Garching (Germany); Sasaki, Manami [Friedrich-Alexander-Universität Erlangen-Nürnberg, Sternwartstrasse 7, 96049 Bamberg (Germany); Laycock, Silas, E-mail: jaesub@head.cfa.harvard.edu [Department of Physics, University of Massachusetts Lowell, MA 01854 (United States)

2017-09-20

We report the timing analysis results of X-ray pulsars from a recent deep Chandra survey of the Small Magellanic Cloud (SMC). We analyzed a total exposure of 1.4 Ms from 31 observations over a 1.2 deg{sup 2} region in the SMC under a Chandra X-ray Visionary Program. Using the Lomb–Scargle and epoch-folding techniques, we detected periodic modulations from 20 pulsars and a new candidate pulsar. The survey also covered 11 other pulsars with no clear sign of periodic modulation. The 0.5–8 keV X-ray luminosity ( L {sub X} ) of the pulsars ranges from 10{sup 34} to 10{sup 37} erg s{sup −1} at 60 kpc. All of the Chandra sources with L {sub X} ≳ 4 × 10{sup 35} erg s{sup −1} exhibit X-ray pulsations. The X-ray spectra of the SMC pulsars (and high-mass X-ray binaries) are in general harder than those of the SMC field population. All but SXP 8.02 can be fitted by an absorbed power-law model with a photon index of Γ ≲ 1.5. The X-ray spectrum of the known magnetar SXP 8.02 is better fitted with a two-temperature blackbody model. Newly measured pulsation periods of SXP 51.0, SXP 214, and SXP 701, are significantly different from the previous XMM-Newton and RXTE measurements. This survey provides a rich data set for energy-dependent pulse profile modeling. Six pulsars show an almost eclipse-like dip in the pulse profile. Phase-resolved spectral analysis reveals diverse spectral variations during pulsation cycles: e.g., for an absorbed power-law model, some exhibit an (anti)-correlation between absorption and X-ray flux, while others show more intrinsic spectral variation (i.e., changes in photon indices).

Field evaluation of the effectiveness of three industrial by-products as organic amendments for phytostabilization of a Pb/Zn mine tailings.

Science.gov (United States)

Yang, Shengxiang; Cao, Jianbing; Li, Fengmei; Peng, Xizhu; Peng, Qingjing; Yang, Zhihui; Chai, Liyuan

2016-01-01

Although the potential of industrial by-products as organic amendments for phytostabilization has long been recognized, most of the previous studies addressing this issue have been laboratory-based. In this study, a field trial was conducted to evaluate the effectiveness of three industrial by-products [sweet sorghum vinasse (SSV), medicinal herb residues (MHR) and spent mushroom compost (SMC)] as organic amendments for phytostabilization of abandoned Pb/Zn mine tailings. Our results showed the following: (i) when compared to the control tailings, the mean concentrations of diethylene-triamine-pentaacetic acid (DTPA)-extractable Cd, Cu, Pb and Zn in SSV, MHR and SMC treatments decreased by 20.8-28.0%, 41.6-49.1%, 17.7-22.7% and 9.5-14.7%, respectively; (ii) the mean values of organic C, ammonium-N and available P in SSV, MHR and SMC treatments increased by 1.7-2.8, 10.8-14.9 and 3.9-5.1 times as compared with the mine tailings; and (iii) the addition of SSV, MHR and SMC significantly enhanced soil respiration and microbial biomass being 1.5-1.8 and 1.3-1.6 fold higher than those in the control tailings. There were no significant differences in soil biochemical properties among the plots amended with these by-products, suggesting that they were almost equally effective in improving the biochemical conditions of the tailings. In addition, the application of these amendments promoted seed germination, seedling growth, and consequently increased the vegetation cover and its biomass. Moreover, concentrations of Cd, Cu, Pb and Zn in above-ground parts of the plants were below the toxicity limit levels for animals. The results obtained in this field study confirmed that the three organic-rich industrial by-products could be used as amendments for phytostabilization of some types of mine tailings.

Washington photometry of 14 intermediate-age to old star clusters in the Small Magellanic Cloud

Science.gov (United States)

Piatti, Andrés E.; Clariá, Juan J.; Bica, Eduardo; Geisler, Doug; Ahumada, Andrea V.; Girardi, Léo

2011-10-01

We present CCD photometry in the Washington system C, T1 and T2 passbands down to T1˜ 23 in the fields of L3, L28, HW 66, L100, HW 79, IC 1708, L106, L108, L109, NGC 643, L112, HW 84, HW 85 and HW 86, 14 Small Magellanic Cloud (SMC) clusters, most of them poorly studied objects. We measured T1 magnitudes and C-T1 and T1-T2 colours for a total of 213 516 stars spread throughout cluster areas of 14.7 × 14.7 arcmin2 each. We carried out an in-depth analysis of the field star contamination of the colour-magnitude diagrams (CMDs) and statistically cleaned the cluster CMDs. Based on the best fits of isochrones computed by the Padova group to the (T1, C-T1) CMDs, as well as from the δ(T1) index and the standard giant branch procedure, we derived ages and metallicities for the cluster sample. With the exception of IC 1708, a relatively metal-poor Hyades-age cluster, the remaining 13 objects are between intermediate and old age (from 1.0 to 6.3 Gyr), their [Fe/H] values ranging from -1.4 to -0.7 dex. By combining these results with others available in the literature, we compiled a sample of 43 well-known SMC clusters older than 1 Gyr, with which we produced a revised age distribution. We found that the present clusters' age distribution reveals two primary excesses of clusters at t˜ 2 and 5 Gyr, which engraves the SMC with clear signs of enhanced formation episodes at both ages. In addition, we found that from the birth of the SMC cluster system until approximately the first 4 Gyr of its lifetime, the cluster formation resembles that of a constant formation rate scenario.

A study of a three-dimensional PLGA sponge containing natural polymers co-cultured with endothelial and mesenchymal stem cells as a tissue engineering scaffold

International Nuclear Information System (INIS)

Shim, Jung Bo; Kim, Hyeongseok; Khang, Gilson; Ankeny, Randall F; Nerem, Robert M

2014-01-01

The interaction between vascular endothelial cells (ECs) and vascular smooth muscle cells (VSMCs) in a complex hemodynamic and mechanical environment plays an important role in the control of blood vessel growth and function. Despite the importance of VSMCs, substitutes are needed for vascular therapies. A potential VSMC substitute is human adult bone marrow derived mesenchymal stem cells (hMSCs). In this study, the effect of poly(lactic-co-glycolic acid) (PLGA) scaffolds containing three natural polymers (demineralized bone particles, silk, and small intestine submucosa) on the phenotype of MSCs and SMCs cultured with or without ECs was investigated. The study objective was to create a media equivalent for a tissue engineered blood vessel using PLGA, natural polymers, and MSCs co-cultured with ECs. The PLGA containing the natural polymers silk and SIS showed increased proliferation and cell adhesion. The presence of silk and DBP promoted a MSC phenotype change into a SMC-like phenotype at the mRNA level; however these differences at the protein level were not seen. Additionally, PLGA containing SIS did not induce SMC gene or protein upregulation. Finally, the effect of ECs in combination with the natural polymers was tested. When co-cultured with ECs, the mRNA of SMC specific markers in MSCs and SMCs were increased when compared to SMCs or MSCs alone. However, MSCs, when co-cultured with ECs on PLGA containing silk, exhibited significantly increased α-SMA and calponin expression when compared to PLGA only scaffolds. These results indicate that the natural polymer silk in combination with the co-culture of endothelial cells was most effective at increasing cell viability and inducing a SMC-like phenotype at the mRNA and protein level in MSCs. (paper)

The low-metallicity starburst NGC346: massive-star population and feedback

Science.gov (United States)

Oskinova, Lida

2017-08-01

The Small Magellanic Cloud (SMC) is ideal to study young, massive stars at low metallicity. The compact cluster NGC346 contains about half of all O-type stars in the entire SMC. The massive-star population of this cluster powers N66, the brightest and largest HII region in the SMC. We propose to use HST-STIS to slice NGC346 with 20 long-slit exposures, in order to obtain the UV spectra of most of the massive early-type stars of this cluster. Archival data of 13 exposures that cover already a minor part of this cluster will be included in our analyses. Our aim is to quantitatively analyze virtually the whole massive-star population of NGC346. We have already secured the optical spectra of all massive stars in the field with the integral-field spectrograph MUSE at the ESO-VLT. However, for the determination of the stellar-wind parameters, i.e. the mass-loss rates and the wind velocities, ultraviolet spectra are indispensable. Our advanced Potsdam Wolf-Rayet (PoWR) code will be used for modeling the stellar and wind spectra in the course of the analysis. Finally, we will obtain:(a) the fundamental stellar and wind parameters of all stars brighter than spectral type B2V in the field, which, e,g,, will constrain the initial mass function in this young low-metallicity starburst;(b) mass-loss rates of many more OB-type stars at SMC metallicity than hitherto known, allowing to better constrain their metallicity dependence;(c) the integrated feedback by ionizing radiation and stellar winds of the whole massive-star population of NGC346, which will be used as input to model the ecology of the giant HII region N66.These HST UV data will be of high legacy value.

Which factors enhance positive drug reimbursement recommendation in Scotland? A retrospective analysis 2006-2013.

Science.gov (United States)

Charokopou, Mata; Majer, Istvan M; Raad, Johan de; Broekhuizen, Stefan; Postma, Maarten; Heeg, Bart

2015-03-01

To identify the factors that influence the Scottish Medicines Consortium (SMC) in deciding whether to accept pharmaceutical technologies for use within the Scottish health care system. A database of SMC submissions between 2006 and 2013 was created, containing a range of clinical, economic, and other factors extracted from published health technology assessment reports. A binomial outcome variable was used, defined as the decision to "accept for use" or "not recommend" a technology. Univariate and multivariate analyses were conducted to assess the impact by means of odds ratios (ORs) of the submitted evidence on the recommendation decision. Out of 463 applications, 265 were accepted for use (57%) and 198 (43%) were not recommended for use within National Health Service Scotland. Univariate analyses showed that 13 variables significantly affected the SMC decision. Of these 13 variables, 7 variables were shown to have a meaningful impact in the multivariate analysis. Four of these concerned the outcome of cost-effectiveness analyses; the fact that a submission was supported by a cost-minimization analysis was the strongest positive variable (OR = 10.30) and a submission showing a product not being cost-effective (i.e., incremental cost-effectiveness ratio above £30,000/quality-adjusted life-year gained) was the strongest negative predictor (OR = 0.47). The other variables concerned whether the submission was related to a product indicated for a nervous system disease (OR = 0.41), whether it was indicated for nonchronic use (OR = 1.66), and whether the submission was performed by a big company (OR = 2.83). This study demonstrated that the outcome of cost-effectiveness analyses is an important factor affecting the SMC's reimbursement recommendation decision. Copyright © 2015. Published by Elsevier Inc.

Association of Plasma Neurofilament Light Chain with Neocortical Amyloid-β Load and Cognitive Performance in Cognitively Normal Elderly Participants.

Science.gov (United States)

Chatterjee, Pratishtha; Goozee, Kathryn; Sohrabi, Hamid R; Shen, Kaikai; Shah, Tejal; Asih, Prita R; Dave, Preeti; ManYan, Candice; Taddei, Kevin; Chung, Roger; Zetterberg, Henrik; Blennow, Kaj; Martins, Ralph N

2018-01-01

The disruption of neurofilament, an axonal cytoskeletal protein, in neurodegenerative conditions may result in neuronal damage and its release into the cerebrospinal fluid and blood. In Alzheimer's disease (AD), neurofilament light chain (NFL), a neurofilament subunit, is elevated in the cerebrospinal fluid and blood. Investigate the association of plasma NFL with preclinical-AD features, such as high neocortical amyloid-β load (NAL) and subjective memory complaints, and cognitive performance in cognitively normal older adults. Plasma NFL concentrations were measured employing the single molecule array platform in participants from the Kerr Anglican Retirement Village Initiative in Ageing Health cohort, aged 65- 90 years. Participants underwent a battery of neuropsychological testing to evaluate cognitive performance and were categorized as low NAL (NAL-, n = 65) and high NAL (NAL+, n = 35) assessed via PET, and further stratified into subjective memory complainers (SMC; nNAL- = 51, nNAL+ = 25) and non-SMC (nNAL- = 14, nNAL+ = 10) based on the Memory Assessment Clinic- Questionnaire. Plasma NFL inversely correlated with cognitive performance. No significant difference in NFL was observed between NAL+ and NAL- participants; however, within APOEɛ4 non-carriers, higher NAL was observed in individuals with NFL concentrations within quartiles 3 and 4 (versus quartile 1). Additionally, within the NAL+ participants, SMC had a trend of higher NFL compared to non-SMC. Plasma NFL is inversely associated with cognitive performance in elderly individuals. While plasma NFL may not reflect NAL in individuals with normal global cognition, the current observations indicate that onset of axonal injury, reflected by increased plasma NFL, within the preclinical phase of AD may contribute to the pathogenesis of AD.

Throughfall-mediated alterations to soil microbial community structure in a forest plot of homogenous soil texture, litter, and plant species composition

Science.gov (United States)

Van Stan, John; Rosier, Carl; Moore, Leslie; Gay, Trent; Reichard, James; Wu, Tiehang; Kan, Jinjun

2015-04-01

Identifying spatiotemporal influences on soil microbial community (SMC) structure is critical to our understanding of patterns in biogeochemical cycling and related ecological services (e.g., plant community structure, water quality, response to environmental change). Since forest canopy structure alters the spatiotemporal patterning of precipitation water and solute supplies to soils (via "throughfall"), is it possible that changes in SMC structure could arise from modifications in canopy elements? Our study investigates this question by monitoring throughfall water and dissolved ion supply to soils beneath a continuum of canopy structure: from large gaps (0% cover), to bare Quercus virginiana Mill. (southern live oak) canopy (~50-70%), to heavy Tillandsia usneoides L. (Spanish moss) canopy (>90% cover). Throughfall water supply diminished with increasing canopy cover, yet increased washoff/leaching of Na+, Cl-, PO43-, and SO42- from the canopy to the soils. Presence of T. usneoides diminished throughfall NO3-, but enhanced NH4+, concentrations supplied to subcanopy soils. The mineral soil horizon (0-10 cm) sampled in triplicate from locations receiving throughfall water and solutes from canopy gaps, bare canopy, and T. usneoides-laden canopy significantly differed in soil chemistry parameters (pH, Ca2+, Mg2+, CEC). Polymerase Chain Reaction-Denaturant Gradient Gel Electrophoresis (PCR-DGGE) banding patterns beneath similar canopy covers (experiencing similar throughfall dynamics) also produced high similarities per ANalyses Of SIMilarity (ANO-SIM), and clustered together when analyzed by Nonmetric Multidimensional Scaling (NMDS). These results suggest that modifications of forest canopy structures are capable of affecting mineral-soil horizon SMC structure via throughfall when canopies' biomass distribution is highly heterogeneous. As SMC structure, in many instances, relates to functional diversity, we suggest that future research seek to identify functional

Sustained hypoxia leads to the emergence of cells with enhanced growth, migratory, and promitogenic potentials within the distal pulmonary artery wall.

Science.gov (United States)

Frid, Maria G; Li, Min; Gnanasekharan, Meena; Burke, Danielle L; Fragoso, Miguel; Strassheim, Derek; Sylman, Joanna L; Stenmark, Kurt R

2009-12-01

All forms of chronic pulmonary hypertension (PH) are characterized by structural remodeling of the pulmonary artery (PA) media, a process previously attributed solely to changes in the phenotype of resident smooth muscle cells (SMC). However, recent experimental evidence in both systemic and pulmonary circulations suggests that other cell types, including circulating and local progenitors, contribute significantly to this process. The goal of this study was to determine if hypoxia-induced remodeling of distal PA (dPA) media involves the emergence of cells with phenotypic and functional characteristics distinct from those of resident dPA SMC and fibroblasts. In vivo, in contrast to the phenotypically uniform SMC composition of dPA media in control calves, the remodeled dPA media of neonatal calves with severe hypoxia-induced PH comprised cells exhibiting a distinct phenotype, including the expression of hematopoetic (CD45), leukocytic/monocytic (CD11b, CD14), progenitor (cKit), and motility-associated (S100A4) cell markers. Consistent with these in vivo observations, primary cell cultures isolated from dPA media of hypertensive calves yielded not only differentiated SMC, but also smaller, morphologically rhomboidal (thus termed here "R") cells that transiently expressed CD11b, constitutively expressed the mesenchymal cell marker type I procollagen, expressed high mRNA levels of progenitor cell markers cKit, CD34, CD73, as well as for inflammatory mediators, IL-6 and MCP-1, and, with time in culture, gained expression of a myofibroblast marker, alpha-SM-actin. R cells exhibited highly augmented proliferative, migratory, invasive, and potent promitogenic capabilities, which were due, at least in part, to the production of PDGFs, SDF-1/CXCL12, and S100A4. These data suggest that the cellular mechanisms of dPA remodeling include the emergence of cells with phenotypic and functional characteristics markedly distinct from those of resident dPA cells.

Nitrergic neuromuscular transmission in the mouse internal anal sphincter is accomplished by multiple pathways and postjunctional effector cells

Science.gov (United States)

Sotherton, A. G.; Peri, L. E.; Sanders, K. M.; Ward, S. M.; Keef, K. D.

2014-01-01

The effector cells and second messengers participating in nitrergic neuromuscular transmission (NMT) were investigated in the mouse internal anal sphincter (IAS). Protein expression of guanylate cyclase (GCα, GCβ) and cyclic GMP-dependent protein kinase I (cGKI) were examined in cryostat sections with dual-labeling immunohistochemical techniques in PDGFRα+ cells, interstitial cells of Cajal (ICC), and smooth muscle cells (SMC). Gene expression levels were determined with quantitative PCR of dispersed cells from Pdgfrαegfp/+, KitcopGFP/+, and smMHCCre-egfp mice sorted with FACS. The relative gene and protein expression levels of GCα and GCβ were PDGFRα+ cells > ICC ≫ SMC. In contrast, cGKI gene expression sequence was SMC = ICC > PDGFRα+ cells whereas cGKI protein expression sequence was neurons > SMC ≫ ICC = PDGFRα+ cells. The functional role of cGKI was investigated in cGKI−/− mice. Relaxation with 8-bromo (8-Br)-cGMP was greatly reduced in cGKI−/− mice whereas responses to sodium nitroprusside (SNP) were partially reduced and forskolin responses were unchanged. A nitrergic relaxation occurred with nerve stimulation (NS, 5 Hz, 60 s) in cGKI+/+ and cGKI−/− mice although there was a small reduction in the cGKI−/− mouse. Nω-nitro-l-arginine (l-NNA) abolished responses during the first 20–30 s of NS in both animals. The GC inhibitor ODQ greatly reduced or abolished SNP and nitrergic NS responses in both animals. These data confirm an essential role for GC in NO-induced relaxation in the IAS. However, the expression of GC and cGKI by all three cell types suggests that each may participate in coordinating muscular responses to NO. The persistence of nitrergic NMT in the cGKI−/− mouse suggests the presence of a significant GC-dependent, cGKI-independent pathway. PMID:25301187

Estimation of Soil Moisture Content from the Spectral Reflectance of Bare Soils in the 0.4–2.5 µm Domain

Directory of Open Access Journals (Sweden)

Sophie Fabre

2015-02-01

Full Text Available This work aims to compare the performance of new methods to estimate the Soil Moisture Content (SMC of bare soils from their spectral signatures in the reflective domain (0.4–2.5 µm in comparison with widely used spectral indices like Normalized Soil Moisture Index (NSMI and Water Index SOIL (WISOIL. Indeed, these reference spectral indices use wavelengths located in the water vapour absorption bands and their performance are thus very sensitive to the quality of the atmospheric compensation. To reduce these limitations, two new spectral indices are proposed which wavelengths are defined using the determination matrix tool by taking into account the atmospheric transmission: Normalized Index of Nswir domain for Smc estimatiOn from Linear correlation (NINSOL and Normalized Index of Nswir domain for Smc estimatiOn from Non linear correlation (NINSON. These spectral indices are completed by two new methods based on the global shape of the soil spectral signatures. These methods are the Inverse Soil semi-Empirical Reflectance model (ISER, using the inversion of an existing empirical soil model simulating the soil spectral reflectance according to soil moisture content for a given soil class, and the convex envelope model, linking the area between the envelope and the spectral signature to the SMC. All these methods are compared using a reference database built with 32 soil samples and composed of 190 spectral signatures with five or six soil moisture contents. Half of the database is used for the calibration stage and the remaining to evaluate the performance of the SMC estimation methods. The results show that the four new methods lead to similar or better performance than the one obtained by the reference indices. The RMSE is ranging from 3.8% to 6.2% and the coefficient of determination R2 varies between 0.74 and 0.91 with the best performance obtained with the ISER model. In a second step, simulated spectral radiances at the sensor level are

OLD MAIN-SEQUENCE TURNOFF PHOTOMETRY IN THE SMALL MAGELLANIC CLOUD. II. STAR FORMATION HISTORY AND ITS SPATIAL GRADIENTS

International Nuclear Information System (INIS)

Noel, Noelia E. D.; Gallart, Carme; Hidalgo, Sebastian L.; Aparicio, Antonio; Costa, Edgardo; Mendez, Rene A.

2009-01-01

We present a quantitative analysis of the star formation history (SFH) of 12 fields in the Small Magellanic Cloud (SMC) based on unprecedented deep [(B - R), R] color-magnitude diagrams (CMDs). Our fields reach down to the oldest main-sequence turnoff with a high photometric accuracy, which is vital for obtaining accurate SFHs, particularly at intermediate and old ages. We use the IAC-pop code to obtain the SFH, using synthetic CMDs generated with IAC-star. We obtain the SFH as a function ψ(t, z) of age and metallicity. We also consider several auxiliary functions: the initial mass function (IMF), φ(m), and a function accounting for the frequency and relative mass distribution of binary stars, β(f, q). We find that there are several main periods of enhancement of star formation: a young one peaked at ∼0.2-0.5 Gyr old, only present in the eastern and in the central-most fields; two at intermediate ages present in all fields: a conspicuous one peaked at ∼4-5 Gyr, and a less significant one peaked at ∼1.5-2.5; and an old one, peaked at ∼10 Gyr in all fields but the western ones. In the western fields, this old enhancement splits into two, one peaked at ∼8 Gyr old and another at ∼12 Gyr old. This 'two-enhancement' zone is unaffected by our choice of stellar evolutionary library but more data covering other fields of the SMC are necessary in order to ascertain its significancy. Correlation between star formation rate enhancements and SMC-Milky Way encounters is not clear. Some correlation could exist with encounters taken from the orbit determination of Kallivayalil et al. But our results would also fit in a first pericenter passage scenario like the one claimed by Besla et al. For SMC-Large Magellanic Cloud encounters, we find a correlation only for the most recent encounter ∼0.2 Gyr ago. This coincides with the youngest ψ(t) enhancement peaked at these ages in our eastern fields. The population younger than 1 Gyr represents ∼7%-12% of the total �

Adding chiropractic to standard medical therapy for nonspecific low back pain

DEFF Research Database (Denmark)

Goertz, Christine M; Long, Cynthia R; Hondras, Maria

2013-01-01

Study Design. Randomized controlled trial.Objective. To assess changes in pain levels and physical functioning in response to standard medical care (SMC) versus SMC plus chiropractic manipulative therapy (CMT) for the treatment of low back pain (LBP) among 18 to 35-year-old active-duty military...... physical functioning when compared with only standard care, for men and women between 18 and 35 years of age with acute LBP........ The primary outcome measures were changes in back-related pain on the numerical rating scale and physical functioning at 4 weeks on the Roland-Morris Disability Questionnaire and back pain functional scale (BPFS).Results. Mean Roland-Morris Disability Questionnaire scores decreased in both groups during...

Sliding Mode Control of PMSG Wind Turbine Based on Enhanced Exponential Reaching Law

DEFF Research Database (Denmark)

Mozayan, Seyed Mehdi; Saad, Maarouf; Vahedi, Hani

2016-01-01

This paper proposes a Sliding Mode Control (SMC) based scheme for a variable speed, direct-driven Wind Energy Conversion Systems (WECS) equipped with Permanent Magnet Synchronous Generator (PMSG) connected to the grid. In this work, diode rectifier, boost converter, Neutral Point Clamped (NPC......) inverter and L filter are used as the interface between the wind turbine and grid. This topology has abundant features such as simplicity for low and medium power wind turbine applications. It is also less costly than back-to-back two-level converters in medium power applications. SMC approach demonstrates...... is explored by simulation study on a 4 kW wind turbine, and then verified by experimental tests for a 2 kW set-up....

Development of a low-cost double rotor axial flux motor with soft magnetic composite and ferrite permanent magnet materials

Science.gov (United States)

Liu, Chengcheng; Zhu, Jianguo; Wang, Youhua; Guo, Youguang; Lei, Gang; Liu, Xiaojing

2015-05-01

This paper proposes a low-cost double rotor axial flux motor (DRAFM) with low cost soft magnetic composite (SMC) core and ferrite permanent magnets (PMs). The topology and operating principle of DRAFM and design considerations for best use of magnetic materials are presented. A 905 W 4800 rpm DRAFM is designed for replacing the high cost NdFeB permanent magnet synchronous motor (PMSM) in a refrigerator compressor. By using the finite element method, the electromagnetic parameters and performance of the DRAFM operated under the field oriented control scheme are calculated. Through the analysis, it is shown that that the SMC and ferrite PM materials can be good candidates for low-cost electric motor applications.

Distortion of absorption-line velocity curves due to x-ray heating in x-ray binaries

International Nuclear Information System (INIS)

Milgrom, M.

1976-01-01

The effects of X-ray heating on the measured absorption line velocities, in X-ray binaries with low X-rays to optical luminosities ratio are considered. These effects may be appreciable even for such binaries where the effect of X-ray heating on the light-curve is negligible. The effects are studied qualitatively and suggest possible ways to partially eliminate the systematic errors introduced by them. The individual systems Cyg x-1 and SMC x-1 are treated and the results of numerical calculations are presented for them. For Cyg x-1 it is found that the effect is detectable during the X-ray 'high' state in all regions of the spectrum. During the 'low' state it may be important in the red region of the spectrum. The results for the case in which soft X-ray fluxes (E < or approximately .4 keV, suggested by theoretical models) are present are also given. For SMC x-1 a strong effect for Hα, Hβ, Hγ had been found. This effect may be responsible for the observed variable velocity curve. We also find for SMC x-1 that the average X-ray intensity falling on the primary must be considerably smaller than what is derived from the detected flux, or else the effect is too large. (author)

Cleavage of cohesin rings coordinates the separation of centrioles and chromatids.

Science.gov (United States)

Schöckel, Laura; Möckel, Martin; Mayer, Bernd; Boos, Dominik; Stemmann, Olaf

2011-07-10

Cohesin pairs sister chromatids by forming a tripartite Scc1-Smc1-Smc3 ring around them. In mitosis, cohesin is removed from chromosome arms by the phosphorylation-dependent prophase pathway. Centromeric cohesin is protected by shugoshin 1 and protein phosphatase 2A (Sgo1-PP2A) and opened only in anaphase by separase-dependent cleavage of Scc1 (refs 4-6). Following chromosome segregation, centrioles loosen their tight orthogonal arrangement, which licenses later centrosome duplication in S phase. Although a role of separase in centriole disengagement has been reported, the molecular details of this process remain enigmatic. Here, we identify cohesin as a centriole-engagement factor. Both premature sister-chromatid separation and centriole disengagement are induced by ectopic activation of separase or depletion of Sgo1. These unscheduled events are suppressed by expression of non-cleavable Scc1 or inhibition of the prophase pathway. When endogenous Scc1 is replaced by artificially cleavable Scc1, the corresponding site-specific protease triggers centriole disengagement. Separation of centrioles can alternatively be induced by ectopic cleavage of an engineered Smc3. Thus, the chromosome and centrosome cycles exhibit extensive parallels and are coordinated with each other by dual use of the cohesin ring complex.

Tuning the Pore Geometry of Ordered Mesoporous Carbons for Enhanced Adsorption of Bisphenol-A

Directory of Open Access Journals (Sweden)

Wannes Libbrecht

2015-04-01

Full Text Available Mesoporous carbons were synthesized via both soft and hard template methods and compared to a commercial powder activated carbon (PAC for the adsorption ability of bisphenol-A (BPA from an aqueous solution. The commercial PAC had a BET-surface of 1027 m2/g with fine pores of 3 nm and less. The hard templated carbon (CMK-3 material had an even higher BET-surface of 1420 m2/g with an average pore size of 4 nm. The soft templated carbon (SMC reached a BET-surface of 476 m2/g and a pore size of 7 nm. The maximum observed adsorption capacity (qmax of CMK-3 was the highest with 474 mg/g, compared to 290 mg/g for PAC and 154 mg/g for SMC. The difference in adsorption capacities was attributed to the specific surface area and hydrophobicity of the adsorbent. The microporous PAC showed the slowest adsorption, while the ordered mesopores of SMC and CMK-3 enhanced the BPA diffusion into the adsorbent. This difference in adsorption kinetics is caused by the increase in pore diameter. However, CMK-3 with an open geometry consisting of interlinked nanorods allows for even faster intraparticle diffusion.

Hypomorphism in human NSMCE2 linked to primordial dwarfism and insulin resistance.

Science.gov (United States)

Payne, Felicity; Colnaghi, Rita; Rocha, Nuno; Seth, Asha; Harris, Julie; Carpenter, Gillian; Bottomley, William E; Wheeler, Eleanor; Wong, Stephen; Saudek, Vladimir; Savage, David; O'Rahilly, Stephen; Carel, Jean-Claude; Barroso, Inês; O'Driscoll, Mark; Semple, Robert

2014-09-01

Structural maintenance of chromosomes (SMC) complexes are essential for maintaining chromatin structure and regulating gene expression. Two the three known SMC complexes, cohesin and condensin, are important for sister chromatid cohesion and condensation, respectively; however, the function of the third complex, SMC5-6, which includes the E3 SUMO-ligase NSMCE2 (also widely known as MMS21) is less clear. Here, we characterized 2 patients with primordial dwarfism, extreme insulin resistance, and gonadal failure and identified compound heterozygous frameshift mutations in NSMCE2. Both mutations reduced NSMCE2 expression in patient cells. Primary cells from one patient showed increased micronucleus and nucleoplasmic bridge formation, delayed recovery of DNA synthesis, and reduced formation of foci containing Bloom syndrome helicase (BLM) after hydroxyurea-induced replication fork stalling. These nuclear abnormalities in patient dermal fibroblast were restored by expression of WT NSMCE2, but not a mutant form lacking SUMO-ligase activity. Furthermore, in zebrafish, knockdown of the NSMCE2 ortholog produced dwarfism, which was ameliorated by reexpression of WT, but not SUMO-ligase-deficient NSMCE. Collectively, these findings support a role for NSMCE2 in recovery from DNA damage and raise the possibility that loss of its function produces dwarfism through reduced tolerance of replicative stress.

Compensation of significant parametric uncertainties using sliding mode online learning

Science.gov (United States)

Schnetter, Philipp; Kruger, Thomas

An augmented nonlinear inverse dynamics (NID) flight control strategy using sliding mode online learning for a small unmanned aircraft system (UAS) is presented. Because parameter identification for this class of aircraft often is not valid throughout the complete flight envelope, aerodynamic parameters used for model based control strategies may show significant deviations. For the concept of feedback linearization this leads to inversion errors that in combination with the distinctive susceptibility of small UAS towards atmospheric turbulence pose a demanding control task for these systems. In this work an adaptive flight control strategy using feedforward neural networks for counteracting such nonlinear effects is augmented with the concept of sliding mode control (SMC). SMC-learning is derived from variable structure theory. It considers a neural network and its training as a control problem. It is shown that by the dynamic calculation of the learning rates, stability can be guaranteed and thus increase the robustness against external disturbances and system failures. With the resulting higher speed of convergence a wide range of simultaneously occurring disturbances can be compensated. The SMC-based flight controller is tested and compared to the standard gradient descent (GD) backpropagation algorithm under the influence of significant model uncertainties and system failures.

Stretching human mesenchymal stromal cells on stiffness-customized collagen type I generates a smooth muscle marker profile without growth factor addition

Science.gov (United States)

Rothdiener, Miriam; Hegemann, Miriam; Uynuk-Ool, Tatiana; Walters, Brandan; Papugy, Piruntha; Nguyen, Phong; Claus, Valentin; Seeger, Tanja; Stoeckle, Ulrich; Boehme, Karen A.; Aicher, Wilhelm K.; Stegemann, Jan P.; Hart, Melanie L.; Kurz, Bodo; Klein, Gerd; Rolauffs, Bernd

2016-10-01

Using matrix elasticity and cyclic stretch have been investigated for inducing mesenchymal stromal cell (MSC) differentiation towards the smooth muscle cell (SMC) lineage but not in combination. We hypothesized that combining lineage-specific stiffness with cyclic stretch would result in a significantly increased expression of SMC markers, compared to non-stretched controls. First, we generated dense collagen type I sheets by mechanically compressing collagen hydrogels. Atomic force microscopy revealed a nanoscale stiffness range known to support myogenic differentiation. Further characterization revealed viscoelasticity and stable biomechanical properties under cyclic stretch with >99% viable adherent human MSC. MSCs on collagen sheets demonstrated a significantly increased mRNA but not protein expression of SMC markers, compared to on culture flasks. However, cyclic stretch of MSCs on collagen sheets significantly increased both mRNA and protein expression of α-smooth muscle actin, transgelin, and calponin versus plastic and non-stretched sheets. Thus, lineage-specific stiffness and cyclic stretch can be applied together for inducing MSC differentiation towards SMCs without the addition of recombinant growth factors or other soluble factors. This represents a novel stimulation method for modulating the phenotype of MSCs towards SMCs that could easily be incorporated into currently available methodologies to obtain a more targeted control of MSC phenotype.

Bank Valuation and Its Connections with the Subprime Mortgage Crisis and Basel II Capital Accord

Directory of Open Access Journals (Sweden)

C. H. Fouche

2008-01-01

Full Text Available The ongoing subprime mortgage crisis (SMC and implementation of Basel II Capital Accord regulation have resulted in issues related to bank valuation and profitability becoming more topical. Profit is a major indicator of financial crises for households, companies, and financial institutions. An SMC-related example of this is the U.S. bank, Wachovia Corp., which reported major losses in the first quarter of 2007 and eventually was bought by Citigroup in September 2008. A first objective of this paper is to value a bank subject to Basel II based on premiums for market, credit, and operational risk. In this case, we investigate the discrete-time dynamics of banking assets, capital, and profit when loan losses and macroeconomic conditions are explicitly considered. These models enable us to formulate an optimal bank valuation problem subject to cash flow, loan demand, financing, and balance sheet constraints. The main achievement of this paper is bank value maximization via optimal choices of loan rate and supply which leads to maximal deposits, provisions for deposit withdrawals, and bank profitability. The aforementioned loan rates and capital provide connections with the SMC. Finally, OECD data confirms that loan loss provisioning and profitability are strongly correlated with the business cycle.

Design and Control of a Buck–Boost Charger-Discharger for DC-Bus Regulation in Microgrids

Directory of Open Access Journals (Sweden)

Carlos Andrés Ramos-Paja

2017-11-01

Full Text Available In DC and hybrid microgrids (MG, the DC-bus regulation using Energy Storage Devices (ESD is important for the stable operation of both the generators and loads. There are multiple commercial voltage levels for both ESD and DC-bus; therefore, the ESD voltage may be higher, equal or lower than the DC-bus voltage depending on the application. Moreover, most of the ESD converter controllers are linear-based, hence they ensure stability in a limited operation range. This paper proposes a system to regulate the DC-bus voltage of an MG accounting for any voltage relation between the ESD and the DC-bus voltage. The proposed system is formed by an ESD connected to a DC-bus through a bidirectional Buck–Boost converter, which is regulated by a Sliding-Mode Controller (SMC to ensure the system stability in the entire operation range. The SMC drives the Buck–Boost charger–discharger to regulate the DC-bus voltage, at the desired reference value, by charging or discharging the ESD. This paper also provides detailed procedures to design the parameters of both the SMC and the charger–dischager. Finally, simulation and experimental results validate the proposed solution and illustrate its performance.

Cosmic rays in the large and small Magellanic clouds and the relationship to our galaxy

International Nuclear Information System (INIS)

Fichtel, C.E.; Sreekumar, P.

1991-01-01

Information on the cosmic rays in the Large and Small Magellanic Clouds may be obtained from measurements of the synchrotron radiation related to the energetic electrons, which are believed to contain only about 1% of the cosmic ray energy. Assuming the same ratio as in our galaxy between the cosmic ray electrons and nucleons, the energy density distribution may be estimated. This prediction is compared to that deduced from the matter density distribution, the concept of dynamic galance, and an appropriate coupling scale. For the Large Magellanic Cloud (LMC), the condition of quasi-equilibrium seems satisfied as is required for dynamic balance to be a valid concept, but for the Small Magellanic Cloud (SMC), this seems not to be the case. For the LMC, the scale of coupling is calculated to be about 2 1/2 kiloparsecs, within the range of estimates for our own galaxy, and the intensity level of the cosmic rays in the central region is similar to that in the local region of our own galaxy. In the SMC, the cosmic ray density seems to be lower than in our galaxy and lower than if the conditions required for dynamic equilibrium were in place for the SMC as a whole

On the Nature of Bright Infrared Sources in the Small Magellanic Cloud: Interpreting MSX through the Lens of Spitzer

Science.gov (United States)

Kraemer, Kathleen E.; Sloan, G. C.

2015-01-01

We compare infrared observations of the Small Magellanic Cloud (SMC) by the Midcourse Space Experiment (MSX) and the Spitzer Space Telescope to better understand what components of a metal-poor galaxy dominate radiative processes in the infrared. The SMC, at a distance of ~60 kpc and with a metallicity of ~0.1-0.2 solar, can serve as a nearby proxy for metal-poor galaxies at high redshift. The MSX Point Source Catalog contains 243 objects in the SMC that were detected at 8.3 microns, the most sensitive MSX band. Multi-epoch, multi-band mapping with Spitzer, supplemented with observations from the Two-Micron All-Sky Survey (2MASS) and the Wide-field Infrared Survey Explorer (WISE), provides variability information, and, together with spectra from Spitzer for ~15% of the sample, enables us to determine what these luminous sources are. How many remain simple point sources? What fraction break up into multiple stars? Which are star forming regions, with both bright diffuse emission and point sources? How do evolved stars and stellar remnants contribute at these wavelengths? What role do young stellar objects and HII regions play? Answering these questions sets the stage for understanding what we will see with the James Webb Space Telescope (JWST).

Experimental study of the effect of 103Pd on the proliferation and apoptosis of vascular smooth muscle cells

International Nuclear Information System (INIS)

Luo Quanyong; Zhu Jun; Chen Libo; Lu Hankui; Zhu Ruisen

2002-01-01

Objective: To investigate the ability of γ emitting radionuclide 103 Pd to inhibit the vascular smooth muscle cell (SMC) proliferation and to induce its apoptosis in vitro. Methods: 103 Pd solution was added to the culture medium to irradiate SMCs for 72 h and non-radioactive Pd solution was added as control. 3 H-TdR incorporation test was used to detect the effect of 103 Pd on the proliferation of SMCs. Flow cytometer was used to detect the apoptotic SMCs. Results: The results showed that inhibition of SMC proliferation was evident and the effects were dose-dependant. Inhibition rate of SMC proliferation by 1.85 MBq 103 Pd was 2.3% , which was not significant. The inhibition rate increased from 41.6% to 91.2% as the dose of 103 Pd increased from 7.4 to 37.0 MBq, and the proliferation of SMCs was repressed significantly then. The apoptosis rate was extremely low (less than 4.0% ) with the 103 pd dose escalating from 1.85 to 37.0 MBq. Conclusions: This study suggests that proliferation of SMCs can be repressed effectively in vitro by 103 pd. 103 Pd can be used to inhibit the neointimal proliferation. 103 Pd radioactive stent implantation can be employed as a possible novel means to prevent restenosis

Designing a Robust Nonlinear Dynamic Inversion Controller for Spacecraft Formation Flying

Directory of Open Access Journals (Sweden)

Inseok Yang

2014-01-01

Full Text Available The robust nonlinear dynamic inversion (RNDI control technique is proposed to keep the relative position of spacecrafts while formation flying. The proposed RNDI control method is based on nonlinear dynamic inversion (NDI. NDI is nonlinear control method that replaces the original dynamics into the user-selected desired dynamics. Because NDI removes nonlinearities in the model by inverting the original dynamics directly, it also eliminates the need of designing suitable controllers for each equilibrium point; that is, NDI works as self-scheduled controller. Removing the original model also provides advantages of ease to satisfy the specific requirements by simply handling desired dynamics. Therefore, NDI is simple and has many similarities to classical control. In real applications, however, it is difficult to achieve perfect cancellation of the original dynamics due to uncertainties that lead to performance degradation and even make the system unstable. This paper proposes robustness assurance method for NDI. The proposed RNDI is designed by combining NDI and sliding mode control (SMC. SMC is inherently robust using high-speed switching inputs. This paper verifies similarities of NDI and SMC, firstly. And then RNDI control method is proposed. The performance of the proposed method is evaluated by simulations applied to spacecraft formation flying problem.

Association between Ability Emotional Intelligence and Left Insula during Social Judgment of Facial Emotions.

Directory of Open Access Journals (Sweden)

Tiziana Quarto

Full Text Available The human ability of identifying, processing and regulating emotions from social stimuli is generally referred as Emotional Intelligence (EI. Within EI, Ability EI identifies a performance measure assessing individual skills at perceiving, using, understanding and managing emotions. Previous models suggest that a brain "somatic marker circuitry" (SMC sustains emotional sub-processes included in EI. Three primary brain regions are included: the amygdala, the insula and the ventromedial prefrontal cortex (vmPFC. Here, our aim was to investigate the relationship between Ability EI scores and SMC activity during social judgment of emotional faces. Sixty-three healthy subjects completed a test measuring Ability EI and underwent fMRI during a social decision task (i.e. approach or avoid about emotional faces with different facial expressions. Imaging data revealed that EI scores are associated with left insula activity during social judgment of emotional faces as a function of facial expression. Specifically, higher EI scores are associated with greater left insula activity during social judgment of fearful faces but also with lower activity of this region during social judgment of angry faces. These findings indicate that the association between Ability EI and the SMC activity during social behavior is region- and emotion-specific.

Tuning the Pore Geometry of Ordered Mesoporous Carbons for Enhanced Adsorption of Bisphenol-A

Science.gov (United States)

Libbrecht, Wannes; Vandaele, Koen; De Buysser, Klaartje; Verberckmoes, An; Thybaut, Joris W.; Poelman, Hilde; De Clercq, Jeriffa; Van Der Voort, Pascal

2015-01-01

Mesoporous carbons were synthesized via both soft and hard template methods and compared to a commercial powder activated carbon (PAC) for the adsorption ability of bisphenol-A (BPA) from an aqueous solution. The commercial PAC had a BET-surface of 1027 m2/g with fine pores of 3 nm and less. The hard templated carbon (CMK-3) material had an even higher BET-surface of 1420 m2/g with an average pore size of 4 nm. The soft templated carbon (SMC) reached a BET-surface of 476 m2/g and a pore size of 7 nm. The maximum observed adsorption capacity (qmax) of CMK-3 was the highest with 474 mg/g, compared to 290 mg/g for PAC and 154 mg/g for SMC. The difference in adsorption capacities was attributed to the specific surface area and hydrophobicity of the adsorbent. The microporous PAC showed the slowest adsorption, while the ordered mesopores of SMC and CMK-3 enhanced the BPA diffusion into the adsorbent. This difference in adsorption kinetics is caused by the increase in pore diameter. However, CMK-3 with an open geometry consisting of interlinked nanorods allows for even faster intraparticle diffusion. PMID:28788023