An improved PCR method for direct identification of Porphyra (Bangiales, Rhodophyta) using conchocelis based on a RUBISCO intergenic spacer

Science.gov (United States)

Wang, Chao; Dong, Dong; Wang, Guangce; Zhang, Baoyu; Peng, Guang; Xu, Pu; Tang, Xiaorong

2009-09-01

An improved method of PCR in which the small segment of conchocelis is amplified directly without DNA extraction was used to amplify a RUBISCO intergenic spacer DNA fragment from nine species of red algal genus Porphyra (Bangiales, Rhodophyta), including Porphyra yezoensis (Jiangsu, China), P. haitanensis (Fujian, China), P. oligospermatangia (Qingdao, China), P. katadai (Qingdao, China), P. tenera (Qingdao, China), P. suborboculata (Fujian, China), P. pseudolinearis (Kogendo, Korea), P. linearis (Devon, England), and P. fallax (Seattle, USA). Standard PCR and the method developed here were both conducted using primers specific for the RUBISCO spacer region, after which the two PCR products were sequenced. The sequencing data of the amplicons obtained using both methods were identical, suggesting that the improved PCR method was functional. These findings indicate that the method developed here may be useful for the rapid identification of species of Porphyra in a germplasm bank. In addition, a phylogenetic tree was constructed using the RUBISCO spacer and partial rbcS sequence, and the results were in concordant with possible alternative phylogenies based on traditional morphological taxonomic characteristics, indicating that the RUBISCO spacer is a useful region for phylogenetic studies.

Effects of near-ultraviolet light on mutations, intragenic and intergenic recombinations in Saccharomyces cerevisiae

International Nuclear Information System (INIS)

Machida, Isamu; Saeki, Tetsuya; Nakai, Sayaka

1986-01-01

The effects of far and near ultraviolet light on mutations, intragenic and intergenic recombinations were compared in diploid strains of Saccharomyces cerevisiae. At equivalent survival levels there was not much difference in the induction of nonsense and missense mutations between far- and near-UV radiations. However, frameshift mutations were induced more frequently by near-UV than by far-UV radiation. Near-UV radiation induced intragenic recombination as efficiently as far-UV radiation. A strikingly higher frequency was observed for the intergenic recombination induced by near-UV radiation than by far-UV radiation when compared at equivalent survival levels. Photoreactivation reduced the frequency only slightly in far-UV induced intergenic recombination and not at all in near-UV induction. These results indicate that near-UV damage involves strand breakage in addition to pyrimidine dimers and other lesions induced, whereas far-UV damage consists largely of photoreactivable lesions, pyrimidine dimers, and near-UV induced damage is more efficient for the induction of crossing-over. (Auth.)

An Intergenic Region Shared by At4g35985 and At4g35987 in Arabidopsis thaliana Is a Tissue Specific and Stress Inducible Bidirectional Promoter Analyzed in Transgenic Arabidopsis and Tobacco Plants

Science.gov (United States)

Banerjee, Joydeep; Sahoo, Dipak Kumar; Dey, Nrisingha; Houtz, Robert L.; Maiti, Indu Bhushan

2013-01-01

On chromosome 4 in the Arabidopsis genome, two neighboring genes (calmodulin methyl transferase At4g35987 and senescence associated gene At4g35985) are located in a head-to-head divergent orientation sharing a putative bidirectional promoter. This 1258 bp intergenic region contains a number of environmental stress responsive and tissue specific cis-regulatory elements. Transcript analysis of At4g35985 and At4g35987 genes by quantitative real time PCR showed tissue specific and stress inducible expression profiles. We tested the bidirectional promoter-function of the intergenic region shared by the divergent genes At4g35985 and At4g35987 using two reporter genes (GFP and GUS) in both orientations in transient tobacco protoplast and Agro-infiltration assays, as well as in stably transformed transgenic Arabidopsis and tobacco plants. In transient assays with GFP and GUS reporter genes the At4g35985 promoter (P85) showed stronger expression (about 3.5 fold) compared to the At4g35987 promoter (P87). The tissue specific as well as stress responsive functional nature of the bidirectional promoter was evaluated in independent transgenic Arabidopsis and tobacco lines. Expression of P85 activity was detected in the midrib of leaves, leaf trichomes, apical meristemic regions, throughout the root, lateral roots and flowers. The expression of P87 was observed in leaf-tip, hydathodes, apical meristem, root tips, emerging lateral root tips, root stele region and in floral tissues. The bidirectional promoter in both orientations shows differential up-regulation (2.5 to 3 fold) under salt stress. Use of such regulatory elements of bidirectional promoters showing spatial and stress inducible promoter-functions in heterologous system might be an important tool for plant biotechnology and gene stacking applications. PMID:24260266

An intergenic region shared by At4g35985 and At4g35987 in Arabidopsis thaliana is a tissue specific and stress inducible bidirectional promoter analyzed in transgenic arabidopsis and tobacco plants.

Directory of Open Access Journals (Sweden)

Joydeep Banerjee

Full Text Available On chromosome 4 in the Arabidopsis genome, two neighboring genes (calmodulin methyl transferase At4g35987 and senescence associated gene At4g35985 are located in a head-to-head divergent orientation sharing a putative bidirectional promoter. This 1258 bp intergenic region contains a number of environmental stress responsive and tissue specific cis-regulatory elements. Transcript analysis of At4g35985 and At4g35987 genes by quantitative real time PCR showed tissue specific and stress inducible expression profiles. We tested the bidirectional promoter-function of the intergenic region shared by the divergent genes At4g35985 and At4g35987 using two reporter genes (GFP and GUS in both orientations in transient tobacco protoplast and Agro-infiltration assays, as well as in stably transformed transgenic Arabidopsis and tobacco plants. In transient assays with GFP and GUS reporter genes the At4g35985 promoter (P85 showed stronger expression (about 3.5 fold compared to the At4g35987 promoter (P87. The tissue specific as well as stress responsive functional nature of the bidirectional promoter was evaluated in independent transgenic Arabidopsis and tobacco lines. Expression of P85 activity was detected in the midrib of leaves, leaf trichomes, apical meristemic regions, throughout the root, lateral roots and flowers. The expression of P87 was observed in leaf-tip, hydathodes, apical meristem, root tips, emerging lateral root tips, root stele region and in floral tissues. The bidirectional promoter in both orientations shows differential up-regulation (2.5 to 3 fold under salt stress. Use of such regulatory elements of bidirectional promoters showing spatial and stress inducible promoter-functions in heterologous system might be an important tool for plant biotechnology and gene stacking applications.

Differential effect of UV irradiation on induction of intragenic and intergenic recombination during commitment to meiosis in Saccharomyces cerevisiae

International Nuclear Information System (INIS)

Machida, I.; Nakai, S.

1980-01-01

A comparison was made between the induction of intragenic and intergenic recombinations during meiosis in a wild-type diploid of Saccharomyces cerevisiae. Under non-irradiated normal conditions, production of both intragenic and intergenic recombinants greatly increased in the cells with commitment to meiosis. The susceptibility of cells to the induction ob both the spontaneous intra- and intergenic recombinations in meiotic cells was similar. However, under condition of UV irradiation, there were striking differences between intra- and intergenic recombinations. Susceptibility to induction of intragenic recombination by UV irradiation was not enhanced at meiosis compared with mitosis, and was not altered through commitment to meiotic processes. In contrast, however, susceptibility to the induction of intergenic recombination by UV irradiation was enhanced markedly during commitment to meiosis compared with mitosis. Genetic analysis suggested that the enhanced susceptibility to recombination during meiosis is specifically concerned with reciprocal-type recombination (crossing-over) but not non-reciprocal-type recombination (gene conversion). Hence it is concluded that the meiotic that the meiotic process appears to be intimately concerned with the mechanism(s) of induction of recombination, especially reciprocal-type recombination. (orig.)

Genic and Intergenic SSR Database Generation, SNPs Determination and Pathway Annotations, in Date Palm (Phoenix dactylifera L.).

Science.gov (United States)

Mokhtar, Morad M; Adawy, Sami S; El-Assal, Salah El-Din S; Hussein, Ebtissam H A

2016-01-01

The present investigation was carried out aiming to use the bioinformatics tools in order to identify and characterize, simple sequence repeats within the third Version of the date palm genome and develop a new SSR primers database. In addition single nucleotide polymorphisms (SNPs) that are located within the SSR flanking regions were recognized. Moreover, the pathways for the sequences assigned by SSR primers, the biological functions and gene interaction were determined. A total of 172,075 SSR motifs was identified on date palm genome sequence with a frequency of 450.97 SSRs per Mb. Out of these, 130,014 SSRs (75.6%) were located within the intergenic regions with a frequency of 499 SSRs per Mb. While, only 42,061 SSRs (24.4%) were located within the genic regions with a frequency of 347.5 SSRs per Mb. A total of 111,403 of SSR primer pairs were designed, that represents 291.9 SSR primers per Mb. Out of the 111,403, only 31,380 SSR primers were in the genic regions, while 80,023 primers were in the intergenic regions. A number of 250,507 SNPs were recognized in 84,172 SSR flanking regions, which represents 75.55% of the total SSR flanking regions. Out of 12,274 genes only 463 genes comprising 896 SSR primers were mapped onto 111 pathways using KEGG data base. The most abundant enzymes were identified in the pathway related to the biosynthesis of antibiotics. We tested 1031 SSR primers using both publicly available date palm genome sequences as templates in the in silico PCR reactions. Concerning in vitro validation, 31 SSR primers among those used in the in silico PCR were synthesized and tested for their ability to detect polymorphism among six Egyptian date palm cultivars. All tested primers have successfully amplified products, but only 18 primers detected polymorphic amplicons among the studied date palm cultivars.

Intergenic sequence between Arabidopsis caseinolytic protease B-cytoplasmic/heat shock protein100 and choline kinase genes functions as a heat-inducible bidirectional promoter.

Science.gov (United States)

Mishra, Ratnesh Chandra; Grover, Anil

2014-11-01

In Arabidopsis (Arabidopsis thaliana), the At1g74310 locus encodes for caseinolytic protease B-cytoplasmic (ClpB-C)/heat shock protein100 protein (AtClpB-C), which is critical for the acquisition of thermotolerance, and At1g74320 encodes for choline kinase (AtCK2) that catalyzes the first reaction in the Kennedy pathway for phosphatidylcholine biosynthesis. Previous work has established that the knockout mutants of these genes display heat-sensitive phenotypes. While analyzing the AtClpB-C promoter and upstream genomic regions in this study, we noted that AtClpB-C and AtCK2 genes are head-to-head oriented on chromosome 1 of the Arabidopsis genome. Expression analysis showed that transcripts of these genes are rapidly induced in response to heat stress treatment. In stably transformed Arabidopsis plants harboring this intergenic sequence between head-to-head oriented green fluorescent protein and β-glucuronidase reporter genes, both transcripts and proteins of the two reporters were up-regulated upon heat stress. Four heat shock elements were noted in the intergenic region by in silico analysis. In the homozygous transfer DNA insertion mutant Salk_014505, 4,393-bp transfer DNA is inserted at position -517 upstream of ATG of the AtClpB-C gene. As a result, AtCk2 loses proximity to three of the four heat shock elements in the mutant line. Heat-inducible expression of the AtCK2 transcript was completely lost, whereas the expression of AtClpB-C was not affected in the mutant plants. Our results suggest that the 1,329-bp intergenic fragment functions as a heat-inducible bidirectional promoter and the region governing the heat inducibility is possibly shared between the two genes. We propose a model in which AtClpB-C shares its regulatory region with heat-induced choline kinase, which has a possible role in heat signaling. © 2014 American Society of Plant Biologists. All Rights Reserved.

Comparing Generative and Inter-generative Subjectivity in Post-Revolutionary Academic Generations in Iran

Directory of Open Access Journals (Sweden)

mehran Sohrabzadeh

2010-01-01

Full Text Available Comparative study of different post-revolutionary generation has been broadly applied by social scientists; among them some believe there is a gulf between generations, while some others endorsing some small differences among generations, emphasis that this variety is natural. Avoiding being loyal to any of these two views, the present study attempts to compare three different post-revolutionary academic generations using theory of “generative objects” which explores generations’ view about their behaviors, Beliefs, and historical monuments. Sampling was carried among 3 generations; firstly ones who were student in 60s and now are experienced faculties in the university, secondly ones who are recently employed as faculty members, and finally who are now students in universities. Results show that in all 3 generations there are essential in-generation similarities, while comparatively there are some differentiations in inter-generative analysis.

Evolution of the rpoB-psbZ region in fern plastid genomes: notable structural rearrangements and highly variable intergenic spacers.

Science.gov (United States)

Gao, Lei; Zhou, Yuan; Wang, Zhi-Wei; Su, Ying-Juan; Wang, Ting

2011-04-13

The rpoB-psbZ (BZ) region of some fern plastid genomes (plastomes) has been noted to go through considerable genomic changes. Unraveling its evolutionary dynamics across all fern lineages will lead to clarify the fundamental process shaping fern plastome structure and organization. A total of 24 fern BZ sequences were investigated with taxon sampling covering all the extant fern orders. We found that: (i) a tree fern Plagiogyria japonica contained a novel gene order that can be generated from either the ancestral Angiopteris type or the derived Adiantum type via a single inversion; (ii) the trnY-trnE intergenic spacer (IGS) of the filmy fern Vandenboschia radicans was expanded 3-fold due to the tandem 27-bp repeats which showed strong sequence similarity with the anticodon domain of trnY; (iii) the trnY-trnE IGSs of two horsetail ferns Equisetum ramosissimum and E. arvense underwent an unprecedented 5-kb long expansion, more than a quarter of which was consisted of a single type of direct repeats also relevant to the trnY anticodon domain; and (iv) ycf66 has independently lost at least four times in ferns. Our results provided fresh insights into the evolutionary process of fern BZ regions. The intermediate BZ gene order was not detected, supporting that the Adiantum type was generated by two inversions occurring in pairs. The occurrence of Vandenboschia 27-bp repeats represents the first evidence of partial tRNA gene duplication in fern plastomes. Repeats potentially forming a stem-loop structure play major roles in the expansion of the trnY-trnE IGS.

Evolution of the rpoB-psbZ region in fern plastid genomes: notable structural rearrangements and highly variable intergenic spacers

Directory of Open Access Journals (Sweden)

Su Ying-Juan

2011-04-01

Full Text Available Abstract Background The rpoB-psbZ (BZ region of some fern plastid genomes (plastomes has been noted to go through considerable genomic changes. Unraveling its evolutionary dynamics across all fern lineages will lead to clarify the fundamental process shaping fern plastome structure and organization. Results A total of 24 fern BZ sequences were investigated with taxon sampling covering all the extant fern orders. We found that: (i a tree fern Plagiogyria japonica contained a novel gene order that can be generated from either the ancestral Angiopteris type or the derived Adiantum type via a single inversion; (ii the trnY-trnE intergenic spacer (IGS of the filmy fern Vandenboschia radicans was expanded 3-fold due to the tandem 27-bp repeats which showed strong sequence similarity with the anticodon domain of trnY; (iii the trnY-trnE IGSs of two horsetail ferns Equisetum ramosissimum and E. arvense underwent an unprecedented 5-kb long expansion, more than a quarter of which was consisted of a single type of direct repeats also relevant to the trnY anticodon domain; and (iv ycf66 has independently lost at least four times in ferns. Conclusions Our results provided fresh insights into the evolutionary process of fern BZ regions. The intermediate BZ gene order was not detected, supporting that the Adiantum type was generated by two inversions occurring in pairs. The occurrence of Vandenboschia 27-bp repeats represents the first evidence of partial tRNA gene duplication in fern plastomes. Repeats potentially forming a stem-loop structure play major roles in the expansion of the trnY-trnE IGS.

Similar Ratios of Introns to Intergenic Sequence across Animal Genomes.

Science.gov (United States)

Francis, Warren R; Wörheide, Gert

2017-06-01

One central goal of genome biology is to understand how the usage of the genome differs between organisms. Our knowledge of genome composition, needed for downstream inferences, is critically dependent on gene annotations, yet problems associated with gene annotation and assembly errors are usually ignored in comparative genomics. Here, we analyze the genomes of 68 species across 12 animal phyla and some single-cell eukaryotes for general trends in genome composition and transcription, taking into account problems of gene annotation. We show that, regardless of genome size, the ratio of introns to intergenic sequence is comparable across essentially all animals, with nearly all deviations dominated by increased intergenic sequence. Genomes of model organisms have ratios much closer to 1:1, suggesting that the majority of published genomes of nonmodel organisms are underannotated and consequently omit substantial numbers of genes, with likely negative impact on evolutionary interpretations. Finally, our results also indicate that most animals transcribe half or more of their genomes arguing against differences in genome usage between animal groups, and also suggesting that the transcribed portion is more dependent on genome size than previously thought. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

Long Intergenic Noncoding RNA 00511 Acts as an Oncogene in Non–small-cell Lung Cancer by Binding to EZH2 and Suppressing p57

Directory of Open Access Journals (Sweden)

Cheng-Cao Sun

2016-01-01

Full Text Available Long noncoding RNAs (lncRNAs play crucial roles in carcinogenesis. However, the function and mechanism of lncRNAs in human non–small-cell lung cancer (NSCLC are still remaining largely unknown. Long intergenic noncoding RNA 00511 (LINC00511 has been found to be upregulated and acts as an oncogene in breast cancer, but little is known about its expression pattern, biological function and underlying mechanism in NSCLC. Herein, we identified LINC00511 as an oncogenic lncRNA by driving tumorigenesis in NSCLC. We found LINC00511 was upregulated and associated with oncogenesis, tumor size, metastasis, and poor prognosis in NSCLC. Moreover, LINC00511 affected cell proliferation, invasiveness, metastasis, and apoptosis in multiple NSCLC cell lines. Mechanistically, LINC00511 bound histone methyltransferase enhancer of zeste homolog 2 ((EZH2, the catalytic subunit of the polycomb repressive complex 2 (PRC2, a highly conserved protein complex that regulates gene expression by methylating lysine 27 on histone H3, and acted as a modular scaffold of EZH2/PRC2 complexes, coordinated their localization, and specified the histone modification pattern on the target genes, including p57, and consequently altered NSCLC cell biology. Thus, LINC00511 is mechanistically, functionally, and clinically oncogenic in NSCLC. Targeting LINC00511 and its pathway may be meaningful for treating patients with NSCLC.

16S-23S rDNA intergenic spacer region polymorphism of Lactococcus garvieae, Lactococcus raffinolactis and Lactococcus lactis as revealed by PCR and nucleotide sequence analysis.

Science.gov (United States)

Blaiotta, Giuseppe; Pepe, Olimpia; Mauriello, Gianluigi; Villani, Francesco; Andolfi, Rosamaria; Moschetti, Giancarlo

2002-12-01

The intergenic spacer region (ISR) between the 16S and 23S rRNA genes was tested as a tool for differentiating lactococci commonly isolated in a dairy environment. 17 reference strains, representing 11 different species belonging to the genera Lactococcus, Streptococcus, Lactobacillus, Enterococcus and Leuconostoc, and 127 wild streptococcal strains isolated during the whole fermentation process of "Fior di Latte" cheese were analyzed. After 16S-23S rDNA ISR amplification by PCR, species or genus-specific patterns were obtained for most of the reference strains tested. Moreover, results obtained after nucleotide analysis show that the 16S-23S rDNA ISR sequences vary greatly, in size and sequence, among Lactococcus garvieae, Lactococcus raffinolactis, Lactococcus lactis as well as other streptococci from dairy environments. Because of the high degree of inter-specific polymorphism observed, 16S-23S rDNA ISR can be considered a good potential target for selecting species-specific molecular assays, such as PCR primer or probes, for a rapid and extremely reliable differentiation of dairy lactococcal isolates.

76 FR 9630 - Federal Regulatory Enforcement Fairness Hearing; National Ombudsman and Region VI Regional Small...

Science.gov (United States)

2011-02-18

... Administration (SBA). ACTION: Notice of open hearing of the Regional (Region VI) Small Business Regulatory... location, date and time of the Regional Small Business Regulatory Fairness hearing. This hearing is open to... Chasse Room, New Orleans, LA 70140. SUPPLEMENTARY INFORMATION: Pursuant to the Small Business Regulatory...

Adaptation of the short intergenic spacers between co-directional genes to the Shine-Dalgarno motif among prokaryote genomes

DEFF Research Database (Denmark)

Caro, Albert Pallejà; García-Vallvé, Santiago; Romeu, Antoni

2009-01-01

ABSTRACT: BACKGROUND: In prokaryote genomes most of the co-directional genes are in close proximity. Even the coding sequence or the stop codon of a gene can overlap with the Shine-Dalgarno (SD) sequence of the downstream co-directional gene. In this paper we analyze how the presence of SD may...... influence the stop codon usage or the spacing lengths between co-directional genes. RESULTS: The SD sequences for 530 prokaryote genomes have been predicted using computer calculations of the base-pairing free energy between translation initiation regions and the 16S rRNA 3' tail. Genomes with a large...... to the discussion of which factors affect the intergenic lengths, which cannot be totally explained by the pressure to compact the prokaryote genomes....

The identification of two Trypanosoma cruzi I genotypes from domestic and sylvatic transmission cycles in Colombia based on a single polymerase chain reaction amplification of the spliced-leader intergenic region

Directory of Open Access Journals (Sweden)

Lina Marcela Villa

2013-11-01

Full Text Available A single polymerase chain reaction (PCR reaction targeting the spliced-leader intergenic region of Trypanosoma cruzi I was standardised by amplifying a 231 bp fragment in domestic (TcIDOM strains or clones and 450 and 550 bp fragments in sylvatic strains or clones. This reaction was validated using 44 blind coded samples and 184 non-coded T. cruzi I clones isolated from sylvatic triatomines and the correspondence between the amplified fragments and their domestic or sylvatic origin was determined. Six of the nine strains isolated from acute cases suspected of oral infection had the sylvatic T. cruzi I profile. These results confirmed that the sylvatic T. cruzi I genotype is linked to cases of oral Chagas disease in Colombia. We therefore propose the use of this novel PCR reaction in strains or clones previously characterised as T. cruzi I to distinguish TcIDOMfrom sylvatic genotypes in studies of transmission dynamics, including the verification of population selection within hosts or detection of the frequency of mixed infections by both T. cruzi I genotypes in Colombia.

Ribosomal DNA intergenic spacer sequence in foxtail millet, Setaria italica (L.) P. Beauv. and its characterization and application to typing of foxtail millet landraces.

Science.gov (United States)

Fukunaga, Kenji; Ichitani, Katsuyuki; Taura, Satoru; Sato, Muneharu; Kawase, Makoto

2005-02-01

We determined the sequence of ribosomal DNA (rDNA) intergenic spacer (IGS) of foxtail millet isolated in our previous study, and identified subrepeats in the polymorphic region. We also developed a PCR-based method for identifying rDNA types based on sequence information and assessed 153 accessions of foxtail millet. Results were congruent with our previous works. This study provides new findings regarding the geographical distribution of rDNA variants. This new method facilitates analyses of numerous foxtail millet accessions. It is helpful for typing of foxtail millet germplasms and elucidating the evolution of this millet.

Organizational and economic aspects of development of small business in region

Directory of Open Access Journals (Sweden)

Vladimir Grigorjevich Klimov

2012-12-01

Full Text Available By the purpose of the given research was revealing the basic problems and prospects of development of small business in regions. The methodology of reception of results of the specified purpose consists in the generalized analysis of scientific and legislative sources in the field of economic and organizational problems of development of small business in regions of Russia. As a result of research is revealed, that unions, association, and other public associations of the small enterprises more and more actively work at regional levels. System of commercial and industrial chambers having in significant potential in thesphere of support of the fine businessmen in regions essentially has become stronger. Area of application of results of the given research can be used by the managers of small business and teachers of higher educational institutions in the sphere of preparation of the managers in economy and management. The results of research allow to make conclusions: The level of development of small business in regions, in comparison of the advanced foreign states, rather lags behind; the analysis of the normativecertificates in sphere of small business from a position of their influence on development of regions testifies, that the mechanism of state influence includes economic and organizational measures; the small business has the brightly expressed regional orientation.

Phylogenetic relationships in Solanaceae and related species based on cpDNA sequence from plastid trnE-trnT region

Directory of Open Access Journals (Sweden)

Danila Montewka Melotto-Passarin

2008-01-01

Full Text Available Intergenic spacers of chloroplast DNA (cpDNA are very useful in phylogenetic and population genetic studiesof plant species, to study their potential integration in phylogenetic analysis. The non-coding trnE-trnT intergenic spacer ofcpDNA was analyzed to assess the nucleotide sequence polymorphism of 16 Solanaceae species and to estimate its ability tocontribute to the resolution of phylogenetic studies of this group. Multiple alignments of DNA sequences of trnE-trnT intergenicspacer made the identification of nucleotide variability in this region possible and the phylogeny was estimated by maximumparsimony and rooted with Convolvulaceae Ipomoea batatas, the most closely related family. Besides, this intergenic spacerwas tested for the phylogenetic ability to differentiate taxonomic levels. For this purpose, species from four other families wereanalyzed and compared with Solanaceae species. Results confirmed polymorphism in the trnE-trnT region at different taxonomiclevels.

Genome-wide CpG island methylation and intergenic demethylation propensities vary among different tumor sites.

Science.gov (United States)

Lee, Seung-Tae; Wiemels, Joseph L

2016-02-18

The epigenetic landscape of cancer includes both focal hypermethylation and broader hypomethylation in a genome-wide manner. By means of a comprehensive genomic analysis on 6637 tissues of 21 tumor types, we here show that the degrees of overall methylation in CpG island (CGI) and demethylation in intergenic regions, defined as 'backbone', largely vary among different tumors. Depending on tumor type, both CGI methylation and backbone demethylation are often associated with clinical, epidemiological and biological features such as age, sex, smoking history, anatomic location, histological type and grade, stage, molecular subtype and biological pathways. We found connections between CGI methylation and hypermutability, microsatellite instability, IDH1 mutation, 19p gain and polycomb features, and backbone demethylation with chromosomal instability, NSD1 and TP53 mutations, 5q and 19p loss and long repressive domains. These broad epigenetic patterns add a new dimension to our understanding of tumor biology and its clinical implications. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

Functional Characterization of MC1R-TUBB3 Intergenic Splice Variants of the Human Melanocortin 1 Receptor.

Directory of Open Access Journals (Sweden)

Cecilia Herraiz

Full Text Available The melanocortin 1 receptor gene (MC1R expressed in melanocytes is a major determinant of skin pigmentation. It encodes a Gs protein-coupled receptor activated by α-melanocyte stimulating hormone (αMSH. Human MC1R has an inefficient poly(A site allowing intergenic splicing with its downstream neighbour Tubulin-β-III (TUBB3. Intergenic splicing produces two MC1R isoforms, designated Iso1 and Iso2, bearing the complete seven transmembrane helices from MC1R fused to TUBB3-derived C-terminal extensions, in-frame for Iso1 and out-of-frame for Iso2. It has been reported that exposure to ultraviolet radiation (UVR might promote an isoform switch from canonical MC1R (MC1R-001 to the MC1R-TUBB3 chimeras, which might lead to novel phenotypes required for tanning. We expressed the Flag epitope-tagged intergenic isoforms in heterologous HEK293T cells and human melanoma cells, for functional characterization. Iso1 was expressed with the expected size. Iso2 yielded a doublet of Mr significantly lower than predicted, and impaired intracellular stability. Although Iso1- and Iso2 bound radiolabelled agonist with the same affinity as MC1R-001, their plasma membrane expression was strongly reduced. Decreased surface expression mostly resulted from aberrant forward trafficking, rather than high rates of endocytosis. Functional coupling of both isoforms to cAMP was lower than wild-type, but ERK activation upon binding of αMSH was unimpaired, suggesting imbalanced signaling from the splice variants. Heterodimerization of differentially labelled MC1R-001 with the splicing isoforms analyzed by co-immunoprecipitation was efficient and caused decreased surface expression of binding sites. Thus, UVR-induced MC1R isoforms might contribute to fine-tune the tanning response by modulating MC1R-001 availability and functional parameters.

Regional statistical and economic analysis of small and medium-sized businesses development in Zhytomyr region

Directory of Open Access Journals (Sweden)

S.I. Pavlova

2017-08-01

Full Text Available Small and medium-sized businesses play an important role in the development of the regional economic system in particular and in solving a number of the following local problems: developing competition, developing the market for goods and services, providing jobs for the able-bodied population, raising living standards and improving the social environment in society. The purpose of this paper is to analyze the state and development of small and medium-sized businesses in the Zhytomyr region, to analyze its contribution to the economic development of the region, and to identify the main problems existing in the region. According to the indicators of state statistics, the author presents the general characteristics of enterprises in the Zhytomyr region from 2012 to 2016 in the context of indicators of the number of enterprises, the number of employed workers and the volume of the products sold, highlighting the activities of small enterprises and assessing their share in general levels. In addition, the paper provides the description of the activities of individual entrepreneurs. The structural comparison for the above-listed indicators of the distribution of influence on the economic system of the Zhytomyr region in terms of enterprises by size is presented. In terms of quantity 93,5 % are small enterprises that provide 31,4 % of the total number of employees with work and make up 23,1 % of the total volume of sales. Average enterprises in these indicators have 6,4 %, 62,0 % and 54,8 % respectively. The statistical and economic analysis of the structure of small enterprises by types of economic activity, by indicators of the number of registered enterprises, and by the volumes of sold products is carried out. The uniformity of the distribution is estimated using the index of the concentration coefficient. The indicators of revenues to budgets of different levels from small and medium-sized businesses are set. The paper presents and summarizes the

EVALUATION OF SMALL BUSINESS INFLUENCE ON THE ECONOMIC DEVELOPMENT OF THE REGION

Directory of Open Access Journals (Sweden)

Olena Zvarych

2017-12-01

Full Text Available The purpose of the paper is to study the role and assess the small business development influence on the economic development of the region. Methods. Theoretical and methodological foundations of the research draw up the scientists’ works on the problems of economic development of the regions. During the scientific research, a complex of such methods was used: generalization and scientific abstraction – in order to specify the conceptualcategorical instrument and identify characteristics of the small business; monographic – in case of highlighting the scientists’ views on the investigated problems; comparative analysis – when identifying features of small business influence on the economic development of the region; mathematical modelling in economics – to develop the methodology for the evaluation of small business development influence on the economic development of the region. Results. Special aspects of small business functioning as a factor of the economic development of the region that accommodates economic growth, the improvement of the product quality and social indicators of development, formation of the middle class, decrease of the unemployment rate, increase of the population living standards are researched. The ambiguity of approaches to the small business definition is established, the characteristic feature of which, in most cases, is the number of employees. However, the small business is distinguished for industrial enterprises and service-oriented companies, based on the structure of management, and also taking into account the self-regulation of small enterprises or their relations to the large enterprises or industrial group of companies. It is established that criteria for the evaluation of the efficiency of small business enterprises can be: increase in the entrepreneurship development rates, minimization of material and social losses of the society, increasing the share of small business in GDP formation

Genome-wide identification, characterization and evolutionary analysis of long intergenic noncoding RNAs in cucumber.

Directory of Open Access Journals (Sweden)

Zhiqiang Hao

Full Text Available Long intergenic noncoding RNAs (lincRNAs are intergenic transcripts with a length of at least 200 nt that lack coding potential. Emerging evidence suggests that lincRNAs from animals participate in many fundamental biological processes. However, the systemic identification of lincRNAs has been undertaken in only a few plants. We chose to use cucumber (Cucumis sativus as a model to analyze lincRNAs due to its importance as a model plant for studying sex differentiation and fruit development and the rich genomic and transcriptome data available. The application of a bioinformatics pipeline to multiple types of gene expression data resulted in the identification and characterization of 3,274 lincRNAs. Next, 10 lincRNAs targeted by 17 miRNAs were also explored. Based on co-expression analysis between lincRNAs and mRNAs, 94 lincRNAs were annotated, which may be involved in response to stimuli, multi-organism processes, reproduction, reproductive processes, and growth. Finally, examination of the evolution of lincRNAs showed that most lincRNAs are under purifying selection, while 16 lincRNAs are under natural selection. Our results provide a rich resource for further validation of cucumber lincRNAs and their function. The identification of lincRNAs targeted by miRNAs offers new clues for investigations into the role of lincRNAs in regulating gene expression. Finally, evaluation of the lincRNAs suggested that some lincRNAs are under positive and balancing selection.

Trypanosoma cruzi I genotypes in different geographic regions and transmission cycles based on a microsatellite motif of the intergenic spacer of spliced leader genes✯

Science.gov (United States)

Cura, Carolina I.; Mejía-Jaramillo, Ana M.; Duffy, Tomás; Burgos, Juan M.; Rodriguero, Marcela; Cardinal, Marta V.; Kjos, Sonia; Gurgel-Gonçalves, Rodrigo; Blanchet, Denis; De Pablos, Luis M.; Tomasini, Nicolás; Silva, Alex Da; Russomando, Graciela; Cuba Cuba, Cesar A.; Aznar, Christine; Abate, Teresa; Levin, Mariano J.; Osuna, Antonio; Gürtler, Ricardo E.; Diosque, Patricio; Solari, Aldo; Triana-Chávez, Omar; Schijman, Alejandro G.

2011-01-01

The intergenic region of spliced-leader (SL-IR) genes from 105 Trypanosoma cruzi I (Tc I) infected biological samples, culture isolates and stocks from 11 endemic countries, from Argentina to the USA were characterised, allowing identification of 76 genotypes with 54 polymorphic sites from 123 aligned sequences. On the basis of the microsatellite motif proposed by Herrera et al. (2007) to define four haplotypes in Colombia, we could classify these genotypes into four distinct Tc I SL-IR groups, three corresponding to the former haplotypes Ia (11 genotypes), Ib (11 genotypes) and Id (35 genotypes); and one novel group, Ie (19 genotypes). Genotypes harboring the Tc Ic motif were not detected in our study. Tc Ia was associated with domestic cycles in southern and northern South America and sylvatic cycles in Central and North America. Tc Ib was found in all transmission cycles from Colombia. Tc Id was identified in all transmission cycles from Argentina and Colombia, including Chagas cardiomyopathy patients, sylvatic Brazilian samples and human cases from French Guiana, Panama and Venezuela. Tc Ie gathered five samples from domestic Triatoma infestans from northern Argentina, nine samples from wild Mepraia spinolai and Mepraia gajardoi and two chagasic patients from Chile and one from a Bolivian patient with chagasic reactivation. Mixed infections by Tc Ia + Tc Id, Tc Ia + Tc Ie and Tc Id + Tc Ie were detected in vector faeces and isolates from human and vector samples. In addition, Tc Ia and Tc Id were identified in different tissues from a heart transplanted Chagas cardiomyopathy patient with reactivation, denoting histotropism. Trypanosoma cruzi I SL-IR genotypes from parasites infecting Triatoma gerstaeckeri and Didelphis virginiana from USA, T. infestans from Paraguay, Rhodnius nasutus and Rhodnius neglectus from Brazil and M. spinolai and M. gajardoi from Chile are to our knowledge described for the first time. PMID:20670628

The evolutionary landscape of intergenic trans-splicing events in insects

Science.gov (United States)

Kong, Yimeng; Zhou, Hongxia; Yu, Yao; Chen, Longxian; Hao, Pei; Li, Xuan

2015-01-01

To explore the landscape of intergenic trans-splicing events and characterize their functions and evolutionary dynamics, we conduct a mega-data study of a phylogeny containing eight species across five orders of class Insecta, a model system spanning 400 million years of evolution. A total of 1,627 trans-splicing events involving 2,199 genes are identified, accounting for 1.58% of the total genes. Homology analysis reveals that mod(mdg4)-like trans-splicing is the only conserved event that is consistently observed in multiple species across two orders, which represents a unique case of functional diversification involving trans-splicing. Thus, evolutionarily its potential for generating proteins with novel function is not broadly utilized by insects. Furthermore, 146 non-mod trans-spliced transcripts are found to resemble canonical genes from different species. Trans-splicing preserving the function of ‘breakup' genes may serve as a general mechanism for relaxing the constraints on gene structure, with profound implications for the evolution of genes and genomes. PMID:26521696

REGIONAL DEVELOPMENT PROBLEMS OF SMALL AND MEDIUMSIZED ENTERPRISES IN LATVIA

Directory of Open Access Journals (Sweden)

Natalja Lace

2013-10-01

Full Text Available Despite the achievements attained in recent years in the economic development of Latvia, until now Latvia’s regions demonstrate uneven development, which negatively impacts the development of small business. The development of the regional innovation environment will contribute to the enhancement of competitiveness of regional economies.

Small hydropower plants in the region of Mariovo (Macedonia)

International Nuclear Information System (INIS)

Panovski, Sotir; Anastasov, Ljupcho

2003-01-01

In this paper the results of an initial Pre-feasibility study within the framework of the PHARE Programme for Cross Border Cooperation between Republic of Macedonia and Republic of Greece. In this study we have looked at the existing research originating from three sources. The Strategies for Economic Development of Republic of Macedonia, the Development Plans of the Electric Power Company of Macedonia as well as the existing technical documentation and studies on a level of idea projects for specific location for small hydropower plants in Mariovo region. Furthermore, analysis and evaluation of this documentation is included. Research done in this region has produced evidence of numerous potential locations for small hydropower plants (total of 46) generating power between 58 kW and 4900 kW, discharging between 0,082 m 3 /s and 30 m 3 /s with a head between 6 m and 208 m for which we have detailed data. Furthermore, in the paper we pay attention to the enormous and so far unrealised hydro energetic power which could be utilised by constructing small hydropower plants in Republic of Macedonia. specifically in the Mariovo region. (Original)

The Intergenic Recombinant HLA-B∗46:01 Has a Distinctive Peptidome that Includes KIR2DL3 Ligands

Directory of Open Access Journals (Sweden)

Hugo G. Hilton

2017-05-01

Full Text Available HLA-B∗46:01 was formed by an intergenic mini-conversion, between HLA-B∗15:01 and HLA-C∗01:02, in Southeast Asia during the last 50,000 years, and it has since become the most common HLA-B allele in the region. A functional effect of the mini-conversion was introduction of the C1 epitope into HLA-B∗46:01, making it an exceptional HLA-B allotype that is recognized by the C1-specific natural killer (NK cell receptor KIR2DL3. High-resolution mass spectrometry showed that HLA-B∗46:01 has a low-diversity peptidome that is distinct from those of its parents. A minority (21% of HLA-B∗46:01 peptides, with common C-terminal characteristics, form ligands for KIR2DL3. The HLA-B∗46:01 peptidome is predicted to be enriched for peptide antigens derived from Mycobacterium leprae. Overall, the results indicate that the distinctive peptidome and functions of HLA-B∗46:01 provide carriers with resistance to leprosy, which drove its rapid rise in frequency in Southeast Asia.

Small State Strategies in emerging Regional Governance Structures

DEFF Research Database (Denmark)

Kluth, Michael Friederich; Lynggaard, Kennet

2017-01-01

This article departs from the puzzling observation that of the five littoral arctic states the Danish realm has been the most consistent backer in China’s quest to gain observer status in the Arctic Council. Small states are generally assumed to adapt to changes in the international system...... such as spatial reconfigurations and alterations in the distribution of capabilities. Yet Denmark’s enabling role in relation to China seems to contravene that assumption. Why would a small state invite one of the world’s leading powers to enter its regional domain while its principle allies and regional partners...... explanation suggesting that unease with growing Canadian securitisation of Arctic issues has prompted courting China as a balancing act. 3) a foreign policy identity explanation focussing on the normative desire to enmeshment China into a liberal Arctic order....

Suitability of the molecular subtyping methods intergenic spacer region, direct genome restriction analysis, and pulsed-field gel electrophoresis for clinical and environmental Vibrio parahaemolyticus isolates.

Science.gov (United States)

Lüdeke, Catharina H M; Fischer, Markus; LaFon, Patti; Cooper, Kara; Jones, Jessica L

2014-07-01

Vibrio parahaemolyticus is the leading cause of infectious illness associated with seafood consumption in the United States. Molecular fingerprinting of strains has become a valuable research tool for understanding this pathogen. However, there are many subtyping methods available and little information on how they compare to one another. For this study, a collection of 67 oyster and 77 clinical V. parahaemolyticus isolates were analyzed by three subtyping methods--intergenic spacer region (ISR-1), direct genome restriction analysis (DGREA), and pulsed-field gel electrophoresis (PFGE)--to determine the utility of these methods for discriminatory subtyping. ISR-1 analysis, run as previously described, provided the lowest discrimination of all the methods (discriminatory index [DI]=0.8665). However, using a broader analytical range than previously reported, ISR-1 clustered isolates based on origin (oyster versus clinical) and had a DI=0.9986. DGREA provided a DI=0.9993-0.9995, but did not consistently cluster the isolates by any identifiable characteristics (origin, serotype, or virulence genotype) and ∼ 15% of isolates were untypeable by this method. PFGE provided a DI=0.9998 when using the combined pattern analysis of both restriction enzymes, SfiI and NotI. This analysis was more discriminatory than using either enzyme pattern alone and primarily grouped isolates by serotype, regardless of strain origin (clinical or oyster) or presence of currently accepted virulence markers. These results indicate that PFGE and ISR-1 are more reliable methods for subtyping V. parahemolyticus, rather than DGREA. Additionally, ISR-1 may provide an indication of pathogenic potential; however, more detailed studies are needed. These data highlight the diversity within V. parahaemolyticus and the need for appropriate selection of subtyping methods depending on the study objectives.

A ribosomal RNA gene intergenic spacer based PCR and DGGE fingerprinting method for the analysis of specific rhizobial communities in soil

NARCIS (Netherlands)

de Oliveira, VM; Manfio, GP; Coutinho, HLD; Keijzer-Wolters, AC; van Elsas, JD

A direct molecular method for assessing the diversity of specific populations of rhizobia in soil, based on nested PCR amplification of 16S-23S ribosomal RNA gene (rDNA) intergenic spacer (IGS) sequences, was developed. Initial generic amplification of bacterial rDNA IGS sequences from soil DNA was

A ribosomal RNA gene intergenic spacer based PCR and DGGE fingerprinting method for the analysis of specific rhizobial communities in soil

NARCIS (Netherlands)

Oliveira, de V.M.; Manfio, G.P.; Coutinho, H.L.D.; Keijzer-Wolters, A.C.; Elsas, van J.D.

2006-01-01

A direct molecular method for assessing the diversity of specific populations of rhizobia in soil, based on nested PCR amplification of 16S-23S ribosomal RNA gene (rDNA) intergenic spacer (IGS) sequences, was developed. Initial generic amplification of bacterial rDNA IGS sequences from soil DNA was

A numerical estimate of the small-kT region in the BFKL pomeron

International Nuclear Information System (INIS)

Bartels, J.

1995-11-01

A computer study is performed to estimate the influence of the small-k T region in the BFKL evolution equation. We consider the small-x region of the deep inelastic structure function F 2 and show that the magnitude of the small-k T region depends on Q 2 and x B . We suggest that the width of the log k T 2 -distribution in the final state may serve as an additional footprint of BFKL-dynamics. For diffractive dissociation it is shown that the contribution of the infrared region is large - event for large Q 2 . This contribution becomes smaller only if restrictions on the final state are imposed. (orig.)

Formation of the Regional System of Small and Medium Enterprises in the Current Economic Conditions

Directory of Open Access Journals (Sweden)

Sergey Aleksandrovich Korobov

2016-10-01

Full Text Available In connection with the growing importance of small and medium enterprises as a crucial element of innovation-oriented economy, the implementation of measures to support and promote small and medium enterprises at the regional level should be based on rational development of existing regional authorities’ resources. Therefore, for the development and adoption of effective (rational decisions in management development of small and medium business, it is important to use the cognitive tools of analysis – modern technologies of system analysis. The article assesses the government measures on the formation of a regional system of development of small and medium enterprises using 4 author’s criteria; provides a cognitive map of the interaction of resources at their development in the process of formation of regional system of development of small and medium enterprises; presents the algorithm of formation of regional system of small and medium business development. The study is based on comprehensive and comparative analysis of the state measures for formation of regional system of small and medium enterprises development in the context of the resource-oriented approach, graphical analysis in the framework of cognitive modeling causal relationships between existing regional authorities, resources, and stages of formation of regional system of development of small and medium enterprises in modern economic conditions, represented in the form of an algorithm. The author comes to the conclusion that the tools of cognitive analysis can be successfully applied in the formation of a regional system of development of small and medium enterprises, as they allow to provide the maximum socio-economic efficiency of harnessing the region’s resources.

Deep sequencing analysis of small noncoding RNA and mRNA targets of the global post-transcriptional regulator, Hfq

DEFF Research Database (Denmark)

Sittka, A; Lucchini, S; Papenfort, K

2008-01-01

would be rescued by overexpression of HilD and FlhDC, and we proved this to be correct. The combination of epitope-tagging and HTPS of immunoprecipitated RNA detected the expression of many intergenic chromosomal regions of Salmonella. Our approach overcomes the limited availability of high...

Genomic Variability of Haemophilus influenzae Isolated from Mexican Children Determined by Using Enterobacterial Repetitive Intergenic Consensus Sequences and PCR

OpenAIRE

Gomez-De-Leon, Patricia; Santos, Jose I.; Caballero, Javier; Gomez, Demostenes; Espinosa, Luz E.; Moreno, Isabel; Piñero, Daniel; Cravioto, Alejandro

2000-01-01

Genomic fingerprints from 92 capsulated and noncapsulated strains of Haemophilus influenzae from Mexican children with different diseases and healthy carriers were generated by PCR using the enterobacterial repetitive intergenic consensus (ERIC) sequences. A cluster analysis by the unweighted pair-group method with arithmetic averages based on the overall similarity as estimated from the characteristics of the genomic fingerprints, was conducted to group the strains. A total of 69 fingerprint...

Identification of Small RNAs in Desulfovibrio vulgaris Hildenborough

International Nuclear Information System (INIS)

Burns, Andrew; Joachimiak, Marcin; Deutschbauer, Adam; Arkin, Adam; Bender, Kelly

2010-01-01

Desulfovibrio vulgaris is an anaerobic sulfate-reducing bacterium capable of facilitating the removal of toxic metals such as uranium from contaminated sites via reduction. As such, it is essential to understand the intricate regulatory cascades involved in how D. vulgaris and its relatives respond to stressors in such sites. One approach is the identification and analysis of small non-coding RNAs (sRNAs); molecules ranging in size from 20-200 nucleotides that predominantly affect gene regulation by binding to complementary mRNA in an anti-sense fashion and therefore provide an immediate regulatory response. To identify sRNAs in D. vulgaris, a bacterium that does not possess an annotated hfq gene, RNA was pooled from stationary and exponential phases, nitrate exposure, and biofilm conditions. The subsequent RNA was size fractionated, modified, and converted to cDNA for high throughput transcriptomic deep sequencing. A computational approach to identify sRNAs via the alignment of seven separate Desulfovibrio genomes was also performed. From the deep sequencing analysis, 2,296 reads between 20 and 250 nt were identified with expression above genome background. Analysis of those reads limited the number of candidates to ∼87 intergenic, while ∼140 appeared to be antisense to annotated open reading frames (ORFs). Further BLAST analysis of the intergenic candidates and other Desulfovibrio genomes indicated that eight candidates were likely portions of ORFs not previously annotated in the D. vulgaris genome. Comparison of the intergenic and antisense data sets to the bioinformatical predicted candidates, resulted in ∼54 common candidates. Current approaches using Northern analysis and qRT-PCR are being used toverify expression of the candidates and to further develop the role these sRNAs play in D. vulgaris regulation.

The role of small agribusiness in regional development: the case of Sumatera Utara province

Science.gov (United States)

Subhilhar

2018-03-01

The agribusiness is an emerging sector in Indonesia and its potential needs to be fully explored. Its development can contribute to a development of regions or correct the discrepancy in welfare benefits between groups and regions. The development of small agribusiness is important and strategic. There are more than 32 million small agribusinesses with their working capital less than Rp. 2 billion per year. In Indonesia, out of this 90 percent (about 21.30 million business units) are household businesses which run business in the agriculture sector. The aim of this study is to identify the contributions of small agribusiness to regional development in Sumatera Utara. The method that used in this study is quantitative approach by using survey and case studies through an in-depth interview. The result shows that small agribusinesses do contribute significantly towards regional development in Sumatera Utara. This study found that annual business turnover significantly contributes toward regional development. The main contribution of small agribusinesses is in the utilization of labor force and local tax revenues.

DNA Methylation of Regulatory Regions of Imprinted Genes at Birth and Its Relation to Infant Temperament

Directory of Open Access Journals (Sweden)

Bernard F. Fuemmeler

2016-01-01

Full Text Available BACKGROUND DNA methylation of the differentially methylated regions (DMRs of imprinted genes is relevant to neurodevelopment. METHODS DNA methylation status of the DMRs of nine imprinted genes in umbilical cord blood leukocytes was analyzed in relation to infant behaviors and temperament (n = 158. RESULTS MEG3 DMR levels were positively associated with internalizing ( β = 0.15, P = 0.044 and surgency ( β = 0.19, P = 0.018 behaviors, after adjusting for birth weight, gender, gestational age at birth, maternal age at delivery, race/ethnicity, education level, smoking status, parity, and a history of anxiety or depression. Higher methylation levels at the intergenic MEG3-IG methylation regions were associated with surgency ( β = 0.28, P = 0.0003 and PEG3 was positively related to externalizing ( β = 0.20, P = 0.01 and negative affectivity ( β = 0.18, P = 0.02. CONCLUSION While the small sample size limits inference, these pilot data support gene-specific associations between epigenetic differences in regulatory regions of imprinted domains at birth and later infant temperament.

Probing the perturbative NLO parton evolution in the small-x region

International Nuclear Information System (INIS)

Glueck, M.; Pisano, C.; Reya, E.

2005-01-01

A dedicated test of the perturbative QCD NLO parton evolution in the very small-x region is performed. We find a good agreement with recent precision HERA data for F 2 p (x,Q 2 ), as well as with the present determination of the curvature of F 2 p . Characteristically, perturbative QCD evolutions result in a positive curvature which increases as xdecreases. Future precision measurements in the very small x-region, x -4 , could provide a sensitive test of the range of validity of perturbative QCD. (orig.)

Small towns as centres of rural micro-regions

Czech Academy of Sciences Publication Activity Database

Vaishar, Antonín; Zapletalová, Jana

2009-01-01

Roč. 1, č. 2 (2009), s. 70-81 ISSN 1803-8417 Grant - others:Nadace Volkswagen(DE) RA2240/06 Institutional research plan: CEZ:AV0Z30860518 Keywords : small towns * periphery * Czechia Subject RIV: AP - Urban, Regional and Transport Planning http://versita.metapress.com/content/w7p7282292l48735/fulltext.pdf

Obstacles to Small Innovative Companies’ Development: Case Study of Nizhny Novgorod Region

Directory of Open Access Journals (Sweden)

Nadezhda Butryumova

2015-12-01

Full Text Available The article presents the survey results of obstacles to small innovative companies as a case study of Nizhny Novgorod region of Russia as an area with high innovative potential and great level of socio-economic indicators. Based on the semi-structural personal interviews with 19 experts - the management of support infrastructure, results shows some typical for this region impediments: bureaucracy; lack of trust, poor collaboration within the innovation system; poor information support; legislative obstacles to innovations and intellectual property protection; low interest of large companies in collaboration with small ones. The findings and recommendations can help policy-makers to meet the needs of small innovative companies, and increase the innovative activity of small firms through the improvement of the assistance programs.

Analysis of a new strain of Euphorbia mosaic virus with distinct replication specificity unveils a lineage of begomoviruses with short Rep sequences in the DNA-B intergenic region

Directory of Open Access Journals (Sweden)

Argüello-Astorga Gerardo R

2010-10-01

Full Text Available Abstract Background Euphorbia mosaic virus (EuMV is a member of the SLCV clade, a lineage of New World begomoviruses that display distinctive features in their replication-associated protein (Rep and virion-strand replication origin. The first entirely characterized EuMV isolate is native from Yucatan Peninsula, Mexico; subsequently, EuMV was detected in weeds and pepper plants from another region of Mexico, and partial DNA-A sequences revealed significant differences in their putative replication specificity determinants with respect to EuMV-YP. This study was aimed to investigate the replication compatibility between two EuMV isolates from the same country. Results A new isolate of EuMV was obtained from pepper plants collected at Jalisco, Mexico. Full-length clones of both genomic components of EuMV-Jal were biolistically inoculated into plants of three different species, which developed symptoms indistinguishable from those induced by EuMV-YP. Pseudorecombination experiments with EuMV-Jal and EuMV-YP genomic components demonstrated that these viruses do not form infectious reassortants in Nicotiana benthamiana, presumably because of Rep-iteron incompatibility. Sequence analysis of the EuMV-Jal DNA-B intergenic region (IR led to the unexpected discovery of a 35-nt-long sequence that is identical to a segment of the rep gene in the cognate viral DNA-A. Similar short rep sequences ranging from 35- to 51-nt in length were identified in all EuMV isolates and in three distinct viruses from South America related to EuMV. These short rep sequences in the DNA-B IR are positioned downstream to a ~160-nt non-coding domain highly similar to the CP promoter of begomoviruses belonging to the SLCV clade. Conclusions EuMV strains are not compatible in replication, indicating that this begomovirus species probably is not a replicating lineage in nature. The genomic analysis of EuMV-Jal led to the discovery of a subgroup of SLCV clade viruses that contain in

Annotating long intergenic non-coding RNAs under artificial selection during chicken domestication.

Science.gov (United States)

Wang, Yun-Mei; Xu, Hai-Bo; Wang, Ming-Shan; Otecko, Newton Otieno; Ye, Ling-Qun; Wu, Dong-Dong; Zhang, Ya-Ping

2017-08-15

Numerous biological functions of long intergenic non-coding RNAs (lincRNAs) have been identified. However, the contribution of lincRNAs to the domestication process has remained elusive. Following domestication from their wild ancestors, animals display substantial changes in many phenotypic traits. Therefore, it is possible that diverse molecular drivers play important roles in this process. We analyzed 821 transcriptomes in this study and annotated 4754 lincRNA genes in the chicken genome. Our population genomic analysis indicates that 419 lincRNAs potentially evolved during artificial selection related to the domestication of chicken, while a comparative transcriptomic analysis identified 68 lincRNAs that were differentially expressed under different conditions. We also found 47 lincRNAs linked to special phenotypes. Our study provides a comprehensive view of the genome-wide landscape of lincRNAs in chicken. This will promote a better understanding of the roles of lincRNAs in domestication, and the genetic mechanisms associated with the artificial selection of domestic animals.

Rapid identification of 11 human intestinal Lactobacillus species by multiplex PCR assays using group- and species-specific primers derived from the 16S-23S rRNA intergenic spacer region and its flanking 23S rRNA.

Science.gov (United States)

Song, Y; Kato, N; Liu, C; Matsumiya, Y; Kato, H; Watanabe, K

2000-06-15

Rapid and reliable two-step multiplex polymerase chain reaction (PCR) assays were established to identify human intestinal lactobacilli; a multiplex PCR was used for grouping of lactobacilli with a mixture of group-specific primers followed by four multiplex PCR assays with four sorts of species-specific primer mixtures for identification at the species level. Primers used were designed from nucleotide sequences of the 16S-23S rRNA intergenic spacer region and its flanking 23S rRNA gene of members of the genus Lactobacillus which are commonly isolated from human stool specimens: Lactobacillus acidophilus, Lactobacillus crispatus, Lactobacillus delbrueckii (ssp. bulgaricus and ssp. lactis), Lactobacillus fermentum, Lactobacillus gasseri, Lactobacillus jensenii, Lactobacillus paracasei (ssp. paracasei and ssp. tolerans), Lactobacillus plantarum, Lactobacillus reuteri, Lactobacillus rhamnosus and Lactobacillus salivarius (ssp. salicinius and ssp. salivarius). The established two-step multiplex PCR assays were applied to the identification of 84 Lactobacillus strains isolated from human stool specimens and the PCR results were consistent with the results from the DNA-DNA hybridization assay. These results suggest that the multiplex PCR system established in this study is a simple, rapid and reliable method for the identification of common Lactobacillus isolates from human stool samples.

The architecture of the chloroplast trnH-psbA non-coding region in angiosperms

Czech Academy of Sciences Publication Activity Database

Štorchová, Helena; Olson, M.S.

2007-01-01

Roč. 268, 1-4 (2007), s. 235-256 ISSN 0378-2697 R&D Projects: GA MŠk(CZ) LC06004 Grant - others:ESPSCor Visiting Scholar Research Grant(US) NSF DEB 0317115 Institutional research plan: CEZ:AV0Z50380511 Source of funding: V - iné verejné zdroje ; V - iné verejné zdroje Keywords : Chloroplast DNA * psbA-trnH intergenic region * Silene * deletions * insertions and inversions in stem-loop region * psbA 3´untranslated region * RNA secondary structure Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.492, year: 2007

THE ROLE OF SMALL AND MEDIUM ENTERPRISES IN THE REGIONALIZATION PROCESS – CASE STUDY

Directory of Open Access Journals (Sweden)

AMALIA VENERA TODORUȚ

2013-12-01

Full Text Available The study presents a short economic incursion concerning the role of small and medium enterprises in the complex regionalization process of Romania and the impact of this sector on the economic development of the regions, as generating new value. In this paper I have approached aspects related to the problematic of regionalization within the new economic context, which is marked by major turbulence with medium and long-term effects. The development disparities are a reality and, therefore, the interventions of the regional development process is designed to reduce these disparities. Through the case study presented, based on the scientific investigations in the field of small and medium enterprises, I have shown which the analyzed economic disparities are, using the following indicators: the grand domestic product per inhabitant, the number of small and medium enterprises on regions, the number of SMEs in economic sectors and development regions, the average number of employees in SMEs, the share of the turnover in SMEs at the regional level. I have also presented several factors that contribute to eliminate the disparities and develop the regions, focusing on the importance of the innovation and creation process, the development of the human resource, the specialization of regions, infrastructure and accessibility.

Potentials and limitations of histone repeat sequences for phylogenetic reconstruction of Sophophora.

Science.gov (United States)

Baldo, A M; Les, D H; Strausbaugh, L D

1999-11-01

Simplified DNA sequence acquisition has provided many new data sets that are useful for phylogenetic reconstruction, including single- and multiple-copy nuclear and organellar genes. Although transcribed regions receive much attention, nontranscribed regions have recently been added to the repertoire of sequences suitable for phylogenetic studies, especially for closely related taxa. We evaluated the efficacy of a small portion of the histone repeat for phylogenetic reconstruction among Drosophila species. Histone repeats in invertebrates offer distinct advantages similar to those of widely used ribosomal repeats. First, the units are tandemly repeated and undergo concerted evolution. Second, histone repeats include both highly conserved coding and variable intergenic regions. This composition facilitates application of "universal" primers spanning potentially informative sites. We examined a small region of the histone repeat, including the intergenic spacer segments of coding regions from the divergently transcribed H2A and H2B histone genes. The spacer (about 230 bp) exists as a mosaic with highly conserved functional motifs interspersed with rapidly diverging regions; the former aid in alignment of the spacer. There are no ambiguities in alignment of coding regions. Coding and noncoding regions were analyzed together and separately for phylogenetic information. Parsimony, distance, and maximum-likelihood methods successfully retrieve the corroborated phylogeny for the taxa examined. This study demonstrates the resolving power of a small histone region which may now be added to the growing collection of phylogenetically useful DNA sequences.

Regional and international market integration of a small open economy

OpenAIRE

Sebastian Fossati; Fernando Lorenzo; Cesar M. Rodríguez

2007-01-01

This paper studies the relationship between a set of commodity prices in a small open economy like Uruguay and the corresponding international and regional prices. The empirical methodology used is the multivariate cointegration procedure based on maximum likelihood methods introduced by Johansen (1988) as well as estimations of half-life persistence indicators. In the case of cereals, the evidence suggests strong market integration between domestic and regional markets and, to some extent, a...

Multiple independent origins of mitochondrial control region duplications in the order Psittaciformes

Science.gov (United States)

Schirtzinger, Erin E.; Tavares, Erika S.; Gonzales, Lauren A.; Eberhard, Jessica R.; Miyaki, Cristina Y.; Sanchez, Juan J.; Hernandez, Alexis; Müeller, Heinrich; Graves, Gary R.; Fleischer, Robert C.; Wright, Timothy F.

2012-01-01

Mitochondrial genomes are generally thought to be under selection for compactness, due to their small size, consistent gene content, and a lack of introns or intergenic spacers. As more animal mitochondrial genomes are fully sequenced, rearrangements and partial duplications are being identified with increasing frequency, particularly in birds (Class Aves). In this study, we investigate the evolutionary history of mitochondrial control region states within the avian order Psittaciformes (parrots and cockatoos). To this aim, we reconstructed a comprehensive multi-locus phylogeny of parrots, used PCR of three diagnostic fragments to classify the mitochondrial control region state as single or duplicated, and mapped these states onto the phylogeny. We further sequenced 44 selected species to validate these inferences of control region state. Ancestral state reconstruction using a range of weighting schemes identified six independent origins of mitochondrial control region duplications within Psittaciformes. Analysis of sequence data showed that varying levels of mitochondrial gene and tRNA homology and degradation were present within a given clade exhibiting duplications. Levels of divergence between control regions within an individual varied from 0–10.9% with the differences occurring mainly between 51 and 225 nucleotides 3′ of the goose hairpin in domain I. Further investigations into the fates of duplicated mitochondrial genes, the potential costs and benefits of having a second control region, and the complex relationship between evolutionary rates, selection, and time since duplication are needed to fully explain these patterns in the mitochondrial genome. PMID:22543055

Region descriptors for automatic classification of small sea targets in infrared video

NARCIS (Netherlands)

Mouthaan, M.M.; Broek, S.P. van den; Hendriks, E.A.; Schwering, P.B.W.

2011-01-01

We evaluate the performance of different key-point detectors and region descriptors when used for automatic classification of small sea targets in infrared video. In our earlier research performed on this subject as well as in other literature, many different region descriptors have been proposed.

Intergenic DNA sequences from the human X chromosome reveal high rates of global gene flow

Directory of Open Access Journals (Sweden)

Wall Jeffrey D

2008-11-01

Full Text Available Abstract Background Despite intensive efforts devoted to collecting human polymorphism data, little is known about the role of gene flow in the ancestry of human populations. This is partly because most analyses have applied one of two simple models of population structure, the island model or the splitting model, which make unrealistic biological assumptions. Results Here, we analyze 98-kb of DNA sequence from 20 independently evolving intergenic regions on the X chromosome in a sample of 90 humans from six globally diverse populations. We employ an isolation-with-migration (IM model, which assumes that populations split and subsequently exchange migrants, to independently estimate effective population sizes and migration rates. While the maximum effective size of modern humans is estimated at ~10,000, individual populations vary substantially in size, with African populations tending to be larger (2,300–9,000 than non-African populations (300–3,300. We estimate mean rates of bidirectional gene flow at 4.8 × 10-4/generation. Bidirectional migration rates are ~5-fold higher among non-African populations (1.5 × 10-3 than among African populations (2.7 × 10-4. Interestingly, because effective sizes and migration rates are inversely related in African and non-African populations, population migration rates are similar within Africa and Eurasia (e.g., global mean Nm = 2.4. Conclusion We conclude that gene flow has played an important role in structuring global human populations and that migration rates should be incorporated as critical parameters in models of human demography.

TALEN-mediated single-base-pair editing identification of an intergenic mutation upstream of BUB1B as causative of PCS (MVA) syndrome

Science.gov (United States)

Ochiai, Hiroshi; Miyamoto, Tatsuo; Kanai, Akinori; Hosoba, Kosuke; Sakuma, Tetsushi; Kudo, Yoshiki; Asami, Keiko; Ogawa, Atsushi; Watanabe, Akihiro; Kajii, Tadashi; Yamamoto, Takashi; Matsuura, Shinya

2014-01-01

Cancer-prone syndrome of premature chromatid separation with mosaic variegated aneuploidy [PCS (MVA) syndrome] is a rare autosomal recessive disorder characterized by constitutional aneuploidy and a high risk of childhood cancer. We previously reported monoallelic mutations in the BUB1B gene (encoding BUBR1) in seven Japanese families with the syndrome. No second mutation was found in the opposite allele of any of the families studied, although a conserved BUB1B haplotype and a decreased transcript were identified. To clarify the molecular pathology of the second allele, we extended our mutational search to a candidate region surrounding BUB1B. A unique single nucleotide substitution, G > A at ss802470619, was identified in an intergenic region 44 kb upstream of a BUB1B transcription start site, which cosegregated with the disorder. To examine whether this is the causal mutation, we designed a transcription activator-like effector nuclease–mediated two-step single-base pair editing strategy and biallelically introduced this substitution into cultured human cells. The cell clones showed reduced BUB1B transcripts, increased PCS frequency, and MVA, which are the hallmarks of the syndrome. We also encountered a case of a Japanese infant with PCS (MVA) syndrome carrying a homozygous single nucleotide substitution at ss802470619. These results suggested that the nucleotide substitution identified was the causal mutation of PCS (MVA) syndrome. PMID:24344301

THE CONCEPTUAL BASIS FOR THE DEVELOPMENT OF SMALL BUSINESS POTENTIAL IN THE REGION

Directory of Open Access Journals (Sweden)

Nataliia Hryshyna

2017-12-01

Full Text Available The article deals with the study of conceptual foundations of the development of the potential of small business in the region. The purpose of the article is to study the essence and features of small business potential and to form conceptual foundations of its development at the regional level. The subject of the research is theoretical, methodological, and practical aspects of the potential of small business in providing a sustainable economic growth. In the course of the research, the following general scientific and special methods are used: dialectical, system analysis, graphical analysis, matrix, mathematical modelling in economics, and logical generalization of results. The essence of the category “small business potential of the region” is studied; it should be understood as a complex system of balanced and mutually related elements in the form of conditions, resources, and opportunities for small business enterprises in the region to conduct production, economic, commercial, and other activities in order to ensure public needs in terms of sustainable economic growth. Methodological principles for forming a conceptual model for the development of small business potential and the scheme of generalized stages of its implementation (preparatory, analytical, operational stages and stage of introduction and implementation are determined, the implementation of which will help to determine the preconditions for the formation of strategic potential, assess its modern quantitative and qualitative composition, and make a forecast of prospects of the use in ensuring sustainable economic growth. It is proposed to use economic and mathematical models, by means of which it is possible to quantitatively describe the connection between the input indicators of the economic system and the performance indicator. In order to substantiate directions of development of the potential of small business in the region in view of its role in creating new jobs

Intergenic mRNA molecules resulting from trans-splicing.

Science.gov (United States)

Finta, Csaba; Zaphiropoulos, Peter G

2002-02-22

Accumulated recent evidence is indicating that alternative splicing represents a generalized process that increases the complexity of human gene expression. Here we show that mRNA production may not necessarily be limited to single genes, as human liver also has the potential to produce a variety of hybrid cytochrome P450 3A mRNA molecules. The four known cytochrome P450 3A genes in humans, CYP3A4, CYP3A5, CYP3A7, and CYP3A43, share a high degree of similarity, consist of 13 exons with conserved exon-intron boundaries, and form a cluster on chromosome 7. The chimeric CYP3A mRNA molecules described herein are characterized by CYP3A43 exon 1 joined at canonical splice sites to distinct sets of CYP3A4 or CYP3A5 exons. Because the CYP3A43 gene is in a head-to-head orientation with the CYP3A4 and CYP3A5 genes, bypassing transcriptional termination can not account for the formation of hybrid CYP3A mRNAs. Thus, the mechanism generating these molecules has to be an RNA processing event that joins exons of independent pre-mRNA molecules, i.e. trans-splicing. Using quantitative real-time polymerase chain reaction, the ratio of one CYP3A43/3A4 intergenic combination was estimated to be approximately 0.15% that of the CYP3A43 mRNAs. Moreover, trans-splicing has been found not to interfere with polyadenylation. Heterologous expression of the chimeric species composed of CYP3A43 exon 1 joined to exons 2-13 of CYP3A4 revealed catalytic activity toward testosterone.

Steps to Internet Adoption Success: a study of four small regional organisations

Directory of Open Access Journals (Sweden)

Aileen Cater-Steel

2004-05-01

Full Text Available In response to concerns about the reluctance of Australian small business to embrace e-commerce, this study describes the steps taken by four small regional organisations to establish web sites and enter into e-commerce. As well as mapping the actual adoption steps to models of e-commerce adoption, recommendations are made to guide small business through initial web site development. This study suggests that when adopting internet technologies, small organisations needs to focus on sound business objectives, plan for an evolutionary approach, and recognise the value of adapting a traditional systems development life cycle approach to web site development.

Decentralized electrification by small-scale hydraulic stations : a viable solution in mountainous regions

International Nuclear Information System (INIS)

Dahman Saidi, A.

1998-01-01

The installation of a small-scale hydroelectric generating station to supply electricity to the small community of Takordmi in Morocco was described. The community of Takordmi consists of 32 households located in the remote mountainous region of Morocco. Takordmi was without electrical power until 1992 when a small 15 kW Pelton turbine was installed to supply electricity to the residents. Water to power the turbine generator was supplied by a small stream with an output of 4 to 8 liters per second and a head of 535 meters. Since the unit was installed, the mean monthly consumption of the community has been only 115 kWh, which averages to 4 kWh per household. The success of the Takordmi project has prompted the electrification of several other small communities in the remote regions of Morocco either by similar micro-hydroelectric stations or by photovoltaic cells. This project, funded by the Republic of Austria, demonstrates that it is feasible to provide electricity to remote rural communities by using local sources of power. 3 figs

[Late-replicating regions in salivary gland polytene chromosomes of Drosophila melanogaster].

Science.gov (United States)

Kolesnikov, T D; Andreenkova, N G; Beliaeva, E S; Goncharov, F P; Zykova, T Iu; Boldyreva, L V; Pokholkova, g V; Zhimulev, I F

2013-01-01

About 240 specific regions that are replicated at the very end of the S-phase have been identified in D. melanogaster polytene chromosomes. These regions have a repressive chromatine state, low gene density, long intergenic distances and are enriched in tissue specific genes. In polytene chromosomes, about a quarter of these regions have no enough time to complete replication. As a result, underreplication zones represented by fewer DNA copy number, appear. We studied 60 chromosome regions that demonstrated the most pronounced under-replication. By comparing the location of these regions on a molecular map with syntenic blocks found earlier for Drosophila species by von Grotthuss et al., 2010, we have shown that across the genus Drosophila, these regions tend to have conserved gene order. This forces us to assume the existence of evolutionary mechanisms aimed at maintaining the integrity of these regions.

Arabidopsis RNASE THREE LIKE2 Modulates the Expression of Protein-Coding Genes via 24-Nucleotide Small Interfering RNA-Directed DNA Methylation.

Science.gov (United States)

Elvira-Matelot, Emilie; Hachet, Mélanie; Shamandi, Nahid; Comella, Pascale; Sáez-Vásquez, Julio; Zytnicki, Matthias; Vaucheret, Hervé

2016-02-01

RNaseIII enzymes catalyze the cleavage of double-stranded RNA (dsRNA) and have diverse functions in RNA maturation. Arabidopsis thaliana RNASE THREE LIKE2 (RTL2), which carries one RNaseIII and two dsRNA binding (DRB) domains, is a unique Arabidopsis RNaseIII enzyme resembling the budding yeast small interfering RNA (siRNA)-producing Dcr1 enzyme. Here, we show that RTL2 modulates the production of a subset of small RNAs and that this activity depends on both its RNaseIII and DRB domains. However, the mode of action of RTL2 differs from that of Dcr1. Whereas Dcr1 directly cleaves dsRNAs into 23-nucleotide siRNAs, RTL2 likely cleaves dsRNAs into longer molecules, which are subsequently processed into small RNAs by the DICER-LIKE enzymes. Depending on the dsRNA considered, RTL2-mediated maturation either improves (RTL2-dependent loci) or reduces (RTL2-sensitive loci) the production of small RNAs. Because the vast majority of RTL2-regulated loci correspond to transposons and intergenic regions producing 24-nucleotide siRNAs that guide DNA methylation, RTL2 depletion modifies DNA methylation in these regions. Nevertheless, 13% of RTL2-regulated loci correspond to protein-coding genes. We show that changes in 24-nucleotide siRNA levels also affect DNA methylation levels at such loci and inversely correlate with mRNA steady state levels, thus implicating RTL2 in the regulation of protein-coding gene expression. © 2016 American Society of Plant Biologists. All rights reserved.

Identification of multiple sites suitable for insertion of foreign genes in herpes simplex virus genomes.

Science.gov (United States)

Morimoto, Tomomi; Arii, Jun; Akashi, Hiroomi; Kawaguchi, Yasushi

2009-03-01

Information on sites in HSV genomes at which foreign gene(s) can be inserted without disrupting viral genes or affecting properties of the parental virus are important for basic research on HSV and development of HSV-based vectors for human therapy. The intergenic region between HSV-1 UL3 and UL4 genes has been reported to satisfy the requirements for such an insertion site. The UL3 and UL4 genes are oriented toward the intergenic region and, therefore, insertion of a foreign gene(s) into the region between the UL3 and UL4 polyadenylation signals should not disrupt any viral genes or transcriptional units. HSV-1 and HSV-2 each have more than 10 additional regions structurally similar to the intergenic region between UL3 and UL4. In the studies reported here, it has been demonstrated that insertion of a reporter gene expression cassette into several of the HSV-1 and HSV-2 intergenic regions has no effect on viral growth in cell culture or virulence in mice, suggesting that these multiple intergenic regions may be suitable HSV sites for insertion of foreign genes.

Comparative phylogenetic analysis of intergenic spacers and small ...

African Journals Online (AJOL)

The phylogenetic analysis of test isolates included assessment of variation in sequences and length of IGS and SSU-rRNA genes with reference to 16 different microsporidian sequences. The results proved that IGS sequences have more variation than SSU-rRNA gene sequences. Analysis of phylogenetic trees reveal that ...

Spectrum of small mutations in the dystrophin coding region

Energy Technology Data Exchange (ETDEWEB)

Prior, T.W.; Bartolo, C.; Pearl, D.K. [Ohio State Univ., Columbus, OH (United States)] [and others

1995-07-01

Duchenne and Becker muscular dystrophies (DMD and BMD) are caused by defects in the dystrophin gene. About two-thirds of the affected patients have large deletions or duplications, which occur in the 5` and central portion of the gene. The nondeletion/duplication cases are most likely the result of smaller mutations that cannot be identified by current diagnostic screening strategies. We screened {approximately} 80% of the dystrophin coding sequence for small mutations in 158 patients without deletions or duplications and identified 29 mutations. The study indicates that many of the DMD and the majority of the BMD small mutations lie in noncoding regions of the gene. All of the mutations identified were unique to single patients, and most of the mutations resulted in protein truncation. We did not find a clustering of small mutations similar to the deletion distribution but found > 40% of the small mutations 3` of exon 55. The extent of protein truncation caused by the 3` mutations did not determine the phenotype, since even the exon 76 nonsense mutation resulted in the severe DMD phenotype. Our study confirms that the dystrophin gene is subject to a high rate of mutation in CpG sequences. As a consequence of not finding any hotspots or prevalent small mutations, we conclude that it is presently not possible to perform direct carrier and prenatal diagnostics for many families without deletions or duplications. 71 refs., 2 figs., 2 tabs.

Expression of antisense small RNAs in response to stress in Pseudomonas aeruginosa

DEFF Research Database (Denmark)

Gómez Lozano, María; Marvig, Rasmus Lykke; Tulstrup, Monica Vera-Lise

2014-01-01

Background: RNA sequencing technologies reveal that bacteria express RNA molecules other than mRNA, rRNA or tRNA. During the last years genome-wide bacterial transcriptomes have been shown to comprise intergenic RNA, antisense RNA, and untranslated regions, all capable of performing diverse...... that the extent of overlap between the studies is very limited. Conclusions: RNA-seq experiments are revealing hundreds of novel transcripts in all bacterial genomes investigated. The comparison between independent studies that used RNA-seq to detect novel asRNAs in P. aeruginosa shows that the overlap between...

Genome wide discovery of long intergenic non-coding RNAs in Diamondback moth (Plutella xylostella) and their expression in insecticide resistant strains

Science.gov (United States)

Etebari, Kayvan; Furlong, Michael J.; Asgari, Sassan

2015-01-01

Long non-coding RNAs (lncRNAs) play important roles in genomic imprinting, cancer, differentiation and regulation of gene expression. Here, we identified 3844 long intergenic ncRNAs (lincRNA) in Plutella xylostella, which is a notorious pest of cruciferous plants that has developed field resistance to all classes of insecticides, including Bacillus thuringiensis (Bt) endotoxins. Further, we found that some of those lincRNAs may potentially serve as precursors for the production of small ncRNAs. We found 280 and 350 lincRNAs that are differentially expressed in Chlorpyrifos and Fipronil resistant larvae. A survey on P. xylostella midgut transcriptome data from Bt-resistant populations revealed 59 altered lincRNA in two resistant strains compared with the susceptible population. We validated the transcript levels of a number of putative lincRNAs in deltamethrin-resistant larvae that were exposed to deltamethrin, which indicated that this group of lincRNAs might be involved in the response to xenobiotics in this insect. To functionally characterize DBM lincRNAs, gene ontology (GO) enrichment of their associated protein-coding genes was extracted and showed over representation of protein, DNA and RNA binding GO terms. The data presented here will facilitate future studies to unravel the function of lincRNAs in insecticide resistance or the response to xenobiotics of eukaryotic cells. PMID:26411386

Small And Medium-Sized Business Development In Regions: Establishment Of Priority Directions By The Example Of Sverdlovsk Region

Directory of Open Access Journals (Sweden)

Dmitry Yevgenyevich Tolmachev

2015-03-01

Full Text Available The paper presents the research of current small and medium-sized business development in Sverdlovsk region. It includes analysis of enterprise development statistics, Russian and international experience, sociological survey of entrepreneurs’ satisfaction of doing business conditions in Sverdlovsk region. The aim of the research was to develop proposals for business support system development in the long run for inclusion in the SME Development Strategy in Sverdlovsk region up to 2030. As a result, a set of strategic SME development directions was formulated. It includes measures aimed at business problems solving through the development of SME support tools and at addressing institutional problems of business support. The paper includes proposals for improvement of regional support system and implementation the priority SME development direction

The role of small and medium-sized high-tech enterprise in the formation of innovative potential of the Voronezh region

Directory of Open Access Journals (Sweden)

E. A. Shubina

2016-01-01

Full Text Available In modern conditions the region's sustainable development and economic growth is largely determined by its ability to implement innovations. One of the determining factors of long-term economic development of the territories, to date, is innovation. A mechanism to give impetus to the innovative development of the regions is to create effective small and medium-sized innovative enterprises. Voronezh region, like many Russian regions, has considerable potential for innovation, but usually it is not used efficiently or not used at all. The article deals with the concept and the need to develop innovative entrepreneurship and the role of small and medium innovative enterprises in the formation of scientific and technical potential of the Voronezh region. The basic conditions and factors promoting and impeding the development of small and medium innovative businesses in the region, determined the willingness of subjects of innovation activity in the development, implementation and promotion of innovation in the region. The problems of development of small and medium-sized businesses at the regional level. The evaluation of actions to improve SMEs management programs in the region. Particular attention is given to the classification of small and medium-sized innovative business structures. In order to stimulate the development of small and medium-sized innovative business in the Voronezh region in the article suggests the implementation of a package of measures. The active use of innovation by small and medium-sized enterprises of the Voronezh area enhances their efficiency and competitiveness, creates new jobs, which ultimately has a positive effect on the region's economic development, the growth of the tax base, improving the quality of life of the population.

Assessment of the impact of nuclear power plant construction and operation on small regions

International Nuclear Information System (INIS)

Johnson, M.H. Jr.

1977-01-01

This study addresses the problem of the comprehensive, quantitative evaluation of the environmental, economic, and social impacts of the construction and operation of nuclear power plant on a given region. A theoretical model of the regional impacts is constructed employing input-output methods that are extended to include ecologic as well as economic effects. Thus, the regional model explicitly incorporates environmental feedback as a consequence of economic activity. The model is then employed to estimate the impact of the construction and operation of a nuclear power facility on a small region in South Carolina. Measures of economic and environmental effects include estimates of changes in output, income, employment, local government revenue and expenditure, external costs of environmental decay, pollution loads, and common-property resource usage. Results indicate that, in the South Carolina case study, significant gains in social welfare accrued to the region due to the construction and operation of the nuclear power facility. Further, the theoretical method developed herein provides a comprehensive method of objectively assessing various types of impacts on a region as small as several contiguous counties or even a single county

Production operation of small petroleum enterprises in Tomsk region

Science.gov (United States)

Sharf, I.; Filjushin, V.; Shenderova, I.; Kochetkova, O.

2015-11-01

Implementing resource-innovative strategy to develop Russian fuel-and-energy sector implies the promotion of small oil production enterprises developing fields with the reserves of less than 5 mln. tons. However, the efficiency of such enterprises, investigated on the example of Tomsk region (considering the indexes of oil extraction, growth of reserves, amount of capital expenditures and geological surveys), signifies the presence of definite tendencies. Consequently, management decisions concerning economic, organizational, financial and fiscal character should be taken in order to eliminate detrimental factors.

TILT ANGLE AND FOOTPOINT SEPARATION OF SMALL AND LARGE BIPOLAR SUNSPOT REGIONS OBSERVED WITH HMI

International Nuclear Information System (INIS)

McClintock, B. H.; Norton, A. A.

2016-01-01

We investigate bipolar sunspot regions and how tilt angle and footpoint separation vary during emergence and decay. The Helioseismic and Magnetic Imager on board the Solar Dynamic Observatory collects data at a higher cadence than historical records and allows for a detailed analysis of regions over their lifetimes. We sample the umbral tilt angle, footpoint separation, and umbral area of 235 bipolar sunspot regions in Helioseismic and Magnetic Imager—Debrecen Data with an hourly cadence. We use the time when the umbral area peaks as time zero to distinguish between the emergence and decay periods of each region and we limit our analysis of tilt and separation behavior over time to within ±96 hr of time zero. Tilt angle evolution is distinctly different for regions with small (≈30 MSH), midsize (≈50 MSH), and large (≈110 MSH) maximum umbral areas, with 45 and 90 MSH being useful divisions for separating the groups. At the peak umbral area, we determine median tilt angles for small (7.°6), midsize (5.°9), and large (9.°3) regions. Within ±48 hr of the time of peak umbral area, large regions steadily increase in tilt angle, midsize regions are nearly constant, and small regions show evidence of negative tilt during emergence. A period of growth in footpoint separation occurs over a 72-hr period for all of the regions from roughly 40 to 70 Mm. The smallest bipoles (<9 MSH) are outliers in that they do not obey Joy's law and have a much smaller footpoint separation. We confirm the Muñoz-Jaramillo et al. results that the sunspots appear to be two distinct populations

Security region-based small signal stability analysis of power systems with FSIG based wind farm

Science.gov (United States)

Qin, Chao; Zeng, Yuan; Yang, Yang; Cui, Xiaodan; Xu, Xialing; Li, Yong

2018-02-01

Based on the Security Region approach, the impact of fixed-speed induction generator based wind farm on the small signal stability of power systems is analyzed. Firstly, the key factors of wind farm on the small signal stability of power systems are analyzed and the parameter space for small signal stability region is formed. Secondly, the small signal stability region of power systems with wind power is established. Thirdly, the corresponding relation between the boundary of SSSR and the dominant oscillation mode is further studied. Results show that the integration of fixed-speed induction generator based wind farm will cause the low frequency oscillation stability of the power system deteriorate. When the output of wind power is high, the oscillation stability of the power system is mainly concerned with the inter-area oscillation mode caused by the integration of the wind farm. Both the active power output and the capacity of reactive power compensation of the wind farm have a significant influence on the SSSR. To improve the oscillation stability of power systems with wind power, it is suggested to reasonably set the reactive power compensation capacity for the wind farm through SSSR.

FINANCIAL STABILITY OF SMALL BUSINESS: THE ESTIMATION AND DYNAMICS OF REGIONAL DEVELOPMENT

Directory of Open Access Journals (Sweden)

A.U. Makarova

2008-03-01

Full Text Available In clause the problem of an estimation of financial stability of the enterprises of small business is considered. It is offered to use traditional indicators of an estimation of the financial stability, describing it in the short-term period, and such indicators as equation of monetary streams, qualitative risk-management, a level äèâåðñèôèêàöèè business and competitive position of the company for an estimation of stability in the long-term period. On the basis of data of statistical supervision over small enterprises the estimation of dynamics of results of financial activity and financial stability of small enterprises of Sverdlovsk area is lead to 2001 – 2005 is drawn a conclusion about low parameters of solvency and financial stability of small enterprises of region in comparison with normative parameters and data on the large and average enterprises. The measures directed on increase of financial stability of the enterprises of small business are offered.

Regional Determinants of Small Business Survival during the Crisis in Romania

Directory of Open Access Journals (Sweden)

Anca Dachin

2013-08-01

Full Text Available The economic crisis in Romania has increased the business vulnerability since 2009. The recessionary gap and the high uncertainty of the economic environment have determined many companies to leave the market. The regional differences in the entrepreneurial performance suggest that the regional dimension should be included in the firm demography analysis. Most studies refer to the favorable conditions which stimulate the entry of new firms. However, during the crisis, for many small businesses the main problem has been the survival. The paper focuses on the analysis of adjustment processes within the SME´s sector in terms of changes in number of enterprises and turnover. The regional differences in the three-year survival rate (2008-2011 show the structural particularities of the economic activity. The paper aims at identifying the empirical relationship between economic determinants and entrepreneurial performance at regional NUTS2 level in Romania.

Optimisation of automated ribosomal intergenic spacer analysis for the estimation of microbial diversity in fynbos soil

Directory of Open Access Journals (Sweden)

Karin Jacobs

2010-07-01

Full Text Available Automated ribosomal intergenic spacer analysis (ARISA has become a commonly used molecular technique for the study of microbial populations in environmental samples. The reproducibility and accuracy of ARISA, with and without the polymerase chain reaction (PCR are important aspects that influence the results and effectiveness of these techniques. We used the primer set ITS4/ITS5 for ARISA to assess the fungal community composition of two sites situated in the Sand Fynbos. The primer set proved to deliver reproducible ARISA profiles of the fungal community composition with little variation observed between ARISA-PCRs. Variation that occurred in a sample due to repeated DNA extraction is expected for ecological studies. This reproducibility made ARISA a useful tool for the assessment and comparison of diversity in ecological samples. In this paper, we also offered particular suggestions concerning the binning strategy for the analysis of ARISA profiles.

75 FR 48986 - Vendor Outreach Workshop for Small Businesses in the National Capitol Region of the United States

Science.gov (United States)

2010-08-12

... DEPARTMENT OF THE INTERIOR Office of the Secretary Vendor Outreach Workshop for Small Businesses in the National Capitol Region of the United States AGENCY: Office of the Secretary, Interior. ACTION... Interior are hosting a Vendor Outreach Workshop for small businesses in the National Capitol region of the...

Population genetic structure and phylogeographical pattern of a relict tree fern, Alsophila spinulosa (Cyatheaceae), inferred from cpDNA atpB- rbcL intergenic spacers.

Science.gov (United States)

Su, Yingjuan; Wang, Ting; Zheng, Bo; Jiang, Yu; Chen, Guopei; Gu, Hongya

2004-11-01

Sequences of chloroplast DNA (cpDNA) atpB- rbcL intergenic spacers of individuals of a tree fern species, Alsophila spinulosa, collected from ten relict populations distributed in the Hainan and Guangdong provinces, and the Guangxi Zhuang region in southern China, were determined. Sequence length varied from 724 bp to 731 bp, showing length polymorphism, and base composition was with high A+T content between 63.17% and 63.95%. Sequences were neutral in terms of evolution (Tajima's criterion D=-1.01899, P>0.10 and Fu and Li's test D*=-1.39008, P>0.10; F*=-1.49775, P>0.10). A total of 19 haplotypes were identified based on nucleotide variation. High levels of haplotype diversity (h=0.744) and nucleotide diversity (Dij=0.01130) were detected in A. spinulosa, probably associated with its long evolutionary history, which has allowed the accumulation of genetic variation within lineages. Both the minimum spanning network and neighbor-joining trees generated for haplotypes demonstrated that current populations of A. spinulosa existing in Hainan, Guangdong, and Guangxi were subdivided into two geographical groups. An analysis of molecular variance indicated that most of the genetic variation (93.49%, P<0.001) was partitioned among regions. Wright's isolation by distance model was not supported across extant populations. Reduced gene flow by the Qiongzhou Strait and inbreeding may result in the geographical subdivision between the Hainan and Guangdong + Guangxi populations (FST=0.95, Nm=0.03). Within each region, the star-like pattern of phylogeography of haplotypes implied a population expansion process during evolutionary history. Gene genealogies together with coalescent theory provided significant information for uncovering phylogeography of A. spinulosa.

Energy price increases, economic rents, and industrial structure in a small regional economy

Energy Technology Data Exchange (ETDEWEB)

Norrie, K.H.; Percy, M.B.

1982-01-01

The authors model the relationship between natural-resource revenues and regional economic diversification in the context of a general-equilibrium model of a small, open, natural-resource-based regional economy. The model is then used to stimulate the implications of various province-building strategies, and to draw policy implications from this. They find that the efforts to diversify the economy using the fiscal capacity of the region will, in general, impose real welfare losses on the residents of the province, although certain groups, such as land owners, are already better off.

The Dunaliella salina organelle genomes: large sequences, inflated with intronic and intergenic DNA

Energy Technology Data Exchange (ETDEWEB)

Smith, David R.; Lee, Robert W.; Cushman, John C.; Magnuson, Jon K.; Tran, Duc; Polle, Juergen E.

2010-05-07

Abstract Background: Dunaliella salina Teodoresco, a unicellular, halophilic green alga belonging to the Chlorophyceae, is among the most industrially important microalgae. This is because D. salina can produce massive amounts of β-carotene, which can be collected for commercial purposes, and because of its potential as a feedstock for biofuels production. Although the biochemistry and physiology of D. salina have been studied in great detail, virtually nothing is known about the genomes it carries, especially those within its mitochondrion and plastid. This study presents the complete mitochondrial and plastid genome sequences of D. salina and compares them with those of the model green algae Chlamydomonas reinhardtii and Volvox carteri. Results: The D. salina organelle genomes are large, circular-mapping molecules with ~60% noncoding DNA, placing them among the most inflated organelle DNAs sampled from the Chlorophyta. In fact, the D. salina plastid genome, at 269 kb, is the largest complete plastid DNA (ptDNA) sequence currently deposited in GenBank, and both the mitochondrial and plastid genomes have unprecedentedly high intron densities for organelle DNA: ~1.5 and ~0.4 introns per gene, respectively. Moreover, what appear to be the relics of genes, introns, and intronic open reading frames are found scattered throughout the intergenic ptDNA regions -- a trait without parallel in other characterized organelle genomes and one that gives insight into the mechanisms and modes of expansion of the D. salina ptDNA. Conclusions: These findings confirm the notion that chlamydomonadalean algae have some of the most extreme organelle genomes of all eukaryotes. They also suggest that the events giving rise to the expanded ptDNA architecture of D. salina and other Chlamydomonadales may have occurred early in the evolution of this lineage. Although interesting from a genome evolution standpoint, the D. salina organelle DNA sequences will aid in the development of a viable

The Dunaliella salina organelle genomes: large sequences, inflated with intronic and intergenic DNA

Directory of Open Access Journals (Sweden)

Tran Duc

2010-05-01

Full Text Available Abstract Background Dunaliella salina Teodoresco, a unicellular, halophilic green alga belonging to the Chlorophyceae, is among the most industrially important microalgae. This is because D. salina can produce massive amounts of β-carotene, which can be collected for commercial purposes, and because of its potential as a feedstock for biofuels production. Although the biochemistry and physiology of D. salina have been studied in great detail, virtually nothing is known about the genomes it carries, especially those within its mitochondrion and plastid. This study presents the complete mitochondrial and plastid genome sequences of D. salina and compares them with those of the model green algae Chlamydomonas reinhardtii and Volvox carteri. Results The D. salina organelle genomes are large, circular-mapping molecules with ~60% noncoding DNA, placing them among the most inflated organelle DNAs sampled from the Chlorophyta. In fact, the D. salina plastid genome, at 269 kb, is the largest complete plastid DNA (ptDNA sequence currently deposited in GenBank, and both the mitochondrial and plastid genomes have unprecedentedly high intron densities for organelle DNA: ~1.5 and ~0.4 introns per gene, respectively. Moreover, what appear to be the relics of genes, introns, and intronic open reading frames are found scattered throughout the intergenic ptDNA regions -- a trait without parallel in other characterized organelle genomes and one that gives insight into the mechanisms and modes of expansion of the D. salina ptDNA. Conclusions These findings confirm the notion that chlamydomonadalean algae have some of the most extreme organelle genomes of all eukaryotes. They also suggest that the events giving rise to the expanded ptDNA architecture of D. salina and other Chlamydomonadales may have occurred early in the evolution of this lineage. Although interesting from a genome evolution standpoint, the D. salina organelle DNA sequences will aid in the

Prevalence of Toxoplasma gondii in small mammals from the Ardennes region, France.

Science.gov (United States)

Afonso, Eve; Poulle, Marie-Lazarine; Lemoine, Mélissa; Villena, Isabelle; Aubert, Dominique; Gilot-Fromont, Emmanuelle

2007-11-01

Serum samples from 218 small mammals trapped in forest and grassland in the Ardennes region (North-eastern France) were tested for antibodies to Toxoplasma gondii. Using the modified agglutination test, positive results were found in 4/92 Apodemus sp., 3/64 Clethrionomys glareolus, 0/26 Microtus agrestis, 0/4 Micromys minutus, 3/5 Sorex sp., 2/9 Arvicola terrestris, and 7/18 Talpa europaea. Toxoplasma gondii was not isolated from the heart of seropositive individuals after bioassay in mice. Seroprevalence was significantly higher in large fossorial mammals living in grassland than in small forest mammals, probably related to ecological factors.

The mitochondrial genomes of sponges provide evidence for multiple invasions by Repetitive Hairpin-forming Elements (RHE

Directory of Open Access Journals (Sweden)

Lavrov Dennis V

2009-12-01

Full Text Available Abstract Background The mitochondrial (mt genomes of sponges possess a variety of features, which appear to be intermediate between those of Eumetazoa and non-metazoan opisthokonts. Among these features is the presence of long intergenic regions, which are common in other eukaryotes, but generally absent in Eumetazoa. Here we analyse poriferan mitochondrial intergenic regions, paying particular attention to repetitive sequences within them. In this context we introduce the mitochondrial genome of Ircinia strobilina (Lamarck, 1816; Demospongiae: Dictyoceratida and compare it with mtDNA of other sponges. Results Mt genomes of dictyoceratid sponges are identical in gene order and content but display major differences in size and organization of intergenic regions. An even higher degree of diversity in the structure of intergenic regions was found among different orders of demosponges. One interesting observation made from such comparisons was of what appears to be recurrent invasions of sponge mitochondrial genomes by repetitive hairpin-forming elements, which cause large genome size differences even among closely related taxa. These repetitive hairpin-forming elements are structurally and compositionally divergent and display a scattered distribution throughout various groups of demosponges. Conclusion Large intergenic regions of poriferan mt genomes are targets for insertions of repetitive hairpin- forming elements, similar to the ones found in non-metazoan opisthokonts. Such elements were likely present in some lineages early in animal mitochondrial genome evolution but were subsequently lost during the reduction of intergenic regions, which occurred in the Eumetazoa lineage after the split of Porifera. Porifera acquired their elements in several independent events. Patterns of their intra-genomic dispersal can be seen in the mt genome of Vaceletia sp.

Energy transitions in small-scale regions – What we can learn from a regional innovation systems perspective

International Nuclear Information System (INIS)

Mattes, Jannika; Huber, Andreas; Koehrsen, Jens

2015-01-01

The prevalent theories in the debate on sustainability transitions have been criticised for not sufficiently addressing energy change processes at the local level. This paper aims to enhance our understanding of local energy reorganisation processes. Drawing on the Regional Innovation Systems (RIS) approach, we argue that local development dynamics result from the interaction of various subsystems: science, politics, public administration, industry, finance, intermediaries and civil society. The analysis of the involved subsystems and their interaction shows how energy transitions are shaped by different individual and organisational actors as well as institutions on the local level. Empirical evidence from case studies on the German cities of Emden and Bottrop illustrates our theoretical conceptualisation of energy transitions. We conclude by presenting characteristic interaction patterns for energy transition drawn from the two cases. - Highlights: • We highlight the importance of spatial and regional aspects for transitions. • We draw upon regional innovation systems’ subsystems to describe energy transitions. • We show how actors and institutions interact in and coordinate transition processes. • We present evidence from two small-scale regions in Germany: Emden and Bottrop

Clothing industry: development problems, regional dislocation and modern management technologies for small enterprises

Directory of Open Access Journals (Sweden)

I. Hristoforova

2015-01-01

Full Text Available This article discusses issues related to the problems of development of light industry in the territory of the former Soviet Union, systematize industry regions and analyzes modern management technologies used by small businesses garment industry. The aim of the article is the analysis of the organizational and economic aspects of light industry on the example of clothing companies. The objectives of the article: to sistematize the major regions of the dislocation of light industry: textile, footwear, clothing; to characterize the current state of the apparel industry enterprises; to show the value of small clothing companies; to study the need for the introduction of flexible manufacturing systems (FMS on small sewing factories; to analyze the range of the scientific development of national universities in the study of flexible manufacturing systems and give them a brief description.Methodology. The methodological basis of the paper is the following scientific methods: deduction, comparative and group analysis, desk research. The Results. The result of the study is to identify the main issues and trends in the development of light industry, ordering the placement of the industry in the territory of the former Soviet Union, the definition of the most popular management techniques used in small businesses garment industry.Conclusions / significance. The above article analyzes the development of light industry has allowed to identify the main trends and formulate problems for the enterprises. New conditions require the development of small enterprises and the introduction of modern technologies in production processes and management.

The web-based information system for small and medium enterprises of Tomsk region

Science.gov (United States)

Senchenko, P. V.; Zhukovskiy, O. I.; Gritsenko, Yu B.; Senchenko, A. P.; Gritsenko, L. M.; Kovaleva, E. V.

2017-01-01

This paper presents the web enabled automated information data support system of small and medium-sized enterprises of Tomsk region. We define the purpose and application field of the system. In addition, we build a generic architecture and find system functions.

An Assessment of Regional Sustainability through Quality Labels for Small Farmers’ Products: A Slovak Case Study

Directory of Open Access Journals (Sweden)

Jana Jaďuďová

2018-04-01

Full Text Available Regional product labelling can help develop regional business activities, especially with traditional regional products. Their general popularity is a significant source of income for less-developed regions. The Gemer-Malohont region is an economically underdeveloped area with a high unemployment rate. The subject of the survey was focused on regional food products that are made by small farmers. The analysis was carried out using data from a questionnaire survey on the period April–July 2017 in each of the region’s districts. The results obtained by the questionnaire survey were processed with the use of statistical methods (two-step cluster analysis, radar chart, box-plots, regression analysis using Microsoft Excel and the IBM SPSS Statistics 23 software. We divided consumers into two groups—knowledgeable regional food purchasers and priced-oriented consumers—based on their preference for regional food and through cluster analysis. We show that the more developed regions (Rimavská Sobota and Rožňava show a higher rate of purchase of regional foods. Less-developed regions (Poltár, Revúca are represented by lower-income consumers for whom the food price is the decisive criterion. Local residents of backward regions should pay attention to domestic food and local small farmers who are tools for the creation of local capital and local development.

A one-step reaction for the rapid identification of Lactobacillus mindensis, Lactobacillus panis, Lactobacillus paralimentarius, Lactobacillus pontis and Lactobacillus frumenti using oligonucleotide primers designed from the 16S-23S rRNA intergenic sequences.

Science.gov (United States)

Ferchichi, M; Valcheva, R; Prévost, H; Onno, B; Dousset, X

2008-06-01

Species-specific primers targeting the 16S-23S ribosomal DNA (rDNA) intergenic spacer region (ISR) were designed to rapidly discriminate between Lactobacillus mindensis, Lactobacillus panis, Lactobacillus paralimentarius, Lactobacillus pontis and Lactobacillus frumenti species recently isolated from French sourdough. The 16S-23S ISRs were amplified using primers 16S/p2 and 23S/p7, which anneal to positions 1388-1406 of the 16S rRNA gene and to positions 207-189 of the 23S rRNA gene respectively, Escherichia coli numbering (GenBank accession number V00331). Clone libraries of the resulting amplicons were constructed using a pCR2.1 TA cloning kit and sequenced. Species-specific primers were designed based on the sequences obtained and were used to amplify the 16S-23S ISR in the Lactobacillus species considered. For all of them, two PCR amplicons, designated as small ISR (S-ISR) and large ISR (L-ISR), were obtained. The L-ISR is composed of the corresponding S-ISR, interrupted by a sequence containing tRNA(Ile) and tRNA(Ala) genes. Based on these sequences, species-specific primers were designed and proved to identify accurately the species considered among 30 reference Lactobacillus species tested. Designed species-specific primers enable a rapid and accurate identification of L. mindensis, L. paralimentarius, L. panis, L. pontis and L. frumenti species among other lactobacilli. The proposed method provides a powerful and convenient means of rapidly identifying some sourdough lactobacilli, which could be of help in large starter culture surveys.

Research on a Small Signal Stability Region Boundary Model of the Interconnected Power System with Large-Scale Wind Power

Directory of Open Access Journals (Sweden)

Wenying Liu

2015-03-01

Full Text Available For the interconnected power system with large-scale wind power, the problem of the small signal stability has become the bottleneck of restricting the sending-out of wind power as well as the security and stability of the whole power system. Around this issue, this paper establishes a small signal stability region boundary model of the interconnected power system with large-scale wind power based on catastrophe theory, providing a new method for analyzing the small signal stability. Firstly, we analyzed the typical characteristics and the mathematic model of the interconnected power system with wind power and pointed out that conventional methods can’t directly identify the topological properties of small signal stability region boundaries. For this problem, adopting catastrophe theory, we established a small signal stability region boundary model of the interconnected power system with large-scale wind power in two-dimensional power injection space and extended it to multiple dimensions to obtain the boundary model in multidimensional power injection space. Thirdly, we analyzed qualitatively the topological property’s changes of the small signal stability region boundary caused by large-scale wind power integration. Finally, we built simulation models by DIgSILENT/PowerFactory software and the final simulation results verified the correctness and effectiveness of the proposed model.

Methylation pattern of the intergenic spacer of rRNA genes in excised cotyledons of Cucurbita pepo L. (Zucchini) after hormone treatment

International Nuclear Information System (INIS)

Ananiev, E.; Abdulova, G.; Grozdanov, P.; Karagyozov, L.

2003-01-01

High molecular mass genomic DNA was isolated from excised marrow cotyledons (Cucurbita pepo L. zucchini) treated with 6-benzyladenine (BA) of methyl ester of jasmonic acid (MeJA) for 24 h in darkness. DNA purified from contaminating polysaccharides with Celite column was completely digested with the restriction enzyme Eco RI and the changes in the methylation pattern of the intergenic spacer (IGS) of r RNA genes were studied after subsequent digestion with the couple of restriction enzymes-isoschizomers MSP I and Hpa II by the method of 'indirect end labelling'. As rDNA units probe a cloned 32 P-labelled Eco RI 2.1 kb fragment spanning in the most part of 18S r RNA gene from flax rDNA was used. Results showed heavy methylation of the rRNA genes. As judged from the almost total lack of digestion with HPA II, there were no methylation free regions in repeated rDNA units or little if any were observed. A hypo methylated Hps II site was detected near the promoter region in some of the repeats. Digestion with Msp I affected nearly 50% of the repeating units. The Msp digestion fragments of the 6.2 kb Eco RI fragment of r DNA were few in number and large in size (0.5 - 2.5 kb). This suggested that in addition with -CpG- sequences, methylation in -CpNpG- might not be random. Methylation pattern in IGS was not changed upon treatment of the cotyledons in vivo with BA and MeJA. Thus, previously observed hormone-mediated effects on the eactivity of rRNA gene expression were not accompanied by any significant changes of the methylation pattern in IGS. (authors)

Genome-wide analysis of regions similar to promoters of histone genes

KAUST Repository

Chowdhary, Rajesh

2010-05-28

Background: The purpose of this study is to: i) develop a computational model of promoters of human histone-encoding genes (shortly histone genes), an important class of genes that participate in various critical cellular processes, ii) use the model so developed to identify regions across the human genome that have similar structure as promoters of histone genes; such regions could represent potential genomic regulatory regions, e.g. promoters, of genes that may be coregulated with histone genes, and iii/ identify in this way genes that have high likelihood of being coregulated with the histone genes.Results: We successfully developed a histone promoter model using a comprehensive collection of histone genes. Based on leave-one-out cross-validation test, the model produced good prediction accuracy (94.1% sensitivity, 92.6% specificity, and 92.8% positive predictive value). We used this model to predict across the genome a number of genes that shared similar promoter structures with the histone gene promoters. We thus hypothesize that these predicted genes could be coregulated with histone genes. This hypothesis matches well with the available gene expression, gene ontology, and pathways data. Jointly with promoters of the above-mentioned genes, we found a large number of intergenic regions with similar structure as histone promoters.Conclusions: This study represents one of the most comprehensive computational analyses conducted thus far on a genome-wide scale of promoters of human histone genes. Our analysis suggests a number of other human genes that share a high similarity of promoter structure with the histone genes and thus are highly likely to be coregulated, and consequently coexpressed, with the histone genes. We also found that there are a large number of intergenic regions across the genome with their structures similar to promoters of histone genes. These regions may be promoters of yet unidentified genes, or may represent remote control regions that

An intergenic risk locus containing an enhancer deletion in 2q35 modulates breast cancer risk by deregulating IGFBP5 expression

Science.gov (United States)

Wyszynski, Asaf; Hong, Chi-Chen; Lam, Kristin; Michailidou, Kyriaki; Lytle, Christian; Yao, Song; Zhang, Yali; Bolla, Manjeet K.; Wang, Qin; Dennis, Joe; Hopper, John L.; Southey, Melissa C.; Schmidt, Marjanka K.; Broeks, Annegien; Muir, Kenneth; Lophatananon, Artitaya; Fasching, Peter A.; Beckmann, Matthias W.; Peto, Julian; dos-Santos-Silva, Isabel; Sawyer, Elinor J.; Tomlinson, Ian; Burwinkel, Barbara; Marme, Frederik; Guénel, Pascal; Truong, Thérèse; Bojesen, Stig E.; Nordestgaard, Børge G.; González-Neira, Anna; Benitez, Javier; Neuhausen, Susan L.; Brenner, Hermann; Dieffenbach, Aida Karina; Meindl, Alfons; Schmutzler, Rita K.; Brauch, Hiltrud; Nevanlinna, Heli; Khan, Sofia; Matsuo, Keitaro; Ito, Hidemi; Dörk, Thilo; Bogdanova, Natalia V.; Lindblom, Annika; Margolin, Sara; Mannermaa, Arto; Kosma, Veli-Matti; Wu, Anna H.; Van Den Berg, David; Lambrechts, Diether; Wildiers, Hans; Chang-Claude, Jenny; Rudolph, Anja; Radice, Paolo; Peterlongo, Paolo; Couch, Fergus J.; Olson, Janet E.; Giles, Graham G.; Milne, Roger L.; Haiman, Christopher A.; Henderson, Brian E.; Dumont, Martine; Teo, Soo Hwang; Wong, Tien Y.; Kristensen, Vessela; Zheng, Wei; Long, Jirong; Winqvist, Robert; Pylkäs, Katri; Andrulis, Irene L.; Knight, Julia A.; Devilee, Peter; Seynaeve, Caroline; García-Closas, Montserrat; Figueroa, Jonine; Klevebring, Daniel; Czene, Kamila; Hooning, Maartje J.; van den Ouweland, Ans M.W.; Darabi, Hatef; Shu, Xiao-Ou; Gao, Yu-Tang; Cox, Angela; Blot, William; Signorello, Lisa B.; Shah, Mitul; Kang, Daehee; Choi, Ji-Yeob; Hartman, Mikael; Miao, Hui; Hamann, Ute; Jakubowska, Anna; Lubinski, Jan; Sangrajrang, Suleeporn; McKay, James; Toland, Amanda E.; Yannoukakos, Drakoulis; Shen, Chen-Yang; Wu, Pei-Ei; Swerdlow, Anthony; Orr, Nick; Simard, Jacques; Pharoah, Paul D.P.; Dunning, Alison M.; Chenevix-Trench, Georgia; Hall, Per; Bandera, Elisa; Amos, Chris; Ambrosone, Christine; Easton, Douglas F.; Cole, Michael D.

2016-01-01

Breast cancer is the most diagnosed malignancy and the second leading cause of cancer mortality in females. Previous association studies have identified variants on 2q35 associated with the risk of breast cancer. To identify functional susceptibility loci for breast cancer, we interrogated the 2q35 gene desert for chromatin architecture and functional variation correlated with gene expression. We report a novel intergenic breast cancer risk locus containing an enhancer copy number variation (enCNV; deletion) located approximately 400Kb upstream to IGFBP5, which overlaps an intergenic ERα-bound enhancer that loops to the IGFBP5 promoter. The enCNV is correlated with modified ERα binding and monoallelic-repression of IGFBP5 following oestrogen treatment. We investigated the association of enCNV genotype with breast cancer in 1,182 cases and 1,362 controls, and replicate our findings in an independent set of 62,533 cases and 60,966 controls from 41 case control studies and 11 GWAS. We report a dose-dependent inverse association of 2q35 enCNV genotype (percopy OR = 0.68 95%CI 0.55–0.83, P = 0.0002; replication OR = 0.77 95% CI 0.73-0.82, P = 2.1 × 10−19) and identify 13 additional linked variants (r2 > 0.8) in the 20Kb linkage block containing the enCNV (P = 3.2 × 10−15 − 5.6 × 10−17). These associations were independent of previously reported 2q35 variants, rs13387042/rs4442975 and rs16857609, and were stronger for ER-positive than ER-negative disease. Together, these results suggest that 2q35 breast cancer risk loci may be mediating their effect through IGFBP5. PMID:27402876

Variation of 45S rDNA intergenic spacers in Arabidopsis thaliana.

Science.gov (United States)

Havlová, Kateřina; Dvořáčková, Martina; Peiro, Ramon; Abia, David; Mozgová, Iva; Vansáčová, Lenka; Gutierrez, Crisanto; Fajkus, Jiří

2016-11-01

Approximately seven hundred 45S rRNA genes (rDNA) in the Arabidopsis thaliana genome are organised in two 4 Mbp-long arrays of tandem repeats arranged in head-to-tail fashion separated by an intergenic spacer (IGS). These arrays make up 5 % of the A. thaliana genome. IGS are rapidly evolving sequences and frequent rearrangements inside the rDNA loci have generated considerable interspecific and even intra-individual variability which allows to distinguish among otherwise highly conserved rRNA genes. The IGS has not been comprehensively described despite its potential importance in regulation of rDNA transcription and replication. Here we describe the detailed sequence variation in the complete IGS of A. thaliana WT plants and provide the reference/consensus IGS sequence, as well as genomic DNA analysis. We further investigate mutants dysfunctional in chromatin assembly factor-1 (CAF-1) (fas1 and fas2 mutants), which are known to have a reduced number of rDNA copies, and plant lines with restored CAF-1 function (segregated from a fas1xfas2 genetic background) showing major rDNA rearrangements. The systematic rDNA loss in CAF-1 mutants leads to the decreased variability of the IGS and to the occurrence of distinct IGS variants. We present for the first time a comprehensive and representative set of complete IGS sequences, obtained by conventional cloning and by Pacific Biosciences sequencing. Our data expands the knowledge of the A. thaliana IGS sequence arrangement and variability, which has not been available in full and in detail until now. This is also the first study combining IGS sequencing data with RFLP analysis of genomic DNA.

Enterobacterial repetitive intergenic consensus sequences and the PCR to generate fingerprints of genomic DNAs from Vibrio cholerae O1, O139, and non-O1 strains.

OpenAIRE

Rivera, I G; Chowdhury, M A; Huq, A; Jacobs, D; Martins, M T; Colwell, R R

1995-01-01

Enterobacterial repetitive intergenic consensus (ERIC) sequence polymorphism was studied in Vibrio Cholerae strains isolated before and after the cholera epidemic in Brazil (in 1991), along with epidemic strains from Peru, Mexico, and India, by PCR. A total of 17 fingerprint patterns (FPs) were detected in the V. cholerae strains examined; 96.7% of the toxigenic V. cholerae O1 strains and 100% of the O139 serogroup strains were found to belong to the same FP group comprising four fragments (F...

HOW SOCIAL CAPITAL HELPS SMALL ENTERPRISE?: IMPLICATIONS FOR REGIONAL ECONOMIC DEVELOPMENT

Directory of Open Access Journals (Sweden)

Feray ERSELCAN

2011-07-01

Full Text Available Presenting findings from a sample survey carried among manufacturing small and medium sized enterprises in Kayseri Sub-Region (TR72 – Sivas, Kayseri and Yozgat, this study attempts to understand whether and how social capital has an impact on small firms’ performance. Besides, the study goes further to bring into question the effectiveness of different types of social capital, norms and networks and how social capital is created at local level. Social capital is measured at two different (potential and actual levels. Results of our analysis point to the fact that measuring social capital at its “actual” level might be more useful than measuring it as a “potential”. Our findings suggest that firms perform better, if they enjoy higher levels of collective action and can reduce their transaction costs through social relations.

Photospheric Velocity Structures during the Emergence of Small Active Regions on the Sun

International Nuclear Information System (INIS)

Khlystova, Anna; Toriumi, Shin

2017-01-01

We study the plasma flows in the solar photosphere during the emergence of two small active regions, NOAA 9021 and 10768. Using Solar and Heliospheric Observatory /Michelson Doppler Imager data, we find that the strong plasma upflows appear at the initial stage of active region formation, with maximum upflow velocities of −1650 and −1320 m s −1 . The structures with enhanced upflows have size ∼8 Mm in diameter, and they exist for 1–2 hr. The parameters of the enhanced upflows are consistent with those of the large active region NOAA 10488, which may suggest the possibility that the elementary emerging magnetic loops that appear at the earliest phase of active region formation have similar properties, irrespective of scales of active regions. Comparison between the observations and a numerical simulation of magnetic flux emergence shows a striking consistency. We find that the driving force of the plasma upflow is at first the gas pressure gradient and later the magnetic pressure gradient.

Photospheric Velocity Structures during the Emergence of Small Active Regions on the Sun

Energy Technology Data Exchange (ETDEWEB)

Khlystova, Anna [Institute of Solar-Terrestrial Physics SB RAS, Lermontov St., 126a, 664033 Irkutsk (Russian Federation); Toriumi, Shin, E-mail: hlystova@iszf.irk.ru, E-mail: shin.toriumi@nao.ac.jp [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)

2017-04-10

We study the plasma flows in the solar photosphere during the emergence of two small active regions, NOAA 9021 and 10768. Using Solar and Heliospheric Observatory /Michelson Doppler Imager data, we find that the strong plasma upflows appear at the initial stage of active region formation, with maximum upflow velocities of −1650 and −1320 m s{sup −1}. The structures with enhanced upflows have size ∼8 Mm in diameter, and they exist for 1–2 hr. The parameters of the enhanced upflows are consistent with those of the large active region NOAA 10488, which may suggest the possibility that the elementary emerging magnetic loops that appear at the earliest phase of active region formation have similar properties, irrespective of scales of active regions. Comparison between the observations and a numerical simulation of magnetic flux emergence shows a striking consistency. We find that the driving force of the plasma upflow is at first the gas pressure gradient and later the magnetic pressure gradient.

Properties of non-coding DNA and identification of putative cis-regulatory elements in Theileria parva

Directory of Open Access Journals (Sweden)

Guo Xiang

2008-12-01

Full Text Available Abstract Background Parasites in the genus Theileria cause lymphoproliferative diseases in cattle, resulting in enormous socio-economic losses. The availability of the genome sequences and annotation for T. parva and T. annulata has facilitated the study of parasite biology and their relationship with host cell transformation and tropism. However, the mechanism of transcriptional regulation in this genus, which may be key to understanding fundamental aspects of its parasitology, remains poorly understood. In this study, we analyze the evolution of non-coding sequences in the Theileria genome and identify conserved sequence elements that may be involved in gene regulation of these parasitic species. Results Intergenic regions and introns in Theileria are short, and their length distributions are considerably right-skewed. Intergenic regions flanked by genes in 5'-5' orientation tend to be longer and slightly more AT-rich than those flanked by two stop codons; intergenic regions flanked by genes in 3'-5' orientation have intermediate values of length and AT composition. Intron position is negatively correlated with intron length, and positively correlated with GC content. Using stringent criteria, we identified a set of high-quality orthologous non-coding sequences between T. parva and T. annulata, and determined the distribution of selective constraints across regions, which are shown to be higher close to translation start sites. A positive correlation between constraint and length in both intergenic regions and introns suggests a tight control over length expansion of non-coding regions. Genome-wide searches for functional elements revealed several conserved motifs in intergenic regions of Theileria genomes. Two such motifs are preferentially located within the first 60 base pairs upstream of transcription start sites in T. parva, are preferentially associated with specific protein functional categories, and have significant similarity to know

Mycoplasmas hyorhinis in different regions of cuba: diagnosis

Directory of Open Access Journals (Sweden)

Evelyn Lobo

2011-06-01

Full Text Available M. hyorhinis is considered one of the etiological agents of arthritis in sucking pigs, but recently as seen, some strains can produce pneumonia that could not be distinguished from the mycoplasmosis caused by M. hyopneumoniae. The study was conducted to research the presence of Mycoplasma hyorhinis (M. hyorhinis in different regions of the country from exudates of pig lungs with typical EP lesions. Exudates from 280 pig lungs with typical EP lesions were studied using molecular techniques such as PCR, real time PCR and amplification of the 16S-23S rRNA. It was detected that the 66% of the samples studied resulted positive to M. hyorhinis, and the presence of this species was detected in all the provinces. Amplification and studies on the intergenic region 16S-23S of M. hyorhinis rRNA demonstrated the existing variability among strains of a same species. This study is the first report on M. hyorhinis detection in Cuba.

Experimental evidence of widespread regions of small-scale plasma irregularities in the magnetosphere

International Nuclear Information System (INIS)

Holmgren, G.; Kintner, P.M.

1990-01-01

Small-scale (≤ 1 km) plasma irregularities have previously been observed in situ from the E region to an altitude of 8,000 km. In this paper the authors report results from the Viking plasma wave experiments which extends the measurements of high-latitude irregularities in two ways: (1) they have acquired electron density fluctuation measurements up to an altitude of 13,500 km and (2) for the first time a measurement technique was used that made a phase velocity deduction possible from in situ measurements. The spacecraft was equipped with two spatially separated Langmuir probes, each with an ability to measure relative probe current fluctuations with frequencies from dc to about 400 Hz. Under certain assumptions the current fluctuations could be interpreted as relative plasma density fluctuations, δn e /n e . Data from this interferometric instrument has been used to infer the distribution and nature of plasma irregularities along Viking orbits. It is demonstrated that the interferometric technique offers great advantages compared to single point measurements in this kind of study. It is shown that the observed small-scale plasma irregularities are nondispersive and convecting with the background plasma. They exhibit a power law frequency spectrum as observed in the satellite reference frame. The spectral index varies with location. An attempt to map source regions by identifying regions of high power and shallow spectrums is made

Exploring DNA methylation changes in promoter, intragenic, and intergenic regions as early and late events in breast cancer formation

International Nuclear Information System (INIS)

Rauscher, Garth H.; Kresovich, Jacob K.; Poulin, Matthew; Yan, Liying; Macias, Virgilia; Mahmoud, Abeer M.; Al-Alem, Umaima; Kajdacsy-Balla, Andre; Wiley, Elizabeth L.; Tonetti, Debra; Ehrlich, Melanie

2015-01-01

Breast cancer formation is associated with frequent changes in DNA methylation but the extent of very early alterations in DNA methylation and the biological significance of cancer-associated epigenetic changes need further elucidation. Pyrosequencing was done on bisulfite-treated DNA from formalin-fixed, paraffin-embedded sections containing invasive tumor and paired samples of histologically normal tissue adjacent to the cancers as well as control reduction mammoplasty samples from unaffected women. The DNA regions studied were promoters (BRCA1, CD44, ESR1, GSTM2, GSTP1, MAGEA1, MSI1, NFE2L3, RASSF1A, RUNX3, SIX3 and TFF1), far-upstream regions (EN1, PAX3, PITX2, and SGK1), introns (APC, EGFR, LHX2, RFX1 and SOX9) and the LINE-1 and satellite 2 DNA repeats. These choices were based upon previous literature or publicly available DNA methylome profiles. The percent methylation was averaged across neighboring CpG sites. Most of the assayed gene regions displayed hypermethylation in cancer vs. adjacent tissue but the TFF1 and MAGEA1 regions were significantly hypomethylated (p ≤0.001). Importantly, six of the 16 regions examined in a large collection of patients (105 – 129) and in 15-18 reduction mammoplasty samples were already aberrantly methylated in adjacent, histologically normal tissue vs. non-cancerous mammoplasty samples (p ≤0.01). In addition, examination of transcriptome and DNA methylation databases indicated that methylation at three non-promoter regions (far-upstream EN1 and PITX2 and intronic LHX2) was associated with higher gene expression, unlike the inverse associations between cancer DNA hypermethylation and cancer-altered gene expression usually reported. These three non-promoter regions also exhibited normal tissue-specific hypermethylation positively associated with differentiation-related gene expression (in muscle progenitor cells vs. many other types of normal cells). The importance of considering the exact DNA region analyzed and the

Demographic Evolution of the Small Towns in the North-East Development Region in the Post-Communist Period

Directory of Open Access Journals (Sweden)

GABRIEL CAMARĂ

2011-01-01

Full Text Available Romania's population has declined steadily from 23.2 million in 1990 to 21.5 million inhabitants in 2007. This overall decline in population is not entirely true for the towns and cities of the North-East Region, as during the same period they recorded both decreases and increases in population due to positive natural balance. The North-East Region (partially superimposed over the historic region of the western Moldova is considered the poorest region in the European Union and a disadvantaged area. The rural young population of Moldova is a reservoir which supplies urban areas and especially large cities. In these circumstances, the small towns of the North-East Region are seeking balance (demographic, economic, functional. This paper examines the demographic evolution of the small towns located in the area under analysis, in the post-communist period, illustrating the types of fluctuations in statistical methods as regards demographic changes and the risk of depopulation in the future, correlated with a lower overall population of Romania.

Reemergence of rabies in the southern Han river region, Korea.

Science.gov (United States)

Oem, Jae-Ku; Kim, Seong-Hee; Kim, Yeon-Hee; Lee, Myoung-Heon; Lee, Kyoung-Ki

2014-07-01

Recently, 11 cases of animal rabies were reported in the southern region (Suwon and Hwaseong cities) of Gyeonggi Province, South Korea. The cases were temporally separated into two cases in dogs (Canis lupus familiaris) in spring 2012 and nine cases in domestic animals and wildlife in winter 2012-13. All carcasses were submitted for histopathologic examination and viral antigen identification. Sequences of the glycoprotein, nucleoprotein, and glycoprotein-large polymerase protein intergenic noncoding loci of the 11 strains were determined and compared with published reference sequences. All rabies strains were closely related to the Gangwon strains isolated in 2008-09, suggesting that the rabies virus strains isolated in Gyeonggi were introduced from Gangwon Province.

Radiation structurization borosilicates in the region of small dozes

International Nuclear Information System (INIS)

Gadzhieva, N.N.; Melikova, S.Z.

2007-01-01

Full text: Borosilicates are one of perspective materials who are characterized by high thermal and radiating stability. Owing to these properties they are widely applied as constructional materials in reactor technologies. The structural condition of a bor in crystal compounds is characterized by two coordination numbers- three and and four. Change of this condition speaks also original properties borosilicate. Studying influence is actual γ-irradiations in the region of rather small dozes on ability change coordination of a B in borosilicate. In the given work results of IR-spectroscopic researches initial and radiation-structured borosilicates are presented. With this purpose were investigated borosilicates with maintenance B 2 O 3 in SiO 2 equal 0.5; 1; 1.5; 3; 5 and 10 mas.%, received by a method of sedimentation. Samples irradiated γ-quanta on an isotope source 60 Co with capacity of a doze dD γ /dt=0.80 Gy/s. The absorbed doze made D γ ∼0.5-50 kGy. IR-spectra of reflection initial and γ-irradiated tablets borosilicates measured on spectrophotometer Specord 71 IR (Carl Zeiss) at a room temperature. Optical density of the bands corresponding trigonal and tetrahedric - coordination atoms of a bor and their parity at the various mass maintenance of boric anhydride in SiO 2 before and after γ-irradiation. The absorption bands of asymmetric stretching vibration BO 3 and BO 4 groupings in structure of B 2 O 3 /SiO 2 have maxima at ν=1320 (ν as BO 3 ) and 980 cm -1 (ν as BO 4 ). Studying dose has shown dependences D 1320 /D 980 , that in the region of rather small dozes 0.5 γ 1320 /D 980 of optical densities trigonal and tetrahedric coordination a B it is established, that at the contain B 2 O 3 in SiO 2 /B 2 O 3 ∼1.5 mas.% maximal introduction B 3+ in a lattice oxide silicon is observed

Long-Term Observation of Small and Medium-Scale Gravity Waves over the Brazilian Equatorial Region

Science.gov (United States)

Essien, Patrick; Buriti, Ricardo; Wrasse, Cristiano M.; Medeiros, Amauri; Paulino, Igo; Takahashi, Hisao; Campos, Jose Andre

2016-07-01

This paper reports the long term observations of small and medium-scale gravity waves over Brazilian equatorial region. Coordinated optical and radio measurements were made from OLAP at Sao Joao do Cariri (7.400S, 36.500W) to investigate the occurrences and properties and to characterize the regional mesospheric gravity wave field. All-sky imager measurements were made from the site. for almost 11 consecutive years (September 2000 to November 2010). Most of the waves propagated were characterized as small-scale gravity. The characteristics of the two waves events agreed well with previous gravity wave studies from Brazil and other sites. However, significant differences in the wave propagation headings indicate dissimilar source regions. The observed medium-scale gravity wave events constitute an important new dataset to study their mesospheric properties at equatorial latitudes. These data exhibited similar propagation headings to the short period events, suggesting they originated from the same source regions. It was also observed that some of the medium-scale were capable of propagating into the lower thermosphere where they may have acted directly as seeds for the Rayleigh-Taylor instability development. The wave events were primarily generated by meteorological processes since there was no correlation between the evolution of the wave events and solar cycle F10.7.

A New Intergenic α-Globin Deletion (α-αΔ125) Found in a Kabyle Population.

Science.gov (United States)

Singh, Amrathlal Rabbind; Lacan, Philippe; Cadet, Estelle; Bignet, Patricia; Dumesnil, Cécile; Vannier, Jean-Pierre; Joly, Philippe; Rochette, Jacques

2016-01-01

We have identified a deletion of 125 bp (α-α(Δ125)) (NG_000006.1: g.37040_37164del) in the α-globin gene cluster in a Kabyle population. A combination of singlex and multiplex polymerase chain reaction (PCR)-based assays have been used to identify the molecular defect. Sequencing of the abnormal PCR amplification product revealed a novel α1-globin promoter deletion. The endpoints of the deletion were characterized by sequencing the deletion junctions of the mutated allele. The observed deletion was located 378 bp upstream of the α1-globin gene transcription initiation site and leaves the α2 gene intact. In some patients, the α-α(Δ125) deletion was shown to segregate with Hb S (HBB: c.20A>T) and/or Hb C (HBB: c.19G>A) or a β-thalassemic allele. The α-α(Δ125) deletion has no discernible effect on red cell indices when inherited with no other abnormal globin genes. The family study demonstrated that the deletion is heritable. This is the only example of an intergenic α2-α1 non coding DNA deletion, leaving the α2-globin gene and the α1 coding part intact.

PHYSICAL PROPERTIES OF LARGE AND SMALL GRANULES IN SOLAR QUIET REGIONS

Energy Technology Data Exchange (ETDEWEB)

Yu Daren; Xie Zongxia; Hu Qinghua [Harbin Institute of Technology, Harbin 150001 (China); Yang Shuhong; Zhang Jun; Wang Jingxiu, E-mail: caddiexie@hotmail.com, E-mail: zjun@ourstar.bao.ac.cn [Key Laboratory of Solar Activity, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China)

2011-12-10

The normal mode observations of seven quiet regions obtained by the Hinode spacecraft are analyzed to study the physical properties of granules. An artificial intelligence technique is introduced to automatically find the spatial distribution of granules in feature spaces. In this work, we investigate the dependence of granular continuum intensity, mean Doppler velocity, and magnetic fields on granular diameter. We recognized 71,538 granules by an automatic segmentation technique and then extracted five properties: diameter, continuum intensity, Doppler velocity, and longitudinal and transverse magnetic flux density to describe the granules. To automatically explore the intrinsic structures of the granules in the five-dimensional parameter space, the X-means clustering algorithm and one-rule classifier are introduced to define the rules for classifying the granules. It is found that diameter is a dominating parameter in classifying the granules and two families of granules are derived: small granules with diameters smaller than 1.''44, and large granules with diameters larger than 1.''44. Based on statistical analysis of the detected granules, the following results are derived: (1) the averages of diameter, continuum intensity, and Doppler velocity in the upward direction of large granules are larger than those of small granules; (2) the averages of absolute longitudinal, transverse, and unsigned flux density of large granules are smaller than those of small granules; (3) for small granules, the average of continuum intensity increases with their diameters, while the averages of Doppler velocity, transverse, absolute longitudinal, and unsigned magnetic flux density decrease with their diameters. However, the mean properties of large granules are stable; (4) the intensity distributions of all granules and small granules do not satisfy Gaussian distribution, while that of large granules almost agrees with normal distribution with a peak at 1.04 I

The early postnatal pattern of vesicle formation in different regions of the porcien small intestine

DEFF Research Database (Denmark)

Elbrønd, Vibeke Sødring; Weström, B.R.

2007-01-01

applied to visualize cytoplasmatic subcellular components such as fat (Oil red O) and carbohydrates (PAS). Appearance and morphology of the epithelial vesicles were compared. In the proximal region several small supranuclear and a single large subnuclear electron dense, eosinophilic and PAS+ vesicle were...

76 FR 32986 - Vendor Outreach Workshop for Small Businesses in the Texas Intermountain Region of the United States

Science.gov (United States)

2011-06-07

... DEPARTMENT OF THE INTERIOR Office of the Secretary Vendor Outreach Workshop for Small Businesses in the Texas Intermountain Region of the United States AGENCY: Office of the Secretary, Interior... region of the United States that are interested in doing business with the Department. This outreach...

New 20-cm radio-continuum study of the small Magellanic cloud - part III: Compact Hii regions

Directory of Open Access Journals (Sweden)

Wong G.F.

2012-01-01

Full Text Available We present and discuss a new catalogue of 48 compact Hii regions in the Small Magellanic Cloud (SMC and a newly created deep 1420 MHz (λ=20 cm radio-continuum image of the N19 region located in the southwestern part of the SMC. The new images were created by merging 1420 MHz radiocontinuum archival data from the Australian Telescope Compact Array. The majority of these detected radio compact Hii regions have rather flat spectral indices which indicates, as expected, that the dominant emission mechanism is of thermal nature.

New theoretical model for two-phase flow discharged from stratified two-phase region through small break

International Nuclear Information System (INIS)

Yonomoto, Taisuke; Tasaka, Kanji

1988-01-01

A theoretical and experimental study was conducted to understand two-phase flow discharged from a stratified two-phase region through a small break. This problem is important for an analysis of a small break loss-of-coolant accident (LOCA) in a light water reactor (LWR). The present theoretical results show that a break quality is a function of h/h b , where h is the elevation difference between a bulk water level in the upstream region and break and b the suffix for entrainment initiation. This result is consistent with existing eperimental results in literature. An air-water experiment was also conducted changing a break orientation as an experimental parameter to develop and assess the model. Comparisons between the model and the experimental results show that the present model can satisfactorily predict the flow rate and the quality at the break without using any adjusting constant when liquid entrainment occurs in a stratified two-phase region. When gas entrainment occurs, the experimental data are correlated well by using a single empirical constant. (author)

[Phylogenetic relationships of the species of Oxytropis DC. subg. Oxytropis and Phacoxytropis (Fabaceae) from Asian Russia inferred from the nucleotide sequence analysis of the intergenic spacers of the chloroplast genome].

Science.gov (United States)

Kholina, A B; Kozyrenko, M M; Artyukova, E V; Sandanov, D V; Andrianova, E A

2016-08-01

The nucleotide sequence analysis of trnH–psbA, trnL–trnF, and trnS–trnG intergenic spacer regions of chloroplast DNA performed in the representatives of the genus Oxytropis from Asian Russia provided clarification of the phylogenetic relationships of some species and sections in the subgenera Oxytropis and Phacoxytropis and in the genus Oxytropis as a whole. Only the section Mesogaea corresponds to the subgenus Phacoxytropis, while the section Janthina of the same subgenus groups together with the sections of the subgenus Oxytropis. The sections Chrysantha and Ortholoma of the subgenus Oxytropis are not only closely related to each other, but together with the section Mesogaea, they are grouped into the subgenus Phacoxytropis. It seems likely that the sections Chrysantha and Ortholoma should be assigned to the subgenus Phacoxytropis, and the section Janthina should be assigned to the subgenus Oxytropis. The molecular differences were identified between O. coerulea and O. mandshurica from the section Janthina that were indicative of considerable divergence of their chloroplast genomes and the species independence of the taxa. The species independence of O. czukotica belonging to the section Arctobia was also confirmed.

Small Engine Technology (SET) Task 24 Business and Regional Aircraft System Studies

Science.gov (United States)

Lieber, Lysbeth

2003-01-01

This final report has been prepared by Honeywell Engines & Systems, Phoenix, Arizona, a unit of Honeywell International Inc., documenting work performed during the period June 1999 through December 1999 for the National Aeronautics and Space Administration (NASA) Glenn Research Center, Cleveland, Ohio, under the Small Engine Technology (SET) Program, Contract No. NAS3-27483, Task Order 24, Business and Regional Aircraft System Studies. The work performed under SET Task 24 consisted of evaluating the noise reduction benefits compared to the baseline noise levels of representative 1992 technology aircraft, obtained by applying different combinations of noise reduction technologies to five business and regional aircraft configurations. This report focuses on the selection of the aircraft configurations and noise reduction technologies, the prediction of noise levels for those aircraft, and the comparison of the noise levels with those of the baseline aircraft.

A Comparative Observational Study of YSO Classification in Four Small Star-forming H ii Regions

Energy Technology Data Exchange (ETDEWEB)

Kang, Sung-Ju; Choi, Minho; Kang, Miju [Korea Astronomy and Space Science Institute, 776, Daedeokdae-ro, Yuseong-gu, Daejeon, 34055 (Korea, Republic of); Kerton, C. R., E-mail: sjkang@kasi.re.kr, E-mail: kerton@iastate.edu [Department of Physics and Astronomy, Iowa State University, Ames, IA 50011 (United States)

2017-08-10

We have developed a new young stellar object (YSO) identification and classification technique using mid-infrared Wide-field Infrared Survey Explorer (WISE) data. We compare this new technique with previous WISE YSO detection and classification methods that used either infrared colors or spectral energy distribution slopes. In this study, we also use the new technique to detect and examine the YSO population associated with four small H ii regions: KR 7, KR 81, KR 120, and KR 140. The relatively simple structure of these regions allows us to effectively use both spatial and temporal constraints to identify YSOs that are potential products of triggered star formation. We are also able to identify regions of active star formation around these H ii regions that are clearly not influenced by the H ii region expansion, and thus demonstrate that star formation is on-going on megayear timescales in some of these molecular clouds.

A novel intergenic ETnII-β insertion mutation causes multiple malformations in polypodia mice.

Directory of Open Access Journals (Sweden)

Jessica A Lehoczky

Full Text Available Mouse early transposon insertions are responsible for ~10% of spontaneous mutant phenotypes. We previously reported the phenotypes and genetic mapping of Polypodia, (Ppd, a spontaneous, X-linked dominant mutation with profound effects on body plan morphogenesis. Our new data shows that mutant mice are not born in expected Mendelian ratios secondary to loss after E9.5. In addition, we refined the Ppd genetic interval and discovered a novel ETnII-β early transposon insertion between the genes for Dusp9 and Pnck. The ETn inserted 1.6 kb downstream and antisense to Dusp9 and does not disrupt polyadenylation or splicing of either gene. Knock-in mice engineered to carry the ETn display Ppd characteristic ectopic caudal limb phenotypes, showing that the ETn insertion is the Ppd molecular lesion. Early transposons are actively expressed in the early blastocyst. To explore the consequences of the ETn on the genomic landscape at an early stage of development, we compared interval gene expression between wild-type and mutant ES cells. Mutant ES cell expression analysis revealed marked upregulation of Dusp9 mRNA and protein expression. Evaluation of the 5' LTR CpG methylation state in adult mice revealed no correlation with the occurrence or severity of Ppd phenotypes at birth. Thus, the broad range of phenotypes observed in this mutant is secondary to a novel intergenic ETn insertion whose effects include dysregulation of nearby interval gene expression at early stages of development.

Business models and leadership styles in small medical device and bio-science businesses--examples in a region and their implications.

Science.gov (United States)

Williams, D J; Hourd, P C

2004-01-01

This paper reviews the leadership styles and business models found in small technologically based businesses operating in the healthcare sector within one of the UK regions, the East Midlands. The most frequently encountered business model strands were 1) mixed economies: that fund development with service income; cross-sectoral product portfolios; and decoupled business portfolios led by a single entrepreneur and 2) scale sensitive "stay small" models including the avoidance of venture capital; "early exit"; and virtual business strands. There was found to be little correlation between leadership style and business model for the small number of businesses surveyed. The avoidance of venture capital is in direct contrast to adjacent regions.

Outcome following radiotherapy for loco-regionally recurrent non-small cell lung cancer

International Nuclear Information System (INIS)

Foo, K.; Yeghiaian-Alvandi, R.; Foroudi, F.

2005-01-01

Local and regional recurrence of non-small cell lung cancer is reported to occur in 13-20% of treatment failures after resection. Reported post-recurrent median survival following radiotherapy ranges from 9 to 14 months. This study examines survival following radiotherapy alone for patients with loco-regionally recurring non-small cell lung cancer after initial surgery. Fifty-five patients, receiving radiotherapy at Westmead Hospital between 1979 and 1997, were eligible for study. Data were collected retrospectively by reviewing patient records. The end-point was overall survival. Symptom control was also recorded. Prognostic factors for analysis included age, sex, original presenting stage, disease-free interval (DFI), performance status, site of recurrence, treatment intent and dose. The median overall survival was 11.5 months (95% confidence interval: 8.1-13.0). Survival following treatment with radical intent was 26 months compared to 10.5 months for patients treated with palliative intent (P = 0.025). There was no significant difference in survival for short (<2 years) or long DFI, performance status, radiation dose, age, sex, site of recurrence or stage. Most patients (55%) had partial or complete resolution of symptoms. Radiotherapy results in overall post-recurrence median survival of nearly 1 year, consistent with previous published data. Radical treatment intent predicts better prognosis as a result of patient selection and higher dose. Radiotherapy is effective at palliating symptoms of this disease Copyright (2005) Blackwell Publishing Asia Pty Ltd

Long intergenic non-coding RNA TUG1 is overexpressed in urothelial carcinoma of the bladder.

Science.gov (United States)

Han, Yonghua; Liu, Yuchen; Gui, Yaoting; Cai, Zhiming

2013-04-01

Long intergenic non-coding RNAs (lincRNAs) are a class of non-coding RNAs that regulate gene expression via chromatin reprogramming. Taurine Up-regulated Gene 1 (TUG1) is a lincRNA that is associated with chromatin-modifying complexes and plays roles in gene regulation. In this study, we determined the expression patterns of TUG1 and the cell proliferation inhibition and apoptosis induced by silencing TUG1 in urothelial carcinoma of the bladder. The expression levels of TUG1 were determined using Real-Time qPCR in a total of 44 patients with bladder urothelial carcinomas. Bladder urothelial carcinoma T24 and 5637 cells were transfected with TUG1 siRNA or negative control siRNA. Cell proliferation was evaluated using MTT assay. Apoptosis was determined using ELISA assay. TUG1 was up-regulated in bladder urothelial carcinoma compared to paired normal urothelium. High TUG1 expression levels were associated with high grade and stage carcinomas. Cell proliferation inhibition and apoptosis induction were observed in TUG1 siRNA-transfected bladder urothelial carcinoma T24 and 5637 cells. Our data suggest that lincRNA TUG1 is emerging as a novel player in the disease state of bladder urothelial carcinoma. TUG1 may have potential roles as a biomarker and/or a therapeutic target in bladder urothelial carcinoma. Copyright © 2012 Wiley Periodicals, Inc.

Small Galactic H II regions. II. The molecular clouds and star formation

International Nuclear Information System (INIS)

Hunter, D.A.; Thronson, H.A. Jr.; Wilton, C.

1990-01-01

CO maps of molecular clouds associated with 11 small Galactic H II regions are presented and compared with IR images obtained by IRAS. The molecular masses of the clouds are computed and compared with the masses of the stellar content. The mapped clouds have masses of 1000-60,000 solar and are typical of the more numerous, smaller Galactic molecular clouds. All of the clouds have recently made massive OB stars, and many have complex spatial and kinematic structures. The coincidence of IRAS sources and CO peaks suggests that many of the clouds have sites of star formation other than the optically visible H II region. Star-formation efficiencies are uncertain, with values for the clouds ranging from 0.02 to 0.6 with an average value of 0.2. There is no trend of the upper stellar mass limit with Galactic radius and with molecular cloud mass. 53 refs

Long noncoding RNA HOTAIR, a hypoxia-inducible factor-1α activated driver of malignancy, enhances hypoxic cancer cell proliferation, migration, and invasion in non-small cell lung cancer.

Science.gov (United States)

Zhou, Chunxia; Ye, Lincai; Jiang, Chuan; Bai, Jie; Chi, Yongbin; Zhang, Haibo

2015-12-01

Despite the fact that great advances have been made in the management of non-small cell lung cancer (NSCLC), the prognosis of advanced NSCLC remains very poor. HOX transcript antisense intergenic RNA (HOTAIR) has been identified as an oncogenic long noncoding RNA (lncRNA) that is involved in the progression of a variety of carcinomas and acts as a negative prognostic biomarker. Yet, little is known about the effect of HOTAIR in the hypoxic microenvironment of NSCLC. The expression and promoter activity of HOTAIR were measured by quantitative real-time polymerase chain reaction (qRT-PCR) and luciferase reporter assay. The function of the hypoxia-inducible factor-1α (HIF-1α) binding site to hypoxia-responsive elements (HREs) in the HOTAIR promoter region was tested by luciferase reporter assay with nucleotide substitutions. The binding of HIF-1α to the HOTAIR promoter in vivo was confirmed by chromatin immunoprecipitation assay (CHIP) and electrophoretic mobility shift assay (EMSA). The effect of HIF-1α suppression by small interference RNA or YC-1 on HOTAIR expression was also determined. In the present study, we demonstrated that HOTAIR was upregulated by hypoxia in NSCLC cells. HOTAIR is a direct target of HIF-1α through interaction with putative HREs in the upstream region of HOTAIR in NSCLC cells. Furthermore, HIF-1α knockdown or inhibition could prevent HOTAIR upregulation under hypoxic conditions. Under hypoxic conditions, HOTAIR enhanced cancer cell proliferation, migration, and invasion. These data suggested that suppression of HOTAIR upon hypoxia of NSCLC could be a novel therapeutic strategy.

Innovative potential of small and medium-sized enterprises in the Antofagasta-Chile region: an exploratory study

Directory of Open Access Journals (Sweden)

Gianni A. Romani Chocce

2006-10-01

Full Text Available The aim of this research is to analyze the innovative potential of Small and Medium Enterprises (SMEs in the Region of Antofagasta - Chile. The paper makes a detailed bibliographic revision on regional innovation processes and presents the results of a questionnaire applied to SMEs, considered as innovative according to the Organization for Economic Co-operation and Development (OCDE criteria. Although these results have to be carefully considered, due to the size of the sample it is possible to observe that there is an increasing awareness of the importance of innovation in the region while, at the same time, many obstacles to innovate are recognized.

Study of the regional potential for the development of small hydroelectricity - Final report

International Nuclear Information System (INIS)

Ruillet, Mathieu; Buchet, Eric

2005-01-01

Whereas the potential of small hydroelectric plants in the eastern part of the PACA region, and more generally in the whole region appears to be promising to support energy supply safety, to reduce greenhouse gas emissions, and for local development, this study aimed at making an inventory of existing hydraulic plants (to be renewed or developed for a higher production), of existing weirs to be equipped, and of new sites to be possibly developed (non classified rives, irrigation canals, drinkable water networks). Another objective of this study was to propose a selection among the most promising sites or works. Moreover, the power for these existing or possible installations ranges from 100 kW to 10 MW. After a presentation of the adopted methodology, lists of sites are provided, as well as more detailed presentations of selected sites

Small scale structure in the wall region of a turbulent boundary layer

International Nuclear Information System (INIS)

Bogar, T.J.

1975-01-01

This paper is a report of the construction and application of an extremely small hot-wire X-probe (typical dimensions of 100 μ) to the measurement of Reynolds stress in the wall region of the turbulent boundary layer of a flat plate at high Reynolds number (Re/sub theta/ = 11,300). In the present flow, the size of the probe corresponds to a dimensionless length based on wall parameters of lu/sub tau//ν = 3. Probe construction methods are described. The Wyngaard-Lumley constant temperature anemometer used to heat the wire is analyzed, and a direct acoustical frequency calibration of the wire is made. This calibration shows the small wire to have uniform frequency response to 15 kHz. A novel calibration technique is employed using a high speed, digital mini-computer to determine the velocity in the stream direction and in a direction normal to the wall by matching the unique voltage pairs produced by the X-wire array in a turbulent flow to the voltage pairs produced when the probe is exposed to a known uniform flow inclined at various angles

Regional Analysis of Aids and Prices for Small-scale Grid-connected Solar Photovoltaic Systems in Spain

International Nuclear Information System (INIS)

Varela, M.; Ramirez, L.; Mora, L.; Sidrach de Cardona, M.

2002-01-01

Electricity production from small solar photovoltaic systems in Spain obtains a premium pnce of 0,36 ε/kWh over the electricity market price or a fix price of 0,40 ε/kWh. The development of these small systems in Spain clearly demonstrates that the established prime is not sufficient in the majority of locations. On the other hand, the prime revision set up by the RD 2818/98, considering the profitability of the renewable installations, demand a regional analysis of small PV systems profitability necessary in Spain. The accomplished results permit to conclude that the amount of the current prime is by itself insufficient to make profitable the small grid-connected PV systems in anywhere of the national geography. To guarantee the profitability of these systems it should be necessary to place the fix price at around 0,93 ε/kWh. However, if the duplication of the current price obtained by these installations was considered, this could ensure the profitability of these small systems in at least the 77% of the land. (Author) 12 refs

Differential accumulation of nif structural gene mRNA in Azotobacter vinelandii.

Science.gov (United States)

Hamilton, Trinity L; Jacobson, Marty; Ludwig, Marcus; Boyd, Eric S; Bryant, Donald A; Dean, Dennis R; Peters, John W

2011-09-01

Northern analysis was employed to investigate mRNA produced by mutant strains of Azotobacter vinelandii with defined deletions in the nif structural genes and in the intergenic noncoding regions. The results indicate that intergenic RNA secondary structures effect the differential accumulation of transcripts, supporting the high Fe protein-to-MoFe protein ratio required for optimal diazotrophic growth.

Genetic Diversity in Salmonella Isolates from Ducks and their Environments in Penang, Malaysia using Enterobacterial Repetitive Intergenic Consensus

Directory of Open Access Journals (Sweden)

Frederick Adzitey 1, Gulam Rusul Rahmat Ali2*, Nurul Huda2 and Rosma Ahmad3

2013-07-01

Full Text Available A total of 107 Salmonella isolates (37 S. typhimurium, 26 S. hadar, 15 S. enteritidis, 15 S. braenderup, and 14 S. albany isolated from ducks and their environments in Penang, Malaysia were typed using enterobacterial repetitive intergenic consensus (ERIC to determine their genetic diversity. Analysis of the Salmonella strains by ERIC produced DNA fingerprints of different sizes for differentiation purposes. The DNA fingerprints or band sizes ranged from 14-8300bp for S. Typhimurium, 146-6593bp for S. hadar, 15-4929bp for S. enteritidis, 14-5142bp for S. braenderup and 7-5712bp for S. albany. Cluster analysis at a coefficient of 0.85 grouped the Salmonella strains into various clusters and singletons. S. typhimurium were grouped into 10 clusters and 6 singletons, S. Hadar were grouped into 3 clusters and 18 singletons, S. enteritidis were grouped into 3 clusters and 7 singletons, S. braenderup were grouped into 4 clusters and 7 singletons, and S. albany were grouped into 3 clusters and 7 singletons with discriminatory index (D ranging from 0.92-0.98. ERIC proved to be a useful typing tool for determining the genetic diversity of the duck Salmonella strains.

The music of trees: the intergenerative tie between primary care and public health.

Science.gov (United States)

Whitehouse, Peter

2016-01-01

Stories help us frame and understand complex ideas and challenges. Metaphors are particularly powerful linguistic devices that guide and extend our thinking by bridging conceptual domains, for example to consider the brain as a digital computer. Trees are widely used as metaphors for broad concepts like evolution, history, society, and even life itself, i.e. 'the tree of life'. Tree-like diagrams of roots and branches are used to demonstrate historical and cultural relationships, for example, between different species or different languages. In this paper, we describe a theatrical character called a tree doctor which is a living metaphor. A human being, namely the author, lectures, acts or dances as a tree and offers lessons to Homo Sapiens about 'holistic' ideas of health. The character teaches us to not only see the value of our relationships to trees, but the importance of seeing forests as well the individual trees. The metaphorical statement that we should not 'miss the forest for the trees' means we should learn to think of health embedded in systems and communities. In medicine, we too often focus on individual molecules, pharmaceuticals, or even patients and miss the bigger picture of public and environmental health. In a time of great ecological system change, the tree doctor points to broad ethical responsibility for each other and future generations of humans and other living creatures. The character embraces arts and particularly music as a powerful way of infusing purpose and improving the qualities of our lives together, especially as we age. The tree doctor knows the value of intergenerational relationships. But it also points to intergenerative innovations across many cultural domains, disciplines and professions. The tree doctor supports primary care and empowers the value of intergenerational relationships, art and music in the recommendations doctors make to patients to improve their health and well-being.

PlantRNA_Sniffer: A SVM-Based Workflow to Predict Long Intergenic Non-Coding RNAs in Plants.

Science.gov (United States)

Vieira, Lucas Maciel; Grativol, Clicia; Thiebaut, Flavia; Carvalho, Thais G; Hardoim, Pablo R; Hemerly, Adriana; Lifschitz, Sergio; Ferreira, Paulo Cavalcanti Gomes; Walter, Maria Emilia M T

2017-03-04

Non-coding RNAs (ncRNAs) constitute an important set of transcripts produced in the cells of organisms. Among them, there is a large amount of a particular class of long ncRNAs that are difficult to predict, the so-called long intergenic ncRNAs (lincRNAs), which might play essential roles in gene regulation and other cellular processes. Despite the importance of these lincRNAs, there is still a lack of biological knowledge and, currently, the few computational methods considered are so specific that they cannot be successfully applied to other species different from those that they have been originally designed to. Prediction of lncRNAs have been performed with machine learning techniques. Particularly, for lincRNA prediction, supervised learning methods have been explored in recent literature. As far as we know, there are no methods nor workflows specially designed to predict lincRNAs in plants. In this context, this work proposes a workflow to predict lincRNAs on plants, considering a workflow that includes known bioinformatics tools together with machine learning techniques, here a support vector machine (SVM). We discuss two case studies that allowed to identify novel lincRNAs, in sugarcane ( Saccharum spp.) and in maize ( Zea mays ). From the results, we also could identify differentially-expressed lincRNAs in sugarcane and maize plants submitted to pathogenic and beneficial microorganisms.

Genome-wide identification of potato long intergenic noncoding RNAs responsive to Pectobacterium carotovorum subspecies brasiliense infection.

Science.gov (United States)

Kwenda, Stanford; Birch, Paul R J; Moleleki, Lucy N

2016-08-11

Long noncoding RNAs (lncRNAs) represent a class of RNA molecules that are implicated in regulation of gene expression in both mammals and plants. While much progress has been made in determining the biological functions of lncRNAs in mammals, the functional roles of lncRNAs in plants are still poorly understood. Specifically, the roles of long intergenic nocoding RNAs (lincRNAs) in plant defence responses are yet to be fully explored. In this study, we used strand-specific RNA sequencing to identify 1113 lincRNAs in potato (Solanum tuberosum) from stem tissues. The lincRNAs are expressed from all 12 potato chromosomes and generally smaller in size compared to protein-coding genes. Like in other plants, most potato lincRNAs possess single exons. A time-course RNA-seq analysis between a tolerant and a susceptible potato cultivar showed that 559 lincRNAs are responsive to Pectobacterium carotovorum subsp. brasiliense challenge compared to mock-inoculated controls. Moreover, coexpression analysis revealed that 17 of these lincRNAs are highly associated with 12 potato defence-related genes. Together, these results suggest that lincRNAs have potential functional roles in potato defence responses. Furthermore, this work provides the first library of potato lincRNAs and a set of novel lincRNAs implicated in potato defences against P. carotovorum subsp. brasiliense, a member of the soft rot Enterobacteriaceae phytopathogens.

PlantRNA_Sniffer: A SVM-Based Workflow to Predict Long Intergenic Non-Coding RNAs in Plants

Directory of Open Access Journals (Sweden)

Lucas Maciel Vieira

2017-03-01

Full Text Available Non-coding RNAs (ncRNAs constitute an important set of transcripts produced in the cells of organisms. Among them, there is a large amount of a particular class of long ncRNAs that are difficult to predict, the so-called long intergenic ncRNAs (lincRNAs, which might play essential roles in gene regulation and other cellular processes. Despite the importance of these lincRNAs, there is still a lack of biological knowledge and, currently, the few computational methods considered are so specific that they cannot be successfully applied to other species different from those that they have been originally designed to. Prediction of lncRNAs have been performed with machine learning techniques. Particularly, for lincRNA prediction, supervised learning methods have been explored in recent literature. As far as we know, there are no methods nor workflows specially designed to predict lincRNAs in plants. In this context, this work proposes a workflow to predict lincRNAs on plants, considering a workflow that includes known bioinformatics tools together with machine learning techniques, here a support vector machine (SVM. We discuss two case studies that allowed to identify novel lincRNAs, in sugarcane (Saccharum spp. and in maize (Zea mays. From the results, we also could identify differentially-expressed lincRNAs in sugarcane and maize plants submitted to pathogenic and beneficial microorganisms.

Evaluation of Automated Ribosomal Intergenic Spacer Analysis for Bacterial Fingerprinting of Rumen Microbiome Compared to Pyrosequencing Technology

Directory of Open Access Journals (Sweden)

Elie Jami

2014-01-01

Full Text Available The mammalian gut houses a complex microbial community which is believed to play a significant role in host physiology. In recent years, several microbial community analysis methods have been implemented to study the whole gut microbial environment, in contrast to classical microbiological methods focusing on bacteria which can be cultivated. One of these is automated ribosomal intergenic spacer analysis (ARISA, an inexpensive and popular way of analyzing bacterial diversity and community fingerprinting in ecological samples. ARISA uses the natural variability in length of the DNA fragment found between the 16S and 23S genes in different bacterial lineages to infer diversity. This method is now being supplanted by affordable next-generation sequencing technologies that can also simultaneously annotate operational taxonomic units for taxonomic identification. We compared ARISA and pyrosequencing of samples from the rumen microbiome of cows, previously sampled at different stages of development and varying in microbial complexity using several ecological parameters. We revealed close agreement between ARISA and pyrosequencing outputs, especially in their ability to discriminate samples from different ecological niches. In contrast, the ARISA method seemed to underestimate sample richness. The good performance of the relatively inexpensive ARISA makes it relevant for straightforward use in bacterial fingerprinting analysis as well as for quick cross-validation of pyrosequencing data.

Accounting for thermodynamic non-ideality in the Guinier region of small-angle scattering data of proteins.

Science.gov (United States)

Scott, David J

2016-12-01

Hydrodynamic studies of the solution properties of proteins and other biological macromolecules are often hard to interpret when the sample is present at a reasonably concentrated solution. The reason for this is that solutions exhibit deviations from ideal behaviour which is manifested as thermodynamic non-ideality. The range of concentrations at which this behaviour typically is exhibited is as low as 1-2 mg/ml, well within the range of concentrations used for their analysis by techniques such as small-angle scattering. Here we discuss thermodynamic non-ideality used previously used in the context of light scattering and sedimentation equilibrium analytical ultracentrifugation and apply it to the Guinier region of small-angle scattering data. The results show that there is a complementarity between the radially averaged structure factor derived from small-angle X-ray scattering/small-angle neutron scattering studies and the second virial coefficient derived from sedimentation equilibrium analytical ultracentrifugation experiments.

Comparative analysis of the small RNA transcriptomes of Pinus contorta and Oryza sativa.

Science.gov (United States)

Morin, Ryan D; Aksay, Gozde; Dolgosheina, Elena; Ebhardt, H Alexander; Magrini, Vincent; Mardis, Elaine R; Sahinalp, S Cenk; Unrau, Peter J

2008-04-01

The diversity of microRNAs and small-interfering RNAs has been extensively explored within angiosperms by focusing on a few key organisms such as Oryza sativa and Arabidopsis thaliana. A deeper division of the plants is defined by the radiation of the angiosperms and gymnosperms, with the latter comprising the commercially important conifers. The conifers are expected to provide important information regarding the evolution of highly conserved small regulatory RNAs. Deep sequencing provides the means to characterize and quantitatively profile small RNAs in understudied organisms such as these. Pyrosequencing of small RNAs from O. sativa revealed, as expected, approximately 21- and approximately 24-nt RNAs. The former contained known microRNAs, and the latter largely comprised intergenic-derived sequences likely representing heterochromatin siRNAs. In contrast, sequences from Pinus contorta were dominated by 21-nt small RNAs. Using a novel sequence-based clustering algorithm, we identified sequences belonging to 18 highly conserved microRNA families in P. contorta as well as numerous clusters of conserved small RNAs of unknown function. Using multiple methods, including expressed sequence folding and machine learning algorithms, we found a further 53 candidate novel microRNA families, 51 appearing specific to the P. contorta library. In addition, alignment of small RNA sequences to the O. sativa genome revealed six perfectly conserved classes of small RNA that included chloroplast transcripts and specific types of genomic repeats. The conservation of microRNAs and other small RNAs between the conifers and the angiosperms indicates that important RNA silencing processes were highly developed in the earliest spermatophytes. Genomic mapping of all sequences to the O. sativa genome can be viewed at http://microrna.bcgsc.ca/cgi-bin/gbrowse/rice_build_3/.

Social Networks, Social Media and Absorptive Capacity in Regional Small and Medium Enterprises (SMES) in Australia

Science.gov (United States)

Bosua, Rachelle; Evans, Nina; Sawyer, Janet

2013-01-01

Small and Medium Enterprises (SMEs) are major sources of prosperity and employment and are viewed as critical to regional development in Australia. A key factor to foster productivity and growth in SMEs is their ability to identify, acquire, transform and exploit external knowledge. This ability, referred to as the "absorptive capacity…

Detecting non-coding selective pressure in coding regions

Directory of Open Access Journals (Sweden)

Blanchette Mathieu

2007-02-01

Full Text Available Abstract Background Comparative genomics approaches, where orthologous DNA regions are compared and inter-species conserved regions are identified, have proven extremely powerful for identifying non-coding regulatory regions located in intergenic or intronic regions. However, non-coding functional elements can also be located within coding region, as is common for exonic splicing enhancers, some transcription factor binding sites, and RNA secondary structure elements affecting mRNA stability, localization, or translation. Since these functional elements are located in regions that are themselves highly conserved because they are coding for a protein, they generally escaped detection by comparative genomics approaches. Results We introduce a comparative genomics approach for detecting non-coding functional elements located within coding regions. Codon evolution is modeled as a mixture of codon substitution models, where each component of the mixture describes the evolution of codons under a specific type of coding selective pressure. We show how to compute the posterior distribution of the entropy and parsimony scores under this null model of codon evolution. The method is applied to a set of growth hormone 1 orthologous mRNA sequences and a known exonic splicing elements is detected. The analysis of a set of CORTBP2 orthologous genes reveals a region of several hundred base pairs under strong non-coding selective pressure whose function remains unknown. Conclusion Non-coding functional elements, in particular those involved in post-transcriptional regulation, are likely to be much more prevalent than is currently known. With the numerous genome sequencing projects underway, comparative genomics approaches like that proposed here are likely to become increasingly powerful at detecting such elements.

Impact of mining and forest regeneration on small mammal biodiversity in the Western Region of Ghana.

Science.gov (United States)

Attuquayefio, Daniel K; Owusu, Erasmus H; Ofori, Benjamin Y

2017-05-01

Much of the terrestrial biodiversity in sub-Saharan Africa is supported by tropical rainforest. Natural resource development, particularly surface mining in the rainforest, poses great risks to the region's rich and endemic biodiversity. Here, we assessed the impact of surface mining and the success of forest rehabilitation on small mammal diversity in the Western Region of Ghana. We surveyed small mammals in the project area and two adjoining forest reserves (control sites) before the mining operation and 10 years after mine closure and forest rehabilitation (topsoil replacement and revegetation). The forest reserves recorded higher species abundance than the mining areas. Majority of the species captured in the forest reserves, including Hylomyscus alleni, Praomys tullbergi, Malacomys cansdalei, and Hybomys trivirgatus, are forest obligate species. Only one individual each of H. alleni and P. tullbergi was captured in the naturally regenerated areas (core areas of mining activities that were allowed to revegetate naturally), while 32 individuals belonging to four species (Lophuromys sikapusi, Mus musculoides, Mastomys erythroleucus, and Crocidura olivieri) were recorded in the rehabilitated areas. Our data suggested negative effects of mining on small mammal diversity and the restoration of species diversity and important ecological processes after rehabilitation of altered habitats. We strongly encourage deliberate conservation efforts, particularly the development of management plans that require the restoration of degraded land resulting from mining activities.

Upgrade of the First Level Muon Trigger in the End-Cap New Small Wheel Region of the ATLAS Detector

International Nuclear Information System (INIS)

Munwes, Yonathan

2013-06-01

The luminosity levels foreseen at the LHC after the 2018 LHC upgrade will tighten the demands on the ATLAS first level muon trigger system. A finer muon selection will be required to cope with the increased background and to keep the trigger rate for 20 GeV/c pTmuons as before. The introduction of new detectors in the small wheel region of the end-cap muon spectrometer will allow to refine the current trigger selection, allowing to increase the rejection power for tracks not coming from the interaction point, thus to find candidate muon tracks within 1 mrad angular resolution and within the 500 ns available latency. The on-detector trigger logic will require a coincidence of eight layers of small thin gap chambers detector pads to determine the trigger regions-of-interest. The charge information from the detector strips of the selected regions-of-interest will be sent to the off-detector trigger logic, which will calculate the strip centroids and extrapolate the muon tracks. The muon tracks information will be finally sent to the end-cap sector logic, which will combine the big wheel and the new small wheel trigger data, and provide the trigger muon candidates to the ATLAS central trigger. (author)

Systematically profiling and annotating long intergenic non-coding RNAs in human embryonic stem cell.

Science.gov (United States)

Tang, Xing; Hou, Mei; Ding, Yang; Li, Zhaohui; Ren, Lichen; Gao, Ge

2013-01-01

While more and more long intergenic non-coding RNAs (lincRNAs) were identified to take important roles in both maintaining pluripotency and regulating differentiation, how these lincRNAs may define and drive cell fate decisions on a global scale are still mostly elusive. Systematical profiling and comprehensive annotation of embryonic stem cells lincRNAs may not only bring a clearer big picture of these novel regulators but also shed light on their functionalities. Based on multiple RNA-Seq datasets, we systematically identified 300 human embryonic stem cell lincRNAs (hES lincRNAs). Of which, one forth (78 out of 300) hES lincRNAs were further identified to be biasedly expressed in human ES cells. Functional analysis showed that they were preferentially involved in several early-development related biological processes. Comparative genomics analysis further suggested that around half of the identified hES lincRNAs were conserved in mouse. To facilitate further investigation of these hES lincRNAs, we constructed an online portal for biologists to access all their sequences and annotations interactively. In addition to navigation through a genome browse interface, users can also locate lincRNAs through an advanced query interface based on both keywords and expression profiles, and analyze results through multiple tools. By integrating multiple RNA-Seq datasets, we systematically characterized and annotated 300 hES lincRNAs. A full functional web portal is available freely at http://scbrowse.cbi.pku.edu.cn. As the first global profiling and annotating of human embryonic stem cell lincRNAs, this work aims to provide a valuable resource for both experimental biologists and bioinformaticians.

Variability among the Most Rapidly Evolving Plastid Genomic Regions is Lineage-Specific: Implications of Pairwise Genome Comparisons in Pyrus (Rosaceae) and Other Angiosperms for Marker Choice

Science.gov (United States)

Ter-Voskanyan, Hasmik; Allgaier, Martin; Borsch, Thomas

2014-01-01

Plastid genomes exhibit different levels of variability in their sequences, depending on the respective kinds of genomic regions. Genes are usually more conserved while noncoding introns and spacers evolve at a faster pace. While a set of about thirty maximum variable noncoding genomic regions has been suggested to provide universally promising phylogenetic markers throughout angiosperms, applications often require several regions to be sequenced for many individuals. Our project aims to illuminate evolutionary relationships and species-limits in the genus Pyrus (Rosaceae)—a typical case with very low genetic distances between taxa. In this study, we have sequenced the plastid genome of Pyrus spinosa and aligned it to the already available P. pyrifolia sequence. The overall p-distance of the two Pyrus genomes was 0.00145. The intergenic spacers between ndhC–trnV, trnR–atpA, ndhF–rpl32, psbM–trnD, and trnQ–rps16 were the most variable regions, also comprising the highest total numbers of substitutions, indels and inversions (potentially informative characters). Our comparative analysis of further plastid genome pairs with similar low p-distances from Oenothera (representing another rosid), Olea (asterids) and Cymbidium (monocots) showed in each case a different ranking of genomic regions in terms of variability and potentially informative characters. Only two intergenic spacers (ndhF–rpl32 and trnK–rps16) were consistently found among the 30 top-ranked regions. We have mapped the occurrence of substitutions and microstructural mutations in the four genome pairs. High AT content in specific sequence elements seems to foster frequent mutations. We conclude that the variability among the fastest evolving plastid genomic regions is lineage-specific and thus cannot be precisely predicted across angiosperms. The often lineage-specific occurrence of stem-loop elements in the sequences of introns and spacers also governs lineage-specific mutations

Variability among the most rapidly evolving plastid genomic regions is lineage-specific: implications of pairwise genome comparisons in Pyrus (Rosaceae and other angiosperms for marker choice.

Directory of Open Access Journals (Sweden)

Nadja Korotkova

Full Text Available Plastid genomes exhibit different levels of variability in their sequences, depending on the respective kinds of genomic regions. Genes are usually more conserved while noncoding introns and spacers evolve at a faster pace. While a set of about thirty maximum variable noncoding genomic regions has been suggested to provide universally promising phylogenetic markers throughout angiosperms, applications often require several regions to be sequenced for many individuals. Our project aims to illuminate evolutionary relationships and species-limits in the genus Pyrus (Rosaceae-a typical case with very low genetic distances between taxa. In this study, we have sequenced the plastid genome of Pyrus spinosa and aligned it to the already available P. pyrifolia sequence. The overall p-distance of the two Pyrus genomes was 0.00145. The intergenic spacers between ndhC-trnV, trnR-atpA, ndhF-rpl32, psbM-trnD, and trnQ-rps16 were the most variable regions, also comprising the highest total numbers of substitutions, indels and inversions (potentially informative characters. Our comparative analysis of further plastid genome pairs with similar low p-distances from Oenothera (representing another rosid, Olea (asterids and Cymbidium (monocots showed in each case a different ranking of genomic regions in terms of variability and potentially informative characters. Only two intergenic spacers (ndhF-rpl32 and trnK-rps16 were consistently found among the 30 top-ranked regions. We have mapped the occurrence of substitutions and microstructural mutations in the four genome pairs. High AT content in specific sequence elements seems to foster frequent mutations. We conclude that the variability among the fastest evolving plastid genomic regions is lineage-specific and thus cannot be precisely predicted across angiosperms. The often lineage-specific occurrence of stem-loop elements in the sequences of introns and spacers also governs lineage-specific mutations. Sequencing

High-throughput sequencing identification and characterization of potentially adhesion-related small RNAs in Streptococcus mutans.

Science.gov (United States)

Zhu, Wenhui; Liu, Shanshan; Liu, Jia; Zhou, Yan; Lin, Huancai

2018-05-01

Adherence capacity is one of the principal virulence factors of Streptococcus mutans, and adhesion virulence factors are controlled by small RNAs (sRNAs) at the post-transcriptional level in various bacteria. Here, we aimed to identify and decipher putative adhesion-related sRNAs in clinical strains of S. mutans. RNA deep-sequencing was performed to identify potential sRNAs under different adhesion conditions. The expression of sRNAs was analysed by quantitative real-time PCR (qRT-PCR), and bioinformatic methods were used to predict the functional characteristics of sRNAs. A total of 736 differentially expressed candidate sRNAs were predicted, and these included 352 sRNAs located on the antisense to mRNA (AM) and 384 sRNAs in intergenic regions (IGRs). The top 7 differentially expressed sRNAs were successfully validated by qRT-PCR in UA159, and 2 of these were further confirmed in 100 clinical isolates. Moreover, the sequences of two sRNAs were conserved in other Streptococcus species, indicating a conserved role in such closely related species. A good correlation between the expression of sRNAs and the adhesion of 100 clinical strains was observed, which, combined with GO and KEGG, provides a perspective for the comprehension of sRNA function annotation. This study revealed a multitude of novel putative adhesion-related sRNAs in S. mutans and contributed to a better understanding of information concerning the transcriptional regulation of adhesion in S. mutans.

Learning Cultures in Small to Medium-Size Enterprises and Their Role in Supporting the Learning Region

Science.gov (United States)

Fitzpatrick, Maeve; O'Connell, Janice; Murphy, Eamonn

2010-01-01

The role of work-based learning is a pivotal part of developing the learning region. With rates of employment at their highest for many years across Europe, the need for up-skilling the workforce in many areas will be essential to retain competitiveness and employability. This paper will focus on quality management up-skilling in small to…

Small RNAs and the regulation of cis-natural antisense transcripts in Arabidopsis

Directory of Open Access Journals (Sweden)

Lonardi Stefano

2008-01-01

Full Text Available Abstract Background In spite of large intergenic spaces in plant and animal genomes, 7% to 30% of genes in the genomes encode overlapping cis-natural antisense transcripts (cis-NATs. The widespread occurrence of cis-NATs suggests an evolutionary advantage for this type of genomic arrangement. Experimental evidence for the regulation of two cis-NAT gene pairs by natural antisense transcripts-generated small interfering RNAs (nat-siRNAs via the RNA interference (RNAi pathway has been reported in Arabidopsis. However, the extent of siRNA-mediated regulation of cis-NAT genes is still unclear in any genome. Results The hallmarks of RNAi regulation of NATs are 1 inverse regulation of two genes in a cis-NAT pair by environmental and developmental cues and 2 generation of siRNAs by cis-NAT genes. We examined Arabidopsis transcript profiling data from public microarray databases to identify cis-NAT pairs whose sense and antisense transcripts show opposite expression changes. A subset of the cis-NAT genes displayed negatively correlated expression profiles as well as inverse differential expression changes under at least one of the examined developmental stages or treatment conditions. By searching the Arabidopsis Small RNA Project (ASRP and Massively Parallel Signature Sequencing (MPSS small RNA databases as well as our stress-treated small RNA dataset, we found small RNAs that matched at least one gene in 646 pairs out of 1008 (64% protein-coding cis-NAT pairs, which suggests that siRNAs may regulate the expression of many cis-NAT genes. 209 putative siRNAs have the potential to target more than one gene and half of these small RNAs could target multiple members of a gene family. Furthermore, the majority of the putative siRNAs within the overlapping regions tend to target only one transcript of a given NAT pair, which is consistent with our previous finding on salt- and bacteria-induced nat-siRNAs. In addition, we found that genes encoding plastid- or

Small Arms Proliferation and Homegrown Terrorism in the Great Lakes Region: Uganda’s Experience

Science.gov (United States)

2016-12-01

in Karamoja was also motivated by the low standard of living there, as the colonial administration and other entrepreneurs expropriated their land...facilitate homegrown terrorism. Because of porous borders that make it easier for potentially disruptive groups to cross into the country, the Act makes it...used by homegrown terrorists and conflicts in the region.209 Conflict entrepreneurs continue to profit from illegal small arms trade taking advantage

Small Coronal Holes Near Active Regions as Sources of Slow Solar Wind

Energy Technology Data Exchange (ETDEWEB)

Wang, Y.-M., E-mail: yi.wang@nrl.navy.mil [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States)

2017-06-01

We discuss the nature of the small areas of rapidly diverging, open magnetic flux that form in the strong unipolar fields at the peripheries of active regions (ARs), according to coronal extrapolations of photospheric field measurements. Because such regions usually have dark counterparts in extreme-ultraviolet (EUV) images, we refer to them as coronal holes, even when they appear as narrow lanes or contain sunspots. Revisiting previously identified “AR sources” of slow solar wind from 1998 and 1999, we find that they are all associated with EUV coronal holes; the absence of well-defined He i 1083.0 nm counterparts to some of these holes is attributed to the large flux of photoionizing radiation from neighboring AR loops. Examining a number of AR-associated EUV holes during the 2014 activity maximum, we confirm that they are characterized by wind speeds of ∼300–450 km s{sup −1}, O{sup 7+}/O{sup 6+} ratios of ∼0.05–0.4, and footpoint field strengths typically of order 30 G. The close spacing between ARs at sunspot maximum limits the widths of unipolar regions and their embedded holes, while the continual emergence of new flux leads to rapid changes in the hole boundaries. Because of the highly nonradial nature of AR fields, the smaller EUV holes are often masked by the overlying canopy of loops, and may be more visible toward one solar limb than at central meridian. As sunspot activity declines, the AR remnants merge to form much larger, weaker, and longer-lived unipolar regions, which harbor the “classical” coronal holes that produce recurrent high-speed streams.

Large Intergenic Non-coding RNA-RoR Inhibits Aerobic Glycolysis of Glioblastoma Cells via Akt Pathway

Science.gov (United States)

Li, Yong; He, Zhi-Cheng; Liu, Qing; Zhou, Kai; Shi, Yu; Yao, Xiao-Hong; Zhang, Xia; Kung, Hsiang-Fu; Ping, Yi-Fang; Bian, Xiu-Wu

2018-01-01

Reprogramming energy metabolism is a hallmark of malignant tumors, including glioblastoma (GBM). Aerobic glycolysis is often utilized by tumor cells to maintain survival and proliferation. However, the underlying mechanisms of aerobic glycolysis in GBM remain elusive. Herein, we demonstrated that large intergenic non-coding RNA-RoR (LincRNA-RoR) functioned as a critical suppressor to inhibit the aerobic glycolysis and viability of GBM cells. We found that LincRNA-RoR was markedly reduced in GBM tissues compared with adjacent non-tumor tissues from 10 cases of GBM patients. Consistently, LincRNA-RoR expression in GBM cells was significantly lower than that in normal glial cells. The aerobic glycolysis of GBM cells, as determined by the measurement of glucose uptake and lactate production, was impaired by LincRNA-RoR overexpression. Mechanistically, LincRNA-RoR inhibited the expression of Rictor, the key component of mTORC2 (mammalian target of rapamycin complex 2), to suppress the activity of Akt pathway and impair the expression of glycolytic effectors, including Glut1, HK2, PKM2 and LDHA. Finally, enforced expression of LincRNA-RoR reduced the proliferation of GBM cells in vitro, restrained tumor growth in vivo, and repressed the expression of glycolytic molecules in GBM xenografts. Collectively, our results underscore LincRNA-RoR as a new suppressor of GBM aerobic glycolysis with therapeutic potential. PMID:29581766

Identification and Functional Analysis of Long Intergenic Non-coding RNAs Underlying Intramuscular Fat Content in Pigs

Directory of Open Access Journals (Sweden)

Cheng Zou

2018-03-01

Full Text Available Intramuscular fat (IMF content is an important trait that can affect pork quality. Previous studies have identified many genes that can regulate IMF. Long intergenic non-coding RNAs (lincRNAs are emerging as key regulators in various biological processes. However, lincRNAs related to IMF in pig are largely unknown, and the mechanisms by which they regulate IMF are yet to be elucidated. Here we reconstructed 105,687 transcripts and identified 1,032 lincRNAs in pig longissimus dorsi muscle (LDM of four stages with different IMF contents based on published RNA-seq. These lincRNAs show typical characteristics such as shorter length and lower expression compared with protein-coding genes. Combined with methylation data, we found that both the promoter and genebody methylation of lincRNAs can negatively regulate lincRNA expression. We found that lincRNAs exhibit high correlation with their protein-coding neighbors in expression. Co-expression network analysis resulted in eight stage-specific modules, gene ontology and pathway analysis of them suggested that some lincRNAs were involved in IMF-related processes, such as fatty acid metabolism and peroxisome proliferator-activated receptor signaling pathway. Furthermore, we identified hub lincRNAs and found six of them may play important roles in IMF development. This work detailed some lincRNAs which may affect of IMF development in pig, and facilitated future research on these lincRNAs and molecular assisted breeding for pig.

[Nitrogen Losses Under the Action of Different Land Use Types of Small Catchment in Three Gorges Region].

Science.gov (United States)

Chen, Cheng-long; Gao, Ming; Ni, Jiu-pai; Xie, De-ti; Deng, Hua

2016-05-15

As an independent water-collecting area, small catchment is the source of non-point source pollution in Three Gorges Region. Choosing 3 kinds of the most representative land-use types and using them to lay monitoring points of overland runoff within the small catchment of Wangjiagou in Fuling of Three Gorges Region, the author used the samples of surface runoff collected through the twelve natural rainfalls from May to December to analyze the feature of spatial-temporal change of Nitrogen's losses concentrations under the influence of different land use types and the hillslopes and small catchments composed by those land use types, revealing the relation between different land-use types and Nitrogen's losses of small catchments in Three Gorges Region. The result showed: the average losses concentration of TN showed the biggest difference for different land use types during the period of spring crops, and the average value of dry land was 1. 61 times and 6.73 times of the values of interplanting field of mulberry and paddy field, respectively; the change of the losses concentration of TN was most conspicuous in the 3 periods of paddy field. The main element was NO₃⁻-N, and the relation between TN and NO₃⁻-N showed a significant linear correlation. TN's and NO₃⁻-N's losses concentrations were significantly and positively correlated with the area ratio of corn and mustard, but got a significant negative correlation with the area ratio of paddy and mulberry; NH₄⁺-N's losses concentrations got a significant positive correlation with the area ratio of mustard. Among all the hillslopes composed by different land use types, TN's average losses concentration of surface runoff of the hillslope composed by interplantating field of mulberry and paddy land during the three periods was the lowest, and the values were 2.55, 11.52, 8.58 mg · L⁻¹, respectively; the hillslope of rotation plough land of corn and mustard had the maximum value, and the values were

Returning "Region" to World Regional Geography

Science.gov (United States)

Rees, Peter W.; Legates, Margaret

2013-01-01

World regional geography textbooks rarely focus on the process of region formation, despite frequent calls to reincorporate a regional approach to teaching global geography. An instructional strategy using problem-based learning in a small honors section of a large world regional geography course is described. Using a hypothetical scenario…

Construction of a restriction map and gene map of the lettuce chloroplast small single-copy region using Southern cross-hybridization.

Science.gov (United States)

Mitchelson, K R

1996-01-01

The small single-copy region (SSCR) of the chloroplast genome of many higher plants typically contain ndh genes encoding proteins that share homology with subunits of the respiratory-chain reduced nicotinamide adenine dinucleotide (NADH) dehydrogenase complex of mitochondria. A map of the lettuce chloroplast SSCR has been determined by Southern cross-hybridization, taking advantage of the high degree of homology between a tobacco small single-copy fragment and a corresponding lettuce chloroplast fragment. The gene order of the SSCR of lettuce and tobacco chloroplasts is similar. The cross-hybridization method can rapidly create a primary gene map of unknown chloroplast fragments, thus providing detailed information of the localization and arrangement of genes and conserved open reading frame regions.

Genome-wide identification and characterization of long intergenic non-coding RNAs in Ganoderma lucidum.

Directory of Open Access Journals (Sweden)

Jianqin Li

Full Text Available Ganoderma lucidum is a white-rot fungus best-known for its medicinal activities. We have previously sequenced its genome and annotated the protein coding genes. However, long non-coding RNAs in G. lucidum genome have not been analyzed. In this study, we have identified and characterized long intergenic non-coding RNAs (lincRNA in G. lucidum systematically. We developed a computational pipeline, which was used to analyze RNA-Seq data derived from G. lucidum samples collected from three developmental stages. A total of 402 lincRNA candidates were identified, with an average length of 609 bp. Analysis of their adjacent protein-coding genes (apcGenes revealed that 46 apcGenes belong to the pathways of triterpenoid biosynthesis and lignin degradation, or families of cytochrome P450, mating type B genes, and carbohydrate-active enzymes. To determine if lincRNAs and these apcGenes have any interactions, the corresponding pairs of lincRNAs and apcGenes were analyzed in detail. We developed a modified 3' RACE method to analyze the transcriptional direction of a transcript. Among the 46 lincRNAs, 37 were found unidirectionally transcribed, and 9 were found bidirectionally transcribed. The expression profiles of 16 of these 37 lincRNAs were found to be highly correlated with those of the apcGenes across the three developmental stages. Among them, 11 are positively correlated (r>0.8 and 5 are negatively correlated (r<-0.8. The co-localization and co-expression of lincRNAs and those apcGenes playing important functions is consistent with the notion that lincRNAs might be important regulators for cellular processes. In summary, this represents the very first study to identify and characterize lincRNAs in the genomes of basidiomycetes. The results obtained here have laid the foundation for study of potential lincRNA-mediated expression regulation of genes in G. lucidum.

High transcript abundance, RNA editing, and small RNAs in intergenic regions within the massive mitochondrial genome of the angiosperm Silene noctiflora

Czech Academy of Sciences Publication Activity Database

Wu, Z.; Stone, James D.; Štorchová, Helena; Sloan, D.B.

2015-01-01

Roč. 16, NOV 14 (2015), s. 938 ISSN 1471-2164 R&D Projects: GA MŠk(CZ) EE2.3.30.0048 Institutional support: RVO:61389030 Keywords : Antisense RNA * Junk DNA * mtDNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.867, year: 2015

DECREASE IN SOCIAL AND ECONOMIC CONSEQUENCES TECHNOLOGICAL DEVELOPMENT BASE INDUSTRIES BY FORMATION OF EFFECTIVE REGIONAL POLICY OF SUPPORT SMALL BUSINESS

Directory of Open Access Journals (Sweden)

A.G. Shelomentsev

2006-12-01

Full Text Available Clause is devoted to an actual problem of decrease in negative consequences of technological development of key economic branches of the industry at a regional level. During social and economic transformations to Russia to the beginning of 90th years XX of a century there has been begun complex process of re-structuring of key economic branches of the industry, including technological, social and economic transformations. During re-structuring by one of key directions of the decision of existing social problems there is a formation of effective policy of support of small business at a regional and local level. Creation of favorable conditions for development of small business allows for short time and at rather low expenses to smooth disproportions of social and economic development of territories arising at re-structuring. Flexibility inherent in small business, mobility and adaptibility to changeable market conditions can promote the decision of problems of social stability, maintenance of employment and saturation of the consumer market. Creation of the enterprises of small business on the basis of local natural-economic resources raises social and economic potential of industrial territories.

Identification of Candida species by PCR and restriction fragment length polymorphism analysis of intergenic spacer regions of ribosomal DNA.

OpenAIRE

Williams, D W; Wilson, M J; Lewis, M A; Potts, A J

1995-01-01

The PCR was used to amplify a targeted region of the ribosomal DNA from 84 Candida isolates. Unique product sizes were obtained for Candida guilliermondii, Candida (Torulopsis) glabrata, and Candida pseudotropicalis. Isolates of Candida albicans, Candida tropicalis, Candida stellatoidea, Candida parapsilosis, and Candida krusei could be identified following restriction digestion of the PCR products.

Particulate matter pollution from aviation-related activity at a small airport of the Aegean Sea Insular Region.

Science.gov (United States)

Psanis, C; Triantafyllou, E; Giamarelou, M; Manousakas, M; Eleftheriadis, K; Biskos, G

2017-10-15

The unprecedented growth in aviation during the last years has resulted in a notable increase of local air pollution related to airports. The impacts of aviation on air quality can be extremely high particularly around airports serving remote insular regions with pristine atmospheric environments. Here we report measurements that show how the atmospheric aerosol is affected by the activity at a small airport in a remote region. More specifically, we provide measurements performed at the airport of Mytilene, Greece, a regional yet international airport that serves the entire island of Lesvos; the third largest island of the country. The measurements show that the activity during landing, taxiing and take-off of the aircrafts accounted for up to a 10-fold increase in particulate matter (PM) mass concentration in the vicinity of the airport. The number concentration of particles having diameters from 10 to 500nm also increased from ca. 4×10 2 to 8×10 5 particlescm -3 , while the mean particle diameter decreased to 20nm when aircrafts were present at the airport. Elemental analysis on particle samples collected simultaneously at the airport and at a remote site 3km away, showed that the former were significantly influenced by combustion sources, and specifically from the engines of the aircrafts. Our results show that despite their small size, local airports serving remote insular regions should be considered as important air pollution hotspots, raising concerns for the exposure of the people working and leaving in their vicinities to hazardous pollutants. Copyright © 2017 Elsevier B.V. All rights reserved.

Eosinophils may play regionally disparate roles in influencing IgA(+) plasma cell numbers during large and small intestinal inflammation.

Science.gov (United States)

Forman, Ruth; Bramhall, Michael; Logunova, Larisa; Svensson-Frej, Marcus; Cruickshank, Sheena M; Else, Kathryn J

2016-05-31

Eosinophils are innate immune cells present in the intestine during steady state conditions. An intestinal eosinophilia is a hallmark of many infections and an accumulation of eosinophils is also observed in the intestine during inflammatory disorders. Classically the function of eosinophils has been associated with tissue destruction, due to the release of cytotoxic granule contents. However, recent evidence has demonstrated that the eosinophil plays a more diverse role in the immune system than previously acknowledged, including shaping adaptive immune responses and providing plasma cell survival factors during the steady state. Importantly, it is known that there are regional differences in the underlying immunology of the small and large intestine, but whether there are differences in context of the intestinal eosinophil in the steady state or inflammation is not known. Our data demonstrates that there are fewer IgA(+) plasma cells in the small intestine of eosinophil-deficient ΔdblGATA-1 mice compared to eosinophil-sufficient wild-type mice, with the difference becoming significant post-infection with Toxoplasma gondii. Remarkably, and in complete contrast, the absence of eosinophils in the inflamed large intestine does not impact on IgA(+) cell numbers during steady state, and is associated with a significant increase in IgA(+) cells post-infection with Trichuris muris compared to wild-type mice. Thus, the intestinal eosinophil appears to be less important in sustaining the IgA(+) cell pool in the large intestine compared to the small intestine, and in fact, our data suggests eosinophils play an inhibitory role. The dichotomy in the influence of the eosinophil over small and large intestinal IgA(+) cells did not depend on differences in plasma cell growth factors, recruitment potential or proliferation within the different regions of the gastrointestinal tract (GIT). We demonstrate for the first time that there are regional differences in the requirement of

Implication of ICT use on productivity and regional development planning among small scale enterprises in Ondo state

Directory of Open Access Journals (Sweden)

Afolabi Francis Fatusin

2018-03-01

Full Text Available One of the reasons often cited for underdevelopment of African cities and regions is low application of smart technology to improve means of production. This often led to inefficiency which is ultimately reflected in space. This paper investigated the level of ICT usage among small scale manufacturing enterprises in Ondo State. The study also investigated intra-regional variations in use of smart technologies in the industrial subsector and compared same across the three regions of the state. A sample of 352 enterprises was taken from three senatorial regions and nine settlements which were purposively sampled and interviewed using questionnaire. The production and operational system of these firms were observed. The data collected were analysed using descriptive and inferential methods. The study established that proportion of ICT users concentrated more in Ondo Central 45.7% than Ondo south (28.7% and Ondo north (25.6%. It was also discovered that formal small scale enterprises made more use of ICT products, compared with those in the informal sector. Moreover ICT use among enterprises were urban biased as 91.2% of enterprises in this category were located in major towns of Akure, Okitipupa and Ikare, 8.1% in minor towns of Obaile, Ode Aye and Ugbe, with villages of Aponmu Iboropa and Ikoya being relatively insignificant (0.8%. The study established that enterprises that made use of smart technologies tend to be more efficient in terms of production and marketing especially in identification of new markets, networking, subcontracting, security and other linkage benefits. Also, regional industrial development entails not only quantitative growth of industries, but an industry that embrace a new opportunities in innovation, and technology especially in management, record keeping, production, decision making etc.

Specific Regional and Age-Related Small Noncoding RNA Expression Patterns Within Superior Temporal Gyrus of Typical Human Brains Are Less Distinct in Autism Brains.

Science.gov (United States)

Stamova, Boryana; Ander, Bradley P; Barger, Nicole; Sharp, Frank R; Schumann, Cynthia M

2015-12-01

Small noncoding RNAs play a critical role in regulating messenger RNA throughout brain development and when altered could have profound effects leading to disorders such as autism spectrum disorders (ASD). We assessed small noncoding RNAs, including microRNA and small nucleolar RNA, in superior temporal sulcus association cortex and primary auditory cortex in typical and ASD brains from early childhood to adulthood. Typical small noncoding RNA expression profiles were less distinct in ASD, both between regions and changes with age. Typical micro-RNA coexpression associations were absent in ASD brains. miR-132, miR-103, and miR-320 micro-RNAs were dysregulated in ASD and have previously been associated with autism spectrum disorders. These diminished region- and age-related micro-RNA expression profiles are in line with previously reported findings of attenuated messenger RNA and long noncoding RNA in ASD brain. This study demonstrates alterations in superior temporal sulcus in ASD, a region implicated in social impairment, and is the first to demonstrate molecular alterations in the primary auditory cortex. © The Author(s) 2015.

Small farmers and deforestation in Amazonia

Science.gov (United States)

Brondízio, Eduardo S.; Cak, Anthony; Caldas, Marcellus M.; Mena, Carlos; Bilsborrow, Richard; Futemma, Celia T.; Ludewigs, Thomas; Moran, Emilio F.; Batistella, Mateus

This chapter discusses the relationship between small farmers' land use and deforestation, with particular attention paid to the past 30 years of Amazonian colonization in Brazil and Ecuador. Our analysis calls attention to common features uniting different social groups as small farmers (e.g., social identity, access to land and resources, technology, market, and credit), as well as the variability between small farmers in terms of time in the region (from native populations to recent colonists), contribution to regional deforestation, types of land use systems. At a regional level, small farmers contribute to the majority of deforestation events, but are responsible for only a fraction of the total deforested area in Amazonia. We discuss three misconceptions that have been used to define small farmers and their contribution to the regional economy, development, and deforestation: (1) small farmers have backward land use systems associated with low productivity and extensive deforestation and subsistence production, (2) small farmers contribute to Amazonian deforestation as much as large farmers, and (3) small farmers, particularly colonist farmers, follow an inexorable path of deforestation unless curbed by government action. We conclude the chapter discussing their growing regional importance and the need for more inclusive public policies concerning infrastructure and services and valorization of resources produced in rural areas of Amazonia.

Toward compression of small cell population: harnessing stress in passive regions of dielectric elastomer actuators

Science.gov (United States)

Poulin, Alexandre; Rosset, Samuel; Shea, Herbert

2014-03-01

We present a dielectric elastomer actuator (DEA) for in vitro analysis of mm2 biological samples under periodic compressive stress. Understanding how mechanical stimuli affect cell functions could lead to significant advances in diseases diagnosis and drugs development. We previously reported an array of 72 micro-DEAs on a chip to apply a periodic stretch to cells. To diversify our cell mechanotransduction toolkit we have developed an actuator for periodic compression of small cell populations. The device is based on a novel design which exploits the effects of non-equibiaxial pre-stretch and takes advantage of the stress induced in passive regions of DEAs. The device consists of two active regions separated by a 2mm x 2mm passive area. When connected to an AC high-voltage source, the two active regions periodically compress the passive region. Due to the non-equibiaxial pre-stretch it induces uniaxial compressive strain greater than 10%. Cells adsorbed on top of this passive gap would experience the same uniaxial compressive stain. The electrodes configuration confines the electric field and prevents it from reaching the biological sample. A thin layer of silicone is casted on top of the device to ensure a biocompatible environment. This design provides several advantages over alternative technologies such as high optical transparency of the area of interest (passive region under compression) and its potential for miniaturization and parallelization.

Small x physics

International Nuclear Information System (INIS)

Kwiecinski, J.

1993-01-01

The QCD expectations concerning the small x limit of parton distributions where x is the Bjorken scaling variable are reviewed. This includes discussion of the evolutions equations in the small x region, the Lipatov equation which sums the leading powers of ln(1/x) and the shadowing effects. Phenomenological implantations of the theoretical expectations for the deep inelastic lepton-hadron scattering in the small x region which will be accessible at the HERA ep collider are described. We give predictions for structure functions F 2 and F L and discuss specific processes sensitive to the small x physics such as heavy quark production, deep inelastic diffraction and jet production in deep inelastic lepton scattering. A brief review of nuclear shadowing in the inelastic lepton nucleus scattering at small x is also presented. (author). 86 refs, 29 figs

Moment Magnitudes of Small to Moderate Size Regional Events from Coda in the Middle East

Science.gov (United States)

Gok, R.; Pasyanos, M. E.; Matzel, E.; Mayeda, K. M.; Walter, W. R.

2010-12-01

The uneven distribution of stations and heterogeneous structure of the Middle East makes it difficult to calculate reliable moment magnitudes in the region. Such magnitudes are important for event characterization, and for yield estimation applications. The complex structure of the lithosphere in the region causes significant variation in the recorded amplitude of body and surface waves that travel along different paths. These 2-D effects are most significant for small and moderate magnitude events, which are most observable at periods 4.5) at low frequencies ( < 0.5 Hz). But even using coda waves, high frequency spectra show considerable scatter. Next, we applied tomographic inversion to the geometrical spreading corrected coda amplitudes to calculate 2-D coda Q. Coda Q results agree well with direct Lg and tectonics of the region. We observe low Q in Anatolian and Iranian plateaus and high Q in Arabian Plate. Applying the 2-D correction reduced the inter-station scatter of the higher frequency spectra, allowing us to obtain reliable moment magnitude estimates for smaller events (Mw < 4.5).

Agroecological monitoring of small-scale parcels in the zones of radioactive contamination of Chernihiv region

International Nuclear Information System (INIS)

Mel'nyk, A.I.; Baida, V.I.

1996-01-01

It is found out that agricultural products grown at small parcels in Chernihiv region of Ukraine have high content of not only radionuclides but that of heavy metals and nitrates as well. That enhances the threat to human health. In order to ensure food production that meet requirements of their ecological purity and radiological safety the strict control of their quality is a must. The correspondent countermeasures directed at reduction of the toxicants level in plants are to be undertaken as well

Can small island mountains provide relief from the Subtropical Precipitation Decline? Simulating future precipitation regimes for small island nations using high resolution Regional Climate Models.

Science.gov (United States)

Bowden, J.; Terando, A. J.; Misra, V.; Wootten, A.

2017-12-01

Small island nations are vulnerable to changes in the hydrologic cycle because of their limited water resources. This risk to water security is likely even higher in sub-tropical regions where anthropogenic forcing of the climate system is expected to lead to a drier future (the so-called `dry-get-drier' pattern). However, high-resolution numerical modeling experiments have also shown an enhancement of existing orographically-influenced precipitation patterns on islands with steep topography, potentially mitigating subtropical drying on windward mountain sides. Here we explore the robustness of the near-term (25-45 years) subtropical precipitation decline (SPD) across two island groupings in the Caribbean, Puerto Rico and the U.S. Virgin Islands. These islands, forming the boundary between the Greater and Lesser Antilles, significantly differ in size, topographic relief, and orientation to prevailing winds. Two 2-km horizontal resolution regional climate model simulations are used to downscale a total of three different GCMs under the RCP8.5 emissions scenario. Results indicate some possibility for modest increases in precipitation at the leading edge of the Luquillo Mountains in Puerto Rico, but consistent declines elsewhere. We conclude with a discussion of potential explanations for these patterns and the attendant risks to water security that subtropical small island nations could face as the climate warms.

Correlation of maple sap composition with bacterial and fungal communities determined by multiplex automated ribosomal intergenic spacer analysis (MARISA).

Science.gov (United States)

Filteau, Marie; Lagacé, Luc; LaPointe, Gisèle; Roy, Denis

2011-08-01

During collection, maple sap is contaminated by bacteria and fungi that subsequently colonize the tubing system. The bacterial microbiota has been more characterized than the fungal microbiota, but the impact of both components on maple sap quality remains unclear. This study focused on identifying bacterial and fungal members of maple sap and correlating microbiota composition with maple sap properties. A multiplex automated ribosomal intergenic spacer analysis (MARISA) method was developed to presumptively identify bacterial and fungal members of maple sap samples collected from 19 production sites during the tapping period. Results indicate that the fungal community of maple sap is mainly composed of yeast related to Mrakia sp., Mrakiella sp., Guehomyces pullulans, Cryptococcus victoriae and Williopsis saturnus. Mrakia, Mrakiella and Guehomyces peaks were identified in samples of all production sites and can be considered dominant and stable members of the fungal microbiota of maple sap. A multivariate analysis based on MARISA profiles and maple sap chemical composition data showed correlations between Candida sake, Janthinobacterium lividum, Williopsis sp., Leuconostoc mesenteroides, Mrakia sp., Rhodococcus sp., Pseudomonas tolaasii, G. pullulans and maple sap composition at different flow periods. This study provides new insights on the relationship between microbial community and maple sap quality. Copyright © 2011 Elsevier Ltd. All rights reserved.

Proximate, mineral composition and antioxidant activity of traditional small millets cultivated and consumed in Rayalaseema region of south India.

Science.gov (United States)

Vali Pasha, Kotwal; Ratnavathi, Chamarthy Venkata; Ajani, Jayanna; Raju, Dugyala; Manoj Kumar, Sriramoju; Beedu, Sashidhar Rao

2018-01-01

Millets are a diverse group of small seeded grasses, widely grown around the world as cereal foods. This communication details the proximate, mineral profile and antioxidant activity of six different small millets (Finger, Foxtail, Proso, Little, Barnyard and Kodo millets) and their 21 cultivars that are traditionally cultivated and consumed in the region of Ralayaseema, south India. The proximate analysis revealed that these millets are rich in protein, fat, ash (mineral), total dietary fibre and total phenols with appreciable antioxidant activity. However, starch and amylose content was comparatively lower as compared to major millet sorghum. ICP-MS analysis of small millets demonstrated that they are rich in minerals such as Ca, P, K, Mg, Fe, Cu, Zn, Mn, Cr, Mo and Se. Finger and kodo millets were found to be nutritionally superior over other small millets. The results suggest that small millets have a potential to provide food security and can combat micronutrient malnutrition. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Analyzing the management process in small and medium-sized enterprises in the Region of South Bohemia

Directory of Open Access Journals (Sweden)

Váchal Jan

2017-09-01

Full Text Available The entry is aimed at analyzing the process of managing small and medium-sized enterprise, specifically in the Region of South Bohemia. The testing sample included 180 enterprises. The fundamental statistical information about SMEs is included, focusing of the numbers, the size category, and their specialization in the Region of South Bohemia. The research activities were aimed at the steepness of management structures and at their extent on all management levels. The analysis indicates that micro-enterprises prefer one management level, while small and middle-sized enterprises prefer two management levels with the statistic dependence on the size category. In regard to the number of employees on individual management levels, the top positions have from 6 employees up to 30 on the operative level. The general business trend involves a transfer to the functional management structure. With respect to the strategic management and decision- making, enterprises boost an attractive prospect of mainly their own sources. A statistical correlation was proved between the elaborated strategy, the size of the enterprise and number of management levels. A strong correlation between the number of management levels and the aim of the enterprise i.e. the type of organization structure was not proved.

Short-term outcomes of small incision cataract surgery provided by a regional population in the Pacific.

Science.gov (United States)

Bhikoo, Riyaz; Vellara, Hans; Lolokabaira, Salome; Murray, Neil; Sikivou, Biu; McGhee, Charles

2017-11-01

This study aims to describe patient demographics, visual and surgical outcomes of a cohort undergoing small incision cataract surgery at a Pacific regional ophthalmic training facility. This is a prospective, longitudinal study conducted at the Pacific Eye Institute, Fiji. One hundred fifty-six patients underwent small incision cataract surgery. Preoperatively, a complete ophthalmic examination, including pachymetry and macular optical coherence tomography performed by two independent investigators. Temporal small incision cataract surgery with intraocular lens insertion was performed by ophthalmologists, and trainee ophthalmologists. Follow-up occurred at day one, four weeks and 3 months. Patient characteristics, visual outcomes including surgically induced astigmatism and complications. Ninety-one per cent (142/156) attended 3-month follow-up with median age 63 years (range 19-82), 52% female (81/156) and 58% (90/156) Fijian ethnicity. In 37% (57/156), the contralateral eye was pseudophakic. Mean preoperative best spectacle-corrected visual acuity was logMAR 1.44 (6/165). At 3 months, 74% (105/142) achieved ≥6/18 unaided vision (94% [133/142] best spectacle-corrected visual acuity). Mean postoperative spherical equivalent was -0.78 (SD 0.95) D and mean surgically induced astigmatism 1.04 (0.57) D. Complications included posterior capsular rupture with vitreous loss (4% [6/156]), optical coherence tomography confirmed macular oedema (8% [12/152] at 4 weeks), significant posterior capsular opacity (23% [31/136]) and >5% increase in preoperative pachymetry (1% [1/142]) at 3 months. Reduction in preoperative best spectacle-corrected visual acuity occurred in 2% (3/142). No cases of endophthalmitis. Small incision cataract surgery provided to a regional population is effective with 94% achieving the World Health Organisation's definition of 'Good Vision' (≥6/18). Refinements in biometric and surgical techniques may allow a greater proportion of patients to

Hydrogeological approach to the regional analysis of low flow in medium and small streams of the hilly and mountainous areas of Serbia

Directory of Open Access Journals (Sweden)

Nikić Zoran

2006-01-01

Full Text Available During the long rainless spells of the dry season, flows in medium and small streams get reduced to what is generally known as "low flow". For ungauged streams, the controlling "low flows" are determined using the regional analysis method. In the presently described exploration, the method applied was based on the assumption that dry weather discharges in medium and small rivers depended on the hydrogeological conditions. The controlling effect of hydrogeology on the natural low flow in medium and small streams of the hilly and mountainous part of Serbia was analyzed applying the theory of multiple linear regression. The thirty-day minimum mean 80 and 95 per cent exceedance flows were taken for dependent variables, and quantified hydrogeological elements as independent variables. The analysis covered streams that had small or medium size catchment areas. The treated example encompassed sixty-one gauged catchments. The resulting regional relations for the thirty day minimum mean 80 and 95 per cent exceedance flows are presented in this paper. The quality of the established relation was controlled by relevant statistic tests.

The effect of a small creek valley on drainage flows in the Rocky Flats region

International Nuclear Information System (INIS)

Porch, W.

1996-01-01

Regional scale circulation and mountain-plain interactions and effects on boundary layer development are important for understanding the fate of an atmospheric release from Rocky Flats, Colorado. Numerical modeling of Front Range topographic effects near Rocky Flats have shown that though the Front Range dominates large scale flow features, small-scale terrain features near Rocky Flats are important to local transport during nighttime drainage flow conditions. Rocky Flats has been the focus of interest for the Department of Energy's Atmospheric Studies in Complex Terrain (ASCOT) program

Regional distribution and variation of gamma-globulin absorption from the small intestine of the neonatal calf

International Nuclear Information System (INIS)

Fetcher, A.; Gay, C.C.; McGuire, T.C.; Barbee, D.D.; Parish, S.M.

1983-01-01

125I-labeled immunoglobulin (Ig)G1 in colostral whey was used to determine the region of maximum absorption of Ig from the small intestine of the neonatal calf and the variation in Ig absorption among calves at the intestinal level. In experiment 1, 5 segments (approx 5%, 35%, 60%, 80%, and 95% of the duodenocecal length) were formed in the small intestine of 9 colostrum-deprived calves shortly after birth. These segments were injected with colostral whey containing 125I-IgG1 4 hours after birth, and uptake, transfer, and absorption (defined as uptake plus transfer) were determined for each segment 2 hours later. Raw data were adjusted for the milligrams of IgG1 injected per gram of intestinal tissue to obtain the least squares mean (LSM) value. The LSM values for absorption of IgG1 from distal segments 3, 4, and 5 were significantly greater (P less than 0.05) than those values for proximal segments 1 and 2. The region of the maximum IgG1 absorption was the lower small intestine, 60% to 80% of the duodenocecal length. There was also an indication of independence between uptake and transfer in each of the segments. Significant differences (P less than 0.05) were present among calves in the LSM values for uptake and absorption, but not for transfer. In experiment 2, thoracic ducts of 8 newborn calves were cannulated 4 to 5 hours after birth. At 6 hours after birth, colostral whey with 125I-IgG1 was injected into an intestinal segment (approx 60% to 80% of the duodenocecal length)

Biogeography of Deep-sea benthic bacteria at regional scale (LTER HAUSGARTEN, Fram Strait, Arctic.

Directory of Open Access Journals (Sweden)

Marianne Jacob

Full Text Available Knowledge on spatial scales of the distribution of deep-sea life is still sparse, but highly relevant to the understanding of dispersal, habitat ranges and ecological processes. We examined regional spatial distribution patterns of the benthic bacterial community and covarying environmental parameters such as water depth, biomass and energy availability at the Arctic Long-Term Ecological Research (LTER site HAUSGARTEN (Eastern Fram Strait. Samples from 13 stations were retrieved from a bathymetric (1,284-3,535 m water depth, 54 km in length and a latitudinal transect (∼ 2,500 m water depth; 123 km in length. 454 massively parallel tag sequencing (MPTS and automated ribosomal intergenic spacer analysis (ARISA were combined to describe both abundant and rare types shaping the bacterial community. This spatial sampling scheme allowed detection of up to 99% of the estimated richness on phylum and class levels. At the resolution of operational taxonomic units (97% sequence identity; OTU3% only 36% of the Chao1 estimated richness was recovered, indicating a high diversity, mostly due to rare types (62% of all OTU3%. Accordingly, a high turnover of the bacterial community was also observed between any two sampling stations (average replacement of 79% of OTU3%, yet no direct correlation with spatial distance was observed within the region. Bacterial community composition and structure differed significantly with increasing water depth along the bathymetric transect. The relative sequence abundance of Verrucomicrobia and Planctomycetes decreased significantly with water depth, and that of Deferribacteres increased. Energy availability, estimated from phytodetrital pigment concentrations in the sediments, partly explained the variation in community structure. Overall, this study indicates a high proportion of unique bacterial types on relatively small spatial scales (tens of kilometers, and supports the sampling design of the LTER site HAUSGARTEN to

Phylogenetic relationships in the genus Leonardoxa (Leguminosae: Caesalpinioideae) inferred from chloroplast trnL intron and trnL-trnF intergenic spacer sequences.

Science.gov (United States)

Brouat, Carine; Gielly, Ludovic; McKey, Doyle

2001-01-01

The African genus LEONARDOXA: (Leguminosae: Caesalpinioideae) comprises two Congolean species and a group of four mostly allopatric subspecies principally located in Cameroon and clustered together in the L. africana complex. LEONARDOXA: provides a good opportunity to investigate the evolutionary history of ant-plant mutualisms, as it exhibits various grades of ant-plant interactions from diffuse to obligate and symbiotic associations. We present in this paper the first molecular phylogenetic study of this genus. We sequenced both the chloroplast DNA trnL intron (677 aligned base pairs [bp]) and trnL-trnF intergene spacer (598 aligned bp). Inferred phylogenetic relationships suggested first that the genus is paraphyletic. The L. africana complex is clearly separated from the two Congolean species, and the integrity of the genus is thus in question. In the L. africana complex, our data showed a lack of congruence between clades suggested by morphological and chloroplast characters. This, and the low level of molecular divergence found between subspecies, suggests gene flow and introgressive events in the L. africana complex.

Pleiotropic Associations of Allelic Variants in a 2q22 Region with Risks of Major Human Diseases and Mortality.

Directory of Open Access Journals (Sweden)

Alexander M Kulminski

2016-11-01

Full Text Available Gaining insights into genetic predisposition to age-related diseases and lifespan is a challenging task complicated by the elusive role of evolution in these phenotypes. To gain more insights, we combined methods of genome-wide and candidate-gene studies. Genome-wide scan in the Atherosclerosis Risk in Communities (ARIC Study (N = 9,573 was used to pre-select promising loci. Candidate-gene methods were used to comprehensively analyze associations of novel uncommon variants in Caucasians (minor allele frequency~2.5% located in band 2q22.3 with risks of coronary heart disease (CHD, heart failure (HF, stroke, diabetes, cancer, neurodegenerative diseases (ND, and mortality in the ARIC study, the Framingham Heart Study (N = 4,434, and the Health and Retirement Study (N = 9,676. We leveraged the analyses of pleiotropy, age-related heterogeneity, and causal inferences. Meta-analysis of the results from these comprehensive analyses shows that the minor allele increases risks of death by about 50% (p = 4.6×10-9, CHD by 35% (p = 8.9×10-6, HF by 55% (p = 9.7×10-5, stroke by 25% (p = 4.0×10-2, and ND by 100% (p = 1.3×10-3. This allele also significantly influences each of two diseases, diabetes and cancer, in antagonistic fashion in different populations. Combined significance of the pleiotropic effects was p = 6.6×10-21. Causal mediation analyses show that endophenotypes explained only small fractions of these effects. This locus harbors an evolutionary conserved gene-desert region with non-coding intergenic sequences likely involved in regulation of protein-coding flanking genes ZEB2 and ACVR2A. This region is intensively studied for mutations causing severe developmental/genetic disorders. Our analyses indicate a promising target region for interventions aimed to reduce risks of many major human diseases and mortality.

RFLP of analyses of an intergenic spacer region of chloroplast DNA ...

African Journals Online (AJOL)

user

2006-11-16

Nov 16, 2006 ... amplified with PCR and digested with 6 restriction endonucleases (Hpa II, Alu I, Hinc II, Ava III, Nde I and. Hae III). According to results ... the environment, but DNA based techniques represent reliable tools and do not have many of ... existence of some variations in gene content (Downie and Palmer, 1992).

RFLP of analyses of an intergenic spacer region of chloroplast DNA ...

African Journals Online (AJOL)

African Journal of Biotechnology. Journal Home · ABOUT ... In this study, 11 wheat species of Triticum and. Aegilops were ... and a phenogram was constructed using SAHN clustering unweighted pair group method using arithmetic averages.

An analytical framework for extracting hydrological information from time series of small reservoirs in a semi-arid region

Science.gov (United States)

Annor, Frank; van de Giesen, Nick; Bogaard, Thom; Eilander, Dirk

2013-04-01

small reservoirs in the Upper East Region of Ghana. Reservoirs without obvious large seepage losses (field survey) were selected. To verify this, stable water isotopic samples are collected from groundwater upstream and downstream from the reservoir. By looking at possible enrichment of downstream groundwater, a good estimate of seepage can be made in addition to estimates on evaporation. We estimated the evaporative losses and compared those with field measurements using eddy correlation measurements. Lastly, we determined the cumulative surface runoff curves for the small reservoirs .We will present this analytical framework for extracting hydrological information from time series of small reservoirs and show the first results for our study region of northern Ghana.

Argyrophilic nucleolar organizer region in MIB-1 positive cells in non-small cell lung cancer: clinicopathological significance and survival

International Nuclear Information System (INIS)

Kobyakov, Dmitriy Sergeevich; Avdalyan, Ashot Merudzhanovich; Lazarev, Aleksandr Fedorovich; Lushnikova, Elena Leonidovna; Nepomnyashchikh, Lev Moiseevich

2014-01-01

To evaluate the relation between argyrophilic nucleolar organizer region (AgNOR)-associated proteins and clinicopathological parameters and survival in non-small-cell lung cancer (NSCLC). A total of 207 surgical specimens diagnosed as NSCLC were included in this study. Double-staining procedures were performed using antigen Ki-67 (clone MIB-1) and silver nitrate by immunohistochemical and AgNOR-staining methods. The AgNOR area in MIB-1-positive cells of NSCLC is related to clinicopathological parameters under the TNM (tumor, node, and metastasis) system. The survival of patients with small AgNOR area in MIB-1-positive cells is better than that of patients with large AgNOR area. Molecular, biological (AgNOR area in MIB-1-positive cells), and clinicopathological (greatest tumor dimension, metastases to regional lymph nodes, histology, and differentiation) parameters are independent prognostic factors of NSCLC. The AgNOR area in MIB-1-positive cells is related to clinicopathological parameters and survival in NSCLC

An integrative approach to predicting the functional effects of small indels in non-coding regions of the human genome.

Science.gov (United States)

Ferlaino, Michael; Rogers, Mark F; Shihab, Hashem A; Mort, Matthew; Cooper, David N; Gaunt, Tom R; Campbell, Colin

2017-10-06

Small insertions and deletions (indels) have a significant influence in human disease and, in terms of frequency, they are second only to single nucleotide variants as pathogenic mutations. As the majority of mutations associated with complex traits are located outside the exome, it is crucial to investigate the potential pathogenic impact of indels in non-coding regions of the human genome. We present FATHMM-indel, an integrative approach to predict the functional effect, pathogenic or neutral, of indels in non-coding regions of the human genome. Our method exploits various genomic annotations in addition to sequence data. When validated on benchmark data, FATHMM-indel significantly outperforms CADD and GAVIN, state of the art models in assessing the pathogenic impact of non-coding variants. FATHMM-indel is available via a web server at indels.biocompute.org.uk. FATHMM-indel can accurately predict the functional impact and prioritise small indels throughout the whole non-coding genome.

Genome-wide admixture and association study of subclinical atherosclerosis in the Women's Interagency HIV Study (WIHS.

Directory of Open Access Journals (Sweden)

Aditi Shendre

Full Text Available Cardiovascular disease (CVD is a major comorbidity among HIV-infected individuals. Common carotid artery intima-media thickness (cCIMT is a valid and reliable subclinical measure of atherosclerosis and is known to predict CVD. We performed genome-wide association (GWA and admixture analysis among 682 HIV-positive and 288 HIV-negative Black, non-Hispanic women from the Women's Interagency HIV study (WIHS cohort using a combined and stratified analysis approach. We found some suggestive associations but none of the SNPs reached genome-wide statistical significance in our GWAS analysis. The top GWAS SNPs were rs2280828 in the region intergenic to mediator complex subunit 30 and exostosin glycosyltransferase 1 (MED30 | EXT1 among all women, rs2907092 in the catenin delta 2 (CTNND2 gene among HIV-positive women, and rs7529733 in the region intergenic to family with sequence similarity 5, member C and regulator of G-protein signaling 18 (FAM5C | RGS18 genes among HIV-negative women. The most significant local European ancestry associations were in the region intergenic to the zinc finger and SCAN domain containing 5D gene and NADH: ubiquinone oxidoreductase complex assembly factor 1 (ZSCAN5D | NDUF1 pseudogene on chromosome 19 among all women, in the region intergenic to vomeronasal 1 receptor 6 pseudogene and zinc finger protein 845 (VN1R6P | ZNF845 gene on chromosome 19 among HIV-positive women, and in the region intergenic to the SEC23-interacting protein and phosphatidic acid phosphatase type 2 domain containing 1A (SEC23IP | PPAPDC1A genes located on chromosome 10 among HIV-negative women. A number of previously identified SNP associations with cCIMT were also observed and included rs2572204 in the ryanodine receptor 3 (RYR3 and an admixture region in the secretion-regulating guanine nucleotide exchange factor (SERGEF gene. We report several SNPs and gene regions in the GWAS and admixture analysis, some of which are common across HIV-positive and

Differentiation of Populus species using chloroplast single nucleotide polymorphism (SNP) markers--essential for comprehensible and reliable poplar breeding.

Science.gov (United States)

Schroeder, H; Hoeltken, A M; Fladung, M

2012-03-01

Within the genus Populus several species belonging to different sections are cross-compatible. Hence, high numbers of interspecies hybrids occur naturally and, additionally, have been artificially produced in huge breeding programmes during the last 100 years. Therefore, determination of a single poplar species, used for the production of 'multi-species hybrids' is often difficult, and represents a great challenge for the use of molecular markers in species identification. Within this study, over 20 chloroplast regions, both intergenic spacers and coding regions, have been tested for their ability to differentiate different poplar species using 23 already published barcoding primer combinations and 17 newly designed primer combinations. About half of the published barcoding primers yielded amplification products, whereas the new primers designed on the basis of the total sequenced cpDNA genome of Populus trichocarpa Torr. & Gray yielded much higher amplification success. Intergenic spacers were found to be more variable than coding regions within the genus Populus. The highest discrimination power of Populus species was found in the combination of two intergenic spacers (trnG-psbK, psbK-psbl) and the coding region rpoC. In barcoding projects, the coding regions matK and rbcL are often recommended, but within the genus Populus they only show moderate variability and are not efficient in species discrimination. © 2011 German Botanical Society and The Royal Botanical Society of the Netherlands.

Genotyping of virulent Escherichia coli obtained from poultry and poultry farm workers using enterobacterial repetitive intergenic consensus-polymerase chain reaction

Directory of Open Access Journals (Sweden)

M. Soma Sekhar

2017-11-01

Full Text Available Aim: The aim of this study was to characterize virulent Escherichia coli isolated from different poultry species and poultry farm workers using enterobacterial repetitive intergenic consensus-polymerase chain reaction (ERIC-PCR genotyping. Materials and Methods: Fecal swabs from different poultry species (n=150 and poultry farm workers (n=15 were analyzed for E. coli and screened for virulence genes (stx1, stx2, eaeA, and hlyA by multiplex PCR. Virulent E. coli was serotyped based on their "O" antigen and then genotyped using ERIC-PCR. Results: A total of 134 E. coli isolates (122/150 from poultry and 12/15 from farm workers were recovered. Virulence genes were detected in a total of 12 isolates. Serological typing of the 12 virulent E. coli revealed nine different serotypes (O2, O49, O60, O63, O83, O101, O120, UT, and Rough. ERIC-PCR genotyping allowed discrimination of 12 virulent E. coli isolates into 11 ERIC-PCR genotypes. The numerical index of discrimination was 0.999. Conclusion: Our findings provide information about the wide genetic diversity and discrimination of virulent E. coli in apparently healthy poultry and poultry farm workers of Andhra Pradesh (India based on their genotype.

Regional Variation of Cost of Care in the Last 12 Months of Life in Switzerland: Small-area Analysis Using Insurance Claims Data.

Science.gov (United States)

Panczak, Radoslaw; Luta, Xhyljeta; Maessen, Maud; Stuck, Andreas E; Berlin, Claudia; Schmidlin, Kurt; Reich, Oliver; von Wyl, Viktor; Goodman, David C; Egger, Matthias; Zwahlen, Marcel; Clough-Gorr, Kerri M

2017-02-01

Health care spending increases sharply at the end of life. Little is known about variation of cost of end of life care between regions and the drivers of such variation. We studied small-area patterns of cost of care in the last year of life in Switzerland. We used mandatory health insurance claims data of individuals who died between 2008 and 2010 to derive cost of care. We used multilevel regression models to estimate differences in costs across 564 regions of place of residence, nested within 71 hospital service areas. We examined to what extent variation was explained by characteristics of individuals and regions, including measures of health care supply. The study population consisted of 113,277 individuals. The mean cost of care during last year of life was 32.5k (thousand) Swiss Francs per person (SD=33.2k). Cost differed substantially between regions after adjustment for patient age, sex, and cause of death. Variance was reduced by 52%-95% when we added individual and regional characteristics, with a strong effect of language region. Measures of supply of care did not show associations with costs. Remaining between and within hospital service area variations were most pronounced for older females and least for younger individuals. In Switzerland, small-area analysis revealed variation of cost of care during the last year of life according to linguistic regions and unexplained regional differences for older women. Cultural factors contribute to the delivery and utilization of health care during the last months of life and should be considered by policy makers.

A Sequence-Specific Interaction between the Saccharomyces cerevisiae rRNA Gene Repeats and a Locus Encoding an RNA Polymerase I Subunit Affects Ribosomal DNA Stability

Science.gov (United States)

Cahyani, Inswasti; Cridge, Andrew G.; Engelke, David R.; Ganley, Austen R. D.

2014-01-01

The spatial organization of eukaryotic genomes is linked to their functions. However, how individual features of the global spatial structure contribute to nuclear function remains largely unknown. We previously identified a high-frequency interchromosomal interaction within the Saccharomyces cerevisiae genome that occurs between the intergenic spacer of the ribosomal DNA (rDNA) repeats and the intergenic sequence between the locus encoding the second largest RNA polymerase I subunit and a lysine tRNA gene [i.e., RPA135-tK(CUU)P]. Here, we used quantitative chromosome conformation capture in combination with replacement mapping to identify a 75-bp sequence within the RPA135-tK(CUU)P intergenic region that is involved in the interaction. We demonstrate that the RPA135-IGS1 interaction is dependent on the rDNA copy number and the Msn2 protein. Surprisingly, we found that the interaction does not govern RPA135 transcription. Instead, replacement of a 605-bp region within the RPA135-tK(CUU)P intergenic region results in a reduction in the RPA135-IGS1 interaction level and fluctuations in rDNA copy number. We conclude that the chromosomal interaction that occurs between the RPA135-tK(CUU)P and rDNA IGS1 loci stabilizes rDNA repeat number and contributes to the maintenance of nucleolar stability. Our results provide evidence that the DNA loci involved in chromosomal interactions are composite elements, sections of which function in stabilizing the interaction or mediating a functional outcome. PMID:25421713

Theoretical simulation of small scale psychometric solar water desalination system in semi-arid region

International Nuclear Information System (INIS)

Shatat, Mahmoud; Omer, Siddig; Gillott, Mark; Riffat, Saffa

2013-01-01

Many countries around the world suffer from water scarcity. This is especially true in remote and semi-arid regions in the Middle East and North Africa (MENA) where per capita water supplies decline as populations increase. This paper presents the results of a theoretical simulation of an affordable small scale solar water desalination plant using the psychometric humidification and dehumidification process coupled with an evacuated tube solar collector with an area of about 2 m 2 . A mathematical model was developed to describe the system's operation. Then a computer program using Simulink Matlab software was developed to provide the governing equations for the theoretical calculations of the humidification and dehumidification processes. The experimental and theoretical values for the total daily distillate output were found to be closely correlated. After the experimental calibration of the mathematical model, a model simulating solar radiation under the climatic conditions in the Middle East region proved that the performance of the system could be improved to produce a considerably higher amount of fresh water, namely up to 17.5 kg/m 2 day. This work suggests that utilizing the concept of humidification and dehumidification, a compact water desalination unit coupled with solar collectors would significantly increase the potable water supply in remote area. It could be a unique solution of water shortages in such areas. -- Highlights: • An affordable small scale desalination system is proposed. • A mathematical model of the desalination system is developed and programmed using Matlab Simulink. • The model describes the psychometric process based on humidification and dehumidification. • The model is used in optimal selection of elements and operating conditions for solar desalination system. • The use of solar water desalination contributes significantly to reducing global warming

Small businesses performance in West African border regions: Do social networks pay off?

DEFF Research Database (Denmark)

Kuepié, Mathias; Tenikué, Michel; Walther, Olivier

networks are also the most successful in terms of monthly sales and profit. The paper shows that the overall economic performance of traders is affected by the socio-professional position of the actors with whom they are connected. While social ties with local religious leaders have no effect......This paper studies the link between economic performance and social networks in West Africa. Using first-hand data collected on 358 small-scale traders in five border markets between Niger, Nigeria and Benin, we are particularly interested in testing whether the most well-connected actors of trade...... on their business, support received from civil servants, politicians, and security authorities translates into economic performance. The paper also shows significant differences between countries, regions and marketplaces. Social connections developed with state representatives have a much greater effect...

Spatially explicit exposure assessment for small streams in catchments of the orchard growing region `Lake Constance

Science.gov (United States)

Golla, B.; Bach, M.; Krumpe, J.

2009-04-01

1. Introduction Small streams differ greatly from the standardised water body used in the context of aquatic risk assessment for the regulation of plant protection products in Germany. The standard water body is static, with a depth of 0.3 m and a width of 1.0 m. No dilution or water replacement takes place. Spray drift happens always in direction to the water body. There is no variability in drift deposition rate (90th percentile spray drift deposition values [2]). There is no spray drift filtering by vegetation. The application takes place directly adjacent to the water body. In order to establish a more realistic risk assessment procedure the Federal Office for Consumer Protection and Food Safety (BVL) and the Federal Environment Agency (UBA) aggreed to replace deterministic assumptions with data distributions and spatially explicit data and introduce probabilistic methods [3, 4, 5]. To consider the spatial and temporal variability in the exposure situations of small streams the hydraulic and morphological characteristics of catchments need to be described as well as the spatial distribution of fields treated with pesticides. As small streams are the dominant type of water body in most German orchard regions, we use the growing region Lake Constance as pilot region. 2. Materials and methods During field surveys we derive basic morphological parameters for small streams in the Lake Constance region. The mean water width/depth ratio is 13 with a mean depth of 0.12 m. The average residence time is 5.6 s/m (n=87) [1]. Orchards are mostly located in the upper parts of the catchments. Based on an authoritative dataset on rivers and streams of Germany (ATKIS DLM25) we constructed a directed network topology for the Lake Constance region. The gradient of the riverbed is calculated for river stretches of > 500 m length. The network for the pilot region consists of 2000 km rivers and streams. 500 km stream length are located within a distance of 150 m to orchards. Within

ORF Alignment: NC_001140 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... AAP1-SMF2 intergenic region ... Length = 227 ... Query: 8 ... LLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEM...DDEKWQATLD 67 ... LLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLD Sbjct: 1 ... ...LLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLD 60 ... Query: 128 PDHPQ

Ecology in Small Aquatic Ecosystems

DEFF Research Database (Denmark)

Andersen, Mikkel René

Small ecosystems are many-fold more abundant than their larger counterparts. Both on regional and global scale small lakes outnumber medium and large lakes and account for a much larger surface area. Small streams are also far more common than rivers. Despite their abundance small ecosystems are ...

The role of prophylactic cranial irradiation in regionally advanced non-small cell lung cancer. A Southwest Oncology Group Study

Energy Technology Data Exchange (ETDEWEB)

Rusch, V.W.; Griffin, B.R.; Livingston, R.B. (Univ. of Washington, Seattle (USA))

1989-10-01

Lung cancer is the most common malignant disease in the United States. Only the few tumors detected very early are curable, but there has been some progress in the management of more advanced non-small cell lung cancer, particularly in regionally inoperable disease. Prevention of central nervous system relapse is an important issue in this group of patients because brain metastases ultimately develop in 20% to 25% of them. Seventy-three patients with regionally advanced non-small cell lung cancer were entered into a Phase II trial of neutron chest radiotherapy sandwiched between four cycles of chemotherapy including cisplatin, vinblastine, and mitomycin C. Prophylactic cranial irradiation was administered concurrently with chest radiotherapy (3000 cGy in 10 fractions in 15 patients; 3600 cGy in 18 fractions in the remaining 50 patients). Patients underwent computed tomographic scan of the brain before treatment and every 3 months after treatment. The initial overall response rate was 79%, but 65 of the 73 patients have subsequently died of recurrent disease. Median follow-up is 9 months for all 73 patients and 26 months for eight long-term survivors. No patient who completed the prophylactic cranial irradiation program had clinical or radiologic brain metastases. Toxic reactions to prophylactic cranial irradiation included reversible alopecia in all patients, progressive dementia in one patient, and possible optic neuritis in one patient. Both of these patients received 300 cGy per fraction of irradiation. The use of prophylactic cranial irradiation has been controversial, but its safety and efficacy in this trial supports its application in a group of patients at high risk for central nervous system relapse. Further evaluation of prophylactic cranial irradiation in clinical trials for regionally advanced non-small cell lung cancer is warranted.

Applicability of Earth Observation for Identifying Small-Scale Mining Footprints in a Wet Tropical Region

Directory of Open Access Journals (Sweden)

Celso M. Isidro

2017-09-01

Full Text Available The unpredictable climate in wet tropical regions along with the spatial resolution limitations of some satellite imageries make detecting and mapping artisanal and small-scale mining (ASM challenging. The objective of this study was to test the utility of Pleiades and SPOT imagery with an object-based support vector machine (OB-SVM classifier for the multi-temporal remote sensing of ASM and other land cover including a large-scale mine in the Didipio catchment in the Philippines. Historical spatial data on location and type of ASM mines were collected from the field and were utilized as training data for the OB-SVM classifier. The classification had an overall accuracy between 87% and 89% for the three different images—Pleiades-1A for the 2013 and 2014 images and SPOT-6 for the 2016 image. The main land use features, particularly the Didipio large-scale mine, were well identified by the OB-SVM classifier, however there were greater commission errors for the mapping of small-scale mines. The lack of consistency in their shape and their small area relative to pixel sizes meant they were often not distinguished from other land clearance types (i.e., open land. To accurately estimate the total area of each land cover class, we calculated bias-adjusted surface areas based on misclassification values. The analysis showed an increase in small-scale mining areas from 91,000 m2—or 0.2% of the total catchment area—in March 2013 to 121,000 m2—or 0.3%—in May 2014, and then a decrease to 39,000 m2—or 0.1%—in January 2016.

Local repeat sequence organization of an intergenic spacer

Indian Academy of Sciences (India)

The amplification yielded the same uniquely ``sequence-scrambled” product, whether the template used for PCR was total cellular DNA, chloroplast DNA or a plasmid clone DNA corresponding to that region. The PCR product, a ``unique” new sequence, had lost the repetitive organization of the template genome where it ...

Enterobacterial repetitive intergenic consensus sequences and the PCR to generate fingerprints of genomic DNAs from Vibrio cholerae O1, O139, and non-O1 strains.

Science.gov (United States)

Rivera, I G; Chowdhury, M A; Huq, A; Jacobs, D; Martins, M T; Colwell, R R

1995-08-01

Enterobacterial repetitive intergenic consensus (ERIC) sequence polymorphism was studied in Vibrio Cholerae strains isolated before and after the cholera epidemic in Brazil (in 1991), along with epidemic strains from Peru, Mexico, and India, by PCR. A total of 17 fingerprint patterns (FPs) were detected in the V. cholerae strains examined; 96.7% of the toxigenic V. cholerae O1 strains and 100% of the O139 serogroup strains were found to belong to the same FP group comprising four fragments (FP1). The nontoxigenic V. cholerae O1 also yielded four fragments but constituted a different FP group (FP2). A total of 15 different patterns were observed among the V. cholerae non-O1 strains. Two patterns were observed most frequently for V. cholerae non-01 strains, 25% of which have FP3, with five fragments, and 16.7% of which have FP4, with two fragments. Three fragments, 1.75, 0.79, and 0.5 kb, were found to be common to both toxigenic and nontoxigenic V. cholerae O1 strains as well as to group FP3, containing V. cholerae non-O1 strains. Two fragments of group FP3, 1.3 and 1.0 kb, were present in FP1 and FP2 respectively. The 0.5-kb fragment was common to all strains and serogroups of V. cholerae analyzed. It is concluded from the results of this study, based on DNA FPs of environmental isolates, that it is possible to detect an emerging virulent strain in a cholera-endemic region. ERIC-PCR constitutes a powerful tool for determination of the virulence potential of V. cholerae O1 strains isolated in surveillance programs and for molecular epidemiological investigations.

A UKIDSS-based search for low-mass stars and small stellar clumps in off-cloud parts of young star-forming regions* **

Directory of Open Access Journals (Sweden)

Barrado y Navascués D.

2011-07-01

Full Text Available The form and universality of the mass function of young and nearby star-forming regions is still under debate. Its relation to the stellar density, its mass peak and the dependency on most recent models shows significant differencies for the various regions and remains unclear up to date. We aim to get a more complete census of two of such regions. We investigate yet unexplored areas of Orion and Taurus-Auriga, observed by the UKIDSS survey. In the latter, we search for low-mass stars via photometric and proper motion criteria and signs for variability. In Orion, we search for small stellar clumps via nearest-neighbor methods. Highlights in Taurus would be the finding of the missing low-mass stars and the detection of a young cluster T dwarf. In Orion, we discovered small stellar associations of its OB1b and OB1c populations. Combined with what is known in literature, we will provide by this investigations a general picture of the results of the star-forming processes in large areas of Taurus and Orion and probe the most recent models.

"Mature Regionalism" and the Genesis of "Functional Projects": "Educational Regionalism" in Small (and Micro-States)

Science.gov (United States)

Jules, Tavis D.

2017-01-01

This article advances that the movement towards "deeper" Caribbean integration has generated a shift from "immature" regionalism to a "mature" form of regionalism. Thus, mature regionalism, a new governance mechanism, in regulating the institutional and legal framework of Caribbean Single Market and Economy is…

Ectoparasites of small ruminants in three selected agro-ecological sites of Tigray Region, Ethiopia.

Science.gov (United States)

Mulugeta, Y; Yacob, Hailu T; Ashenafi, Hagos

2010-08-01

A study on ectoparasites of small ruminants in three selected agro-ecological sites of Tigray Region, Ethiopia disclosed an overall prevalence of 55.5% and 58% in each examined 750 sheep and goats, respectively. In the sheep population, Melophagus ovinus (19.1%), tick infestations (16%), Damalinia ovis (15.3%), Linognathus africanus (11.5%), and Ctenocephalides felis (9%) were the major ectoparasites. The major ectoparasites identified in goats were tick infestations (29.7%), L. africanus (27.9%), Sarcoptes scabiei var. caprae (12.5%), C. felis (11.1%), and Demodex caprae (6.8%). In sheep, there was a statistically significant difference (P ovinus, L. africanus, and ticks between midland and highland. In goats, the risk of Sarcoptes scabiei var. caprae infestation in midland (odds ratio (OR) = 17.2, P < 0.001) and lowland (OR = 5.2, P < 0.001) was 17.2 times and 5.2 times, respectively, higher than the highland. Favorable climatic conditions, backward level of management, poor level of consciousness and awareness of farmers, and weak animal health extension services are believed to have contributed for widespread distribution and occurrences of ectoparasites. The growing threat of ectoparasites to small ruminant production and the tanning industry needs well-coordinated and urgent control intervention.

Assessing the Economic Situation of Small-Scale Farm Forestry in Mountain Regions: A Case Study in Austria

Directory of Open Access Journals (Sweden)

Philipp Toscani

2017-08-01

Full Text Available Austria is one of the few countries with a long tradition of monitoring the economic performance of forest holdings. The national Farm Accountancy Data Network also addresses some forestry-specific issues, given the high significance of farm forestry in this country. However, it is not possible to assess the profitability of small-scale farm forestry in mountainous regions based on a representative sample. In this paper, we demonstrate how information gaps can be overcome by means of economic modeling and present results of this approach for mountain forestry for the first time. In spite of the unfavorable conditions of an alpine setting, forestry tends to be of special significance for the viability and resilience of family farms in these regions. Sustainable forest management that safeguards the ecosystem services provided by forests relies mostly on the profitability of timber production. Thus, the economic development of farm forestry is a key factor in achieving targets 15.1 and 15.4 of the United Nations Sustainable Development Goals in mountain regions.

Intronic microRNAs

International Nuclear Information System (INIS)

Ying, S.-Y.; Lin, S.-L.

2005-01-01

MicroRNAs (miRNAs), small single-stranded regulatory RNAs capable of interfering with intracellular mRNAs that contain partial complementarity, are useful for the design of new therapies against cancer polymorphism and viral mutation. MiRNA was originally discovered in the intergenic regions of the Caenorhabditis elegans genome as native RNA fragments that modulate a wide range of genetic regulatory pathways during animal development. However, neither RNA promoter nor polymerase responsible for miRNA biogenesis was determined. Recent findings of intron-derived miRNA in C. elegans, mouse, and human have inevitably led to an alternative pathway for miRNA biogenesis, which relies on the coupled interaction of Pol-II-mediated pre-mRNA transcription and intron excision, occurring in certain nuclear regions proximal to genomic perichromatin fibrils

Identification of genes for small non-coding RNAs that belong to the regulon of the two-component regulatory system CiaRH in Streptococcus

Directory of Open Access Journals (Sweden)

Hakenbeck Regine

2010-11-01

Full Text Available Abstract Background Post-transcriptional regulation by small RNAs (sRNAs in bacteria is now recognized as a wide-spread regulatory mechanism modulating a variety of physiological responses including virulence. In Streptococcus pneumoniae, an important human pathogen, the first sRNAs to be described were found in the regulon of the CiaRH two-component regulatory system. Five of these sRNAs were detected and designated csRNAs for cia-dependent small RNAs. CiaRH pleiotropically affects β-lactam resistance, autolysis, virulence, and competence development by yet to be defined molecular mechanisms. Since CiaRH is highly conserved among streptococci, it is of interest to determine if csRNAs are also included in the CiaRH regulon in this group of organisms consisting of commensal as well as pathogenic species. Knowledge on the participation of csRNAs in CiaRH-dependent regulatory events will be the key to define the physiological role of this important control system. Results Genes for csRNAs were predicted in streptococcal genomes and data base entries other than S. pneumoniae by searching for CiaR-activated promoters located in intergenic regions that are followed by a transcriptional terminator. 61 different candidate genes were obtained specifying csRNAs ranging in size from 51 to 202 nt. Comparing these genes among each other revealed 40 different csRNA types. All streptococcal genomes harbored csRNA genes, their numbers varying between two and six. To validate these predictions, S. mitis, S. oralis, and S. sanguinis were subjected to csRNA-specific northern blot analysis. In addition, a csRNA gene from S. thermophilus plasmid pST0 introduced into S. pneumoniae was also tested. Each of the csRNAs was detected on these blots and showed the anticipated sizes. Thus, the method applied here is able to predict csRNAs with high precision. Conclusions The results of this study strongly suggest that genes for small non-coding RNAs, csRNAs, are part of

Competitiveness of Small Farms and Innovative Food Supply Chains: The Role of Food Hubs in Creating Sustainable Regional and Local Food Systems

Directory of Open Access Journals (Sweden)

Giaime Berti

2016-07-01

Full Text Available Over the last decades, the economic, social and environmental sustainability of the conventional agri-food system has and continues to be contested within both academic and public institutions. For small farms, the unsustainability of the food system is even more serious; farms’ declining share of profit and the cost-price squeeze of commodity production has increased barriers to market access with the inevitable effect of agricultural abandonment. One way forward to respond to the existing conventional agri-food systems and to create a competitive or survival strategy for small family farms is the re-construction of regional and local agri-food systems, aligning with Kramer and Porter’s concept of shared value strategy. Through a critical literature review, this paper presents “regional and local food hubs” as innovative organizational arrangements capable of bridging structural holes in the agri-food markets between small producers and the consumers—individuals and families as well as big buyers. Food hubs respond to a supply chain (or supply network organizational strategy aiming at re-territorialising the agri-food systems through the construction of what in the economic literature are defined as values-based food supply chains.

Deduced amino acid sequence of the small hydrophobic protein of US avian pneumovirus has greater identity with that of human metapneumovirus than those of non-US avian pneumoviruses.

Science.gov (United States)

Yunus, Abdul S; Govindarajan, Dhanasekaran; Huang, Zhuhui; Samal, Siba K

2003-05-01

We report here the nucleotide and deduced amino acid (aa) sequences of the small hydrophobic (SH) gene of the avian pneumovirus strain Colorado (APV/CO). The SH gene of APV/CO is 628 nucleotides in length from gene-start to gene-end. The longest ORF of the SH gene encoded a protein of 177 aas in length. Comparison of the deduced aa sequence of the SH protein of APV/CO with the corresponding published sequences of other members of genera metapneumovirus showed 28% identity with the newly discovered human metapneumovirus (hMPV), but no discernable identity with the APV subgroup A or B. Collectively, this data supports the hypothesis that: (i) APV/CO is distinct from European APV subgroups and belongs to the novel subgroup APV/C (APV/US); (ii) APV/CO is more closely related to hMPV, a mammalian metapneumovirus, than to either APV subgroup A or B. The SH gene of APV/CO was cloned using a genomic walk strategy which initiated cDNA synthesis from genomic RNA that traversed the genes in the order 3'-M-F-M2-SH-G-5', thus confirming that gene-order of APV/CO conforms in the genus Metapneumovirus. We also provide the sequences of transcription-signals and the M-F, F-M2, M2-SH and SH-G intergenic regions of APV/CO.

Potential Markets for Small Reactors. Annex XI

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-12-15

The electricity cost of a small power generation plant is generally higher than that of a large scale power plant due to economies of scale. In order to survey the market for small nuclear power plants, the competitive object is not a large scale power plant but a small fossil fuel power generation plant. Large scale power generation plants are not required in all countries and regions of the world. There are many regions where the electricity cost is high because of the cost of fuel transport to remote places. Medium or small power generation plants could turn out to also be preferable from the viewpoints of electrical power demand and distribution cost. For example, the electricity costs in many small cities or towns of the Alaskan and Hawaiian Islands are higher than on the mainland. The electricity costs in the two peninsulas (Baja California and Yucatan) in Mexico are high because, owing to the limited power demand in these regions, small and medium sized fossil fuel power generation plants have been installed there, and the costs of fuel, fuel transport and power transmission appear to be relatively high. Owing to such situations, a market for small and medium sized nuclear reactors exists, and there are certain regions and areas in the world where such reactors can compete with the alternatives.

Small-scale structure and chemical differentiation in the central region of the Sagittarius B2 molecular cloud

International Nuclear Information System (INIS)

Goldsmith, P.F.; Snell, R.L.; Hasegawa, T.; Ukita, N.; Nobeyama Radio Observatory, Minamimaki, Japan)

1987-01-01

Fifteen arcsec angular resolution observations of a number of molecular species in the center of the Sgr B2 molecular cloud, including HC3N in the ground and v7 = 1 vibrational states, SO, OCS,l and HNCO, have been performed. Emission from HC3N is fairly uniformly distributed over the region studied; SO and OCS have a spatially extended component but are strongly centrally peaked. HNCO and vibrationally excited HC 3 N emission are essentially restricted to a very small region around the center of activity in the north. The difference between the spatial distributions are attributed to variation in the chemical abundances of the various clumps. The excitation requirements of the vibrationally excited HC 3 N imply the presence of dust and gas at high temperatures. The results further heighten the apparent contradiction presented by the lack of infrared emission from this source. 53 references

[Potentials in the regionalization of health indicators using small-area estimation methods : Exemplary results based on the 2009, 2010 and 2012 GEDA studies].

Science.gov (United States)

Kroll, Lars Eric; Schumann, Maria; Müters, Stephan; Lampert, Thomas

2017-12-01

Nationwide health surveys can be used to estimate regional differences in health. Using traditional estimation techniques, the spatial depth for these estimates is limited due to the constrained sample size. So far - without special refreshment samples - results have only been available for larger populated federal states of Germany. An alternative is regression-based small-area estimation techniques. These models can generate smaller-scale data, but are also subject to greater statistical uncertainties because of the model assumptions. In the present article, exemplary regionalized results based on the studies "Gesundheit in Deutschland aktuell" (GEDA studies) 2009, 2010 and 2012, are compared to the self-rated health status of the respondents. The aim of the article is to analyze the range of regional estimates in order to assess the usefulness of the techniques for health reporting more adequately. The results show that the estimated prevalence is relatively stable when using different samples. Important determinants of the variation of the estimates are the achieved sample size on the district level and the type of the district (cities vs. rural regions). Overall, the present study shows that small-area modeling of prevalence is associated with additional uncertainties compared to conventional estimates, which should be taken into account when interpreting the corresponding findings.

Symptomatic Citrus trees reveal a new pathogenic lineage in Fusarium and two new Neocosmospora species

NARCIS (Netherlands)

Sandoval-Denis, M.; Guarnaccia, V.; Polizzi, G.; Crous, P.W.

2018-01-01

The diversity of fusaria in symptomatic Citrus trees in Greece, Italy and Spain was evaluated using morphological and molecular multi-locus analyses based on fragments of the calmodulin (CAM), intergenic spacer region of the rDNA (IGS), internal transcribed spacer region of the rDNA (ITS), large

Altered phenotypic expression of immunoglobulin heavy-chain variable-region (VH) genes in Alicia rabbits probably reflects a small deletion in the VH genes closest to the joining region.

Science.gov (United States)

Allegrucci, M; Newman, B A; Young-Cooper, G O; Alexander, C B; Meier, D; Kelus, A S; Mage, R G

1990-07-01

Rabbits of the Alicia strain have a mutation (ali) that segregates with the immunoglobulin heavy-chain (lgh) locus and has a cis effect upon the expression of heavy-chain variable-region (VH) genes encoding the a2 allotype. In heterozygous a1/ali or a3/ali rabbits, serum immunoglobulins are almost entirely the products of the normal a1 or a3 allele and only traces of a2 immunoglobulin are detectable. Adult homozygous ali/ali rabbits likewise have normal immunoglobulin levels resulting from increased production of a-negative immunoglobulins and some residual ability to produce the a2 allotype. By contrast, the majority of the immunoglobulins of wild-type a2 rabbits are a2-positive and only a small percentage are a-negative. Genomic DNAs from homozygous mutant and wild-type animals were indistinguishable by Southern analyses using a variety of restriction enzyme digests and lgh probes. However, when digests with infrequently cutting enzymes were analyzed by transverse alternating-field electrophoresis, the ali DNA fragments were 10-15 kilobases smaller than the wild type. These fragments hybridized to probes both for VH and for a region of DNA a few kilobases downstream of the VH genes nearest the joining region. We suggest that this relatively small deletion affects a segment containing 3' VH genes with important regulatory functions, the loss of which leads to the ali phenotype. These results, and the fact that the 3' VH genes rearrange early in B-cell development, indicate that the 3' end of the VH locus probably plays a key role in regulation of VH gene expression.

Giardia survey in live-trapped small domestic and wild mammals in four regions in the southwest region of the State of São Paulo, Brazil

Directory of Open Access Journals (Sweden)

Maria Inês L. Sogayar

1995-12-01

Full Text Available For the first time, a survey on Giardia in the live-trapped small domestic and wild mammals was perfomed in four regions of state of the São Paulo, Brazil, with special attention to the parasitism of Rattus rattus rattus by Giardia. This species was found infected in all studied sites: Botucatu (15.4%, Conchas (28.5%, Itaporanga (38.7% and São Roque (100 %. Two new hosts and their frequency of infection were described for Giardia in Nectomys squamipes, an aquatic rodent and in Bolomys lasiurus, a forest rodent (100 % and 14.3 %, respectively. Both G. muris and G. duodenalis groups were found in scrapings of intestinal mucosa of those rodents. Mixed infection was observed in some animals. It is important to emphasize the infection by G. duodenalis in the black rat as this species lives as a comensal with man and in N. squamipes as it may contaminate small streams used for domestic consumption. Therefore, further investigation will be necessary to elucidate the potential of these rodents to act as reservoirs of Giardia for man.

Drift motions of small-scale irregularities in the high-latitude F region: An experimental comparison with plasma drift motions

International Nuclear Information System (INIS)

Ruohoniemi, J.M.; Greenwald, R.A.; Baker, K.B.; Villain, J.P.; McCready, M.A.

1987-01-01

On the evening of January 6, 1986, coordinated observations were carried out with the Johns Hopkins University Applied Physics Laboratory HF coherent scatter radar at Goose Bay, Labrador, and the SRI International incoherent scatter radar at Sondre Stromfjord, Greenland. The common field of view comprised a section of high-latitude F region ionosphere centered on the great circle plane between the radar sites. Over a 40-min period, the HF radar observed strong backscatter from small-scale (13.9 m) field-aligned irregularities. The bulk line-of-sight drift velocity of the irregularities is deduced from the backscatter data. The returns collected simultaneously with the incoherent scatter radar are processed for estimates of the mean line-of-sight ion velocity. Approximately 100 distinct comparisons are possible between the two sets of velocity estimates. Reversals exceeding 1,000 m/s are present in both. In this paper, the authors demonstrate a correspondence between the measured irregularity and ion drifts that is consistent with the supposition that the motion of the irregularities is dominated by convective drift of the ambient plasma. This indicates that the small-scale irregularities detected by HF radars in the high-latitude F region can serve as tracers of ionospheric convective drift

FACTORS CRISIS OF SMALL BUSINESS DEVELOPMENT

Directory of Open Access Journals (Sweden)

A. I. Khorev

2015-01-01

Full Text Available Today it became clear that Russia needs not only economic growth, but also economic growth of a certain quality. Re¬gions are not an exception, since they are the most vulnerable to changes in market conditions resource exports. The main economic indicators for larger regions of the country should become entrepreneurs. The main economic indicators for larger regions of the country should become entrepreneurs. Not accidentally retrospective analysis of the evolutionary development of small business shows that the most important role in the economic development of Europe and America have played and continue to play a small business. Results of activity of small businesses are generally positive; the country saw an increase in the main indicators: the number of small enterprises, the average number of employees in small enterprises, turnover of small businesses and investments in fixed assets. The statistics of recent years show a decline of interest in the business population. Number of small businesses created in the last few years there has been a downward trend, while the proportion of surviving for three years after their registration is low. The greatest negative impact on the business affairs of the factors of regulatory and administrative regulation of small business, corruption and bribery of officials and the activities of control and inspection bodies. Addressing these challenges will require proper coordination of regional and local resources in building infrastructure, forming investment mechanisms to support small enterprises, the development of the entrepreneurial potential of the population.

Brain regions involved in subprocesses of small-space episodic object-location memory: a systematic review of lesion and functional neuroimaging studies.

Science.gov (United States)

Zimmermann, Kathrin; Eschen, Anne

2017-04-01

Object-location memory (OLM) enables us to keep track of the locations of objects in our environment. The neurocognitive model of OLM (Postma, A., Kessels, R. P. C., & Van Asselen, M. (2004). The neuropsychology of object-location memory. In G. L. Allen (Ed.), Human spatial memory: Remembering where (pp. 143-160). Mahwah, NJ: Lawrence Erlbaum, Postma, A., Kessels, R. P. C., & Van Asselen, M. (2008). How the brain remembers and forgets where things are: The neurocognition of object-location memory. Neuroscience & Biobehavioral Reviews, 32, 1339-1345. doi: 10.1016/j.neubiorev.2008.05.001 ) proposes that distinct brain regions are specialised for different subprocesses of OLM (object processing, location processing, and object-location binding; categorical and coordinate OLM; egocentric and allocentric OLM). It was based mainly on findings from lesion studies. However, recent episodic memory studies point to a contribution of additional or different brain regions to object and location processing within episodic OLM. To evaluate and update the neurocognitive model of OLM, we therefore conducted a systematic literature search for lesion as well as functional neuroimaging studies contrasting small-space episodic OLM with object memory or location memory. We identified 10 relevant lesion studies and 8 relevant functional neuroimaging studies. We could confirm some of the proposals of the neurocognitive model of OLM, but also differing hypotheses from episodic memory research, about which brain regions are involved in the different subprocesses of small-space episodic OLM. In addition, we were able to identify new brain regions as well as important research gaps.

Regional Determinants of Efficiency Growth of Small and Medium-Sized Enterprises. Evidence from Poland

Directory of Open Access Journals (Sweden)

Teresa Łuczka

2012-01-01

Full Text Available SMEs sector plays a vital role in modern economies. Therefore, the interest in its functioning among economists is in fact quite natural. This article is a part of a current research on regional factors contributing to the development of enterprises in this category. The first section examines earlier studies in this field conducted globally and in Poland. According to them, many elements enable the SME’s development. It is not surprisingly that the specified set of pro-growth factors does not exists. Next section describes the results of the author’s own studies in the fields. These studies relate to regional factors contributing to the efficiency growth of micro, small and medium-sized enterprises in Poland. Data used in the study was collected from GUS[1] and EUROSTAT and encompassed 16 provinces for the years 2003-2008. The model prepared included 11 independent variables on labor force, social mobility, living standard and R&D policy. The authors would have gladly considered more than 11 explanatory variable, but the inaccessibility of such data made it impossible. In the next step, using GRETL software, equations of regression were defined. On this basis it was concluded that the most important factors contributing to efficiency growth of SMEs are the amount of spending on R&D and the level of wages.

An Unusual Case of White Piedra Due to Trichosporon inkin Mimicking Trichobacteriosis.

Science.gov (United States)

Zhuang, Kaiwen; Ran, Xin; Dai, Yaling; Tang, Jiaoqing; Yang, Qin; Pradhan, Sushmita; Ran, Yuping

2016-12-01

White piedra is a superficial mycosis characterized by soft, white-to-tan, irregular nodules attached to the hair shafts. A 36-year-old man presented with small lumps in his pubic hair, without any other symptoms. The clinical features were suggestive of trichobacteriosis. Pathology analysis of the infected hair revealed that the concretions surrounding the hair shaft were full of fungal elements, parts of which had invaded into the cuticle. Culture on Sabouraud dextrose agar grew creamy, yellow-white colonies identified as Trichosporon inkin by the sequence of the nuclear ribosomal intergenic spacer region. The condition was treated by shaving the pubic hair and administering antifungal therapy (oral itraconazole and topical ketoconazole).

Regional employment growth, shocks and regional industrial resilience

DEFF Research Database (Denmark)

Holm, Jacob Rubæk; Østergaard, Christian Richter

2013-01-01

The resilience of regional industries to economic shocks has gained a lot of attention in evolutionary economic geography recently. This paper uses a novel quantitative approach to investigate the regional industrial resilience of the Danish ICT sector to the shock following the burst of the dot......-com bubble. It is shown that regions characterised by small and young ICT service companies were more adaptable and grew more than others, while diversity and urbanisation increased the sensitivity to the business cycle after the shock. Different types of resilient regions are found: adaptively resilient......, rigidly resilient, entrepreneurially resilient and non-resilient regions....

Transcriptional analysis of the jamaicamide gene cluster from the marine cyanobacterium Lyngbya majuscula and identification of possible regulatory proteins

Directory of Open Access Journals (Sweden)

Dorrestein Pieter C

2009-12-01

Full Text Available Abstract Background The marine cyanobacterium Lyngbya majuscula is a prolific producer of bioactive secondary metabolites. Although biosynthetic gene clusters encoding several of these compounds have been identified, little is known about how these clusters of genes are transcribed or regulated, and techniques targeting genetic manipulation in Lyngbya strains have not yet been developed. We conducted transcriptional analyses of the jamaicamide gene cluster from a Jamaican strain of Lyngbya majuscula, and isolated proteins that could be involved in jamaicamide regulation. Results An unusually long untranslated leader region of approximately 840 bp is located between the jamaicamide transcription start site (TSS and gene cluster start codon. All of the intergenic regions between the pathway ORFs were transcribed into RNA in RT-PCR experiments; however, a promoter prediction program indicated the possible presence of promoters in multiple intergenic regions. Because the functionality of these promoters could not be verified in vivo, we used a reporter gene assay in E. coli to show that several of these intergenic regions, as well as the primary promoter preceding the TSS, are capable of driving β-galactosidase production. A protein pulldown assay was also used to isolate proteins that may regulate the jamaicamide pathway. Pulldown experiments using the intergenic region upstream of jamA as a DNA probe isolated two proteins that were identified by LC-MS/MS. By BLAST analysis, one of these had close sequence identity to a regulatory protein in another cyanobacterial species. Protein comparisons suggest a possible correlation between secondary metabolism regulation and light dependent complementary chromatic adaptation. Electromobility shift assays were used to evaluate binding of the recombinant proteins to the jamaicamide promoter region. Conclusion Insights into natural product regulation in cyanobacteria are of significant value to drug discovery

DIRECTIONS OF THE SMALL-SCALE ENTERPRISES FINANCIAL STABILITY GROTH IN THE REGION

Directory of Open Access Journals (Sweden)

A.Y. Makarova

2008-12-01

Full Text Available Directions of the small-scale business financial stability increase, focused on its economic power strengthening, are offered. They are connected with development of the external factors of financial stability and the internal factors including orientation of the small enterprises in strategic management on the company's value growth. Applicability of a balanced scorecard which fully reflects interrelation of small enterprises’ both financial and non-financial indicators of work to maintenance those small enterprises’ growth of cost and their embedding into the system of the economic power of state and large business is proved.

Trends for Innovation Business Development in Lviv Region

OpenAIRE

Tetyana Skrypko

2014-01-01

The Articles highlights trends of small business innovation development at a regional level. Small business innovation structure has been analyzed for Lviv region; interactive procedures have been researched referring to cooperation between the parties interested in its development. The amount of innovation-active small businesses and the number of innovations introduced in Lviv region have been mentioned by innovation trends and types of economic activity. Up-to-date trends in Lviv region co...

Maternal obesity programs increased leptin gene expression in rat male offspring via epigenetic modifications in a depot-specific manner

Directory of Open Access Journals (Sweden)

Simon Lecoutre

2017-08-01

Conclusions: Consistent with the DOHaD hypothesis, persistent epigenetic remodeling occurs at regulatory regions especially within intergenic sequences, linked to higher leptin gene expression in adult HF offspring in a depot-specific manner.

World Small Hydropower Development Report

Energy Technology Data Exchange (ETDEWEB)

Liu, Heng; Esser, Lara [ICSGP (China); Masera, Diego [UNIDO, Vienna (Austria)

2013-07-01

Currently, small hydropower plants with a capacity of 10 MW, exist in 148 countries or territories worldwide. Four other countries have been identified with resource potential. This report aims to identify the development status and resource potential of small hydro in various countries, territories and regions throughout the world. Working with experts at the ground level to compile and share existing information, experiences and challenges, one comprehensive report was created. Decision-makers, stakeholders and potential investors clearly need this comprehensive information to more effectively promote small hydropower as a renewable and rural energy source for sustainable development and to overcome the existing development barriers. The findings of this report show that small hydropower potential globally is approximated at almost 173 GW. The figure is arrived by totaling data from a wide range of sources with potential compromise of data integrity to varying degrees. For example, research data on economically feasible potential were more readily available in developed countries than those in the least developed or developing countries. More than half of the world's known hydropower potential is located in Asia, around one third can be found in Europe and the Americas. It is possible in the future that more small hydropower potential might be identified both on the African and American continents. The installed small hydropower capacity (up to 10 MW) is estimated to be 75 GW in 2011/2012. The report provides detailed data for each country/region, including recommendations on the national, regional and international level.

World Small Hydropower Development Report

Energy Technology Data Exchange (ETDEWEB)

Liu, Heng; Esser, Lara (ICSGP (China)); Masera, Diego (UNIDO, Vienna (Austria))

2013-07-01

Currently, small hydropower plants with a capacity of 10 MW, exist in 148 countries or territories worldwide. Four other countries have been identified with resource potential. This report aims to identify the development status and resource potential of small hydro in various countries, territories and regions throughout the world. Working with experts at the ground level to compile and share existing information, experiences and challenges, one comprehensive report was created. Decision-makers, stakeholders and potential investors clearly need this comprehensive information to more effectively promote small hydropower as a renewable and rural energy source for sustainable development and to overcome the existing development barriers. The findings of this report show that small hydropower potential globally is approximated at almost 173 GW. The figure is arrived by totaling data from a wide range of sources with potential compromise of data integrity to varying degrees. For example, research data on economically feasible potential were more readily available in developed countries than those in the least developed or developing countries. More than half of the world's known hydropower potential is located in Asia, around one third can be found in Europe and the Americas. It is possible in the future that more small hydropower potential might be identified both on the African and American continents. The installed small hydropower capacity (up to 10 MW) is estimated to be 75 GW in 2011/2012. The report provides detailed data for each country/region, including recommendations on the national, regional and international level.

Five Complete Chloroplast Genome Sequences from Diospyros: Genome Organization and Comparative Analysis.

Science.gov (United States)

Fu, Jianmin; Liu, Huimin; Hu, Jingjing; Liang, Yuqin; Liang, Jinjun; Wuyun, Tana; Tan, Xiaofeng

2016-01-01

Diospyros is the largest genus in Ebenaceae, comprising more than 500 species with remarkable economic value, especially Diospyros kaki Thunb., which has traditionally been an important food resource in China, Korea, and Japan. Complete chloroplast (cp) genomes from D. kaki, D. lotus L., D. oleifera Cheng., D. glaucifolia Metc., and Diospyros 'Jinzaoshi' were sequenced using Illumina sequencing technology. This is the first cp genome reported in Ebenaceae. The cp genome sequences of Diospyros ranged from 157,300 to 157,784 bp in length, presenting a typical quadripartite structure with two inverted repeats each separated by one large and one small single-copy region. For each cp genome, 134 genes were annotated, including 80 protein-coding, 31 tRNA, and 4 rRNA unique genes. In all, 179 repeats and 283 single sequence repeats were identified. Four hypervariable regions, namely, intergenic region of trnQ_rps16, trnV_ndhC, and psbD_trnT, and intron of ndhA, were identified in the Diospyros genomes. Phylogenetic analyses based on the whole cp genome, protein-coding, and intergenic and intron sequences indicated that D. oleifera is closely related to D. kaki and could be used as a model plant for future research on D. kaki; to our knowledge, this is proposed for the first time. Further, these analyses together with two large deletions (301 and 140 bp) in the cp genome of D. 'Jinzaoshi', support its placement as a new species in Diospyros. Both maximum parsimony and likelihood analyses for 19 taxa indicated the basal position of Ericales in asterids and suggested that Ebenaceae is monophyletic in Ericales.

Five Complete Chloroplast Genome Sequences from Diospyros: Genome Organization and Comparative Analysis.

Directory of Open Access Journals (Sweden)

Jianmin Fu

Full Text Available Diospyros is the largest genus in Ebenaceae, comprising more than 500 species with remarkable economic value, especially Diospyros kaki Thunb., which has traditionally been an important food resource in China, Korea, and Japan. Complete chloroplast (cp genomes from D. kaki, D. lotus L., D. oleifera Cheng., D. glaucifolia Metc., and Diospyros 'Jinzaoshi' were sequenced using Illumina sequencing technology. This is the first cp genome reported in Ebenaceae. The cp genome sequences of Diospyros ranged from 157,300 to 157,784 bp in length, presenting a typical quadripartite structure with two inverted repeats each separated by one large and one small single-copy region. For each cp genome, 134 genes were annotated, including 80 protein-coding, 31 tRNA, and 4 rRNA unique genes. In all, 179 repeats and 283 single sequence repeats were identified. Four hypervariable regions, namely, intergenic region of trnQ_rps16, trnV_ndhC, and psbD_trnT, and intron of ndhA, were identified in the Diospyros genomes. Phylogenetic analyses based on the whole cp genome, protein-coding, and intergenic and intron sequences indicated that D. oleifera is closely related to D. kaki and could be used as a model plant for future research on D. kaki; to our knowledge, this is proposed for the first time. Further, these analyses together with two large deletions (301 and 140 bp in the cp genome of D. 'Jinzaoshi', support its placement as a new species in Diospyros. Both maximum parsimony and likelihood analyses for 19 taxa indicated the basal position of Ericales in asterids and suggested that Ebenaceae is monophyletic in Ericales.

Regional Employment Growth, Shocks and Regional Industrial Resilience

DEFF Research Database (Denmark)

Holm, J.R.; Østergaard, Christian Richter

2015-01-01

The resilience of regional industries to economic shocks has gained a lot of attention in evolutionary economic geography recently. This paper uses a novel quantitative approach to investigate the regional industrial resilience of the Danish information and communication technology (ICT) sector...... to the shock following the burst of the dot.com bubble. It is shown that regions characterized by small and young ICT service companies were more adaptable and grew more than others, while diversity and urbanization increased the sensitivity to the business cycle after the shock. Different types of resilient...... regions are found: adaptively resilient, rigidly resilient, entrepreneurially resilient and non-resilient regions....

Regional Analysis of Aids and Prices for Small-scale Grid-connected Solar Photovoltaic Systems in Spain; Analisis Regional de Precios y Ayudas para Sistemas fotovoltaicos de Pequena Escala Conectados a Red Electrica en Espana

Energy Technology Data Exchange (ETDEWEB)

Varela, M; Ramirez, L; Mora, L; Sidrach de Cardona, M

2002-07-01

Electricity production from small solar photovoltaic systems in Spain obtains a premium pnce of 0,36 Euros/kWh over the electricity market price or a fix price of 0.40 Euros/kWh. The development of these small systems, in Spain clearly demonstrates that the established prime is not sufficient in the majority of locations. On the other hand, the prime revision set up by the RD 2818/98. considering the profitability of the renewable installations, demand a regional analysis of small PV systems profitability necessary in Spain. The accomplished results permit to conclude that the amount of the current prime is by itself insufficient to make profitable the small grid-connected PV systems in anywhere of the national geography. To guarantee the profitability of these systems is should be necessary to place the fix price at around 0,93 Euros/k Wh. However, if the duplication of the current price obtained by these installations was considered, this could ensure the profitability of these small systems in at least the 77% of the land. (Author) 12 refs.

Differentiation between Aspergillus flavus and Aspergillus parasiticus from Pure Culture and Aflatoxin-Contaminated Grapes Using PCR-RFLP Analysis of aflR-aflJ Intergenic Spacer

International Nuclear Information System (INIS)

El Khoury, A.; Atoui, A.; Lebrihi, A.; Rizk, T.; Lteif, R.; Kallassy, M.

2011-01-01

Aflatoxins (AFs) represent the most important single mycotoxin-related food safety problem in developed and developing countries as they have adverse effects on human and animal health. They are produced mainly by Aspergillus flavus and A. parasiticus. Both species have different aflatoxinogenic profile. In order to distinguish between A. flavus and A. parasiticus, gene-specific primers were designed to target the intergenic spacer (IGS) for the AF biosynthesis genes, aflJ and aflR. Polymerase chain reaction (PCR) products were subjected to restriction endonuclease analysis using BglII to look for restriction fragment length polymorphisms (RFLPs). Our result showed that both species displayed different PCR-based RFLP (PCR-RFLP) profile. PCR products from A. flavus cleaved into 3 fragments of 362, 210, and 102 bp. However, there is only one restriction site for this enzyme in the sequence of A. parasiticus that produced only 2 fragments of 363 and 311 bp. The method was successfully applied to contaminated grapes samples. This approach of differentiating these 2 species would be simpler, less costly, and quicker than conventional sequencing of PCR products and/or morphological identification. (author)

A ribosomal RNA gene intergenic spacer based PCR and DGGE fingerprinting method for the analysis of specific rhizobial communities in soil.

Science.gov (United States)

de Oliveira, Valéria Maia; Manfio, Gilson Paulo; da Costa Coutinho, Heitor Luiz; Keijzer-Wolters, Anneke Christina; van Elsas, Jan Dirk

2006-03-01

A direct molecular method for assessing the diversity of specific populations of rhizobia in soil, based on nested PCR amplification of 16S-23S ribosomal RNA gene (rDNA) intergenic spacer (IGS) sequences, was developed. Initial generic amplification of bacterial rDNA IGS sequences from soil DNA was followed by specific amplification of (1) sequences affiliated with Rhizobium leguminosarum "sensu lato" and (2) R. tropici. Using analysis of the amplified sequences in clone libraries obtained on the basis of soil DNA, this two-sided method was shown to be very specific for rhizobial subpopulations in soil. It was then further validated as a direct fingerprinting tool of the target rhizobia based on denaturing gradient gel electrophoresis (DGGE). The PCR-DGGE approach was applied to soils from fields in Brazil cultivated with common bean (Phaseolus vulgaris) under conventional or no-tillage practices. The community fingerprints obtained allowed the direct analysis of the respective rhizobial community structures in soil samples from the two contrasting agricultural practices. Data obtained with both primer sets revealed clustering of the community structures of the target rhizobial types along treatment. Moreover, the DGGE profiles obtained with the R. tropici primer set indicated that the abundance and diversity of these organisms were favoured under NT practices. These results suggest that the R. leguminosarum-as well as R. tropici-targeted IGS-based nested PCR and DGGE are useful tools for monitoring the effect of agricultural practices on these and related rhizobial subpopulations in soils.

Genome-wide identification and functional prediction of nitrogen-responsive intergenic and intronic long non-coding RNAs in maize (Zea mays L.).

Science.gov (United States)

Lv, Yuanda; Liang, Zhikai; Ge, Min; Qi, Weicong; Zhang, Tifu; Lin, Feng; Peng, Zhaohua; Zhao, Han

2016-05-11

Nitrogen (N) is an essential and often limiting nutrient to plant growth and development. Previous studies have shown that the mRNA expressions of numerous genes are regulated by nitrogen supplies; however, little is known about the expressed non-coding elements, for example long non-coding RNAs (lncRNAs) that control the response of maize (Zea mays L.) to nitrogen. LncRNAs are a class of non-coding RNAs larger than 200 bp, which have emerged as key regulators in gene expression. In this study, we surveyed the intergenic/intronic lncRNAs in maize B73 leaves at the V7 stage under conditions of N-deficiency and N-sufficiency using ribosomal RNA depletion and ultra-deep total RNA sequencing approaches. By integration with mRNA expression profiles and physiological evaluations, 7245 lncRNAs and 637 nitrogen-responsive lncRNAs were identified that exhibited unique expression patterns. Co-expression network analysis showed that the nitrogen-responsive lncRNAs were enriched mainly in one of the three co-expressed modules. The genes in the enriched module are mainly involved in NADH dehydrogenase activity, oxidative phosphorylation and the nitrogen compounds metabolic process. We identified a large number of lncRNAs in maize and illustrated their potential regulatory roles in response to N stress. The results lay the foundation for further in-depth understanding of the molecular mechanisms of lncRNAs' role in response to nitrogen stresses.

Genetic identification and symbiotic efficiency of Sinorhizobium ...

African Journals Online (AJOL)

STORAGESEVER

2008-08-18

Aug 18, 2008 ... numerical analysis (diversity data base for DNA v2.1.1) of gel data (Figure .... strains nodulating small senegalese legumes by 16S-23S rRNA intergenic gene ... 169-174. Gao J, Terefework Z, Chen W-X, Lindstrom K (2001).

A speeded-up saliency region-based contrast detection method for small targets

Science.gov (United States)

Li, Zhengjie; Zhang, Haiying; Bai, Jiaojiao; Zhou, Zhongjun; Zheng, Huihuang

2018-04-01

To cope with the rapid development of the real applications for infrared small targets, the researchers have tried their best to pursue more robust detection methods. At present, the contrast measure-based method has become a promising research branch. Following the framework, in this paper, a speeded-up contrast measure scheme is proposed based on the saliency detection and density clustering. First, the saliency region is segmented by saliency detection method, and then, the Multi-scale contrast calculation is carried out on it instead of traversing the whole image. Second, the target with a certain "integrity" property in spatial is exploited to distinguish the target from the isolated noises by density clustering. Finally, the targets are detected by a self-adaptation threshold. Compared with time-consuming MPCM (Multiscale Patch Contrast Map), the time cost of the speeded-up version is within a few seconds. Additional, due to the use of "clustering segmentation", the false alarm caused by heavy noises can be restrained to a lower level. The experiments show that our method has a satisfied FASR (False alarm suppression ratio) and real-time performance compared with the state-of-art algorithms no matter in cloudy sky or sea-sky background.

Region of interest based robust watermarking scheme for adaptation in small displays

Science.gov (United States)

Vivekanandhan, Sapthagirivasan; K. B., Kishore Mohan; Vemula, Krishna Manohar

2010-02-01

Now-a-days Multimedia data can be easily replicated and the copyright is not legally protected. Cryptography does not allow the use of digital data in its original form and once the data is decrypted, it is no longer protected. Here we have proposed a new double protected digital image watermarking algorithm, which can embed the watermark image blocks into the adjacent regions of the host image itself based on their blocks similarity coefficient which is robust to various noise effects like Poisson noise, Gaussian noise, Random noise and thereby provide double security from various noises and hackers. As instrumentation application requires a much accurate data, the watermark image which is to be extracted back from the watermarked image must be immune to various noise effects. Our results provide better extracted image compared to the present/existing techniques and in addition we have done resizing the same for various displays. Adaptive resizing for various size displays is being experimented wherein we crop the required information in a frame, zoom it for a large display or resize for a small display using a threshold value and in either cases background is not given much importance but it is only the fore-sight object which gains importance which will surely be helpful in performing surgeries.

Lots of Small Stars Born in Starburst Region

Science.gov (United States)

1999-10-01

Decisive Study of NGC 3603 with the VLT and ISAAC An international group of astronomers [1] has used the ESO Very Large Telescope (VLT) at Paranal (Chile) to perform unique observations of an interstellar nebula in which stars are currently being born. Thanks to the excellent imaging properties of the first of the four 8.2-m VLT Unit Telescopes, ANTU, they were able to demonstrate, for the first time, the presence of large numbers of small and relatively light, new-born stars in NGC 3603, a well-known "starburst" region in the Milky Way Galaxy . Until now, it has only been possible to observe brighter and much heavier stars in such nebulae. The new observations show that stars of all masses are being born together in the same starburst event, a fundamental result for our understanding of the very complex process of star formation. Background of the project The present research programme was granted observing time with VLT ANTU in April 1999. Its general aim is to investigate collective, massive star formation, in particular the coalescence of high- and low-mass stars in the violent environments of starburst regions . These are areas in which the processes that lead to the birth of new stars are particularly active just now. Several fundamental questions arise in this context. A very basic one is whether low-mass stars form at all in such environments. And if so, do they form together with the most massive stars in a starburst event or do they form at different times, before or after or perhaps on different timescales? Are low-mass stars born with any "preferred" mass that may possibly give further clues to the ongoing processes? All of this is most important in order to understand the detailed mechanisms of star formation. Most current theoretical scenarios explain how single stars form in an isolated, contracting gas cloud, but most stars in the Universe did not form in that simple way. Once some massive stars have formed in some place and start to shine, they

Role of an ER stress response element in regulating the bidirectional promoter of the mouse CRELD2 - ALG12 gene pair

Directory of Open Access Journals (Sweden)

Hirata Yoko

2010-11-01

Full Text Available Abstract Background Recently, we identified cysteine-rich with EGF-like domains 2 (CRELD2 as a novel endoplasmic reticulum (ER stress-inducible gene and characterized its transcriptional regulation by ATF6 under ER stress conditions. Interestingly, the CRELD2 and asparagine-linked glycosylation 12 homolog (ALG12 genes are arranged as a bidirectional (head-to-head gene pair and are separated by less than 400 bp. In this study, we characterized the transcriptional regulation of the mouse CRELD2 and ALG12 genes that is mediated by a common bidirectional promoter. Results This short intergenic region contains an ER stress response element (ERSE sequence and is well conserved among the human, rat and mouse genomes. Microarray analysis revealed that CRELD2 and ALG12 mRNAs were induced in Neuro2a cells by treatment with thapsigargin (Tg, an ER stress inducer, in a time-dependent manner. Other ER stress inducers, tunicamycin and brefeldin A, also increased the expression of these two mRNAs in Neuro2a cells. We then tested for the possible involvement of the ERSE motif and other regulatory sites of the intergenic region in the transcriptional regulation of the mouse CRELD2 and ALG12 genes by using variants of the bidirectional reporter construct. With regards to the promoter activities of the CRELD2-ALG12 gene pair, the entire intergenic region hardly responded to Tg, whereas the CRELD2 promoter constructs of the proximal region containing the ERSE motif showed a marked responsiveness to Tg. The same ERSE motif of ALG12 gene in the opposite direction was less responsive to Tg. The direction and the distance of this motif from each transcriptional start site, however, has no impact on the responsiveness of either gene to Tg treatment. Additionally, we found three putative sequences in the intergenic region that antagonize the ERSE-mediated transcriptional activation. Conclusions These results show that the mouse CRELD2 and ALG12 genes are arranged as a

Long Intergenic Noncoding RNAs Mediate the Human Chondrocyte Inflammatory Response and Are Differentially Expressed in Osteoarthritis Cartilage.

Science.gov (United States)

Pearson, Mark J; Philp, Ashleigh M; Heward, James A; Roux, Benoit T; Walsh, David A; Davis, Edward T; Lindsay, Mark A; Jones, Simon W

2016-04-01

To identify long noncoding RNAs (lncRNAs), including long intergenic noncoding RNAs (lincRNAs), antisense RNAs, and pseudogenes, associated with the inflammatory response in human primary osteoarthritis (OA) chondrocytes and to explore their expression and function in OA. OA cartilage was obtained from patients with hip or knee OA following joint replacement surgery. Non-OA cartilage was obtained from postmortem donors and patients with fracture of the neck of the femur. Primary OA chondrocytes were isolated by collagenase digestion. LncRNA expression analysis was performed by RNA sequencing (RNAseq) and quantitative reverse transcriptase-polymerase chain reaction. Modulation of lncRNA chondrocyte expression was achieved using LNA longRNA GapmeRs (Exiqon). Cytokine production was measured with Luminex. RNAseq identified 983 lncRNAs in primary human hip OA chondrocytes, 183 of which had not previously been identified. Following interleukin-1β (IL-1β) stimulation, we identified 125 lincRNAs that were differentially expressed. The lincRNA p50-associated cyclooxygenase 2-extragenic RNA (PACER) and 2 novel chondrocyte inflammation-associated lincRNAs (CILinc01 and CILinc02) were differentially expressed in both knee and hip OA cartilage compared to non-OA cartilage. In primary OA chondrocytes, these lincRNAs were rapidly and transiently induced in response to multiple proinflammatory cytokines. Knockdown of CILinc01 and CILinc02 expression in human chondrocytes significantly enhanced the IL-1-stimulated secretion of proinflammatory cytokines. The inflammatory response in human OA chondrocytes is associated with widespread changes in the profile of lncRNAs, including PACER, CILinc01, and CILinc02. Differential expression of CILinc01 and CIinc02 in hip and knee OA cartilage, and their role in modulating cytokine production during the chondrocyte inflammatory response, suggest that they may play an important role in mediating inflammation-driven cartilage degeneration in

Small hydro plant- present scenario and future prospects

International Nuclear Information System (INIS)

Purohit, D.P.

1996-01-01

The article, deals with the methodology of power generation by small hydro power resources, especially in the Himalayan and sub Himalayan regions and the benefits it will bestow to the inhabitants of this region. The development of small hydro power projects in the Himalayas and sub Himalayas would serve as a model for environment- friendly sources of energy to benefit small communities world wide. The use of water turbine generators for the generation of cheaper power is also discussed. 4 refs

Interior region-of-interest reconstruction using a small, nearly piecewise constant subregion

International Nuclear Information System (INIS)

Taguchi, Katsuyuki; Xu Jingyan; Srivastava, Somesh; Tsui, Benjamin M. W.; Cammin, Jochen; Tang Qiulin

2011-01-01

Purpose: To develop a method to reconstruct an interior region-of-interest (ROI) image with sufficient accuracy that uses differentiated backprojection (DBP) projection onto convex sets (POCS) [H. Kudo et al., ''Tiny a priori knowledge solves the interior problem in computed tomography'', Phys. Med. Biol. 53, 2207-2231 (2008)] and a tiny knowledge that there exists a nearly piecewise constant subregion. Methods: The proposed method first employs filtered backprojection to reconstruct an image on which a tiny region P with a small variation in the pixel values is identified inside the ROI. Total variation minimization [H. Yu and G. Wang, ''Compressed sensing based interior tomography'', Phys. Med. Biol. 54, 2791-2805 (2009); W. Han et al., ''A general total variation minimization theorem for compressed sensing based interior tomography'', Int. J. Biomed. Imaging 2009, Article 125871 (2009)] is then employed to obtain pixel values in the subregion P, which serve as a priori knowledge in the next step. Finally, DBP-POCS is performed to reconstruct f(x,y) inside the ROI. Clinical data and the reconstructed image obtained by an x-ray computed tomography system (SOMATOM Definition; Siemens Healthcare) were used to validate the proposed method. The detector covers an object with a diameter of ∼500 mm. The projection data were truncated either moderately to limit the detector coverage to diameter 350 mm of the object or severely to cover diameter 199 mm. Images were reconstructed using the proposed method. Results: The proposed method provided ROI images with correct pixel values in all areas except near the edge of the ROI. The coefficient of variation, i.e., the root mean square error divided by the mean pixel values, was less than 2.0% or 4.5% with the moderate or severe truncation cases, respectively, except near the boundary of the ROI. Conclusions: The proposed method allows for reconstructing interior ROI images with sufficient accuracy with a tiny knowledge that

CHARACTERIZATION OF SMALL AND MEDIUM ENTERPRISES (SMES OF POMERANIAN REGION IN SIX SIGMA METHODOLOGY APPLICATION

Directory of Open Access Journals (Sweden)

2011-12-01

Full Text Available Background: Six Sigma is related to product’s characteristics and parameters of actions, needed to obtain these products. On the other hand, it is a multi-step, cyclic process aimed at the improvements leading to global standard, closed to the perfection. There is a growing interest in Six Sigma methodology among smaller organizations but there are still too little publications presented such events in the sector of small and medium enterprises, especially based on good empirical results. It was already noticed at the phase of the preliminary researches, that only small part of companies from this sector in Pomerian region use elements of this methodology. Methods: The companies were divided into groups by the type of their activities as well as the employment size. The questionnaires were sent to 150 randomly selected organizations in two steps and were addressed to senior managers. The questionnaire contained the questions about basic information about a company, the level of the knowledge and the practical application of Six Sigma methodology, opinions about improvements of processes occurring in the company, opinions about trainings in Six Sigma methodology. Results: The following hypotheses were proposed, statistically verified and received the answer: The lack of the adequate knowledge of Six Sigma methodology in SMEs limits the possibility to effectively monitor and improve processes - accepted. The use of statistical tools of Six Sigma methodology requires the broad action to popularize this knowledge among national SMEs - accepted. The level of the awareness of the importance as well as practical use of Six Sigma methodology in manufacturing SMEs is higher than in SMEs providing services - rejected, the level is equal. The level of the knowledge and the use of Six Sigma methodology in medium manufacturing companies is significantly higher than in small manufacturing companies - accepted. The level of the knowledge and the application

Bacterial 16S rRNA gene analysis revealed that bacteria related to Arcobacter spp. constitute an abundant and common component of the oyster microbiota (Tiostrea chilensis).

Science.gov (United States)

Romero, J; García-Varela, M; Laclette, J P; Espejo, R T

2002-11-01

To explore the bacterial microbiota in Chilean oyster (Tiostrea chilensis), a molecular approach that permits detection of different bacteria, independently of their capacity to grow in culture media, was used. Bacterial diversity was assessed by analysis of both the 16S rDNA and the 16S-23S intergenic region, obtained by PCR amplifications of DNA extracted from depurated oysters. RFLP of the PCR amplified 16S rDNA showed a prevailing pattern in most of the individuals analyzed, indicating that a few bacterial species were relatively abundant and common in oysters. Cloning and sequencing of the 16S rDNA with the prevailing RFLP pattern indicated that this rRNA was most closely related to Arcobacter spp. However, analysis by the size of the amplified 16S-23S rRNA intergenic regions revealed not Arcobacter spp. but Staphylococcus spp. related bacteria as a major and common component in oyster. These different results may be caused by the absence of target for one of the primers employed for amplification of the intergenic region. Neither of the two bacteria species found in large abundance was recovered after culturing under aerobic, anaerobic, or microaerophilic conditions. This result, however, is expected because the number of bacteria recovered after cultivation was less than 0.01% of the total. All together, these observations suggest that Arcobacter-related strains are probably abundant and common in the Chilean oyster bacterial microbiota.

Heavy metals in the small rivers of Ternopil region under different types of anthropogenic pressure

Directory of Open Access Journals (Sweden)

O. Prokopchuk

2016-03-01

Full Text Available The dynamic of content and peculiarities of migration of heavy metals in small rivers of Ternopil region were analyzed (Zn, Mn, Fe, Co, Ni, Pb. It was determined that cobalt does not exceed maximum permissible levels, whereas the content of other metals exceed these levels at rates from 2 to 42 times the emission limit set by the fishing industry. The waters of Ternopil region are the richest in the compounds of iron and manganese by virtue of the lithological content of the researched water basins. The excess in Mn and Fe concentration in river water is caused by occurrence of these elements in abiotic components of river valleys, particularly in areas with iron and manganese, alluvial deposits, clay soils with ferrous metal compounds and leaching of elements from rock, soil and forest litter. As our research showed, increased metal content in water basins is caused by natural factors (river running through areas with ore and where leaching of ore occurs it, reaction of interstitial water, metals appearing in ground water run-off, anthropogenic (waste waters of industrial plants, agricultural outwash, fuel combustion and hydrochemical factors of the hydroecosystem itself (consumption and releasing of metals by hydrobionts, aquatic habitat pH, metals coming in from ground sediments, metals released from complexes with organic compounds, methylation of non-organic metal compounds. A comparative analysis of the pollution levels of Ternopil region water basins by heavy metals was completed. It was determined that the river most heavily contaminated by the content of nutrients and non-biogenic HM is the Zolota Lypa and the cleanest is the River Strypa, which allows us to recommend the use of water composition as a reference indicator in assessing the ecological state of the region’s surface waters.

1 SHORT COMMUNICATION Resting behaviour of Anopheles ...

African Journals Online (AJOL)

2011-10-04

Oct 4, 2011 ... Resting behaviour of Anopheles gambiae s.l. and its implication on malaria .... nature) were requested to sleep under the double mosquito net trap (one ... designed from the DNA sequences of the intergenic spacer region of ...

A negative regulation loop of long noncoding RNA HOTAIR and p53 in non-small-cell lung cancer

Directory of Open Access Journals (Sweden)

Zhai N

2016-09-01

Full Text Available Nailiang Zhai,1 Yongfu Xia,1 Rui Yin,2 Jinping Liu,3 Fuquan Gao1 1Department of Respiratory Medicine, Affiliated Hospital of Binzhou Medical University, 2Department of Respiratory Medicine, People’s Hospital of Binzhou City, 3Department of Pharmacology, Binzhou Medical University, Binzhou, Shandong, People’s Republic of China Abstract: Non-small-cell lung cancer (NSCLC is one of the leading causes of cancer-related death worldwide, and the 5-year survival rate is still low despite advances in diagnosis and therapeutics. A long noncoding RNA (lncRNA HOX antisense intergenic RNA (HOTAIR has been revealed to play important roles in NSCLC carcinogenesis but the detailed mechanisms are still unclear. In the current study, we aimed to investigate the regulation between the lncRNA HOTAIR and p53 in the NSCLC patient samples and cell lines. Our results showed that HOTAIR expression was significantly higher in the cancer tissues than that in the adjacent normal tissue, and was negatively correlated with p53 functionality rather than expression. When p53 was overexpressed in A549 cells, the lncRNA HOTAIR expression was downregulated, and the cell proliferation rate and cell invasion capacity decreased as a consequence. We identified two binding sites of p53 on the promoter region of HOTAIR, where the p53 protein would bind to and suppress the HOTAIR mRNA transcription. Inversely, overexpression of lncRNA HOTAIR inhibited the expression of p53 in A549 cells. Mechanistic studies revealed that HOTAIR modified the promoter of p53 and enhanced histone H3 lysine 27 trimethylation (H3K27me3. These studies identified a specific negative regulation loop of lncRNA HOTAIR and p53 in NSCLC cells, which revealed a new understanding of tumorigenesis in p53 dysfunction NSCLC cells. Keywords: NSCLC, LncRNA HOTAIR, p53, negative loop

PHOSPHORUS CONTAMINATION AS A BARRIER TO WATER QUALITY OF SMALL RETENTION RESERVOIRS IN PODLASIE REGION

Directory of Open Access Journals (Sweden)

Joanna Ewa Szczykowska

2016-06-01

Full Text Available Dam retention reservoirs created on the rivers play a special role as an environmentally friendly forms of stopping and slowing of water runoff. The aim of this study was to evaluate the quality of water flowing into small retention reservoirs in terms of the concentration of total phosphorus and phosphates. The study involved three small retention reservoirs located in the municipalities of: Bransk, Dubicze Cerkiewne and Kleszczele in Podlasie region. Selection of the research facilities was made due to the similarity in the soil management type within catchment of the flowing watercourse, retained water utilization ways, and a small surface of reservoirs. Watercourse reaching the reservoir provides biogens along with water, which directly affect the water quality resulting in high concentrations in water, either indirectly by initiating or accelerating the process of degradation of the reservoir and the loss of its usability. Given the concentration of total phosphorus, it can be said that only in the case of 20.8% of water samples from Nurzec river feeding the Otapy-Kiersnówek reservoir, about 25% of water samples of Orlanka river feeding Bachmaty reservoir, and 17% of samples taken from the watercourse supplying Repczyce reservoir, corresponded to values specified for the second class in the current Regulation of the Minister of the Environment [Regulation 2014]. It can be assumed that this situation is caused by a long-term fertilization using manure, which in consequence led to the oversaturation of soils and phosphorus compounds penetration into the river waters in areas used for agricultural purposes. Especially in the early spring periods, rising temperature together with rainfall caused soil thawing resulting in increasing concentrations of contaminants carried along with the washed soil particles during the surface and subsurface runoff. Values of TSI(TP calculated for Otapy-Kiersnówek reservoir amounted to 112.4 in hydrological

Soil water content, runoff and soil loss prediction in a small ungauged agricultural basin in the Mediterranean region using the Soil and Water Assessment Tool

OpenAIRE

Ramos Martín, Ma. C. (Ma. Concepción); Martínez Casasnovas, José Antonio

2015-01-01

The aim of the present work was to evaluate the possibilities of using sub-basin data for calibration of the Soil and Water Assessment Tool (SWAT) model in a small (46 ha) ungauged basin (i.e. where the water flow is not systematically measured) and its response. This small basin was located in the viticultural Anoia-Penedès region (North-east Spain), which suffers severe soil erosion. The data sources were: daily weather data from an observatory located close to the basin; a detailed soil ma...

Antigenic evidence of bluetongue virus from small ruminant population of two different geographical regions of Odisha, India

Directory of Open Access Journals (Sweden)

Shaswati Subhadarsini Pany

2016-03-01

Full Text Available Aim: The aim of the present study was to carry out antigenic detection of bluetongue virus (BTV among the small ruminant population of two different geographical regions of Odisha (coastal and central using recombinant VP7 (r-VP-7 based sandwich enzyme-linked immunosorbent assay (s-ELISA. Materials and Methods: Blood samples (n=274 were collected from two different geographical pockets of Odisha, which covered mostly the coastal and central regions. Of the total samples under study 185 were from goat and 89 were from sheep. The blood samples were tested for the presence of BTV antigen by r-VP7 based s-ELISA. Results: r-VP-7 s-ELISA detected BTV antigen in 52.43% and 44.94% of the goat and sheep population under study, respectively. This study highlights the antigenic persistence of BTV in the state for the 1st time. Conclusion: This high antigenic presence in both sheep and goat population suggests an alarming BTV infection in field conditions which warrants more systematic study directed toward isolation and characterization studies as well as the implementation of control strategy for BT in Odisha.

Productivity of Stored Water in Some Selected Multiple Use Small Reservoirs in the Upper East Region of Ghana

Science.gov (United States)

Annor, F. O.; Yamoah-Antwi, D.; Odai, S. N.; Adjei, K. A.; van de Giesen, N. C.

2009-04-01

The Upper East Region (UER) of Ghana is a water stressed area with agriculture as the main occupation of the inhabitants. The importance of small reservoirs for the sustenance of the livelihood of the people in this part of the country during the dry season cannot be over emphasized. Most of these small reservoirs were constructed, in the 1960s, mainly with the aim of providing water for domestic use and livestock watering during the dry periods of the year. Over the years, however, these small reservoirs have been put to a variety of uses, some of which accelerate the depletion of the stored water. The reservoirs are therefore most times, unable to serve the purposes for which they were constructed. To address this situation, a study was conducted to determine the productivity of stored water in small reservoirs to better inform policy makers and water managers in the allocation of water especially in the dry season. Water productivity can be thought of as the output (product) that can be obtained per unit volume of water used or applied for either crop or livestock production. Data on crops and livestock were obtained through questionnaire administration, interviews, focus group discussions, physical measurements as well as field observations from nine reservoirs in the UER. The research findings show that donkeys have the highest productivity of about US90 followed by cattle with US70. These high productivity values are as a result of the variety of products and services rendered by donkeys and cattle. For crop, tomatoes have the highest productivity value compared with pepper and leafy vegetables. Despite the fact that donkeys had the highest productivity and hence priority over all uses, it is prudent to note that, inhabitants of the study area aside the sale of livestock for money (income) keep livestock for prestige. Therefore in the allocation of stored water in small multiple use reservoirs, the allocation criteria should consider the views, values and

The Role of Small Towns in Local Place Making

Directory of Open Access Journals (Sweden)

Csurgó Bernadett

2016-12-01

Full Text Available Self-promotion and reinterpretation of local identity is becoming increasingly important in rural communities. Local identity building is succeeded very differently by rural municipalities and regions. The paper analyses the role of small towns in local identity creation. There are varying interpretations of places in Hungary as ways of achieving meaningful territorialisation. Small towns based on their leading and central position within the micro regions can dominate the place-making processes. Using the example of six Hungarian rural micro-regions we analyse how rural small towns position themselves by local image building. The aim of this paper is to investigate interactions between territorial position and innovative capacity of rural towns through the analysis of symbolisation process and image building. We purpose to introduce a concept of a place oriented approach and demonstrate its usefulness for analysis of rural innovation and place-based development. The case-studies are based on qualitative methods: document-analysis, semi-structured interviews, transect walking and participatory observation. The paper analyses the process of local community and identity building in six rural micro-regions. We seek to understand how small towns position themselves in place-making, the aim of ‘placing’ themselves in the territorial hierarchy of the settlements of micro region. Our results suggest that small towns play very different roles in local image building. Characteristics and territorial scope of local cultural heritage significantly determine the innovative capacity of small towns in local image building where there is a wide range of meanings procedures and processes of place-making.

Small Intestinal Infections.

Science.gov (United States)

Munot, Khushboo; Kotler, Donald P

2016-06-01

Small intestinal infections are extremely common worldwide. They may be bacterial, viral, or parasitic in etiology. Most are foodborne or waterborne, with specific etiologies differing by region and with diverse pathophysiologies. Very young, very old, and immune-deficient individuals are the most vulnerable to morbidity or mortality from small intestinal infections. There have been significant advances in diagnostic sophistication with the development and early application of molecular diagnostic assays, though these tests have not become mainstream. The lack of rapid diagnoses combined with the self-limited nature of small intestinal infections has hampered the development of specific and effective treatments other than oral rehydration. Antibiotics are not indicated in the absence of an etiologic diagnosis, and not at all in the case of some infections.

How Resummation Depresses the Gluon at Small x

CERN Document Server

Forte, Stefano; Ball, Richard D.; Forte, Stefano; Altarelli, Guido; Ball, Richard D.

2006-01-01

We summarize recent progress in the resummation of perturbative evolution at small x. We show that the problem of incorporating BFKL small x logs in GLAP evolution is now completely solved, and that the main effect of small x resummation is to reduce the growth of the gluon at small x in the HERA and LHC regions.

Acute esophagitis for patients with local-regional advanced non small cell lung cancer treated with concurrent chemoradiotherapy

DEFF Research Database (Denmark)

Pan, Yi; Brink, Carsten; Knap, Marianne

2016-01-01

PURPOSE: Esophagitis is common in patients treated with definitive radiotherapy for local-regional advanced non small cell lung cancer (NSCLC). The purpose of this study was to estimate the dose-effect relationship using clinical and dosimetric parameters in patients receiving intensity modulated...... significantly associated with esophagitis. The two models using the relative esophagus volume irradiated above 40Gy (V40, OR=2.18/10% volume) or the length of esophagus irradiated above 40Gy (L40, OR=4.03/5cm) were optimal. The upper part of esophagus was more sensitive and females experienced more toxicity...... than men. CONCLUSION: V40 and L40 were most effective dosimetric predictors of grade ⩾2 esophagitis. The upper part of esophagus was more sensitive....

Border region studies

DEFF Research Database (Denmark)

Makkonen, Teemu; Williams, Allan

2016-01-01

The contemporary conditions of academic capitalism exert pressures on researchers to avoid ‘peripheral’ journals and ‘unfashionable’ topics. Here an attempt is made to shed light onto the structure of one such ‘offbeat’ field, namely ‘border region studies’, by discussing its geographical...... distribution, key themes, significance and impact. The review suggests that border region studies can be considered a significant and important ‘branch’ of regional studies, which accounts for a small but increasing proportion of regional studies research particularly in Europe and North America. Four main...

Nucleon structure function at small χ

International Nuclear Information System (INIS)

Levin, E.M.

1991-09-01

This is a status report on the behaviour of deeply inelastic scattering in the low x region, where a new physics to be expected. It is bound to be theoretical review, since there is no data available at truely small values of x, say x -3 . New data from HERA are anticipated and I am viewing on this talk as summary of the theoretical situation in the region of small x, as is just before this new area of physics will be studied experimentally. This is an extended version of the talk which was presented at EP-HEP 91 Conference. (orig.)

Development and Validation of an Improved PCR Method Using the 23S-5S Intergenic Spacer for Detection of Rickettsiae in Dermacentor variabilis Ticks and Tissue Samples from Humans and Laboratory Animals.

Science.gov (United States)

Kakumanu, Madhavi L; Ponnusamy, Loganathan; Sutton, Haley T; Meshnick, Steven R; Nicholson, William L; Apperson, Charles S

2016-04-01

A novel nested PCR assay was developed to detectRickettsiaspp. in ticks and tissue samples from humans and laboratory animals. Primers were designed for the nested run to amplify a variable region of the 23S-5S intergenic spacer (IGS) ofRickettsiaspp. The newly designed primers were evaluated using genomic DNA from 11Rickettsiaspecies belonging to the spotted fever, typhus, and ancestral groups and, in parallel, compared to otherRickettsia-specific PCR targets (ompA,gltA, and the 17-kDa protein gene). The new 23S-5S IGS nested PCR assay amplified all 11Rickettsiaspp., but the assays employing other PCR targets did not. The novel nested assay was sensitive enough to detect one copy of a cloned 23S-5S IGS fragment from "CandidatusRickettsia amblyommii." Subsequently, the detection efficiency of the 23S-5S IGS nested assay was compared to those of the other three assays using genomic DNA extracted from 40 adultDermacentor variabilisticks. The nested 23S-5S IGS assay detectedRickettsiaDNA in 45% of the ticks, while the amplification rates of the other three assays ranged between 5 and 20%. The novel PCR assay was validated using clinical samples from humans and laboratory animals that were known to be infected with pathogenic species ofRickettsia The nested 23S-5S IGS PCR assay was coupled with reverse line blot hybridization with species-specific probes for high-throughput detection and simultaneous identification of the species ofRickettsiain the ticks. "CandidatusRickettsia amblyommii,"R. montanensis,R. felis, andR. belliiwere frequently identified species, along with some potentially novelRickettsiastrains that were closely related toR. belliiandR. conorii. Copyright © 2016 Kakumanu et al.

Development and Validation of an Improved PCR Method Using the 23S-5S Intergenic Spacer for Detection of Rickettsiae in Dermacentor variabilis Ticks and Tissue Samples from Humans and Laboratory Animals

Science.gov (United States)

Kakumanu, Madhavi L.; Ponnusamy, Loganathan; Sutton, Haley T.; Meshnick, Steven R.; Nicholson, William L.

2016-01-01

A novel nested PCR assay was developed to detect Rickettsia spp. in ticks and tissue samples from humans and laboratory animals. Primers were designed for the nested run to amplify a variable region of the 23S-5S intergenic spacer (IGS) of Rickettsia spp. The newly designed primers were evaluated using genomic DNA from 11 Rickettsia species belonging to the spotted fever, typhus, and ancestral groups and, in parallel, compared to other Rickettsia-specific PCR targets (ompA, gltA, and the 17-kDa protein gene). The new 23S-5S IGS nested PCR assay amplified all 11 Rickettsia spp., but the assays employing other PCR targets did not. The novel nested assay was sensitive enough to detect one copy of a cloned 23S-5S IGS fragment from “Candidatus Rickettsia amblyommii.” Subsequently, the detection efficiency of the 23S-5S IGS nested assay was compared to those of the other three assays using genomic DNA extracted from 40 adult Dermacentor variabilis ticks. The nested 23S-5S IGS assay detected Rickettsia DNA in 45% of the ticks, while the amplification rates of the other three assays ranged between 5 and 20%. The novel PCR assay was validated using clinical samples from humans and laboratory animals that were known to be infected with pathogenic species of Rickettsia. The nested 23S-5S IGS PCR assay was coupled with reverse line blot hybridization with species-specific probes for high-throughput detection and simultaneous identification of the species of Rickettsia in the ticks. “Candidatus Rickettsia amblyommii,” R. montanensis, R. felis, and R. bellii were frequently identified species, along with some potentially novel Rickettsia strains that were closely related to R. bellii and R. conorii. PMID:26818674

Development of a compound energy system for cold region houses using small-scale natural gas cogeneration and a gas hydrate battery

International Nuclear Information System (INIS)

Obara, Shin'ya; Kikuchi, Yoshinobu; Ishikawa, Kyosuke; Kawai, Masahito; Yoshiaki, Kashiwaya

2015-01-01

In this study, an independent energy system for houses in cold regions was developed using a small-scale natural gas CGS (cogeneration), air-source heat pump, heat storage tank, and GHB (gas hydrate battery). Heat sources for the GHB were the ambient air and geothermal resources of the cold region. The heat cycle of CO 2 hydrate as a source of energy was also experimentally investigated. To increase the formation speed of CO 2 hydrates, a ferrous oxide–graphite system catalyst was used. The ambient air of cold regions was used as a heat source for the formation process (electric charge) of the GHB, and the heat supplied by a geothermal heat exchanger was used for the dissociation process (electric discharge). Using a geothermal heat source, fuel consumption was halved because of an increased capacity for hydrate formation in the GHB, a shortening of the charging and discharging cycle, and a decrease in the freeze rate of hydrate formation space. Furthermore, when the GHB was introduced into a cold region house, the application rate of renewable energy was 47–71% in winter. The spread of the GHB can greatly reduce fossil fuel consumption and the associated greenhouse gases released from houses in cold regions. - Highlights: • Compound energy system for cold region houses by a gas hydrate battery was proposed. • Heat sources of a gas hydrate battery are exhaust heat of the CGS and geothermal. • Drastic reduction of the fossil fuel consumption in a cold region is realized

Analysis of world experience in constructing underground small nuclear power plants and assessment of its potential use in the Russian Arctic regions

Directory of Open Access Journals (Sweden)

Smirnov Yu. G.

2016-03-01

Full Text Available The paper considers the common ideology and main idea of locating underground nuclear plants. Specific examples in domestic and foreign experience have been analyzed. It has been established that underground small nuclear power plants can be used as an alternative source of electric and thermal energy for solving defense-strategic and social-economic tasks particularly when developing mineral raw material resources in the Russian Arctic regions

A molecular diagnostic for tropical race 4 of the banana

NARCIS (Netherlands)

Dita Rodriguez, M.A.; Waalwijk, C.; Buddenhagen, I.W.; Souza, M.T.; Kema, G.H.J.

2010-01-01

This study analysed genomic variation of the translation elongation factor 1 (TEF-1) and the intergenic spacer region (IGS) of the nuclear ribosomal operon of Fusarium oxysporum f. sp. cubense (Foc) isolates, from different banana production areas, representing strains within the known races,

Bacteriophage Resistance Mechanisms in the Fish Pathogen Flavobacterium psychrophilum: Linking Genomic Mutations to Changes in Bacterial Virulence Factors

DEFF Research Database (Denmark)

Castillo, Daniel; Christiansen, Rói Hammershaimb; Dalsgaard, Inger

2015-01-01

-resistant strains had all obtained unique insertions and/or deletions and point mutations distributed among intergenic and genic regions. Mutations in genes related to cell surface properties, gliding motility, and biosynthesis of lipopolysaccharides and cell wall were found. The observed links between phage...

Non-coding genomic regions possessing enhancer and silencer potential are associated with healthy aging and exceptional survival.

Science.gov (United States)

Kim, Sangkyu; Welsh, David A; Myers, Leann; Cherry, Katie E; Wyckoff, Jennifer; Jazwinski, S Michal

2015-02-28

We have completed a genome-wide linkage scan for healthy aging using data collected from a family study, followed by fine-mapping by association in a separate population, the first such attempt reported. The family cohort consisted of parents of age 90 or above and their children ranging in age from 50 to 80. As a quantitative measure of healthy aging, we used a frailty index, called FI34, based on 34 health and function variables. The linkage scan found a single significant linkage peak on chromosome 12. Using an independent cohort of unrelated nonagenarians, we carried out a fine-scale association mapping of the region suggestive of linkage and identified three sites associated with healthy aging. These healthy-aging sites (HASs) are located in intergenic regions at 12q13-14. HAS-1 has been previously associated with multiple diseases, and an enhancer was recently mapped and experimentally validated within the site. HAS-2 is a previously uncharacterized site possessing genomic features suggestive of enhancer activity. HAS-3 contains features associated with Polycomb repression. The HASs also contain variants associated with exceptional longevity, based on a separate analysis. Our results provide insight into functional genomic networks involving non-coding regulatory elements that are involved in healthy aging and longevity.

Regional Innovation Clusters

Data.gov (United States)

Small Business Administration — The Regional Innovation Clusters serve a diverse group of sectors and geographies. Three of the initial pilot clusters, termed Advanced Defense Technology clusters,...

Radiation Treatment for Malignant Small Cell Tumor of the Thoracopulmonary Region Primitive Pluripotent Histogenesis and Differential Diagnosis-A Case Report and Review of Literatures-

International Nuclear Information System (INIS)

Oh, Won Young; Yang, Jin Yeong; Whang, In Soon

1991-01-01

Malignant small round cell tumor (SRCT) of the thoracopulmonary region appears to originate in the soft tissues of the chest wall or the peripheral lung. A differential diagnosis of poorly differentiated small round cell tumors which include Ewing's sarcoma of bone and soft tissue, embryonal rhabdomyosarcoma, Askin tumor, neuroblastoma, peripheral neuroectodermal tumor, small cell osteogenic sarcoma and lymphoma are after difficult by light microscopy alone. In recent, by the extensive studies electron microscopic examination, histochemical study, immunochemical study, cytogenetics and gene analysis, these tumors may be derived from the primitive and pluripotential cells, differentiating into mesenchymal, epithelial and neural features in variable proportions. Treatment for SRCT of thoracopulmonary regin is not determined because of massive involvement of the lung, pleura or soft tissues of the chest wall resulted in a dismal outcome despite aggressive surgery, irradiation and chemotherapy

Technical-economic study of the implementation of small pellet units in the Provence-Alpes-Cote d'Azur region. Phases 1 and 2: Frame-working of the regional sector, explanation of possible fabrication processes

International Nuclear Information System (INIS)

2007-09-01

A first part of this report proposes an analysis of the existing supply, demand and competition for the wood pellet production sector. More precisely, it proposes a brief analysis of the European pellet market and of its operation, a study of the individual PACA market (pellet market, actors, market price and evolutions in the region), and a competitive analysis. The second part reports the study of mobilisable resources. It proposes a resource analysis (potential resource identification, analysis of the regional wood sector production, other resource usages, mobilisable resources), a market and resource synthesis, an overview of possible processes (with or without drying), and a discussion of criteria to be taken into account. The third part reports a technical-economic study for the implementation of small wood pellet production units in the region. It addresses the different possible processes, compares them in terms of social and environmental assessments, and in terms of global feasibility. It also proposes a decision-making tool which comprises criteria to be taken into account and elements of thought related to regional policy

Small hydropower in Southern Africa – an overview of five countries in the region

NARCIS (Netherlands)

Jonker Klunne, Wim

2013-01-01

This paper looks at the status of small hydropower in Lesotho, Mozambique, South Africa, Swaziland and Zimbabwe. For each country, an overview will be given of the electricity sector and the role of hydropower, the potential for small hydropower and the expected future of this technology. Small

Estimation of extreme risk regions under multivariate regular variation

NARCIS (Netherlands)

Cai, J.; Einmahl, J.H.J.; de Haan, L.F.M.

2011-01-01

When considering d possibly dependent random variables, one is often interested in extreme risk regions, with very small probability p. We consider risk regions of the form {z ∈ Rd : f (z) ≤ β}, where f is the joint density and β a small number. Estimation of such an extreme risk region is difficult

Investigation of Temperature Dynamics in Small and Shallow Reservoirs, Case Study: Lake Binaba, Upper East Region of Ghana

Directory of Open Access Journals (Sweden)

Ali Abbasi

2016-03-01

Full Text Available An unsteady fully three-dimensional model of Lake Binaba (a shallow small reservoir in semi-arid Upper East Region of Ghana has been developed to simulate its temperature dynamics. The model developed is built on the Reynolds Averaged Navier–Stokes (RANS equations, utilizing the Boussinesq approach. As the results of the model are significantly affected by the physical conditions on the boundaries, allocating appropriate boundary conditions, particularly over a water surface, is essential in simulating the lake’s thermal structure. The thermal effects of incoming short-wave radiation implemented as a heat source term in the temperature equation, while the heat fluxes at the free water surface, which depend on wind speed, air temperature, and atmospheric stability conditions are considered as temperature boundary condition. The model equations were solved using OpenFOAM CFD toolbox. As the flow is completely turbulent, which is affected by the complex boundary conditions, a new heat transfer solver and turbulence model were developed to investigate the spatial and temporal distribution of temperature in small and shallow inland water bodies using improved time-dependent boundary conditions. The computed temperature values were compared with four days of observed field data. Simulated and observed temperature profiles show reasonable agreement where the root mean square error (RMSE over the simulation period ranges from 0.11 to 0.44 °C in temporal temperature profiles with an average value of 0.33 °C. Results indicate that the model is able to simulate the flow variables and the temperature distribution in small inland water bodies with complex bathymetry.

Transcriptional Profiling of the Oral Pathogen Streptococcus mutans in Response to Competence Signaling Peptide XIP.

Science.gov (United States)

Wenderska, Iwona B; Latos, Andrew; Pruitt, Benjamin; Palmer, Sara; Spatafora, Grace; Senadheera, Dilani B; Cvitkovitch, Dennis G

2017-01-01

In the cariogenic Streptococcus mutans , competence development is regulated by the ComRS signaling system comprised of the ComR regulator and the ComS prepeptide to the competence signaling peptide XIP (ComX-inducing peptide). Aside from competence development, XIP signaling has been demonstrated to regulate cell lysis, and recently, the expression of bacteriocins, small antimicrobial peptides used by bacteria to inhibit closely related species. Our study further explores the effect of XIP signaling on the S. mutans transcriptome. RNA sequencing revealed that XIP induction resulted in a global change in gene expression that was consistent with a stress response. An increase in several membrane-bound regulators, including HdrRM and BrsRM, involved in bacteriocin production, and the VicRKX system, involved in acid tolerance and biofilm formation, was observed. Furthermore, global changes in gene expression corresponded to changes observed during the stringent response to amino acid starvation. Effects were also observed on genes involved in sugar transport and carbon catabolite repression and included the levQRST and levDEFG operons. Finally, our work identified a novel heat shock-responsive intergenic region, encoding a small RNA, with a potential role in competence shutoff. IMPORTANCE Genetic competence provides bacteria with an opportunity to increase genetic diversity or acquire novel traits conferring a survival advantage. In the cariogenic pathogen Streptococcus mutans , DNA transformation is regulated by the competence stimulating peptide XIP (ComX-inducing peptide). The present study utilizes high-throughput RNA sequencing (RNAseq) to provide a greater understanding of how global gene expression patterns change in response to XIP. Overall, our work demonstrates that in S. mutans , XIP signaling induces a response that resembles the stringent response to amino acid starvation. We further identify a novel heat shock-responsive intergenic region with a

Program Management Approach to the Territorial Development of Small Business

Directory of Open Access Journals (Sweden)

Natalia Aleksandrovna Knysh

2016-06-01

Full Text Available This article presents the results of the research of the application on a state level of the program management approach to the territorial development of small business. Studying the main mechanism of the state policy implementation in the sphere of small business on a regional level, the authors have revealed the necessity to take into account the territorial specificity while the government programs of small business development are being formed. The analysis of the national practice of utilizing the program management mechanism in the regional system of the government support of small entrepreneurship was conducted on the example of Omsk region. The results of the analysis have shown the inefficiency of the current support system for small business and have determined the need to create an integrated model of territorial programming, which would not only contribute to the qualitative development of small business, but also provide the functioning efficiency of program management mechanism. As a result, the authors have created the two-level model of the programming of the territorial development of small business, which allows to satisfy purposefully the needs of entrepreneurship taking into account the specificity of the internal and external environment of the region. The first level of the model is methodological one and it is based on the marketing approach (the concepts of place marketing and relationship marketing to the operation of the program management mechanism. The second level of the model is methodical one. It offers the combination of the flexible methods of management of programming procedure (benchmarking, foresight, crowdsourcing and outsourcing. The given model raises the efficiency of the management decisions of the state structures in the sphere of small business. Therefore, it is interesting for the government authorities, which are responsible for the regional and municipal support programs of small business, as well

Evolution of the leukotoxin promoter in genus Mannheimia

DEFF Research Database (Denmark)

Larsen, Jesper; Pedersen, Anders Gorm; Davies, Robert L

2009-01-01

of the leukotoxin promoter among representatives of the five species within genus Mannheimia. We also consider how the evolution of the leukotoxin operon fits with the evolution and maintenance of virulence. Results: The alignment of the intergenic regions upstream of the leukotoxin genes showed significant...

Uncovering layers of human RNA polymerase II transcription

DEFF Research Database (Denmark)

Jensen, Torben Heick

In recent years DNA microarray and high-throughput sequencing technologies have challenged the “gene-centric” view that pre-mRNA is the only RNA species transcribed off protein-coding genes. Instead unorthodox transcription from within genic- and intergenic regions has been demonstrated to occur...

Transcriptome analysis reveals regional and temporal differences in mucosal immune system development in the small intestine of neonatal calves.

Science.gov (United States)

Liang, Guanxiang; Malmuthuge, Nilusha; Bao, Hua; Stothard, Paul; Griebel, Philip J; Guan, Le Luo

2016-08-11

Postnatal development of the mammalian mucosal immune system is crucial for responding to the rapid colonization by commensal bacteria and possible exposure to pathogens. This study analyzed expression patterns for mRNAs and their relationship with microRNAs (miRNAs) in the bovine small intestine during the critical neonatal period (0 to 42 days). This analysis revealed molecular mechanisms regulating the postnatal development of the intestinal mucosal immune system. Small intestine samples (jejunum and ileum) were collected from newborn male, Holstein calves immediately post-partum (n = 3) and at 7 (n = 5), 21 (n = 5), and 42 (n = 5) days of age and the transcriptomes were profiled using RNA-Seq. When analyzing all time points collectively, greater expression of genes encoding the complement functional pathway, as well as lower expression of genes encoding Toll-like receptors and NOD-like receptors were observed in the jejunum when compared to the ileum. In addition, significant changes in the expression of immune-related genes were detected within the first week post-partum in both jejunum and ileum. For example, increased expression of genes encoding tight junction proteins (claudin 1, claudin 4 and occludin), an antimicrobial peptide (Regenerating Islet-Derived 3-γ), NOD-like receptors (NACHT, LRR and PYD domain-containing protein 3), regulatory T cell marker (forkhead box P3), and both anti-inflammatory (interleukin 10) and pro-inflammatory (interleukin 8) cytokines was observed throughout the small intestine of 7-day-old calves when compared to newborn calves. Moreover, the expression of mucosal immune-related genes were either positively or negatively correlated with total bacterial population depending on both intestinal region and age. The integrated analysis of miRNAs and mRNAs supported the conclusion that miRNAs may regulate temporal changes in the expression of genes encoding tight junction proteins (miR-335), cytokines (miR-335) and

Impacts of Small-Scale Industrialized Swine Farming on Local Soil, Water and Crop Qualities in a Hilly Red Soil Region of Subtropical China.

Science.gov (United States)

Zhang, Di; Wang, Xingxiang; Zhou, Zhigao

2017-12-06

Industrialized small-scale pig farming has been rapidly developed in developing regions such as China and Southeast Asia, but the environmental problems accompanying pig farming have not been fully recognized. This study investigated 168 small-scale pig farms and 29 example pig farms in Yujiang County of China to examine current and potential impacts of pig wastes on soil, water and crop qualities in the hilly red soil region, China. The results indicated that the small-scale pig farms produced considerable annual yields of wastes, with medians of 216, 333 and 773 ton yr -1 per pig farm for manure, urine and washing wastewater, respectively, which has had significant impact on surface water quality. Taking NH₄⁺-N, total nitrogen (TN) or total phosphorus (TP) as a criterion to judge water quality, the proportions of Class III and below Class III waters in the local surface waters were 66.2%, 78.7% and 72.5%. The well water (shallow groundwater) quality near these pig farms met the water quality standards by a wide margin. The annual output of pollutants from pig farms was the most important factor correlated with the nutrients and heavy metals in soils, and the relationship can be described by a linear equation. The impact on croplands was marked by the excessive accumulation of available phosphorus and heavy metals such as Cu and Zn. For crop safety, the over-limit ratio of Zn in vegetable samples reached 60%, other heavy metals in vegetable and rice samples tested met the food safety standard at present.

Impacts of Small-Scale Industrialized Swine Farming on Local Soil, Water and Crop Qualities in a Hilly Red Soil Region of Subtropical China

Directory of Open Access Journals (Sweden)

Di Zhang

2017-12-01

Full Text Available Industrialized small-scale pig farming has been rapidly developed in developing regions such as China and Southeast Asia, but the environmental problems accompanying pig farming have not been fully recognized. This study investigated 168 small-scale pig farms and 29 example pig farms in Yujiang County of China to examine current and potential impacts of pig wastes on soil, water and crop qualities in the hilly red soil region, China. The results indicated that the small-scale pig farms produced considerable annual yields of wastes, with medians of 216, 333 and 773 ton yr−1 per pig farm for manure, urine and washing wastewater, respectively, which has had significant impact on surface water quality. Taking NH4+-N, total nitrogen (TN or total phosphorus (TP as a criterion to judge water quality, the proportions of Class III and below Class III waters in the local surface waters were 66.2%, 78.7% and 72.5%. The well water (shallow groundwater quality near these pig farms met the water quality standards by a wide margin. The annual output of pollutants from pig farms was the most important factor correlated with the nutrients and heavy metals in soils, and the relationship can be described by a linear equation. The impact on croplands was marked by the excessive accumulation of available phosphorus and heavy metals such as Cu and Zn. For crop safety, the over-limit ratio of Zn in vegetable samples reached 60%, other heavy metals in vegetable and rice samples tested met the food safety standard at present.

Market experiences with small wind turbines

International Nuclear Information System (INIS)

Van Deijl, T.J.

1990-01-01

An overview is given of the marketing experiences of Lagerwey Windturbines with the exploitation of small wind turbines. Attention is paid to the market mechanisms which effect the sale and implementation of small wind turbines: payback of surplus power, provincial and regional subsidies, grid connection costs, energy prices, and flexible solutions for grid connections. Also problems with municipalities with regard to regulations or construction licenses are discussed. Some recommendations are given to stimulate the market for small wind turbines. 1 fig., 1 ref

Parton density at small χB

International Nuclear Information System (INIS)

Levin, E.M.

1992-09-01

This is a status report on new phenomena that are anticipated in deeply inelastic scattering in the low x region. I am viewing on this talk as summary of the theoretical situation in the region of small x, as is just before this new area of physics will be studied experimentally at HERA. (orig.)

Linking maternal and somatic 5S rRNA types with different sequence-specific non-LTR retrotransposons.

Science.gov (United States)

Locati, Mauro D; Pagano, Johanna F B; Ensink, Wim A; van Olst, Marina; van Leeuwen, Selina; Nehrdich, Ulrike; Zhu, Kongju; Spaink, Herman P; Girard, Geneviève; Rauwerda, Han; Jonker, Martijs J; Dekker, Rob J; Breit, Timo M

2017-04-01

5S rRNA is a ribosomal core component, transcribed from many gene copies organized in genomic repeats. Some eukaryotic species have two 5S rRNA types defined by their predominant expression in oogenesis or adult tissue. Our next-generation sequencing study on zebrafish egg, embryo, and adult tissue identified maternal-type 5S rRNA that is exclusively accumulated during oogenesis, replaced throughout the embryogenesis by a somatic-type, and thus virtually absent in adult somatic tissue. The maternal-type 5S rDNA contains several thousands of gene copies on chromosome 4 in tandem repeats with small intergenic regions, whereas the somatic-type is present in only 12 gene copies on chromosome 18 with large intergenic regions. The nine-nucleotide variation between the two 5S rRNA types likely affects TFIII binding and riboprotein L5 binding, probably leading to storage of maternal-type rRNA. Remarkably, these sequence differences are located exactly at the sequence-specific target site for genome integration by the 5S rRNA-specific Mutsu retrotransposon family. Thus, we could define maternal- and somatic-type MutsuDr subfamilies. Furthermore, we identified four additional maternal-type and two new somatic-type MutsuDr subfamilies, each with their own target sequence. This target-site specificity, frequently intact maternal-type retrotransposon elements, plus specific presence of Mutsu retrotransposon RNA and piRNA in egg and adult tissue, suggest an involvement of retrotransposons in achieving the differential copy number of the two types of 5S rDNA loci. © 2017 Locati et al.; Published by Cold Spring Harbor Laboratory Press for the RNA Society.

Environmental management and educational needs of the small and medium-sized businesses of the metallurgical sector in the south region of Madrid

International Nuclear Information System (INIS)

Urena, A.; Rams, J.; Mendez, F. J.; Rodriguez, J.

2004-01-01

In this study, the environmental management and needs of the small and medium-sized businesses of the metallurgical industry in the south region of Madrid were analysed. Information was obtained through a telephone questionnaire distributed to more than 170 companies. Although most of the respondent employees do not consider environmental training one of their priorities, they expressed their interest in implementing Environmental Management Systems, waste minimization and higher knowledge of the specific legal aspects. (Author) 7 refs

A phase transition between small- and large-field models of inflation

International Nuclear Information System (INIS)

Itzhaki, Nissan; Kovetz, Ely D

2009-01-01

We show that models of inflection point inflation exhibit a phase transition from a region in parameter space where they are of large-field type to a region where they are of small-field type. The phase transition is between a universal behavior, with respect to the initial condition, at the large-field region and non-universal behavior at the small-field region. The order parameter is the number of e-foldings. We find integer critical exponents at the transition between the two phases.

Ohio-Based NREL Subcontractor Wins Major Small Business Award

Science.gov (United States)

Ohio-Based NREL Subcontractor Wins Major Small Business Award For more information contact: e:mail alternative fuel vehicles has won a major award from the U.S. Small Business Administration (SBA). Automotive Testing Laboratories, Inc. (ATL) of East Liberty, Ohio was named the SBA's Midwest Regional Small Business

Evaluation of small hydropower plants in Latin America and the Caribbean

International Nuclear Information System (INIS)

Pardo-Gomez, R.

1991-01-01

Latin America and the Caribbean Region has a long-standing tradition of small hydropower plant development. In the 1890s the first plants were installed in the Region, and in the first half of this century pioneering efforts were made to develop the technology. The major reason was the technical modernization of agriculture (coffee, cacao, sugar, etc.) and small-scale mining, which led to increased energy demand in isolated areas when the electrification process was just beginning in the region. However, interest in small hydropower plants (SHP) waned because of technological improvements, enhanced efficiency, lower purchase prices and installation costs of gasoline engines, and the expansion of interconnected power systems

Quantitative Proteomics Analysis Reveals Novel Insights into Mechanisms of Action of Long Noncoding RNA Hox Transcript Antisense Intergenic RNA (HOTAIR) in HeLa Cells*

Science.gov (United States)

Zheng, Peng; Xiong, Qian; Wu, Ying; Chen, Ying; Chen, Zhuo; Fleming, Joy; Gao, Ding; Bi, Lijun; Ge, Feng

2015-01-01

Long noncoding RNAs (lncRNAs), which have emerged in recent years as a new and crucial layer of gene regulators, regulate various biological processes such as carcinogenesis and metastasis. HOTAIR (Hox transcript antisense intergenic RNA), a lncRNA overexpressed in most human cancers, has been shown to be an oncogenic lncRNA. Here, we explored the role of HOTAIR in HeLa cells and searched for proteins regulated by HOTAIR. To understand the mechanism of action of HOTAIR from a systems perspective, we employed a quantitative proteomic strategy to systematically identify potential targets of HOTAIR. The expression of 170 proteins was significantly dys-regulated after inhibition of HOTAIR, implying that they could be potential targets of HOTAIR. Analysis of this data at the systems level revealed major changes in proteins involved in diverse cellular components, including the cytoskeleton and the respiratory chain. Further functional studies on vimentin (VIM), a key protein involved in the cytoskeleton, revealed that HOTAIR exerts its effects on migration and invasion of HeLa cells, at least in part, through the regulation of VIM expression. Inhibition of HOTAIR leads to mitochondrial dysfunction and ultrastructural alterations, suggesting a novel role of HOTAIR in maintaining mitochondrial function in cancer cells. Our results provide novel insights into the mechanisms underlying the function of HOTAIR in cancer cells. We expect that the methods used in this study will become an integral part of functional studies of lncRNAs. PMID:25762744

METHODOLOGY FOR FORMING MUTUALLY BENEFICIAL NETWORK INTERACTION BETWEEN SMALL CITIES AND DISTRICT CENTRES

Directory of Open Access Journals (Sweden)

Nikolay A. Ivanov

2017-01-01

Full Text Available Abstract. Objectives The aim of the study is to develop a methodology for networking between small towns and regional centres on the basis of developing areas of mutual benefit. It is important to assess the possibility of cooperation between small towns and regional centres and local selfgovernment bodies on the example of individual territorial entities of Russia in the context of the formation and strengthening of networks and support for territorial development. Methods Systemic and functional methodical approaches were taken. The modelling of socio-economic processes provides a visual representation of the direction of positive changes for small towns and regional centres of selected Subjects of the Russian Federation. Results Specific examples of cooperation between small towns and district centres are revealed in some areas; these include education, trade and public catering, tourist and recreational activities. The supporting role of subsystems, including management, regulatory activity, transport and logistics, is described. Schemes, by to which mutually beneficial network interaction is formed, are characterised in terms of the specific advantages accruing to each network subject. Economic benefits of realising interaction between small cities and regional centres are discussed. The methodology is based on assessing the access of cities to commutation, on which basis contemporary regional and city networks are formed. Conclusion On the basis of the conducted study, a list of areas for mutually beneficial networking between small towns and district centres has been identified, allowing the appropriate changes in regional economic policies to be effected in terms of programmes aimed at the development of regions and small towns, including those suffering from economic depression.

Small-x physics at LEP/LHC

International Nuclear Information System (INIS)

Bartels, J.; Schuler, G.A.

1990-12-01

The small-x behavior of deep inelastic structure functions in QCD is discussed. After a brief review of theoretical ideas we describe numerical estimates which show that LEP/LHC will be extremely useful for distinguishing between 'standard QCD' and 'new' physics in the low-x region. We also discuss which measurements will be useful for unravelling the new features of small-x physics. (orig.)

Long- and short-term selective forces on malaria parasite genomes

KAUST Repository

Nygaard, Sanne

2010-09-09

Plasmodium parasites, the causal agents of malaria, result in more than 1 million deaths annually. Plasmodium are unicellular eukaryotes with small ~23 Mb genomes encoding ~5200 protein-coding genes. The protein-coding genes comprise about half of these genomes. Although evolutionary processes have a significant impact on malaria control, the selective pressures within Plasmodium genomes are poorly understood, particularly in the non-protein-coding portion of the genome. We use evolutionary methods to describe selective processes in both the coding and non-coding regions of these genomes. Based on genome alignments of seven Plasmodium species, we show that protein-coding, intergenic and intronic regions are all subject to purifying selection and we identify 670 conserved non-genic elements. We then use genome-wide polymorphism data from P. falciparum to describe short-term selective processes in this species and identify some candidate genes for balancing (diversifying) selection. Our analyses suggest that there are many functional elements in the non-genic regions of these genomes and that adaptive evolution has occurred more frequently in the protein-coding regions of the genome. © 2010 Nygaard et al.

RNA-Seq analysis uncovers non-coding small RNA system of Mycobacterium neoaurum in the metabolism of sterols to accumulate steroid intermediates.

Science.gov (United States)

Liu, Min; Zhu, Zhan-Tao; Tao, Xin-Yi; Wang, Feng-Qing; Wei, Dong-Zhi

2016-04-25

Understanding the metabolic mechanism of sterols to produce valuable steroid intermediates in mycobacterium by a noncoding small RNA (sRNA) view is still limited. In the work, RNA-seq was implemented to investigate the noncoding transcriptome of Mycobacterium neoaurum (Mn) in the transformation process of sterols to valuable steroid intermediates, including 9α-hydroxy-4-androstene-3,17-dione (9OHAD), 1,4-androstadiene-3,17-dione (ADD), and 22-hydroxy-23, 24-bisnorchola-1,4-dien-3-one (1,4-BNA). A total of 263 sRNA candidates were predicted from the intergenic regions in Mn. Differential expression of sRNA candidates was explored in the wide type Mn with vs without sterol addition, and the steroid intermediate producing Mn strains vs wide type Mn with sterol addition, respectively. Generally, sRNA candidates were differentially expressed in various strains, but there were still some shared candidates with outstandingly upregulated or downregulated expression in these steroid producing strains. Accordingly, four regulatory networks were constructed to reveal the direct and/or indirect interactions between sRNA candidates and their target genes in four groups, including wide type Mn with vs without sterol addition, 9OHAD, ADD, and BNA producing strains vs wide type Mn with sterol addition, respectively. Based on these constructed networks, several highly focused sRNA candidates were discovered to be prevalent in the networks, which showed comprehensive regulatory roles in various cellular processes, including lipid transport and metabolism, amino acid transport and metabolism, signal transduction, cell envelope biosynthesis and ATP synthesis. To explore the functional role of sRNA candidates in Mn cells, we manipulated the overexpression of candidates 131 and 138 in strain Mn-9OHAD, which led to enhanced production of 9OHAD from 1.5- to 2.3-fold during 6 d' fermentation and a slight effect on growth rate. This study revealed the complex and important regulatory

Social networks and small businesses performance in West African border regions

DEFF Research Database (Denmark)

Kuépié, Mathias; Tenikue, Michel; Walther, Olivier

2016-01-01

burden that leads to a negative economic impact. Testing the effect of social networks between small traders and three categories of actors, we find that the most well-connected actors are also the most successful in terms of monthly profit. The effects of social networks are, however, dependent...... with traditional religious leaders has a negative effect on economic performance. Our work has two implications: first, collecting data on social networks remains challenging due to endogeneity. Second, network-enhancing policies should aim at improving both the internal connectivity of economic actors......This paper studies the link between economic performance and social networks in West Africa. Using data collected about 358 small-scale traders in five border markets, we show that social network can simultaneously be a resource which positively contributes to labor market outcomes and a social...

[Chromosomal variation in Chironomus plumosus L. (Diptera, Chironomidae) from populations of Bryansk region, Saratov region (Russia), and Gomel region (Belarus)].

Science.gov (United States)

Belyanina, S I

2015-02-01

Cytogenetic analysis was performed on samples of Chironomus plumosus L. (Diptera, Chironomidae) taken from waterbodies of various types in Bryansk region (Russia) and Gomel region (Belarus). Karyotypes of specimens taken from stream pools of the Volga were used as reference samples. The populations of Bryansk and Gomel regions (except for a population of Lake Strativa in Starodubskii district, Bryansk region) exhibit broad structural variation, including somatic mosaicism for morphotypes of the salivary gland chromosome set, decondensation of telomeric sites, and the presence of small structural changes, as opposed to populations of Saratov region. As compared with Saratov and Bryansk regions, the Balbiani ring in the B-arm of chromosome I is repressed in populations of Gomel region. It is concluded that the chromosome set of Ch. plumosus in a range of waterbodies of Bryansk and Gomel regions is unstable.

Sediment transport and channel morphology of small, forested streams.

Science.gov (United States)

Marwan A. Hassan; Michael Church; Thomas E. Lisle; Francesco Brardinoni; Lee Benda; Gordon E. Grant

2005-01-01

This paper reviews sediment transport and channel morphology in small, forested streams in the Pacific Northwest region of North America to assess current knowledge of channel stability and morphology relevant to riparian management practices around small streams. Small channels are defined as ones in which morphology and hydraulics may be significantly influenced by...

Comparison of Fusarium oxysporum fsp lycopersici races 1, 2 and 3 ...

African Journals Online (AJOL)

Dr J. T. Ekanem

Sequence analysis of genomic fragments from the intergenic spacer region from three isolates of. Fusarium oxysporum fsp lycoperisci and fsp radicis lycopersici was carried out using the big dye terminator sequencing procedure. Two conditions of the DNA templates were also evaluated for their influence on the outcome of ...

IGS-RFLP analysis and development of molecular markers for identification of Fusarium poae, Fusarium langsethiae, Fusarium sporotrichioides and Fusarium kyushuense

NARCIS (Netherlands)

Konstantinova, P.S.; Yli-Mattila, T.

2004-01-01

The intergenic spacer (IGS) regions of the rDNA of several Fusarium spp. strains obtained from the collaborative researchers (Int. J. Food Microbiol. (2003)) were amplified by polymerase chain reaction (PCR), and an IGS¿RFLP analysis was performed. Restriction digestion with AluI, MspI and PstI

Identification of distal regulatory regions in the human alpha IIb gene locus necessary for consistent, high-level megakaryocyte expression.

Science.gov (United States)

Thornton, Michael A; Zhang, Chunyan; Kowalska, Maria A; Poncz, Mortimer

2002-11-15

The alphaIIb/beta3-integrin receptor is present at high levels only in megakaryocytes and platelets. Its presence on platelets is critical for hemostasis. The tissue-specific nature of this receptor's expression is secondary to the restricted expression of alphaIIb, and studies of the alphaIIb proximal promoter have served as a model of a megakaryocyte-specific promoter. We have examined the alphaIIb gene locus for distal regulatory elements. Sequence comparison between the human (h) and murine (m) alphaIIb loci revealed high levels of conservation at intergenic regions both 5' and 3' to the alphaIIb gene. Additionally, deoxyribonuclease (DNase) I sensitivity mapping defined tissue-specific hypersensitive (HS) sites that coincide, in part, with these conserved regions. Transgenic mice containing various lengths of the h(alpha)IIb gene locus, which included or excluded the various conserved/HS regions, demonstrated that the proximal promoter was sufficient for tissue specificity, but that a region 2.5 to 7.1 kb upstream of the h(alpha)IIb gene was necessary for consistent expression. Another region 2.2 to 7.4 kb downstream of the gene enhanced expression 1000-fold and led to levels of h(alpha)IIb mRNA that were about 30% of the native m(alpha)IIb mRNA level. These constructs also resulted in detectable h(alpha)IIb/m(beta)3 on the platelet surface. This work not only confirms the importance of the proximal promoter of the alphaIIb gene for tissue specificity, but also characterizes the distal organization of the alphaIIb gene locus and provides an initial localization of 2 important regulatory regions needed for the expression of the alphaIIb gene at high levels during megakaryopoiesis.

Air Cargo Development in the Regional Airports of the Baltic Sea Region Through Road Feeder Services

Directory of Open Access Journals (Sweden)

Beifert Anatoli

2015-06-01

Full Text Available As issued in the Competition Policy Brief on the new state aid rules for a competitive aviation industry by the Competition Directorate-General of the European Commission in February 20141, it will be more difficult for unprofitable airports, to obtain financial public subsidies on EU, national or regional level. Although the positive impact of small airports on the regional development and general accessibility was mentioned, still the operating aid to the airports shall be cut out over a maximum of 10 years. It has been further stated that the vast majority of small and regional airports experience problems to cover their running operative costs, as a result from an intensive market competition and overlapping of airports’ catchment areas preventing even some promising airports from growth. Public subsidies are mostly used by the airport management for infrastructural investments, to cover operating losses or to attract price-sensitive airlines. Herewith, among other things, the EU Commission is pointing out at the lack of cooperation structures and network strategies among the regional airports and at rather isolated and individual approach during elaboration of the airport development scenarios. However, the Competition Policy Brief permits public aid to regional airports, among other things if there is sufficient transports need to establish transition periods for small airports; the need for more flexibility of the regional airports in the remote areas has been underlined. The EU Commission is expecting herewith not to close the regional airports, but to stimulate them to operate on cost efficient and profitable basis, and that only the most inefficient airports will be closed.

Biomass for energy - small scale technologies

Energy Technology Data Exchange (ETDEWEB)

Salvesen, F.; Joergensen, P.F. [KanEnergi, Rud (Norway)

1997-12-31

The bioenergy markets and potential in EU region, the different types of biofuels, the energy technology, and the relevant applications of these for small-scale energy production are reviewed in this presentation

Biomass for energy - small scale technologies

Energy Technology Data Exchange (ETDEWEB)

Salvesen, F; Joergensen, P F [KanEnergi, Rud (Norway)

1998-12-31

The bioenergy markets and potential in EU region, the different types of biofuels, the energy technology, and the relevant applications of these for small-scale energy production are reviewed in this presentation

Characterization of a multicopper oxidase gene cluster in Phanerochaete chrysosporium and evidence of altered splicing of the mco transcripts

Science.gov (United States)

Luis F. Larrondo; Bernardo Gonzalez; Dan Cullen; Rafael Vicuna

2004-01-01

A cluster of multicopper oxidase genes (mco1, mco2, mco3, mco4) from the lignin-degrading basidiomycete Phanerochaete chrysosporium is described. The four genes share the same transcriptional orientation within a 25 kb region. mco1, mco2 and mco3 are tightly grouped, with intergenic regions of 2.3 and 0.8 kb, respectively, whereas mco4 is located 11 kb upstream of mco1...

Can we trust small x resummation?

Energy Technology Data Exchange (ETDEWEB)

Forte, Stefano [Dipartimento di Fisica, Universita di Milano and INFN, Sezione di Milano, Via Celoria 16, I-20133 Milan (Italy); Altarelli, Guido [Dipartimento di Fisica ' E.Amaldi' , Universita Roma Tre and INFN, Sezione di Roma Tre, Via della Vasca Navale 84, I-00146 Roma, Italy, CERN, Department of Physics, Theory Division, CH-1211 Geneve 23 (Switzerland); Ball, Richard D. [School of Physics, University of Edinburgh, Edinburgh EH9 3JZ, Scotland (United Kingdom)

2009-06-15

We review the current status of small x resummation of evolution of parton distributions and of deep-inelastic coefficient functions. We show that the resummed perturbative expansion is stable, robust upon different treatments of subleading terms, and that it matches smoothly to the unresummed perturbative expansions, with corrections which are of the same order as the typical NNLO ones in the HERA kinematic region. We discuss different approaches to small x resummation: we show that the ambiguities in the resummation procedure are small, provided all parametrically enhanced terms are included in the resummation and properly matched.

Can we trust small x resummation?

CERN Document Server

Forte, Stefano; Ball, Richard D

2009-01-01

We review the current status of small x resummation of evolution of parton distributions and of deep-inelastic coefficient functions. We show that the resummed perturbative expansion is stable, robust upon different treatments of subleading terms, and that it matches smoothly to the unresummed perturbative expansions, with corrections which are of the same order as the typical NNLO ones in the HERA kinematic region. We discuss different approaches to small x resummation: we show that the ambiguities in the resummation procedure are small, provided all parametrically enhanced terms are included in the resummation and properly matched.

Genome-wide characterization of long intergenic non-coding RNAs (lincRNAs) provides new insight into viral diseases in honey bees Apis cerana and Apis mellifera.

Science.gov (United States)

Jayakodi, Murukarthick; Jung, Je Won; Park, Doori; Ahn, Young-Joon; Lee, Sang-Choon; Shin, Sang-Yoon; Shin, Chanseok; Yang, Tae-Jin; Kwon, Hyung Wook

2015-09-04

Long non-coding RNAs (lncRNAs) are a class of RNAs that do not encode proteins. Recently, lncRNAs have gained special attention for their roles in various biological process and diseases. In an attempt to identify long intergenic non-coding RNAs (lincRNAs) and their possible involvement in honey bee development and diseases, we analyzed RNA-seq datasets generated from Asian honey bee (Apis cerana) and western honey bee (Apis mellifera). We identified 2470 lincRNAs with an average length of 1011 bp from A. cerana and 1514 lincRNAs with an average length of 790 bp in A. mellifera. Comparative analysis revealed that 5 % of the total lincRNAs derived from both species are unique in each species. Our comparative digital gene expression analysis revealed a high degree of tissue-specific expression among the seven major tissues of honey bee, different from mRNA expression patterns. A total of 863 (57 %) and 464 (18 %) lincRNAs showed tissue-dependent expression in A. mellifera and A. cerana, respectively, most preferentially in ovary and fat body tissues. Importantly, we identified 11 lincRNAs that are specifically regulated upon viral infection in honey bees, and 10 of them appear to play roles during infection with various viruses. This study provides the first comprehensive set of lincRNAs for honey bees and opens the door to discover lincRNAs associated with biological and hormone signaling pathways as well as various diseases of honey bee.

Nucleotide diversity and phylogenetic relationships among ...

Indian Academy of Sciences (India)

Navya

2 attached at the base of tree as the diverging Iridaceae relative's lineage. Present study revealed that psbA-trnH region are useful in addressing questions of phylogenetic relationships among the Gladiolus cultivars, as these intergenic spacers are more variable and have more phylogenetically informative sites than the ...

Genotypic anomaly in ebola virus strains circulating in magazine wharf Area, Freetown, Sierra Leone, 2015

NARCIS (Netherlands)

S.L. Smits (Saskia); S.D. Pas (Suzan); C.B.E.M. Reusken (Chantal); B.L. Haagmans (Bart); P. Pertile; C. Cancedda; K. Dierberg; I. Wurie; A. Kamara; D. Kargbo; S.L. Caddy; A. Arias; L. Thorne; J. Lu; U. Jah; I. Goodfellow; M.P.G. Koopmans D.V.M. (Marion)

2015-01-01

textabstractThe Magazine Wharf area, Freetown, Sierra Leone was a focus of ongoing Ebola virus transmission from late June 2015. Viral genomes linked to this area contain a series of 13 T to C substitutions in a 150 base pair intergenic region downstream of viral protein 40 open reading frame,

The Multifractal Structure of Small-Scale Artificial Ionospheric Turbulence

Directory of Open Access Journals (Sweden)

Vybornov F. I.

2013-03-01

Full Text Available We present the results of investigation of a multifractal structure of the artificial ionospheric turbulence when the midlatitude ionosphere is affected by high-power radio waves. The experimental studies were performed on the basis of the SURA heating facility with the help of radio sounding of the disturbed region of ionospheric plasma by signals from the Earth’s orbital satellities. In the case of vertical radio sounding of the disturbed ionosphere region, the measured multipower and generalized multifractal spectra of turbulence coincide well with similar multifractal characteristics of the ionosperic turbulence under the natural conditions. In the case of oblique sounding of the disturbance region at small angles between the line of sight to the satellite and the direction of the Earth’s magnetic field, a nonuniform structure of the small-scale turbulence with a relatively narrow multipower spectrum and small variations in the generalized multifractal spectrum of the electron density was detected.

MAJOR RISK FACTORS FOR STROKE AND THEIR CONTROL IN PATIENTS LIVING IN A SMALL TOWN OF THE MOSCOW REGION

Directory of Open Access Journals (Sweden)

V. V. Kozyaykin

2015-01-01

Full Text Available Background: Evaluation of prevalence and degree of control of leading risk factors for stroke among population of various regions of the Russian Federation enables rational planning of preventive activities.Aim: To analyze prevalence of the leading stroke risk factors, to assess efficacy of their control and to determine their impact on outcomes.Materials and methods: We examined and treated 129 patients with primary and repeated cerebral accidents living in a small town of the Moscow region.Results: The most prevalent stroke risk factor was arterial hypertension (94.6%. During 6 months before the stroke, target levels of systolic blood pressure had been achieved in 36/122 patients with arterial hypertension and those of diastolic blood pressure, in 4/122 patients. During the last 2 years preceding the index stroke, 48.8% of patients had hypertensive crises. More than half of the patients (71/122 either had not been taking their antihypertensive medications, or had not taken them regularly. There was a positive correlation between duration of arterial hypertension and degree of stroke-related disability, assessed by NIHSS (r = 0.263, p = 0.003, as well as between duration of arterial hypertension and functional activity index on Rankin scale at manifestation of stroke (r = 0.268, p = 0.003. Other prevalent risk factors were smoking (51.9% of patients, alcohol use (67.44%, diabetes mellitus (23.26%. Hypercholesterolemia that was diagnosed in 102/129 of the stroke patients, did not significantly affect any parameter of stroke severity (p > 0.05. There were weak positive correlations between body mass index and difference in NIHSS scores at admission and at discharge (r = 0.204, p = 0.049, between body mass and difference in NIHSS scores at admission and at discharge (r = 0.227, p = 0.028, as well as between body mass and difference in Rankin scale scores at admission and at discharge (r = 0.247, p = 0.016. Chronic stress situation (depression

Superconductivity of small particles

International Nuclear Information System (INIS)

Leavens, C.R.; Fenton, E.W.

1981-01-01

The Eliashberg gap equations are used to investigate the contribution of surface-phonon softening to the size dependence of the superconducting transition temperature (T/sub c/) of small metallic particles. Because of our limited quantitative knowledge of phonon spectra and electron-phonon coupling in the surface region, the effect cannot be calculated with certainty. Previous calculations which agree with experiment depend on a fortuitous choice of input parameters which cannot be justified at present. For this reason the absence of any observable size effect for T/sub c/ in Pb is especially important. This null effect is obtained in Pb if the electron-phonon coupling strength is the same in the surface region as in the bulk. This assumption can be tested experimentally because it means that the energy gap of Pb should not be independent of particle size but rather should increase significantly with decreasing radius. Hence, measurement of the size dependence of the energy gap for well-characterized small particles of Pb could provide information regarding the importance of the phonon-softening mechanism, at least for Pb

N-terminal aliphatic residues dictate the structure, stability, assembly, and small molecule binding of the coiled-coil region of cartilage oligomeric matrix protein.

Science.gov (United States)

Gunasekar, Susheel K; Asnani, Mukta; Limbad, Chandani; Haghpanah, Jennifer S; Hom, Wendy; Barra, Hanna; Nanda, Soumya; Lu, Min; Montclare, Jin Kim

2009-09-15

The coiled-coil domain of cartilage oligomeric matrix protein (COMPcc) assembles into a homopentamer that naturally recognizes the small molecule 1,25-dihydroxyvitamin D(3) (vit D). To identify the residues critical for the structure, stability, oligomerization, and binding to vit D as well as two other small molecules, all-trans-retinol (ATR) and curcumin (CCM), here we perform an alanine scanning mutagenesis study. Ten residues lining the hydrophobic pocket of COMPcc were mutated into alanine; of the mutated residues, the N-terminal aliphatic residues L37, L44, V47, and L51 are responsible for maintaining the structure and function. Furthermore, two polar residues, T40 and Q54, within the N-terminal region when converted into alanine improve the alpha-helical structure, stability, and self-assembly behavior. Helical stability, oligomerization, and binding appear to be linked in a manner in which mutations that abolish helical structure and assembly bind poorly to vit D, ATR, and CCM. These results provide not only insight into COMPcc and its functional role but also useful guidelines for the design of stable, pentameric coiled-coils capable of selectively storing and delivering various small molecules.

Mechanisms of Membrane Binding of Small GTPase K-Ras4B Farnesylated Hypervariable Region*

Science.gov (United States)

Jang, Hyunbum; Abraham, Sherwin J.; Chavan, Tanmay S.; Hitchinson, Ben; Khavrutskii, Lyuba; Tarasova, Nadya I.; Nussinov, Ruth; Gaponenko, Vadim

2015-01-01

K-Ras4B belongs to a family of small GTPases that regulates cell growth, differentiation and survival. K-ras is frequently mutated in cancer. K-Ras4B association with the plasma membrane through its farnesylated and positively charged C-terminal hypervariable region (HVR) is critical to its oncogenic function. However, the structural mechanisms of membrane association are not fully understood. Here, using confocal microscopy, surface plasmon resonance, and molecular dynamics simulations, we observed that K-Ras4B can be distributed in rigid and loosely packed membrane domains. Its membrane binding domain interaction with phospholipids is driven by membrane fluidity. The farnesyl group spontaneously inserts into the disordered lipid microdomains, whereas the rigid microdomains restrict the farnesyl group penetration. We speculate that the resulting farnesyl protrusion toward the cell interior allows oligomerization of the K-Ras4B membrane binding domain in rigid microdomains. Unlike other Ras isoforms, K-Ras4B HVR contains a single farnesyl modification and positively charged polylysine sequence. The high positive charge not only modulates specific HVR binding to anionic phospholipids but farnesyl membrane orientation. Phosphorylation of Ser-181 prohibits spontaneous farnesyl membrane insertion. The mechanism illuminates the roles of HVR modifications in K-Ras4B targeting microdomains of the plasma membrane and suggests an additional function for HVR in regulation of Ras signaling. PMID:25713064

The genomic landscape at a late stage of stickleback speciation: High genomic divergence interspersed by small localized regions of introgression.

Directory of Open Access Journals (Sweden)

Mark Ravinet

2018-05-01

Full Text Available Speciation is a continuous process and analysis of species pairs at different stages of divergence provides insight into how it unfolds. Previous genomic studies on young species pairs have revealed peaks of divergence and heterogeneous genomic differentiation. Yet less known is how localised peaks of differentiation progress to genome-wide divergence during the later stages of speciation in the presence of persistent gene flow. Spanning the speciation continuum, stickleback species pairs are ideal for investigating how genomic divergence builds up during speciation. However, attention has largely focused on young postglacial species pairs, with little knowledge of the genomic signatures of divergence and introgression in older stickleback systems. The Japanese stickleback species pair, composed of the Pacific Ocean three-spined stickleback (Gasterosteus aculeatus and the Japan Sea stickleback (G. nipponicus, which co-occur in the Japanese islands, is at a late stage of speciation. Divergence likely started well before the end of the last glacial period and crosses between Japan Sea females and Pacific Ocean males result in hybrid male sterility. Here we use coalescent analyses and Approximate Bayesian Computation to show that the two species split approximately 0.68-1 million years ago but that they have continued to exchange genes at a low rate throughout divergence. Population genomic data revealed that, despite gene flow, a high level of genomic differentiation is maintained across the majority of the genome. However, we identified multiple, small regions of introgression, occurring mainly in areas of low recombination rate. Our results demonstrate that a high level of genome-wide divergence can establish in the face of persistent introgression and that gene flow can be localized to small genomic regions at the later stages of speciation with gene flow.

The genomic landscape at a late stage of stickleback speciation: High genomic divergence interspersed by small localized regions of introgression.

Science.gov (United States)

Ravinet, Mark; Yoshida, Kohta; Shigenobu, Shuji; Toyoda, Atsushi; Fujiyama, Asao; Kitano, Jun

2018-05-01

Speciation is a continuous process and analysis of species pairs at different stages of divergence provides insight into how it unfolds. Previous genomic studies on young species pairs have revealed peaks of divergence and heterogeneous genomic differentiation. Yet less known is how localised peaks of differentiation progress to genome-wide divergence during the later stages of speciation in the presence of persistent gene flow. Spanning the speciation continuum, stickleback species pairs are ideal for investigating how genomic divergence builds up during speciation. However, attention has largely focused on young postglacial species pairs, with little knowledge of the genomic signatures of divergence and introgression in older stickleback systems. The Japanese stickleback species pair, composed of the Pacific Ocean three-spined stickleback (Gasterosteus aculeatus) and the Japan Sea stickleback (G. nipponicus), which co-occur in the Japanese islands, is at a late stage of speciation. Divergence likely started well before the end of the last glacial period and crosses between Japan Sea females and Pacific Ocean males result in hybrid male sterility. Here we use coalescent analyses and Approximate Bayesian Computation to show that the two species split approximately 0.68-1 million years ago but that they have continued to exchange genes at a low rate throughout divergence. Population genomic data revealed that, despite gene flow, a high level of genomic differentiation is maintained across the majority of the genome. However, we identified multiple, small regions of introgression, occurring mainly in areas of low recombination rate. Our results demonstrate that a high level of genome-wide divergence can establish in the face of persistent introgression and that gene flow can be localized to small genomic regions at the later stages of speciation with gene flow.

A Successful Small Wind Future: There Is Great Potential

Energy Technology Data Exchange (ETDEWEB)

Tegen, Suzanne

2017-05-02

Suzanne Tegen made this presentation at the 2017 Small Wind Conference in Bloomington, Minnesota. It provides an overview of DOE-sponsored small wind products, testing, and support; an example of a Regional Resource Center defending distributed wind; the recently published Distributed Wind Taxonomy; the dWind model and recent results; and other recent DOE and NREL publications related to small and distributed wind.

Small hydro-electric potential: west Poverty Bay region

Energy Technology Data Exchange (ETDEWEB)

1981-07-01

This study has identified six schemes in the Bay of Plenty Electric Power Board area and two in the Poverty Bay Electric Power Board area, of which five and one, respectively, are below the economic limit of $2400/kW suggested by the Ministry of Works and Development as of December 1979. Of these, only three appear both economically and environmentally acceptable. The Takaputahi and Torere schemes are not likely to proceed if the Ministry of Works and Development continue with their plans to develop the Motu River. Furthermore, the Motu Falls scheme is unlikely to proceed for environmental reasons. The schemes identified are not very attractive on the national scale and could not be justified on local terms. However, a detailed feasibility study of the Takaputahi/Torere diversion should be undertaken prior to a decision being made to proceed with the Motu development, or if the proposals are dropped. The present low load and slow growth of the area is such that prior to a small hydro-electric scheme being built, there would need to be an established demand for power.

A mechanism of gene amplification driven by small DNA fragments.

Directory of Open Access Journals (Sweden)

Kuntal Mukherjee

Full Text Available DNA amplification is a molecular process that increases the copy number of a chromosomal tract and often causes elevated expression of the amplified gene(s. Although gene amplification is frequently observed in cancer and other degenerative disorders, the molecular mechanisms involved in the process of DNA copy number increase remain largely unknown. We hypothesized that small DNA fragments could be the trigger of DNA amplification events. Following our findings that small fragments of DNA in the form of DNA oligonucleotides can be highly recombinogenic, we have developed a system in the yeast Saccharomyces cerevisiae to capture events of chromosomal DNA amplification initiated by small DNA fragments. Here we demonstrate that small DNAs can amplify a chromosomal region, generating either tandem duplications or acentric extrachromosomal DNA circles. Small fragment-driven DNA amplification (SFDA occurs with a frequency that increases with the length of homology between the small DNAs and the target chromosomal regions. SFDA events are triggered even by small single-stranded molecules with as little as 20-nt homology with the genomic target. A double-strand break (DSB external to the chromosomal amplicon region stimulates the amplification event up to a factor of 20 and favors formation of extrachromosomal circles. SFDA is dependent on Rad52 and Rad59, partially dependent on Rad1, Rad10, and Pol32, and independent of Rad51, suggesting a single-strand annealing mechanism. Our results reveal a novel molecular model for gene amplification, in which small DNA fragments drive DNA amplification and define the boundaries of the amplicon region. As DNA fragments are frequently found both inside cells and in the extracellular environment, such as the serum of patients with cancer or other degenerative disorders, we propose that SFDA may be a common mechanism for DNA amplification in cancer cells, as well as a more general cause of DNA copy number variation

Hidden layers of human small RNAs

DEFF Research Database (Denmark)

Kawaji, Hideya; Nakamura, Mari; Takahashi, Yukari

2008-01-01

small RNA have focused on miRNA and/or siRNA rather than on the exploration of additional classes of RNAs. RESULTS: Here, we explored human small RNAs by unbiased sequencing of RNAs with sizes of 19-40 nt. We provide substantial evidences for the existence of independent classes of small RNAs. Our data......BACKGROUND: Small RNA attracts increasing interest based on the discovery of RNA silencing and the rapid progress of our understanding of these phenomena. Although recent studies suggest the possible existence of yet undiscovered types of small RNAs in higher organisms, many studies to profile...... shows that well-characterized non-coding RNA, such as tRNA, snoRNA, and snRNA are cleaved at sites specific to the class of ncRNA. In particular, tRNA cleavage is regulated depending on tRNA type and tissue expression. We also found small RNAs mapped to genomic regions that are transcribed in both...

Cloning, nucleotide sequence and transcriptional analysis of the uvrA gene from Neisseria gonorrhoeae

International Nuclear Information System (INIS)

Black, C.G.; Fyfe, J.A.M.; Davies, J.K.

1997-01-01

A recombinant plasmid capable of restoring UV resistance to an Escherichia coli uvrA mutant was isolated from a genomic library of Neisseria gonorrhoeae. Sequence analysis revealed an open reading frame whose deduced amino acid sequence displayed significant similarity to those of the UvrA proteins of other bacterial species. A second open reading frame (ORF259) was identified upstream from, and in the opposite orientation to the gonococcal uvrA gene. Transcriptional fusions between portions of the gonococcal uvrA upstream region and a reporter gene were used to localise promoter activity in both E. coli and N. gonorrhoeae. The transcriptional starting points of uvrA and ORF259 were mapped in E. coli by primer extension analysis, and corresponding σ 70 promoters were identified. The arrangement of the uvrA-ORF259 intergenic region is similar to that of the gonococcal recA-aroD intergenic region. Both contain inverted copies of the 10 bp neisserial DNA uptake sequence situated between divergently transcribed genes. However, there is no evidence that either the uptake sequence or the proximity of the promoters influences expression of these genes. (author)

Simulation of Lake Surface Heat Fluxes by the Canadian Small Lake Model: Offline Performance Assessment for Future Coupling with a Regional Climate Model

Science.gov (United States)

Pernica, P.; Guerrero, J. L.; MacKay, M.; Wheater, H. S.

2014-12-01

Lakes strongly influence local and regional climate especially in regions where they are abundant. Development of a lake model for the purpose of integration within a regional climate model is therefore a subject of scientific interest. Of particular importance are the heat flux predictions provided by the lake model since they function as key forcings in a fully coupled atmosphere-land-lake system. The first step towards a coupled model is to validate and characterize the accuracy of the lake model over a range of conditions and to identify limitations. In this work, validation results from offline tests of the Canadian Small Lake Model; a deterministic, computationally efficient, 1D integral model, are presented. Heat fluxes (sensible and latent) and surface water temperatures simulated by the model are compared with in situ observations from two lakes; Landing Lake (NWT, Canada) and L239 (ELA, Canada) for the 2007-2009 period. Sensitivity analysis is performed to identify key parameters important for heat flux predictions. The results demonstrate the ability of the 1-D lake model to reproduce both diurnal and seasonal variations in heat fluxes and surface temperatures for the open water period. These results, in context of regional climate modelling are also discussed.

Regional Lymph Node Uptake of [{sup 18}F]Fluorodeoxyglucose After Definitive Chemoradiation Therapy Predicts Local-Regional Failure of Locally Advanced Non-Small Cell Lung Cancer: Results of ACRIN 6668/RTOG 0235

Energy Technology Data Exchange (ETDEWEB)

Markovina, Stephanie [Mallinckrodt Institute of Radiology and Alvin J. Siteman Cancer Center, Washington University School of Medicine, St. Louis, Missouri (United States); Duan, Fenghai [Department of Biostatistics and Center for Statistical Sciences, Brown University School of Public Health, Providence, Rhode Island (United States); Snyder, Bradley S. [Center for Statistical Sciences, Brown University School of Public Health, Providence, Rhode Island (United States); Siegel, Barry A. [Mallinckrodt Institute of Radiology and Alvin J. Siteman Cancer Center, Washington University School of Medicine, St. Louis, Missouri (United States); Machtay, Mitchell [Department of Radiation Oncology, Case Western Reserve University, Cleveland, Ohio (United States); Bradley, Jeffrey D., E-mail: jbradley@radonc.wustl.edu [Mallinckrodt Institute of Radiology and Alvin J. Siteman Cancer Center, Washington University School of Medicine, St. Louis, Missouri (United States)

2015-11-01

Purpose: The American College of Radiology Imaging Network (ACRIN) 6668/Radiation Therapy Oncology Group (RTOG) 0235 study demonstrated that standardized uptake values (SUV) on post-treatment [{sup 18}F]fluorodeoxyglucose-positron emission tomography (FDG-PET) correlated with survival in locally advanced non-small cell lung cancer (NSCLC). This secondary analysis determined whether SUV of regional lymph nodes (RLNs) on post-treatment FDG-PET correlated with patient outcomes. Methods and Materials: Included for analysis were patients treated with concurrent chemoradiation therapy, using radiation doses ≥60 Gy, with identifiable FDG-avid RLNs (distinct from primary tumor) on pretreatment FDG-PET, and post-treatment FDG-PET data. ACRIN core laboratory SUV measurements were used. Event time was calculated from the date of post-treatment FDG-PET. Local-regional failure was defined as failure within the treated RT volume and reported by the treating institution. Statistical analyses included Wilcoxon signed rank test, Kaplan-Meier curves (log rank test), and Cox proportional hazards regression modeling. Results: Of 234 trial-eligible patients, 139 (59%) had uptake in both primary tumor and RLNs on pretreatment FDG-PET and had SUV data from post-treatment FDG-PET. Maximum SUV was greater for primary tumor than for RLNs before treatment (P<.001) but not different post-treatment (P=.320). Post-treatment SUV of RLNs was not associated with overall survival. However, elevated post-treatment SUV of RLNs, both the absolute value and the percentage of residual activity compared to the pretreatment SUV were associated with inferior local-regional control (P<.001). Conclusions: High residual metabolic activity in RLNs on post-treatment FDG-PET is associated with worse local-regional control. Based on these data, future trials evaluating a radiation therapy boost should consider inclusion of both primary tumor and FDG-avid RLNs in the boost volume to maximize local-regional

Regional Lymph Node Uptake of ["1"8F]Fluorodeoxyglucose After Definitive Chemoradiation Therapy Predicts Local-Regional Failure of Locally Advanced Non-Small Cell Lung Cancer: Results of ACRIN 6668/RTOG 0235

International Nuclear Information System (INIS)

Markovina, Stephanie; Duan, Fenghai; Snyder, Bradley S.; Siegel, Barry A.; Machtay, Mitchell; Bradley, Jeffrey D.

2015-01-01

Purpose: The American College of Radiology Imaging Network (ACRIN) 6668/Radiation Therapy Oncology Group (RTOG) 0235 study demonstrated that standardized uptake values (SUV) on post-treatment ["1"8F]fluorodeoxyglucose-positron emission tomography (FDG-PET) correlated with survival in locally advanced non-small cell lung cancer (NSCLC). This secondary analysis determined whether SUV of regional lymph nodes (RLNs) on post-treatment FDG-PET correlated with patient outcomes. Methods and Materials: Included for analysis were patients treated with concurrent chemoradiation therapy, using radiation doses ≥60 Gy, with identifiable FDG-avid RLNs (distinct from primary tumor) on pretreatment FDG-PET, and post-treatment FDG-PET data. ACRIN core laboratory SUV measurements were used. Event time was calculated from the date of post-treatment FDG-PET. Local-regional failure was defined as failure within the treated RT volume and reported by the treating institution. Statistical analyses included Wilcoxon signed rank test, Kaplan-Meier curves (log rank test), and Cox proportional hazards regression modeling. Results: Of 234 trial-eligible patients, 139 (59%) had uptake in both primary tumor and RLNs on pretreatment FDG-PET and had SUV data from post-treatment FDG-PET. Maximum SUV was greater for primary tumor than for RLNs before treatment (P<.001) but not different post-treatment (P=.320). Post-treatment SUV of RLNs was not associated with overall survival. However, elevated post-treatment SUV of RLNs, both the absolute value and the percentage of residual activity compared to the pretreatment SUV were associated with inferior local-regional control (P<.001). Conclusions: High residual metabolic activity in RLNs on post-treatment FDG-PET is associated with worse local-regional control. Based on these data, future trials evaluating a radiation therapy boost should consider inclusion of both primary tumor and FDG-avid RLNs in the boost volume to maximize local-regional control.

Brain networks: small-worlds, after all?

International Nuclear Information System (INIS)

Muller, Lyle; Destexhe, Alain; Rudolph-Lilith, Michelle

2014-01-01

Since its introduction, the ‘small-world’ effect has played a central role in network science, particularly in the analysis of the complex networks of the nervous system. From the cellular level to that of interconnected cortical regions, many analyses have revealed small-world properties in the networks of the brain. In this work, we revisit the quantification of small-worldness in neural graphs. We find that neural graphs fall into the ‘borderline’ regime of small-worldness, residing close to that of a random graph, especially when the degree sequence of the network is taken into account. We then apply recently introducted analytical expressions for clustering and distance measures, to study this borderline small-worldness regime. We derive theoretical bounds for the minimal and maximal small-worldness index for a given graph, and by semi-analytical means, study the small-worldness index itself. With this approach, we find that graphs with small-worldness equivalent to that observed in experimental data are dominated by their random component. These results provide the first thorough analysis suggesting that neural graphs may reside far away from the maximally small-world regime. (paper)

Brain networks: small-worlds, after all?

Energy Technology Data Exchange (ETDEWEB)

Muller, Lyle; Destexhe, Alain; Rudolph-Lilith, Michelle [Unité de Neurosciences, Information et Complexité (UNIC), Centre National de la Recherche Scientifique (CNRS), 1 Avenue de la Terrasse, Gif-sur-Yvette (France)

2014-10-01

Since its introduction, the ‘small-world’ effect has played a central role in network science, particularly in the analysis of the complex networks of the nervous system. From the cellular level to that of interconnected cortical regions, many analyses have revealed small-world properties in the networks of the brain. In this work, we revisit the quantification of small-worldness in neural graphs. We find that neural graphs fall into the ‘borderline’ regime of small-worldness, residing close to that of a random graph, especially when the degree sequence of the network is taken into account. We then apply recently introducted analytical expressions for clustering and distance measures, to study this borderline small-worldness regime. We derive theoretical bounds for the minimal and maximal small-worldness index for a given graph, and by semi-analytical means, study the small-worldness index itself. With this approach, we find that graphs with small-worldness equivalent to that observed in experimental data are dominated by their random component. These results provide the first thorough analysis suggesting that neural graphs may reside far away from the maximally small-world regime. (paper)

CHIR99021 promotes self-renewal of mouse embryonic stem cells by modulation of protein-encoding gene and long intergenic non-coding RNA expression

Energy Technology Data Exchange (ETDEWEB)

Wu, Yongyan [College of Veterinary Medicine, Northwest A and F University, Yangling 712100, Shaanxi (China); Key Laboratory of Animal Biotechnology, Ministry of Agriculture, Northwest A and F University, Yangling 712100, Shaanxi (China); Ai, Zhiying [Key Laboratory of Animal Biotechnology, Ministry of Agriculture, Northwest A and F University, Yangling 712100, Shaanxi (China); College of Life Sciences, Northwest A and F University, Yangling 712100, Shaanxi (China); Yao, Kezhen [College of Veterinary Medicine, Northwest A and F University, Yangling 712100, Shaanxi (China); Key Laboratory of Animal Biotechnology, Ministry of Agriculture, Northwest A and F University, Yangling 712100, Shaanxi (China); Cao, Lixia; Du, Juan; Shi, Xiaoyan [Key Laboratory of Animal Biotechnology, Ministry of Agriculture, Northwest A and F University, Yangling 712100, Shaanxi (China); College of Life Sciences, Northwest A and F University, Yangling 712100, Shaanxi (China); Guo, Zekun, E-mail: gzk@nwsuaf.edu.cn [College of Veterinary Medicine, Northwest A and F University, Yangling 712100, Shaanxi (China); Key Laboratory of Animal Biotechnology, Ministry of Agriculture, Northwest A and F University, Yangling 712100, Shaanxi (China); Zhang, Yong, E-mail: zhylab@hotmail.com [College of Veterinary Medicine, Northwest A and F University, Yangling 712100, Shaanxi (China); Key Laboratory of Animal Biotechnology, Ministry of Agriculture, Northwest A and F University, Yangling 712100, Shaanxi (China)

2013-10-15

Embryonic stem cells (ESCs) can proliferate indefinitely in vitro and differentiate into cells of all three germ layers. These unique properties make them exceptionally valuable for drug discovery and regenerative medicine. However, the practical application of ESCs is limited because it is difficult to derive and culture ESCs. It has been demonstrated that CHIR99021 (CHIR) promotes self-renewal and enhances the derivation efficiency of mouse (m)ESCs. However, the downstream targets of CHIR are not fully understood. In this study, we identified CHIR-regulated genes in mESCs using microarray analysis. Our microarray data demonstrated that CHIR not only influenced the Wnt/β-catenin pathway by stabilizing β-catenin, but also modulated several other pluripotency-related signaling pathways such as TGF-β, Notch and MAPK signaling pathways. More detailed analysis demonstrated that CHIR inhibited Nodal signaling, while activating bone morphogenetic protein signaling in mESCs. In addition, we found that pluripotency-maintaining transcription factors were up-regulated by CHIR, while several developmental-related genes were down-regulated. Furthermore, we found that CHIR altered the expression of epigenetic regulatory genes and long intergenic non-coding RNAs. Quantitative real-time PCR results were consistent with microarray data, suggesting that CHIR alters the expression pattern of protein-encoding genes (especially transcription factors), epigenetic regulatory genes and non-coding RNAs to establish a relatively stable pluripotency-maintaining network. - Highlights: • Combined use of CHIR with LIF promotes self-renewal of J1 mESCs. • CHIR-regulated genes are involved in multiple pathways. • CHIR inhibits Nodal signaling and promotes Bmp4 expression to activate BMP signaling. • Expression of epigenetic regulatory genes and lincRNAs is altered by CHIR.

CHIR99021 promotes self-renewal of mouse embryonic stem cells by modulation of protein-encoding gene and long intergenic non-coding RNA expression

International Nuclear Information System (INIS)

Wu, Yongyan; Ai, Zhiying; Yao, Kezhen; Cao, Lixia; Du, Juan; Shi, Xiaoyan; Guo, Zekun; Zhang, Yong

2013-01-01

Embryonic stem cells (ESCs) can proliferate indefinitely in vitro and differentiate into cells of all three germ layers. These unique properties make them exceptionally valuable for drug discovery and regenerative medicine. However, the practical application of ESCs is limited because it is difficult to derive and culture ESCs. It has been demonstrated that CHIR99021 (CHIR) promotes self-renewal and enhances the derivation efficiency of mouse (m)ESCs. However, the downstream targets of CHIR are not fully understood. In this study, we identified CHIR-regulated genes in mESCs using microarray analysis. Our microarray data demonstrated that CHIR not only influenced the Wnt/β-catenin pathway by stabilizing β-catenin, but also modulated several other pluripotency-related signaling pathways such as TGF-β, Notch and MAPK signaling pathways. More detailed analysis demonstrated that CHIR inhibited Nodal signaling, while activating bone morphogenetic protein signaling in mESCs. In addition, we found that pluripotency-maintaining transcription factors were up-regulated by CHIR, while several developmental-related genes were down-regulated. Furthermore, we found that CHIR altered the expression of epigenetic regulatory genes and long intergenic non-coding RNAs. Quantitative real-time PCR results were consistent with microarray data, suggesting that CHIR alters the expression pattern of protein-encoding genes (especially transcription factors), epigenetic regulatory genes and non-coding RNAs to establish a relatively stable pluripotency-maintaining network. - Highlights: • Combined use of CHIR with LIF promotes self-renewal of J1 mESCs. • CHIR-regulated genes are involved in multiple pathways. • CHIR inhibits Nodal signaling and promotes Bmp4 expression to activate BMP signaling. • Expression of epigenetic regulatory genes and lincRNAs is altered by CHIR

Price regions and socio-economic efficiency

International Nuclear Information System (INIS)

2001-01-01

In a market without market power, a system in which each node (small price regions) has its own price most effective. The loss when two nodes are combined into one price region is greater the more elastic the demand and supply curve is in the two regions and the more unequal the impact on the flow across the bottleneck is

Small hydropower in Southern Africa: an overview of five countries in the region

CSIR Research Space (South Africa)

Jonker Klunne, W

2013-08-01

Full Text Available dif- ferent sources, but is incomplete and inconsistent. This lack of information severely hampers the abili- ty to learn from past experiences and creates a bar- rier to the uptake of the technology (Gaul et al., 2010). 14 Journal of Energy... of lack of infor- mation by providing an overview of the status of small hydropower in five southern African countries. Defining small hydropower No internationally agreed definitions exist for the different sizes of hydropower. A generic distinction...

Small millet farmers increase yields through participatory varietal ...

International Development Research Centre (IDRC) Digital Library (Canada)

Small millets, despite being rich in micronutrients and dietary fibre and known for their low glycemic index and tolerance of water stress, are in decline in South Asia. Existing varieties suffer from low yield and farmers lack access to improved varieties. The Revalorising Small Millets in Rainfed Regions of South Asia ...

Small Proteins Can No Longer Be Ignored

Science.gov (United States)

Storz, Gisela; Wolf, Yuri I.; Ramamurthi, Kumaran S.

2014-01-01

Small proteins, here defined as proteins of 50 amino acids or less in the absence of processing, have traditionally been overlooked due to challenges in their annotation and biochemical detection. In the past several years however, increasing numbers of small proteins have been identified either through the realization that mutations in “intergenic” regions actually are within unannotated small protein genes, or through the discovery that some small, regulatory RNAs (sRNAs) encode small proteins. These insights together with comparative sequence analysis indicate that tens if not hundreds of small proteins are synthesized in a given organism. This review will summarize what has been learned about the functions of several of these bacterial small proteins, most of which act at the membrane, illustrating the astonishing range of processes in which the small proteins act and pointing to several general conclusions. Important questions for future studies of these overlooked proteins also will be discussed. PMID:24606146

Download this PDF file

African Journals Online (AJOL)

TonukariJ

Fragment Length Polymorphism (PCR-RFLP) analysis of 16S-23S rDNA intergenic spacer region (IGS) directly applied on ... phylogenetic analysis of 16S rRNA gene sequences showed that they belong to the genus,. Bradyrhizobium. .... sterile water with plastic pestle sterilised in 96% ethanol in a 1,5-ml. Eppendorf tube.

Regional Technolgy Policy and Factors Shaping Local Innovation Networks in Small German Cities

OpenAIRE

Gebauer, Andrea; Nam, Chang Woon; Parsche, Rüdiger

2003-01-01

Local innovation networks have been considered to be particularly important to innovation and technological change and to the growth prospects of regions and cities in Germany. Accordingly, innovation is a process that results from various (economic and social) interactions of different institutions located in a given region. Consequently, when analysing the local (or regional) innovation system, one should not only investigate the (horizontal and vertical) relations among firms but also the ...

Mechanisms of haplotype divergence at the RGA08 nucleotide-binding leucine-rich repeat gene locus in wild banana (Musa balbisiana).

Science.gov (United States)

Baurens, Franc-Christophe; Bocs, Stéphanie; Rouard, Mathieu; Matsumoto, Takashi; Miller, Robert N G; Rodier-Goud, Marguerite; MBéguié-A-MBéguié, Didier; Yahiaoui, Nabila

2010-07-16

Comparative sequence analysis of complex loci such as resistance gene analog clusters allows estimating the degree of sequence conservation and mechanisms of divergence at the intraspecies level. In banana (Musa sp.), two diploid wild species Musa acuminata (A genome) and Musa balbisiana (B genome) contribute to the polyploid genome of many cultivars. The M. balbisiana species is associated with vigour and tolerance to pests and disease and little is known on the genome structure and haplotype diversity within this species. Here, we compare two genomic sequences of 253 and 223 kb corresponding to two haplotypes of the RGA08 resistance gene analog locus in M. balbisiana "Pisang Klutuk Wulung" (PKW). Sequence comparison revealed two regions of contrasting features. The first is a highly colinear gene-rich region where the two haplotypes diverge only by single nucleotide polymorphisms and two repetitive element insertions. The second corresponds to a large cluster of RGA08 genes, with 13 and 18 predicted RGA genes and pseudogenes spread over 131 and 152 kb respectively on each haplotype. The RGA08 cluster is enriched in repetitive element insertions, in duplicated non-coding intergenic sequences including low complexity regions and shows structural variations between haplotypes. Although some allelic relationships are retained, a large diversity of RGA08 genes occurs in this single M. balbisiana genotype, with several RGA08 paralogs specific to each haplotype. The RGA08 gene family has evolved by mechanisms of unequal recombination, intragenic sequence exchange and diversifying selection. An unequal recombination event taking place between duplicated non-coding intergenic sequences resulted in a different RGA08 gene content between haplotypes pointing out the role of such duplicated regions in the evolution of RGA clusters. Based on the synonymous substitution rate in coding sequences, we estimated a 1 million year divergence time for these M. balbisiana haplotypes. A

Constraining the Depth of Polar Ice Deposits and Evolution of Cold Traps on Mercury with Small Craters in Permanently Shadowed Regions

Science.gov (United States)

Deutsch, Ariel N.; Head, James W.; Neumann, Gregory A.; Chabot, Nancy L.

2017-01-01

Earth-based radar observations revealed highly reflective deposits at the poles of Mercury [e.g., 1], which collocate with permanently shadowed regions (PSRs) detected from both imagery and altimetry by the MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft [e.g., 2]. MESSENGER also measured higher hydrogen concentrations at the north polar region, consistent with models for these deposits to be composed primarily of water ice [3]. Enigmatic to the characterization of ice deposits on Mercury is the thickness of these radar-bright features. A current minimum bound of several meters exists from the radar measurements, which show no drop in the radar cross section between 13- and 70-cm wavelength observations [4, 5]. A maximum thickness of 300 m is based on the lack of any statistically significant difference between the height of craters that host radar-bright deposits and those that do not [6]. More recently, this upper limit on the depth of a typical ice deposit has been lowered to approximately 150 m, in a study that found a mean excess thickness of 50 +/- 35 m of radar-bright deposits for 6 craters [7]. Refining such a constraint permits the derivation of a volumetric estimate of the total polar ice on Mercury, thus providing insight into possible sources of water ice on the planet. Here, we take a different approach to constrain the thickness of water-ice deposits. Permanently shadowed surfaces have been resolved in images acquired with the broadband filter on MESSENGER's wide-angle camera (WAC) using low levels of light scattered by crater walls and other topography [8]. These surfaces are not featureless and often host small craters (less than a few km in diameter). Here we utilize the presence of these small simple craters to constrain the thickness of the radar-bright ice deposits on Mercury. Specifically, we compare estimated depths made from depth-to-diameter ratios and depths from individual Mercury Laser Altimeter (MLA

An infrared small target detection method based on multiscale local homogeneity measure

Science.gov (United States)

Nie, Jinyan; Qu, Shaocheng; Wei, Yantao; Zhang, Liming; Deng, Lizhen

2018-05-01

Infrared (IR) small target detection plays an important role in the field of image detection area owing to its intrinsic characteristics. This paper presents a multiscale local homogeneity measure (MLHM) for infrared small target detection, which can enhance the performance of IR small target detection system. Firstly, intra-patch homogeneity of the target itself and the inter-patch heterogeneity between target and the local background regions are integrated to enhance the significant of small target. Secondly, a multiscale measure based on local regions is proposed to obtain the most appropriate response. Finally, an adaptive threshold method is applied to small target segmentation. Experimental results on three different scenarios indicate that the MLHM has good performance under the interference of strong noise.

Investigation of the scale for dividing small earthquake regions

Energy Technology Data Exchange (ETDEWEB)

Xu, Y.; Zhang, H.

1980-01-22

In view of the fact that the upper layer of soil has a greater effect on earthquake damage than the lower layers, the area of an inverted triangle is used for averaging the effects of soils of different depths on the composite shear strength, G/sub j/ x 10/sup 3/ tons/m/sup 2/; where G/sub j/ is the composite shear strength of the jth drill hole. For the purpose of supporting the reconstruction of Tangshan, this technique was used in 1977 by the Institute of Engineering Mechanics Chinese Academy of Sciences and the Institute of Surveying Chinese Academy of Architecture to proceed with small area classification of Fengrun, which is a northern suburb of Tangshan. The result basically agrees with the classification data of engineering geology.

Rapid identification of probiotic Lactobacillus species by multiplex PCR using species-specific primers based on the region extending from 16S rRNA through 23S rRNA.

Science.gov (United States)

Kwon, Hyuk-Sang; Yang, Eun-Hee; Yeon, Seung-Woo; Kang, Byoung-Hwa; Kim, Tae-Yong

2004-10-15

This study aimed to develop a novel multiplex polymerase chain reaction (PCR) primer set for the identification of seven probiotic Lactobacillus species such as Lactobacillus acidophilus, Lactobacillus delbrueckii, Lactobacillus casei, Lactobacillus gasseri, Lactobacillus plantarum, Lactobacillus reuteri and Lactobacillus rhamnosus. The primer set, comprising of seven specific and two conserved primers, was derived from the integrated sequences of 16S and 23S rRNA genes and their rRNA intergenic spacer region of each species. It was able to identify the seven target species with 93.6% accuracy, which exceeds that of the general biochemical methods. The phylogenetic analyses, using 16S rDNA sequences of the probiotic isolates, also provided further support that the results from the multiplex PCR assay were trustworthy. Taken together, we suggest that the multiplex primer set is an efficient tool for simple, rapid and reliable identification of seven Lactobacillus species.

SMALL AND MEDIUM ENTERPRISES, REGIONAL DEVELOPMENT AND NETWORKING: THE EMERGING FRAMEWORK IN ROMANIA

Directory of Open Access Journals (Sweden)

Daniela Luminita Constantin

2002-12-01

Full Text Available Networking is a key word in the recent debates on SMEs and regional policies, pointing out the need and advantages of integrating these businesses in a coherent framework, which creates links, relations, exchanges between them and other actors within the region (banks, universities, research institutes, training centres, consulting firms, chambers of commerce, associations of producers, local public administration. This paper aims to explore the main features and significance of the SME sector development for addressing the regional question in Romania during the transition period and to identify the emerging evidence and perspectives of SME territorial networking phenomenon in the specific context induced by the European integration processes. Up to present the idea of creating and supporting regional networks has not been offered the adequate importance in Romania – being only partially, indirectly envisaged, so that this paper proposes some reflections that could be considered by the Romanian regional policy in the forthcoming years, as resulted from the analysis of the international experience and literature devoted to this subject.

THE SUN'S SMALL-SCALE MAGNETIC ELEMENTS IN SOLAR CYCLE 23

International Nuclear Information System (INIS)

Jin, C. L.; Wang, J. X.; Song, Q.; Zhao, H.

2011-01-01

With the unique database from the Michelson Doppler Imager on board the Solar and Heliospheric Observatory in an interval embodying solar cycle 23, the cyclic behavior of solar small-scale magnetic elements is studied. More than 13 million small-scale magnetic elements are selected, and the following results are found. (1) The quiet regions dominated the Sun's magnetic flux for about 8 years in the 12.25 year duration of cycle 23. They contributed (0.94-1.44) x10 23 Mx flux to the Sun from the solar minimum to maximum. The monthly average magnetic flux of the quiet regions is 1.12 times that of the active regions in the cycle. (2) The ratio of quiet region flux to that of the total Sun equally characterizes the course of a solar cycle. The 6 month running average flux ratio of the quiet regions was larger than 90.0% for 28 continuous months from July 2007 to October 2009, which very well characterizes the grand solar minima of cycles 23-24. (3) From the small to the large end of the flux spectrum, the variations of numbers and total flux of the network elements show no correlation, anti-correlation, and correlation with sunspots, respectively. The anti-correlated elements, covering the flux of (2.9-32.0)x10 18 Mx, occupy 77.2% of the total element number and 37.4% of the quiet-Sun flux. These results provide insight into the reason for anti-correlations of small-scale magnetic activity during the solar cycle.

Empirical development taxanomy of micro, small and medium-sized enterprises in South Moravian Region

Directory of Open Access Journals (Sweden)

Veronika Bumberová

2013-01-01

Full Text Available This paper represents a pilot study examining entrepreneurial behavior patterns within the area of development of micro, small and medium-sized market active enterprises in South Moravian Region from the perspective of strategic management. The main aim of this article is to classify the enterprises by the character of development activities into relatively homogeneous groups and identify those activities that contribute to considerable differences between the individual groups. Empirical evidence is based on a quantitative survey in terms of a random choice of respondents obtained by means of an e-mail questionnaire. The major analytic procedure applied within this research comprises methods of Cluster Analysis and validation technique based on chi-square and G-square nonparametric tests for testing differences (independence of variables between the clusters. By means of Cluster Analysis three relatively homogenous SME groups were identified. The first cluster, called “global”, (approximately 6% of the respondents prevails in most of the strategic development aspects of the researched enterprises. Global SMEs rely on development activities in the area of product innovations and risk diversification into other activities. In terms of changes in functional strategies this involves primarily the area of new technology and human resources development, and the ability to benefit from participation in networks of cooperating organizations. The second cluster, called “transition”, (approximately 59% of the respondents is developed mainly by means of investments in business specific knowledge, and/or in technical skills of their employees. They are more conservative in the area of product innovations and risk diversification into other activities, which is then reflected in a lower level of investments in technologies and marketing. In comparison with global enterprises the major difference lies in a much lower number of activities in the area

Restrição do 16S-23S DNAr intergênico para avaliação da diversidade de Azospirillum amazonense isolado de Brachiaria spp. Restriction of 16S-23S intergenic rDNA for diversity evaluation of Azospirillum amazonense isolated from different Brachiaria spp.

Directory of Open Access Journals (Sweden)

Fábio Bueno dos Reis Junior

2006-03-01

Full Text Available O objetivo deste trabalho foi avaliar a diversidade intra-específica de isolados de Azospirillum amazonense e estabelecer a possível influência de diferentes espécies de Brachiaria ssp. e diferentes condições edafoclimáticas. A caracterização da diversidade desses isolados foi conduzida, utilizando-se a análise de restrição da região intergênica 16S-23S DNAr. As estirpes estudadas separaram-se em dois grupos, definidos a 56% de similaridade. As espécies de Brachiaria ssp. influenciaram a diversidade de estirpes. A maioria dos isolados oriundos de B. decumbens e B. brizantha está inserida no primeiro grupo, enquanto os oriundos de B. humidicola concentram-se no segundo grupo.The aim of this work was to study the intra-specific diversity of Azospirillum amazonense isolates and to establish possible influences of different Brachiaria spp. and edaphoclimatic conditions. The characterization of the diversity among the isolates of A. amazonense studied was conducted using restriction analysis of the 16S-23S rDNA intergenic spacer region. The evaluated strains were separated in two groups, defined at 56% of similarity. Brachiaria spp. showed effects on strain diversity. Most part of the isolates from B. decumbens and B. brizantha are inserted in the first group, while B. humidicola isolates concentrate in the second group.

Small rural communities in the inland Northwest: an assessment of small communities in the interior and upper Columbia River basins.

Science.gov (United States)

Charles C. Harris; William McLaughlin; Greg Brown; Dennis R. Becker

2000-01-01

An assessment of small rural communities in the interior and upper Columbia River basin was conducted for the Interior Columbia Basin Ecosystem Management Project (ICBEMP). The characteristics and conditions of the rural communities in this region, which are complex and constantly changing, were examined. The research also assessed the resilience of the region’s...

Small satellites and their regulation

CERN Document Server

Jakhu, Ram S

2014-01-01

Since the launch of UoSat-1 of the University of Surrey (United Kingdom) in 1981, small satellites proved regularly to be useful, beneficial, and cost-effective tools. Typical tasks cover education and workforce development, technology demonstration, verification and validation, scientific and engineering research as well as commercial applications. Today the launch masses range over almost three orders of magnitude starting at less than a kilogram up to a few hundred kilograms, with budgets of less than US$ 100.00 and up to millions within very short timeframes of sometimes less than two years. Therefore each category of small satellites provides specific challenges in design, development and operations. Small satellites offer great potentials to gain responsive, low-cost access to space within a short timeframe for institutions, companies, regions and countries beyond the traditional big players in the space arena. For these reasons (particularly the low cost of construction, launch and operation), small (m...

Small-sample-worth perturbation methods

International Nuclear Information System (INIS)

1985-01-01

It has been assumed that the perturbed region, R/sub p/, is large enough so that: (1) even without a great deal of biasing there is a substantial probability that an average source-neutron will enter it; and (2) once having entered, the neutron is likely to make several collisions in R/sub p/ during its lifetime. Unfortunately neither assumption is valid for the typical configurations one encounters in small-sample-worth experiments. In such experiments one measures the reactivity change which is induced when a very small void in a critical assembly is filled with a sample of some test-material. Only a minute fraction of the fission-source neutrons ever gets into the sample and, of those neutrons that do, most emerge uncollided. Monte Carlo small-sample perturbations computations are described

Identification of rs671, a common variant of ALDH2, as a gout susceptibility locus

OpenAIRE

Sakiyama, Masayuki; Matsuo, Hirotaka; Nakaoka, Hirofumi; Yamamoto, Ken; Nakayama, Akiyoshi; Nakamura, Takahiro; Kawai, Sayo; Okada, Rieko; Ooyama, Hiroshi; Shimizu, Toru; Shinomiya, Nariyoshi

2016-01-01

Gout is a common disease resulting from hyperuricemia. Recently, a genome-wide association study identified an association between gout and a single nucleotide polymorphism (SNP) rs2188380, located on an intergenic region between MYL2 and CUX2 on chromosome 12. However, other genes around rs2188380 could possibly be gout susceptibility genes. Therefore, we performed a fine-mapping study of the MYL2-CUX2 region. From 8,595 SNPs in the MYL2-CUX2 region, 9 tag SNPs were selected, and genotyping ...

Mechanisms of membrane binding of small GTPase K-Ras4B farnesylated hypervariable region.

Science.gov (United States)

Jang, Hyunbum; Abraham, Sherwin J; Chavan, Tanmay S; Hitchinson, Ben; Khavrutskii, Lyuba; Tarasova, Nadya I; Nussinov, Ruth; Gaponenko, Vadim

2015-04-10

K-Ras4B belongs to a family of small GTPases that regulates cell growth, differentiation and survival. K-ras is frequently mutated in cancer. K-Ras4B association with the plasma membrane through its farnesylated and positively charged C-terminal hypervariable region (HVR) is critical to its oncogenic function. However, the structural mechanisms of membrane association are not fully understood. Here, using confocal microscopy, surface plasmon resonance, and molecular dynamics simulations, we observed that K-Ras4B can be distributed in rigid and loosely packed membrane domains. Its membrane binding domain interaction with phospholipids is driven by membrane fluidity. The farnesyl group spontaneously inserts into the disordered lipid microdomains, whereas the rigid microdomains restrict the farnesyl group penetration. We speculate that the resulting farnesyl protrusion toward the cell interior allows oligomerization of the K-Ras4B membrane binding domain in rigid microdomains. Unlike other Ras isoforms, K-Ras4B HVR contains a single farnesyl modification and positively charged polylysine sequence. The high positive charge not only modulates specific HVR binding to anionic phospholipids but farnesyl membrane orientation. Phosphorylation of Ser-181 prohibits spontaneous farnesyl membrane insertion. The mechanism illuminates the roles of HVR modifications in K-Ras4B targeting microdomains of the plasma membrane and suggests an additional function for HVR in regulation of Ras signaling. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

Determination of locust bean gum and guar gum by polymerase chain reaction and restriction fragment length polymorphism analysis.

Science.gov (United States)

Meyer, K; Rosa, C; Hischenhuber, C; Meyer, R

2001-01-01

A polymerase chain reaction (PCR) was developed to differentiate the thickening agents locust bean gum (LBG) and the cheaper guar gum in finished food products. Universal primers for amplification of the intergenic spacer region between trnL 3' (UAA) exon and trnF (GAA) gene in the chloroplast (cp) genome and subsequent restriction analysis were applied to differentiate guar gum and LBG. The presence of guar gum powder added to LBG powder was detectable. Based on data obtained from sequencing this intergenic spacer region, a second PCR method for the specific detection of guar gum DNA was also developed. This assay detected guar gum powder in LBG in amounts as low as 1% (w/w). Both methods successfully detected guar gum and/or LBG in ice cream stabilizers and in foodstuffs, such as dairy products, ice cream, dry seasoning mixes, a finished roasting sauce, and a fruit jelly product, but not in products with highly degraded DNA, such as tomato ketchup and sterilized chocolate cream. Both methods detected guar gum and LBG in ice cream and fresh cheese at levels <0.1%.

Regional anesthesia for small incision cataract surgery: Comparison of subtenon and peribulbar block

Directory of Open Access Journals (Sweden)

Oyebola Olubodun Adekola

2018-01-01

Full Text Available Background and Objective: The recent trend in cataract surgery is the use of regional ophthalmic nerve blocks or topical anesthesia. We determined and compared the effect of peribulbar and subtenon block on pain and patients' satisfaction, following small incision cataract surgery (SICS. Methods: This was age-sex-matched comparative study involving 462 ASA I-III patients, aged 18 years and above scheduled for SICS. They were assigned to receive either peribulbar block (Group P or subtenon (Group ST. The pain score and patients' satisfaction with the anesthetic experiences were recorded by a study-masked anesthesiologist during surgery and postoperatively at 30 min and 1, 2, 4, and 24 h. Results: The median numeric rating score was significantly lower in the subtenon group than the peribulbar group: During surgery, Group ST 1 (1 versus group P 1.5 (2.25, P < 0.001. At 30 min after surgery, Group ST 0 (1 versus Group P 1 (2.5 versus P < 0.001, and at 1 h after surgery, Group ST 0 (1 versus group P 1 (2, P = 0.002. Ten patients had akinesia in the peribulbar group compared with one in the subtenon group. Chemosis was significantly higher in the subtenon group 10 (3.2% than in the peribulbar group 0 (0%, P = 0.035. Similarly, a significant difference was not with subconjuctival hemorrhage; subtenon 14 (4.5% versus peribulbar 2 (1.3%, P = 0.105. Conclusion: The use of subtenon block resulted in lower pain scores and higher patient's satisfaction than peribulbar block. However, subconjuctival hemorrhage and chemosis were more common with subtenon block.

A comparison of small-area hospitalisation rates, estimated morbidity and hospital access.

Science.gov (United States)

Shulman, H; Birkin, M; Clarke, G P

2015-11-01

Published data on hospitalisation rates tend to reveal marked spatial variations within a city or region. Such variations may simply reflect corresponding variations in need at the small-area level. However, they might also be a consequence of poorer accessibility to medical facilities for certain communities within the region. To help answer this question it is important to compare these variable hospitalisation rates with small-area estimates of need. This paper first maps hospitalisation rates at the small-area level across the region of Yorkshire in the UK to show the spatial variations present. Then the Health Survey of England is used to explore the characteristics of persons with heart disease, using chi-square and logistic regression analysis. Using the most significant variables from this analysis the authors build a spatial microsimulation model of morbidity for heart disease for the Yorkshire region. We then compare these estimates of need with the patterns of hospitalisation rates seen across the region. Crown Copyright © 2015. Published by Elsevier Ltd. All rights reserved.

Novel transcripts discovered by mining genomic DNA from defined regions of bovine chromosome 6

Directory of Open Access Journals (Sweden)

Eberlein Annett

2009-04-01

Full Text Available Abstract Background Linkage analyses strongly suggest a number of QTL for production, health and conformation traits in the middle part of bovine chromosome 6 (BTA6. The identification of the molecular background underlying the genetic variation at the QTL and subsequent functional studies require a well-annotated gene sequence map of the critical QTL intervals. To complete the sequence map of the defined subchromosomal regions on BTA6 poorly covered with comparative gene information, we focused on targeted isolation of transcribed sequences from bovine bacterial artificial chromosome (BAC clones mapped to the QTL intervals. Results Using the method of exon trapping, 92 unique exon trapping sequences (ETS were discovered in a chromosomal region of poor gene coverage. Sequence identity to the current NCBI sequence assembly for BTA6 was detected for 91% of unique ETS. Comparative sequence similarity search revealed that 11% of the isolated ETS displayed high similarity to genomic sequences located on the syntenic chromosomes of the human and mouse reference genome assemblies. Nearly a third of the ETS identified similar equivalent sequences in genomic sequence scaffolds from the alternative Celera-based sequence assembly of the human genome. Screening gene, EST, and protein databases detected 17% of ETS with identity to known transcribed sequences. Expression analysis of a subset of the ETS showed that most ETS (84% displayed a distinctive expression pattern in a multi-tissue panel of a lactating cow verifying their existence in the bovine transcriptome. Conclusion The results of our study demonstrate that the exon trapping method based on region-specific BAC clones is very useful for targeted screening for novel transcripts located within a defined chromosomal region being deficiently endowed with annotated gene information. The majority of identified ETS represents unknown noncoding sequences in intergenic regions on BTA6 displaying a

Genome-wide mapping of transcription start sites yields novel insights into the primary transcriptome of Pseudomonas putida

DEFF Research Database (Denmark)

D'Arrigo, Isotta; Bojanovic, Klara; Yang, Xiaochen

2016-01-01

was examined using an in vivo assay with GFP-fusion vectors and shown to function via a translational repression mechanism. Furthermore, 56 novel intergenic small RNAs and 8 putative actuaton transcripts were detected, as well as 8 novel open reading frames (ORFs). This study illustrates how global mapping...... of TSSs can yield novel insights into the transcriptional features and RNA output of bacterial genomes....

The legitimation of the power process: experiences of small entrepreneurs in the region of Passo Fundo/RS.

Directory of Open Access Journals (Sweden)

Daniel Frasson Lima

2016-10-01

Full Text Available The legitimation of power among small entrepreneurs toward the employees was analyzed in the region of Passo Fundo/RS; it’s a process in which these entrepreneurs consolidate working relationships to perform their functions with self-confidence. A descriptive qualitative research was done and used as method of data collection a semi-structured interview, with observation and documental analysis. Four directors of franchises in the field of language education in the northern of Rio Grande do Sul participated in the research. The collected data were submitted to an interpretative analysis that made use of the academic frame to rescue the conception of power, its role and its fountainsin the organizations. The results reinforced the difficulties in measuring the legitimation of power. The phenomenon was investigated from an array of angles and a series of related factors were identified, provokingan evolution on its understanding.It was realized that the strategies of legitimation of the power vary according to the history and leadership style of the directors creating similar results in short term, but not always attending to professionalization and expansion matters.

Cytomolecular analysis of ribosomal DNA evolution in a natural allotetraploid Brachypodium hybridum and its putative ancestors – dissecting complex repetitive structure of intergenic spacers

Directory of Open Access Journals (Sweden)

Natalia Borowska-Zuchowska

2016-10-01

Full Text Available Nucleolar dominance is an epigenetic phenomenon associated with nuclear 35S rRNA genes and consists in selective suppression of gene loci inherited from one of the progenitors in the allopolyploid. Our understanding of the exact mechanisms that determine this process is still fragmentary, especially in case of the grass species. This study aimed to shed some light on the molecular basis of this genome-specific inactivation of 35S rDNA loci in an allotetraploid Brachypodium hybridum (2n=30, which arose from the interspecific hybridization between two diploid ancestors that were very similar to modern B. distachyon (2n=10 and B. stacei (2n=20. Using fluorescence in situ hybridization with 25S rDNA and chromosome-specific BAC clones as probes we revealed that the nucleolar dominance is present not only in meristematic root-tip cells but also in differentiated cell fraction of B. hybridum. Additionally, the intergenic spacers (IGSs from both of the putative ancestors and the allotetraploid were sequenced and analyzed. The presumptive transcription initiation sites, spacer promoters and repeated elements were identified within the IGSs. Two different length variants, 2.3 kb and 3.5 kb, of IGSs were identified in B. distachyon and B. stacei, respectively, however only the IGS that had originated from B. distachyon-like ancestor was present in the allotetraploid. The amplification pattern of B. hybridum IGSs suggests that some genetic changes occurred in inactive B. stacei-like rDNA loci during the evolution of the allotetraploid. We hypothesize that their preferential silencing is an effect of structural changes in the sequence rather than just the result of the sole inactivation at the epigenetic level.

Energy balance measurements over a small reservoir in Ghana's Upper East Region

Science.gov (United States)

van de Giesen, Nick; Ohene Annor, Frank

2013-04-01

Near the small village of Binaba (10.778927 deg N, 0.464859 deg E), a small irrigation reservoir has been instrumented to measure different parts of the energy balance of this water body. Instruments were placed on, or attached to, a spar platform. This platform consisted of a long PVC pipe, the spar, which is closed at the bottom. On the PVC pipe rests an aluminum frame platform that carries instrumentation and solar power panel. In turn, the platform rests partially on a large inflated tire. At the bottom of the PVC pipe, lead weights and batteries were placed to ensure a very low point of gravity to minimize wave impact on the platform movement. The tire ensures a large second moment of the water plane. The combination of large second momentum of the water plane and small displacement, ensures a high placement of the metacenter. The distance between the point of gravity and the metacenter is relatively long and the weight is large due to the weights and batteries. This ensures that the eigenfrequency of the platform is very low. On the platform, we fixed a WindMaster Pro (sonic anemometer for 3D wind speed and air temperature to perform eddy covariance measurements of sensible heat flux), a NR Lite (net radiometer), and air temperature and relative humidity sensors. Water temperature at different depths was measured with a string of TidbiT's (waterproof temperature sensors and loggers). The platform had a wind vane and the spar could turn freely around its anchor cable to ensure that the anemometer always faced upwind. A compass in the logger completed this setup. First results suggest, as expected, that the sensible heat flux is relatively small with on average 20 W/m2 over the course of a day. Sensible heat flux peaked around midnight at 35 W/m2, when the warm water warmed up the air from the colder surrounding land. The dynamics of heat storage during the daytime and longwave radiation during the night time, are important to calculate the latent heat flux.

Small is beautiful: Marine small-scale fisheries catches from the South-West Maluku Regency

Science.gov (United States)

Hutubessy, BG; Mosse, JW; Hayward, P.

2017-10-01

The fisheries data supplied by fisheries agency have served as the primary tool for regional fisheries statistics. However, it is recognized these data are incomplete and often underestimate actual catches, particularly for small-scale fisheries. There is no widely accepted definition of small-scale fisheries or global data on number of small-scale fishers and their catches. This study reconstructed total marine catches from 1980 to 2015 for South-west Maluku (MBD) regency, by applying an established catch construction approach utilizing all available quantitative and qualitative data, combined with assumption-based estimations and interpolations. As newly established regency since 2009, there is lack of fisheries data available which is needed for fisheries management. Fishers’ knowledge is important information taken from to construct long-term fisheries data. Estimated total fish withdrawal from MBD waters was 86,849.66 tonnes during 1980 - 2015, dominated by pelagic fishes. Consistency of estimated total removal and total landings at MBD regency play important role in small-scale fisheries management and this method of visualizing the history of fishery from poor-data condition might be an optimistic effort.

Methodological approach in determination of small spatial units in a highly complex terrain in atmospheric pollution research: the case of Zasavje region in Slovenia.

Science.gov (United States)

Kukec, Andreja; Boznar, Marija Z; Mlakar, Primoz; Grasic, Bostjan; Herakovic, Andrej; Zadnik, Vesna; Zaletel-Kragelj, Lijana; Farkas, Jerneja; Erzen, Ivan

2014-05-01

The study of atmospheric air pollution research in complex terrains is challenged by the lack of appropriate methodology supporting the analysis of the spatial relationship between phenomena affected by a multitude of factors. The key is optimal design of a meaningful approach based on small spatial units of observation. The Zasavje region, Slovenia, was chosen as study area with the main objective to investigate in practice the role of such units in a test environment. The process consisted of three steps: modelling of pollution in the atmosphere with dispersion models, transfer of the results to geographical information system software, and then moving on to final determination of the function of small spatial units. A methodology capable of designing useful units for atmospheric air pollution research in highly complex terrains was created, and the results were deemed useful in offering starting points for further research in the field of geospatial health.

Statistical analysis of the established salary in small and medium enterprises

Directory of Open Access Journals (Sweden)

Yu. S. Pin’kovetskaya

2017-01-01

Full Text Available The aim of the study was to analyze the present regularities, specific to the employees’ salaries of aggregates of small and medium enterprises related to the three dimensional categories and located in different regions of Russia. The following tasks were solved: the indexes, characterizing average monthly salary of employees based on the mentioned enterprises were assessed, belonging to different size categories and located in each of the regions; the relations were established between the average monthly salaries of employees of aggregates of small and medium enterprises and the cost of living in all regions of the country.Preliminary results of stopwatch reading of small and medium business activities in 2015 were used as initial data. The research was based on the comparison of indexes for the entrepreneurial sector and the full range of enterprises and organizations.Modeling differentiation of salaries’ values of small and medium enterprises aggregations, as well as its relationship to the values of the subsistence level was based on the development of the density function of normal distribution. The quality of the developed models was checked according to the Kolmogorov-Smirnov, Pearson and Shapiro-Wilk criteria.The obtained results have some theoretical significance, in particular, when conducting research related to the justification of the proposed wage of employees of enterprises different in number, the formation of measures for increasing efficiency of the entrepreneurial sector activity. Density functions of normal distribution given in the paper can be used in the justification of concepts, plans and programs of developing small and medium entrepreneurship in regions and municipalities. The practical importance of research results connected with the possibility of their use by entrepreneurs directly (especially by beginners when assessing the potential of enterprise creation and definition of employees’ proposed salaries. In

QCD coherence in the structure function and associated distributions at small x

International Nuclear Information System (INIS)

Marchesini, G.

1995-01-01

We recall the origin of angular ordering in soft parton emission and show that at small x this coherent structure is masked in the structure function while it can be detected in the associated distributions. This is due to the fact that collinear singularities cancel completely in the structure function at fixed transverse momentum for x →0. In this limit the dependence on the hard scale is lost, the angular ordered region becomes equivalent to the multi-Regge region in which all transverse momenta are of the same order, and one derives the BFKL equation. For the associated distributions at small x such a complete cancellation of collinear singularities does not hold in general, thus large singular contributions are neglected if angular ordering is replaced by multi-Regge phase space. The deduction of these features requires an analysis without any collinear approximations which is done by extending to small x the soft gluon factorization techniques typically used in the region of large x. Since the coherent structure of parton emission is the same in the small and large x regions, one can formulate a unified evolution equation for the structure function, a unified coherent branching and jet algorithm which allows the calculation of associated distributions in all x regions. Such a unified formulation, valid for all x, is presented and compared with usual treatments. ((orig.))

A diagnostic assay based on variable intergenic region distinguishes between Leishmania donovani and Leishmania infantum

Czech Academy of Sciences Publication Activity Database

Chocholová, Eva; Jirků, Milan; Lukeš, Julius

2008-01-01

Roč. 55, č. 1 (2008), s. 75-78 ISSN 0015-5683 R&D Projects: GA MŠk LC07032; GA MŠk 2B06129 Institutional research plan: CEZ:AV0Z60220518 Keywords : Leishmania * assay * diagnosis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.307, year: 2008

THE CLUSTERED NATURE OF STAR FORMATION. PRE-MAIN-SEQUENCE CLUSTERS IN THE STAR-FORMING REGION NGC 602/N90 IN THE SMALL MAGELLANIC CLOUD

International Nuclear Information System (INIS)

Gouliermis, Dimitrios A.; Gennaro, Mario; Schmeja, Stefan; Dolphin, Andrew E.; Tognelli, Emanuele; Prada Moroni, Pier Giorgio

2012-01-01

Located at the tip of the wing of the Small Magellanic Cloud (SMC), the star-forming region NGC 602/N90 is characterized by the H II nebular ring N90 and the young cluster of pre-main-sequence (PMS) and early-type main-sequence stars NGC 602, located in the central area of the ring. We present a thorough cluster analysis of the stellar sample identified with Hubble Space Telescope/Advanced Camera for Surveys in the region. We show that apart from the central cluster low-mass PMS stars are congregated in 13 additional small, compact sub-clusters at the periphery of NGC 602, identified in terms of their higher stellar density with respect to the average background density derived from star counts. We find that the spatial distribution of the PMS stars is bimodal, with an unusually large fraction (∼60%) of the total population being clustered, while the remaining is diffusely distributed in the intercluster area, covering the whole central part of the region. From the corresponding color-magnitude diagrams we disentangle an age difference of ∼2.5 Myr between NGC 602 and the compact sub-clusters, which appear younger, on the basis of comparison of the brighter PMS stars with evolutionary models, which we accurately calculated for the metal abundance of the SMC. The diffuse PMS population appears to host stars as old as those in NGC 602. Almost all detected PMS sub-clusters appear to be centrally concentrated. When the complete PMS stellar sample, including both clustered and diffused stars, is considered in our cluster analysis, it appears as a single centrally concentrated stellar agglomeration, covering the whole central area of the region. Considering also the hot massive stars of the system, we find evidence that this agglomeration is hierarchically structured. Based on our findings, we propose a scenario according to which the region NGC 602/N90 experiences an active clustered star formation for the last ∼5 Myr. The central cluster NGC 602 was formed first

Motif analysis unveils the possible co-regulation of chloroplast genes and nuclear genes encoding chloroplast proteins.

Science.gov (United States)

Wang, Ying; Ding, Jun; Daniell, Henry; Hu, Haiyan; Li, Xiaoman

2012-09-01

Chloroplasts play critical roles in land plant cells. Despite their importance and the availability of at least 200 sequenced chloroplast genomes, the number of known DNA regulatory sequences in chloroplast genomes are limited. In this paper, we designed computational methods to systematically study putative DNA regulatory sequences in intergenic regions near chloroplast genes in seven plant species and in promoter sequences of nuclear genes in Arabidopsis and rice. We found that -35/-10 elements alone cannot explain the transcriptional regulation of chloroplast genes. We also concluded that there are unlikely motifs shared by intergenic sequences of most of chloroplast genes, indicating that these genes are regulated differently. Finally and surprisingly, we found five conserved motifs, each of which occurs in no more than six chloroplast intergenic sequences, are significantly shared by promoters of nuclear-genes encoding chloroplast proteins. By integrating information from gene function annotation, protein subcellular localization analyses, protein-protein interaction data, and gene expression data, we further showed support of the functionality of these conserved motifs. Our study implies the existence of unknown nuclear-encoded transcription factors that regulate both chloroplast genes and nuclear genes encoding chloroplast protein, which sheds light on the understanding of the transcriptional regulation of chloroplast genes.

Phylogenetic relationships in Taxodiaceae and Cupressaceae sensu stricto based on matK gene, chlL gene, trnL-trnF IGS region, and trnL intron sequences.

Science.gov (United States)

Kusumi, J; Tsumura, Y; Yoshimaru, H; Tachida, H

2000-10-01

Nucleotide sequences from four chloroplast genes, the matK, chlL, intergenic spacer (IGS) region between trnL and trnF, and an intron of trnL, were determined from all species of Taxodiaceae and five species of Cupressaceae sensu stricto (s.s.). Phylogenetic trees were constructed using the maximum parsimony and the neighbor-joining methods with Cunninghamia as an outgroup. These analyses provided greater resolution of relationships among genera and higher bootstrap supports for clades compared to previous analyses. Results indicate that Taiwania diverged first, and then Athrotaxis diverged from the remaining genera. Metasequoia, Sequoia, and Sequoiadendron form a clade. Taxodium and Glyptostrobus form a clade, which is the sister to Cryptomeria. Cupressaceae s.s. are derived from within Taxodiaceae, being the most closely related to the Cryptomeria/Taxodium/Glyptostrobus clade. These relationships are consistent with previous morphological groupings and the analyses of molecular data. In addition, we found acceleration of evolutionary rates in Cupressaceae s.s. Possible causes for the acceleration are discussed.

Occupational and environmental mercury exposure among small-scale gold miners in the Talensi-Nabdam District of Ghana's Upper East region.

Science.gov (United States)

Paruchuri, Yasaswi; Siuniak, Amanda; Johnson, Nicole; Levin, Elena; Mitchell, Katherine; Goodrich, Jaclyn M; Renne, Elisha P; Basu, Niladri

2010-11-15

Mercury use in small-scale gold mining is ubiquitous across Ghana but little is known about the extent to which such activities have contaminated community residents and miners. Here, occupational exposures to elemental mercury (via urine sampling) and dietary exposures to methylmercury (via hair sampling) were assessed among 120 participants recruited from a mining community located in the Talensi-Nabdam District of Ghana's Upper East region during summer 2009. More than one-fifth of the participants had moderately high levels of urinary mercury (>10μg/L) and 5% had urine mercury levels that exceeded the WHO guideline value of 50μg/L. When participants were stratified according to occupation, those active in the mining industry had the highest mercury levels. Specifically, individuals that burned amalgam had urine mercury levels (median: 43.8μg/L; mean ± SD: 171.1±296.5μg/L; n=5) significantly higher than median values measured in mechanical operators (11.6μg/L, n=4), concession managers/owners (5.6μg/L, n=11), excavators that blast and chisel ore (4.9μg/L, n=33), individuals that sift and grind crushed ore (2.2μg/L, n=47), support workers (0.5μg/L, n=14), and those with no role in the mining sector (2.5μg/L, n=6). There was a significant positive Spearman correlation between fish consumption and hair mercury levels (r=0.30) but not with urine mercury (r=0.18) though further studies are needed to document which types of fish are consumed as well as portion sizes. Given that 200,000 people in Ghana are involved in the small-scale gold mining industry and that the numbers are expected to grow in Ghana and many other regions of the world, elucidating mercury exposure pathways in such communities is important to help shape policies and behaviors that may minimize health risks. Copyright © 2010 Elsevier B.V. All rights reserved.

Project of Carbon Capture in Small and Medium Farms in the Brunca Region, Costa Rica

Directory of Open Access Journals (Sweden)

Gilmar Navarrete

2013-12-01

Full Text Available The Clean Development Mechanism (CDM of the Kyoto Protocol, allows the non Annex 1 countries to receive projects that contribute to reducing greenhouse gas emissions and sustainable development in developing countries. The CDM, since its inception, has issued credits equivalent to 1.434.737.562 tons of CO2, distributed across 7.450 projects around the world, from 15 different sectors. Sectors 14 that allow forestry projects (such as reforestation and afforestation have registered 53 projects to date; 19 of which are in Latin America. Nevertheless, the contribution of this sector currently represents less than 1% of CDM Certificates of Emissions Reduction (CERs issued. In September 2013, through their National Forestry Financing Fund (FONAFIFO, Costa Rica registered their first CDM project with the United Nations Framework Convention on Climate Change (UNFCCC, after having complied with all the project cycle processes. The project, known as "Carbon Sequestration in Small and Medium Farms, Brunca Region, Costa Rica" was a project executed by FONAFIFO under their Environmental Services Payment Program. This project was developed in Pérez Zeledón, San José, Costa Rica in partnership with the Cooperative Corporation CoopeAgri RL. The total goal of the project is to reduce the greenhouse gas emission by 176,050 ton of CO2-e, in a period of 20 years and commercialize the CERs in the regulated carbon market.

The mouse small eye mutant, Del(2)Sey3H, which deletes the putative tumor suppressor region of the radiation-induced acute myeloid leukemia is susceptible to radiation

International Nuclear Information System (INIS)

Nitta, Yumiko; Yoshida, Kazuko; Tanaka, Kimio; Peters, Jo; Cattanach, Bruce M.

2003-01-01

Radiation-induced murine acute myeloid leukemia (AML) is characterized by the chromosome 2 deletions. Standing on the hypothesis that an AML suppressor gene would locate on the chromosome 2, a deletion-wide screen was performed on radiation-induced AMLs by the fluorescence in situ hybridization (FISH) method. The hemizugous deletion of the D2Mit15, a marker DNA at the 49.0cM region from the centromere, associated with the AMLs in 97 out of the 105 cases (92.4%). As the deletion region was close to the region of human WAGR syndrome (MIM194072), the mouse small eye mutants could be the animal model for radiation-induced AMLs. The mutant, Del(2)Sey3H (Sey3H) was found to delete around the 49.0cM region by the allelic loss mapping. The Sey3H showed high susceptibility to radiation to develop tumors including the myeloid leukemia with shorter latency. These finding support the existence of a putative tumor suppressor gene responsible for the radiation-leukemogenesis near the D2Mit15 region. (author)

Brain regions for sound processing and song release in a small grasshopper.

Science.gov (United States)

Balvantray Bhavsar, Mit; Stumpner, Andreas; Heinrich, Ralf

2017-05-01

We investigated brain regions - mostly neuropils - that process auditory information relevant for the initiation of response songs of female grasshoppers Chorthippus biguttulus during bidirectional intraspecific acoustic communication. Male-female acoustic duets in the species Ch. biguttulus require the perception of sounds, their recognition as a species- and gender-specific signal and the initiation of commands that activate thoracic pattern generating circuits to drive the sound-producing stridulatory movements of the hind legs. To study sensory-to-motor processing during acoustic communication we used multielectrodes that allowed simultaneous recordings of acoustically stimulated electrical activity from several ascending auditory interneurons or local brain neurons and subsequent electrical stimulation of the recording site. Auditory activity was detected in the lateral protocerebrum (where most of the described ascending auditory interneurons terminate), in the superior medial protocerebrum and in the central complex, that has previously been implicated in the control of sound production. Neural responses to behaviorally attractive sound stimuli showed no or only poor correlation with behavioral responses. Current injections into the lateral protocerebrum, the central complex and the deuto-/tritocerebrum (close to the cerebro-cervical fascicles), but not into the superior medial protocerebrum, elicited species-typical stridulation with high success rate. Latencies and numbers of phrases produced by electrical stimulation were different between these brain regions. Our results indicate three brain regions (likely neuropils) where auditory activity can be detected with two of these regions being potentially involved in song initiation. Copyright © 2017 Elsevier Ltd. All rights reserved.

Use of reservoir deposits to reconstruct the recent changes in sediment yields from a small granite catchment in the Yimeng Mountain region, China

Science.gov (United States)

Zhang, Yunqi; Long, Yi; Li, Bao; Xu, Shujian; Wang, Xiaoli; Liao, Jia

2017-09-01

Information on recent changes in sediment yields from small catchments provides a better understanding of temporal trends in soil loss from certain physical and human-influenced landscapes that have been subjected to recent environmental changes, and will help bridge the current knowledge gap that exists between hillslope erosion and sediment transport in rivers. The Yimeng Mountain region, characterized by alternating granite and limestone, is one of the most susceptible regions to soil erosion in northern China, and has been subjected to intensive anthropogenic activity in recent years. Soil loss from areas underlain by granite is particularly obvious, and is the main sediment source for the Yihe River. In this study, we used reservoir deposits to estimate the changes in sediment yields over the past 50 years from a small catchment underlain by granite, namely the Jiangzhuang catchment in the Yimeng Mountain region. Three cores were collected from the Jiangzhuang Reservoir in the catchment. The activities of 137Cs and 210Pbex at different depths, clay (grain size reference to human activity and environmental change in the catchment. The chronologies of the cores were established by 137Cs and 210Pbex dating. The area-specific sediment yield (SSY) for different time periods since dam construction was estimated from each core by referring to the original capacity curve of the reservoir. The results indicate that the depth profiles of 137Cs, 210Pbex, clay, and SOC contents in cores from the Jiangzhuang Reservoir reflect the general history of human disturbances on the catchment over the past 50 years. The estimated SSY value from each core for each period ranged from 7.2 ± 2.7 to 23.7 ± 8.3 t ha- 1 y- 1, with a mean of 12.5 ± 4.6 t ha- 1 y- 1. SSY decreased during 1954-1972, and then showed a general tendency to increase. The temporal pattern of the sediment yield largely reflects the history of environmental change influenced by human activity in the catchment.

Small bowel tissue engineering using small intestinal submucosa as a scaffold.

Science.gov (United States)

Chen, M K; Badylak, S F

2001-08-01

Small intestinal submucosa (SIS) is an extracellular matrix used in tissue engineering studies to create de novo abdominal wall, urinary bladder, tendons, blood vessels, and dura mater. The purpose of this study is to evaluate the feasibility of using SIS as a scaffold for small bowel regeneration in an in situ xenograft model. Twenty-three dogs had a partial defect created on the small bowel wall which was repaired with a SIS patch. Four dogs underwent small bowel resection with placement of an interposed tube of SIS. The animals were followed 2 weeks to 1 year. Three of the 23 dogs with SIS placed as a patch died shortly after surgery due to leakage from the site. The other 20 dogs survived up to time of elective necropsy with no evidence of intestinal dysfunction. At necropsy, the bowel circumference in the patched area had no stenosis. Histological evaluation showed the presence of a mucosal epithelial layer, varying amount of smooth muscle, sheets of collagen, and a serosal covering. Architecturally, the layers were not well organized in the submucosal region. An abundance of inflammatory cells was present in the early postoperative period but receded with time. All 4 dogs with a tubular segment of SIS interposed had significant problems. One had partial obstruction at 1 month, and 3 died in the early postoperative period due to leakage. This preliminary study suggests that SIS patches can be used for small bowel regeneration. Tubular segmental replacement is not feasible at this time. Copyright 2001 Academic Press.

Small Hydropower Development in Rwanda: Trends, Opportunities and Challenges

Science.gov (United States)

Geoffrey, Gasore; Zimmerle, Daniel; Ntagwirumugara, Etienne

2018-04-01

The Rift Valley region of Sub-Saharan Africa represents a promising area for the development of small (facilities constructed after 2007 are connected to off-grid systems. The study provides an overview of the economic incentives for developing small hydropower systems in Rwanda and the potential contribution of that development to Rwanda’s electrification goals.

Localization of the MEN1 gene to a small region within chromosome 11q13 by deletion mapping in tumors

International Nuclear Information System (INIS)

Bystroem, C.; Larsson, C.; Blomberg, C.; Nordenskjoeld, M.; Sandelin, K.; Falkmer, U.; Werner, S.; Skogseid, B.; Oeberg, K.

1990-01-01

The gene for multiple endocrine neoplasia type 1 (MEN1), and inherited predisposition to neuroendocrine neoplasm of the parathyroid glands, the pancreatic islet parenchyma, and the anterior pituitary gland, was recently mapped to chromosome 11q13 based on genetic linkage in families. The authors now show that the pathogenesis of MEN1-associated parathyroid lesions involves unmasking of a recessive mutation at the disease locus and that sporadic primary hyperparathyroidism shares the same mechanisms. By examination of allele losses in MEN1-associated lesions, they could define deletions of chromosome 11 and map the MEN1 locus to a small region within chromosome band 11q13, telomeric to the PYGM locus. In contrast, a low incidence of deletions involving the MEN1 gene was found in sporadic pituitary adenomas

Going global - growing small businesses

International Nuclear Information System (INIS)

Anderson, D.R.

1994-01-01

The Going Global Energy Steering Committee was established to help small and medium-sized Canadian enterprises to compete in the electrical power industry in the Asia-Pacific region primarily, but also in Eastern Europe and Latin America. The aim is to provide market intelligence, and help with forming consortia for financing. A small to medium-sized business can be defined as one with 50 to 500 employees. Big businesses no longer have the same competitive advantages that they once had, because automated systems can make short production runs just as cost-effective as long ones, and because computerization, automation and rising productivity mean that fewer workers are required than formerly

SMALL HYDRO PLANTS IN LAND USE SYSTEM PLANNING IN POLAND

Directory of Open Access Journals (Sweden)

Anita Bernatek

2014-10-01

Full Text Available Small hydropower plants are present in the land use system planning in Poland. At the national level the important role of spatial planning in the development of renewable energy was highlighted, included small hydroplants. However, it seems that at the regional level this demand has not been realized. The necessity of developing small hydroplants as a renewable energy was highlighted, but negative environmental impact was not indicated. At local level legal instrument of small hydropower plants is specified.

The Ethical Perceptions of Small Business Owners

OpenAIRE

Aydemir, Muzaffer

2006-01-01

This paper reports the findings of an investigation into the ethical perceptions of small business owner/managers. The study has been conducted in Northwest region of Turkey and is the first investigation of ethical perceptions in Turkey. More than 99 percent of the companies in Turkey are small businesses and they play a key role in driving sustainable economic growth and job creation. However, they remain the largely unexplored area of ethics. Most of the findings of this stu...

75 FR 22168 - Region VI-Houston District; Advisory Council Meeting; Public Meeting

Science.gov (United States)

2010-04-27

... SMALL BUSINESS ADMINISTRATION Region VI--Houston District; Advisory Council Meeting; Public Meeting The Small Business Administration-Region VI--Houston Advisory Council, located in the geographical Area of Houston, Texas will hold a federal public meeting on--Thursday, May 20, 2010, starting at 10:30...

Small Mammals, Reptiles, and Amphibians

Science.gov (United States)

Bryce Rickel

2005-01-01

This chapter focuses on small mammals, reptiles, and amphibians that inhabit the grasslands within the Southwestern Region of the USDA Forest Service. The chapter is not intended to be an all inclusive list of species, but rather to address the species that play important roles in grassland ecosystems and that often are associated with the management of grasslands....

Kabachenko A. Restoration of entrepreneurial activity rate in the context of Donetsk region labor market stabilization

OpenAIRE

Кабаченко, Г. С.

2015-01-01

In the article the state of entrepreneurship inDonetskregion, which is characterized by: disproportion specialization of small enterprises by economic activity; uneven deployment of small businesses in the region; the tendency to reduce business in the region; uneven distribution of human capital size enterprises. The analysis shows that small and medium businesses in the region and slowed develops unevenly. Its potential is not realized sufficiently due to several problems at both the region...

Long noncoding RNA HOTAIR is relevant to cellular proliferation, invasiveness, and clinical relapse in small-cell lung cancer

International Nuclear Information System (INIS)

Ono, Hiroshi; Motoi, Noriko; Nagano, Hiroko; Miyauchi, Eisaku; Ushijima, Masaru; Matsuura, Masaaki; Okumura, Sakae; Nishio, Makoto; Hirose, Tetsuro; Inase, Naohiko; Ishikawa, Yuichi

2014-01-01

Small-cell lung cancer (SCLC) is a subtype of lung cancer with poor prognosis. To identify accurate predictive biomarkers and effective therapeutic modalities, we focus on a long noncoding RNA, Hox transcript antisense intergenic RNA (HOTAIR), and investigated its expression, cellular functions, and clinical relevance in SCLC. In this study, HOTAIR expression was assessed in 35 surgical SCLC samples and 10 SCLC cell lines. The efficacy of knockdown of HOTAIR by siRNA transfection was evaluated in SBC-3 cells in vitro, and the gene expression was analyzed using microarray. HOTAIR was expressed highly in pure, rather than combined, SCLC (P = 0.012), that the subgroup with high expression had significantly more pure SCLC (P = 0.04), more lymphatic invasion (P = 0.03) and more relapse (P = 0.04) than the low-expression subgroup. The knockdown of HOTAIR in SBC-3 cells led to decreased proliferation activity and decreased invasiveness in vitro. Gene expression analysis indicated that depletion of HOTAIR resulted in upregulation of cell adhesion-related genes such as ASTN1, PCDHA1, and mucin production-related genes such as MUC5AC, and downregulation of genes involved in neuronal growth and signal transduction including NTM and PTK2B. Our results suggest that HOTAIR has an oncogenic role in SCLC and could be a prognostic biomarker and therapeutic target

Trading off natural resources and rural livelihoods. A framework for sustainability assessment of small-scale food production in water-limited regions

Science.gov (United States)

Recanati, Francesca; Castelletti, Andrea; Dotelli, Giovanni; Melià, Paco

2017-12-01

Enhancing local production is key to promoting food security, especially in rural households of low-income countries, but may conflict with limited natural resources and ecosystems preservation. We propose a framework integrating the water-food nexus and a sustainable livelihoods perspective to assess small-scale food production in water-poor regions. We demonstrate it by assessing alternative production scenarios in the Gaza Strip at different spatial scales. At the scale of a single farm, there is a clear conflict among objectives: while cash crops ensure good incomes but contribute scarcely to domestic protein supply, crops performing well from the nutritional and environmental viewpoint are among the worst from the economic one. At the regional scale, domestic production might cover an important fraction of nutritional needs while contributing to household income, but water scarcity impairs the satisfaction of food demand by domestic production alone. Pursuing food security under multiple constraints thus requires a holistic perspective: we discuss how a multidimensional approach can promote the engagement of different stakeholders and allow the exploration of trade-offs between food security, sustainable exploitation of natural resources and economic viability.

In silico analysis of Simple Sequence Repeats from chloroplast genomes of Solanaceae species

Directory of Open Access Journals (Sweden)

Evandro Vagner Tambarussi

2009-01-01

Full Text Available The availability of chloroplast genome (cpDNA sequences of Atropa belladonna, Nicotiana sylvestris, N.tabacum, N. tomentosiformis, Solanum bulbocastanum, S. lycopersicum and S. tuberosum, which are Solanaceae species,allowed us to analyze the organization of cpSSRs in their genic and intergenic regions. In general, the number of cpSSRs incpDNA ranged from 161 in S. tuberosum to 226 in N. tabacum, and the number of intergenic cpSSRs was higher than geniccpSSRs. The mononucleotide repeats were the most frequent in studied species, but we also identified di-, tri-, tetra-, pentaandhexanucleotide repeats. Multiple alignments of all cpSSRs sequences from Solanaceae species made the identification ofnucleotide variability possible and the phylogeny was estimated by maximum parsimony. Our study showed that the plastomedatabase can be exploited for phylogenetic analysis and biotechnological approaches.

Networking of small cities to gain sustainability

OpenAIRE

Mingaleva , Zhanna; Sheresheva , Marina; Oborin , Matvey; Gvarliani , Tatyana

2017-01-01

International audience; The paper addresses networking as a basis for cooperation of small cities leading to more sustainable regional development at the city, regional, and federal level. It is shown that networking of cities can contribute to increasing sustainability in many ways. Still, additional research is needed to adjust best management practices discussed in the relevant academic literature to the peculiarities of transition economies. The objective of the research presented in the ...

Road Zone Effects in Small-Mammal Communities

Directory of Open Access Journals (Sweden)

John A. Bissonette

2009-06-01

Full Text Available Our study focused on the putative effects of roads on small-mammal communities in a high desert region of southern Utah. Specifically, we tested whether or not roads create adjacent zones characterized by lower small- mammal densities, abundance, and diversity. We sampled abundance of small mammals at increasing distances from Interstate 15 during two summers. We recorded 11 genera and 13 species. We detected no clear abundance, density, or diversity effects relative to distance from the road. Only two of 13 species were never captured near roads. The abundance of the remaining 11 small mammal species was either similar at different distances from the road or higher closer to the road. We conclude that although roads may act as barriers and possible sources of mortality, adjacent zones of vegetation often provide favorable microhabitat in the desert landscape for many small mammals.

Small regulatory RNAs may sharpen spatial expression patterns.

Directory of Open Access Journals (Sweden)

Erel Levine

2007-11-01

Full Text Available The precise establishment of gene expression patterns is a crucial step in development. Formation of a sharp boundary between high and low spatial expression domains requires a genetic mechanism that exhibits sensitivity, yet is robust to fluctuations, a demand that may not be easily achieved by morphogens alone. Recently, it has been demonstrated that small RNAs (and, in particular, microRNAs play many roles in embryonic development. Whereas some RNAs are essential for embryogenesis, others are limited to fine-tuning a predetermined gene expression pattern. Here, we explore the possibility that small RNAs participate in sharpening a gene expression profile that was crudely established by a morphogen. To this end, we study a model in which small RNAs interact with a target gene and diffusively move from cell to cell. Though diffusion generally smoothens spatial expression patterns, we find that intercellular mobility of small RNAs is actually critical in sharpening the interface between target expression domains in a robust manner. This sharpening occurs as small RNAs diffuse into regions of low mRNA expression and eliminate target molecules therein, but cannot affect regions of high mRNA levels. We discuss the applicability of our results, as examples, to the case of leaf polarity establishment in maize and Hox patterning in the early Drosophila embryo. Our findings point out the functional significance of some mechanistic properties, such as mobility of small RNAs and the irreversibility of their interactions. These properties are yet to be established directly for most classes of small RNAs. An indirect yet simple experimental test of the proposed mechanism is suggested in some detail.

Small Screen Technology Use among Indigenous Boarding School Adolescents from Remote Regions of Western Australia

Science.gov (United States)

Johnson, Genevieve Marie; Oliver, Rhonda

2014-01-01

The uptake of small screen technology by adolescents is widespread, particularly in industrial nations. Whether the same is true for Australian Aboriginal youth is less clear as there is a dearth of research in this regard. Therefore, in this exploratory study the use of small screen technology by Indigenous students was examined. Twenty-four…

Non-Meckel Small Intestine Diverticulitis

Directory of Open Access Journals (Sweden)

Shamim Ejaz

2017-08-01

Full Text Available Non-Meckel small intestine diverticulitis can have many manifestations and its management is not well-defined. We report 4 unselect cases of small intestine diverticulitis; all patients were seen by the same physician at the Emergency Center at The University of Texas MD Anderson Cancer Center between 1999 and 2014. The median age at diagnosis of these patients was 82 years (range, 76–87 years. All 4 patients presented with acute onset of abdominal pain, and computed tomography scans showed characteristics of small intestine diverticulitis unrelated to cancer. Most of the diverticula were found in the region of the duodenum and jejuno-ileal segments of the small intestine. The patients, even those with peripancreatic inflammation and localized perforation, were treated conservatively. Non-Meckel diverticulitis can be overlooked in the initial diagnosis because of the location of the diverticulosis, the age of the patient, and the rarity of the disease. Because patients with non-Meckel small intestine diverticulitis can present with acute abdominal pain, non-Meckel small intestine diverticulitis should be considered in the differential diagnosis of patients with acute abdominal pain, and computed tomography scans can help identify the condition. Because of the rarity of non-Meckel small intestine diverticulitis, few studies have been published, and the data are inconclusive about how best to approach these patients. Our experience with these 4 elderly patients indicates that non-Meckel small intestine diverticulitis can be treated conservatively, which avoids the potential morbidity and mortality of a surgical approach.

Staphylococcus nepalensis sp. nov., isolated from goats of the Himalayan region.

Science.gov (United States)

Spergser, Joachim; Wieser, Monika; Täubel, Martin; Rosselló-Mora, Ramon A; Rosengarten, Renate; Busse, Hans-Jürgen

2003-11-01

Four coagulase-negative, novobiocin-resistant cocci, designated CW1(T), PM34, MM3 and RW78, were isolated from the respiratory tract of goats kept in the Himalayan region. The four isolates were assigned to a single species on the basis of almost identical biochemical and physiological traits, protein profiles obtained after SDS-PAGE and identical genomic fingerprints generated after enterobacterial repetitive intergenic consensus (ERIC)-PCR. Strain CW1(T) showed highest 16S rDNA sequence similarities to Staphylococcus cohnii subsp. urealyticus ATCC 49330(T), Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305(T), S. cohnii subsp. cohnii ATCC 29974(T), Staphylococcus arlettae ATCC 43957(T), Staphylococcus gallinarum ATCC 35539(T), Staphylococcus succinus ATCC 700337(T) and Staphylococcus xylosus ATCC 29971(T) (99.0, 98.8, 98.8, 98.4, 98.2, 98.1 and 98.1 %, respectively), indicating its classification within the genus Staphylococcus. The polar lipid composition, fatty acid profiles, quinone systems and diagnostic cell-wall diamino acid were in agreement with the characteristics of the genus Staphylococcus. DNA-DNA hybridization with closely related Staphylococcus species suggested that strain CW1(T) represents an as-yet unrecognized species. Based on these results, a novel species of the genus Staphylococcus is described, Staphylococcus nepalensis sp. nov. The type strain is CW1(T) (=DSM 15150(T)=CCM 7045(T)) and the most dissimilar strain is PM34 (=DSM 15151=CCM 7046).

Transformation of the Zagreb urban region

Directory of Open Access Journals (Sweden)

Milan Ilić

2004-01-01

Full Text Available Several aspects of the transformation of theZagreb urban region are considered in this work: change in the regionćssize and form, socio-economic transformation, functional transformation andphysiognomic or morphological transformation. It was established that theregionćs form has changed: it is moving from the classic star-like form,characteristic of the early developmental phase of the urban region, to acircular form. The region has experienced evolution in the developmentalsense and reached a phase of absolute decentralization. The process oftransformation in the region is continuing at full pace, while onlyperipheral, mainly small and poorly linked settlements with an unfavorabledemographic balance and processes are lagging behind.

Regional Focus on Small-scale wind power (<50kW) in southeastern Sweden within the Network for wind farms. Final Report, Project No. 31852-1. ; Regional Satsning paa Smaaskalig vindkraft (<50kW) i sydoestra Sverige inom Naetverket foer vindbruk. Slutrapport, projekt nr 31852-1.

Energy Technology Data Exchange (ETDEWEB)

Tyrberg, Lennart (ed.)

2011-07-01

Energy Agency for Southeast Sweden AB, the Swedish Network for wind farming and the EU project RuralRES have collaborated in this project. The project has resulted in a competence buildup and dissemination of small-scale wind power knowledge. The project has, among other things documented good practices and performs feasibility studies for establishment of small scale wind power. This work has led to an understanding of preconditions for a successful investment in small-scale wind power. The dissemination of this knowledge here in the region, in other parts of Sweden and to other partners in the EU project has contributed to a more realistic level of expectations on small-scale wind power, something that is very important for the industry's continued development. A good wind location is the most important prerequisite for a successful wind power project; this applies to small as well as large-scale wind power. Availability of reliable wind turbines with good performance is important for the development of the industry. Further, it should be reasonably easy to get building permits and permits for electricity connection. The growth might be stimulated by the introduction of net charging and an adaptation of the electricity certificate system for small producers.

Dispersals of Hyoscyameae and Mandragoreae (Solanaceae) from the New World to Eurasia in the early Miocene and their biogeographic diversification within Eurasia.

Science.gov (United States)

Tu, Tieyao; Volis, Sergei; Dillon, Michael O; Sun, Hang; Wen, Jun

2010-12-01

The cosmopolitan Solanaceae contains 21 tribes and has the greatest diversity in South America. Hyoscyameae and Mandragoreae are the only tribes of this family distributed exclusively in Eurasia with two centers of diversity: the Mediterranean-Turanian (MT) region and the Tibetan Plateau (TP). In this study, we examined the origins and biogeographical diversifications of the two tribes based on the phylogenetic framework and chronogram inferred from a combined data set of six plastid DNA regions (the atpB gene, the ndhF gene, the rps16-trnK intergenic spacer, the rbcL gene, the trnC-psbM region and the psbA-trnH intergenic spacer) with two fossil calibration points. Our data suggest that Hyoscyameae and Mandragoreae each forms a monophyletic group independently derived from different New World lineages in the early Miocene. Phylogenetic relationships within both tribes are generally well resolved. All genera of Hyoscyameae are found to be monophyletic and they diversified in middle to late Miocene. At nearly the same time, Mandragoreae split into two clades, corresponding to the MT region and the TP region, respectively. Both the phylogenetic relationships and the estimated ages of Hyoscyameae and Mandragoreae support two independent dispersal events of their ancestors from the New World into Eurasia. After their arrivals in Eurasia, the two tribes diversified primarily in the MT region and in the TP region via multiple biogeographic processes including vicariance, dispersal, recolonization or being preserved as relicts, from the mid Miocene to the late Quaternary. Published by Elsevier Inc.

Comparison of automated ribosomal intergenic spacer analysis (ARISA) and denaturing gradient gel electrophoresis (DGGE) techniques for analysing the influence of diet on ruminal bacterial diversity.

Science.gov (United States)

Saro, Cristina; Molina-Alcaide, Eduarda; Abecia, Leticia; Ranilla, María José; Carro, María Dolores

2018-04-01

The objective of this study was to compare the automated ribosomal intergenic spacer analysis (ARISA) and the denaturing gradient gel electrophoresis (DGGE) techniques for analysing the effects of diet on diversity in bacterial pellets isolated from the liquid (liquid-associated bacteria (LAB)) and solid (solid-associated bacteria (SAB)) phase of the rumen. The four experimental diets contained forage to concentrate ratios of 70:30 or 30:70 and had either alfalfa hay or grass hay as forage. Four rumen-fistulated animals (two sheep and two goats) received the diets in a Latin square design. Bacterial pellets (LAB and SAB) were isolated at 2 h post-feeding for DNA extraction and analysed by ARISA and DGGE. The number of peaks in individual samples ranged from 48 to 99 for LAB and from 41 to 95 for SAB with ARISA, and values of DGGE-bands ranged from 27 to 50 for LAB and from 18 to 45 for SAB. The LAB samples from high concentrate-fed animals tended (p forage-fed animals with ARISA, but no differences were identified with DGGE. The SAB samples from high concentrate-fed animals had lower (p forage diets with ARISA, but only a trend was noticed for these parameters with DGGE (p forage type on LAB diversity was detected by any technique. In this study, ARISA detected some changes in ruminal bacterial communities that were not detected by DGGE, and therefore ARISA was considered more appropriate for assessing bacterial diversity of ruminal bacterial pellets. The results highlight the impact of the fingerprinting technique used to draw conclusions on dietary factors affecting bacterial diversity in ruminal bacterial pellets.

A limited cone-beam CT for dental, head and neck regions

International Nuclear Information System (INIS)

Kirimura, Susumu

2004-01-01

Recently, limited cone-beam CTs for dental or head-and-neck regions, which utilize two-dimensional X-ray detectors, have been gaining popularity. With one single rotation, they provide high-resolution volumetric data of a small region, which is suitable for specialized medical applications in the dental and otorhinolaryngology fields. It is particularly useful in visualizing small structures such as temporal, maxilla or mandibula bones. Since the imaging area is limited to a small but sufficient region, it can reduce unnecessary X-ray exposure to the patient. As the entire system is designed to be space-efficient compared to existing CT systems in the field, it is possible fit the unit into a small clinic. This type of device can be a far more practical and useful tool than an existing CT for special applications requiring detailed imaging of the fine bone structures of teeth, the middle ear, etc. (author)

The complete mitochondrial genome of the land snail Cornu aspersum (Helicidae: Mollusca: intra-specific divergence of protein-coding genes and phylogenetic considerations within Euthyneura.

Directory of Open Access Journals (Sweden)

Juan Diego Gaitán-Espitia

Full Text Available The complete sequences of three mitochondrial genomes from the land snail Cornu aspersum were determined. The mitogenome has a length of 14050 bp, and it encodes 13 protein-coding genes, 22 transfer RNA genes and two ribosomal RNA genes. It also includes nine small intergene spacers, and a large AT-rich intergenic spacer. The intra-specific divergence analysis revealed that COX1 has the lower genetic differentiation, while the most divergent genes were NADH1, NADH3 and NADH4. With the exception of Euhadra herklotsi, the structural comparisons showed the same gene order within the family Helicidae, and nearly identical gene organization to that found in order Pulmonata. Phylogenetic reconstruction recovered Basommatophora as polyphyletic group, whereas Eupulmonata and Pulmonata as paraphyletic groups. Bayesian and Maximum Likelihood analyses showed that C. aspersum is a close relative of Cepaea nemoralis, and with the other Helicidae species form a sister group of Albinaria caerulea, supporting the monophyly of the Stylommatophora clade.

Genetic health and population monitoring of two small black bear (Ursus americanus populations in Alabama, with a regional perspective of genetic diversity and exchange.

Directory of Open Access Journals (Sweden)

John P Draper

Full Text Available One of the major concerns in conservation today is the loss of genetic diversity which is a frequent consequence of population isolation and small population sizes. Fragmentation of populations and persecution of carnivores has posed a substantial threat to the persistence of free ranging carnivores in North America since the arrival of European settlers. Black bears have seen significant reductions in range size from their historic extent, which is most pronounced in the southeastern United States and even more starkly in Alabama where until recently bears were reduced to a single geographically isolated population in the Mobile River Basin. Recently a second population has naturally re-established itself in northeastern Alabama. We sought to determine size, genetic diversity and genetic connectivity for these two populations in relation to other regional populations. Both populations of black bears in Alabama had small population sizes and had moderate to low genetic diversity, but showed different levels of connectivity to surrounding populations of bears. The Mobile River Basin population had a small population size at only 86 individuals (76-124, 95% C.I., the lowest genetic diversity of compared populations (richness = 2.33, Ho and He = 0.33, and showed near complete genetic isolation from surrounding populations across multiple tests. The newly recolonizing population in northeastern Alabama had a small but growing population doubling in 3 years (34 individuals 26-43, 95% C.I., relatively moderate genetic diversity compared to surrounding populations (richness = 3.32, Ho = 0.53, He = 0.65, and showed a high level of genetic connectivity with surrounding populations.

Genetic health and population monitoring of two small black bear (Ursus americanus) populations in Alabama, with a regional perspective of genetic diversity and exchange.

Science.gov (United States)

Draper, John P; Waits, Lisette P; Adams, Jennifer R; Seals, Christopher L; Steury, Todd D

2017-01-01

One of the major concerns in conservation today is the loss of genetic diversity which is a frequent consequence of population isolation and small population sizes. Fragmentation of populations and persecution of carnivores has posed a substantial threat to the persistence of free ranging carnivores in North America since the arrival of European settlers. Black bears have seen significant reductions in range size from their historic extent, which is most pronounced in the southeastern United States and even more starkly in Alabama where until recently bears were reduced to a single geographically isolated population in the Mobile River Basin. Recently a second population has naturally re-established itself in northeastern Alabama. We sought to determine size, genetic diversity and genetic connectivity for these two populations in relation to other regional populations. Both populations of black bears in Alabama had small population sizes and had moderate to low genetic diversity, but showed different levels of connectivity to surrounding populations of bears. The Mobile River Basin population had a small population size at only 86 individuals (76-124, 95% C.I.), the lowest genetic diversity of compared populations (richness = 2.33, Ho and He = 0.33), and showed near complete genetic isolation from surrounding populations across multiple tests. The newly recolonizing population in northeastern Alabama had a small but growing population doubling in 3 years (34 individuals 26-43, 95% C.I.), relatively moderate genetic diversity compared to surrounding populations (richness = 3.32, Ho = 0.53, He = 0.65), and showed a high level of genetic connectivity with surrounding populations.

A Means for the Scintigraphic Imaging of Regional Brain Dynamics. Regional Cerebral Blood Flow and Regional Cerebral Blood Volume

Energy Technology Data Exchange (ETDEWEB)

Potchen, E. J.; Bentley, R.; Gerth, W.; Hill, R. L.; Davis, D. O. [Washington University School Of Medicine, St. Louis, MO (United States)

1969-05-15

The use of freely diffusable inert radioactive gas as a washout indicator to measure regional cerebral blood flow has become a standardized kinetic procedure in many laboratories. Recent investigations with this technique have led us to conclude that we can reliably distinguish regional flow with perfusion against regional flow without perfusion from the early portion of the curve. Based on a detailed study of the early curve kinetics in patients with and without cerebral vascular disease we have defined the sampling duration necessary for application of the Anger gamma camera imaging process to regional changes in cerebral radioactivity. Using a standard camera and a small computer, a procedure has been developed and based upon entire field to determine the time of maximum height followed by analysis of the data in a matrix. This will permit a contour plot presentation of calculated regional cerebral blood flow in millilitres per 100 grams perfused brain per minute. In addition, we propose to augment this data by the display of regional non-perfusion blood flow versus regional cerebral flow with perfusion. Preliminary investigation on sampling duration, and Compton scattering were prerequisite to clinical scintigraphy of regional cerebral blood flow. In addition, the method of interface for the conventional Anger gamma camera to digital computers used in this procedure are discussed. Applications to further assess regional cerebral dynamics by scintigraphy are presented. (author)

Bacteremia with the bovis group streptococci

DEFF Research Database (Denmark)

Marmolin, Ea S; Hartmeyer, Gitte N; Christensen, Jens Jørgen

2016-01-01

DNA sequencing of the intergenic spacer (ITS) region was used to identify 53 blood culture isolates that had previously been designated to the bovis group streptococci and clinical data was collected retrospectively from patients' records using a standardized protocol. ITS sequencing identified 19....... pasteurianus (58.7%) bacteremia calls for intensive investigation for underlying disease focusing on the pancreas and the hepatobiliary system....

75 FR 71137 - Vendor Outreach Workshop for Women Owned Small Businesses in the National Capitol Region of the...

Science.gov (United States)

2010-11-22

... the Interior is hosting a Vendor Outreach Workshop for women owned small businesses in the National... meeting its business goals for small, small disadvantaged, 8(a), woman-owned, HUBZone, and service... DEPARTMENT OF THE INTERIOR Office of the Secretary Vendor Outreach Workshop for Women Owned Small...

Sequencing and annotation of the chloroplast DNAs and identification of polymorphisms distinguishing normal male-fertile and male-sterile cytoplasms of onion.

Science.gov (United States)

von Kohn, Christopher; Kiełkowska, Agnieszka; Havey, Michael J

2013-12-01

Male-sterile (S) cytoplasm of onion is an alien cytoplasm introgressed into onion in antiquity and is widely used for hybrid seed production. Owing to the biennial generation time of onion, classical crossing takes at least 4 years to classify cytoplasms as S or normal (N) male-fertile. Molecular markers in the organellar DNAs that distinguish N and S cytoplasms are useful to reduce the time required to classify onion cytoplasms. In this research, we completed next-generation sequencing of the chloroplast DNAs of N- and S-cytoplasmic onions; we assembled and annotated the genomes in addition to identifying polymorphisms that distinguish these cytoplasms. The sizes (153 538 and 153 355 base pairs) and GC contents (36.8%) were very similar for the chloroplast DNAs of N and S cytoplasms, respectively, as expected given their close phylogenetic relationship. The size difference was primarily due to small indels in intergenic regions and a deletion in the accD gene of N-cytoplasmic onion. The structures of the onion chloroplast DNAs were similar to those of most land plants with large and small single copy regions separated by inverted repeats. Twenty-eight single nucleotide polymorphisms, two polymorphic restriction-enzyme sites, and one indel distributed across 20 chloroplast genes in the large and small single copy regions were selected and validated using diverse onion populations previously classified as N or S cytoplasmic using restriction fragment length polymorphisms. Although cytoplasmic male sterility is likely associated with the mitochondrial DNA, maternal transmission of the mitochondrial and chloroplast DNAs allows for polymorphisms in either genome to be useful for classifying onion cytoplasms to aid the development of hybrid onion cultivars.

Calculation of economic viability and environmental costs of biomass from dende oil for small communities of Brazilian northeast region

International Nuclear Information System (INIS)

Stecher, Luiza C.; Pacheco, Rafael R.; Sabundjian, Gaiane

2015-01-01

The current environmental problems caused by human activity has been gaining attention in society, i.e., as it has influenced in the growth and development of the global economic. The availability of energy resources is central point to economic development and the generation of energy is responsible for a significant portion of the emissions causing the greenhouse effect nowadays. The Brazil, a developing country, still has a large number of people without access to electricity, which affects the quality of life of individuals. In this context, it should think in the sustainable economic development, so the alternative energy sources emerge as an option for power generation. Can highlight biomass as a source in the Brazilian scenario by its wide availability and variety. Therefore, the objective of this work is to estimate the economic viability of the decentralized generation of electricity based on the use of biomass from dende oil in small communities in the Brazilian Northeast considering the environmental costs involved for the source in question. The methodology is based on economic concepts and economic evaluation of environmental resources. The biomass from dende oil was adopted in this work by its characteristics and availability in the studied region. The results show that the generation of energy by biomass from dende oil, it will contribute significantly to the sustainable development of the region, already that it will bring gains environmental, social and financial to society. (author)

Calculation of economic viability and environmental costs of biomass from dende oil for small communities of Brazilian northeast region

Energy Technology Data Exchange (ETDEWEB)

Stecher, Luiza C.; Pacheco, Rafael R.; Sabundjian, Gaiane, E-mail: luizastecher@usp.br, E-mail: rafaelrade@gmail.com, E-mail: gdjian@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2015-07-01

The current environmental problems caused by human activity has been gaining attention in society, i.e., as it has influenced in the growth and development of the global economic. The availability of energy resources is central point to economic development and the generation of energy is responsible for a significant portion of the emissions causing the greenhouse effect nowadays. The Brazil, a developing country, still has a large number of people without access to electricity, which affects the quality of life of individuals. In this context, it should think in the sustainable economic development, so the alternative energy sources emerge as an option for power generation. Can highlight biomass as a source in the Brazilian scenario by its wide availability and variety. Therefore, the objective of this work is to estimate the economic viability of the decentralized generation of electricity based on the use of biomass from dende oil in small communities in the Brazilian Northeast considering the environmental costs involved for the source in question. The methodology is based on economic concepts and economic evaluation of environmental resources. The biomass from dende oil was adopted in this work by its characteristics and availability in the studied region. The results show that the generation of energy by biomass from dende oil, it will contribute significantly to the sustainable development of the region, already that it will bring gains environmental, social and financial to society. (author)

Program-target methods of management small business

Directory of Open Access Journals (Sweden)

Gurova Ekaterina

2017-01-01

Full Text Available Experience of small businesses in Russia are just beginning their path to development. difficulties arise with the involvement of small businesses in the implementation of government development programmes. Small business in modern conditions to secure a visible prospect of development without the implementation of state support programmes. Ways and methods of regulation of development of the market economy are diverse. The total mass of the huge role is played by the program-target methods of regulation. The article describes the basic principles on the use of program-target approach to the development of a specific sector of the economy, as small businesses, designed to play an important role in getting the national economy out of crisis. The material in this publication is built from the need to maintain the connection between the theory of government regulation, practice of formation of development programs at the regional level and the needs of small businesses. Essential for the formation of entrepreneurship development programmes is to preserve the flexibility of small businesses in making management decisions related to the selection and change of activities.

Measurement and numerical simulation of a small centrifugal compressor characteristics at small or negative flow rate

Science.gov (United States)

Tsukamoto, Kaname; Okada, Mizuki; Inokuchi, Yuzo; Yamasaki, Nobuhiko; Yamagata, Akihiro

2017-04-01

For centrifugal compressors used in automotive turbochargers, the extension of the surge margin is demanded because of lower engine speed. In order to estimate the surge line exactly, it is required to acquire the compressor characteristics at small or negative flow rate. In this paper, measurement and numerical simulation of the characteristics at small or negative flow rate are carried out. In the measurement, an experimental facility with a valve immediately downstream of the compressor is used to suppress the surge. In the numerical work, a new boundary condition that specifies mass flow rate at the outlet boundary is used to simulate the characteristics around the zero flow rate region. Furthermore, flow field analyses at small or negative flow rate are performed with the numerical results. The separated and re-circulated flow fields are investigated by visualization to identify the origin of losses.

Examining significant factors in micro and small enterprises performance: case study in Amhara region, Ethiopia

Science.gov (United States)

Cherkos, Tomas; Zegeye, Muluken; Tilahun, Shimelis; Avvari, Muralidhar

2017-07-01

Furniture manufacturing micro and small enterprises are confronted with several factors that affect their performance. Some enterprises fail to sustain, some others remain for long period of time without transforming, and most are producing similar and non-standard products. The main aim of this manuscript is on improving the performance and contribution of MSEs by analyzing impact of significant internal and external factors. Data was collected via a questionnaire, group discussion with experts and interviewing process. Randomly selected eight representative main cities of Amhara region with 120 furniture manufacturing enterprises are considered. Data analysis and presentation was made using SPSS tools (correlation, proximity, and T test) and impact-effort analysis matrix tool. The correlation analysis shows that politico-legal with infrastructure, leadership with entrepreneurship skills and finance and credit with marketing factors are those factors, which result in high correlation with Pearson correlation values of r = 0.988, 0.983, and 0.939, respectively. The study investigates that the most critical factors faced by MSEs are work premises, access to finance, infrastructure, entrepreneurship and business managerial problems. The impact of these factors is found to be high and is confirmed by the 50% drop-out rate in 2014/2015. Furthermore, more than 25% work time losses due to power interruption daily and around 65% work premises problems challenged MSEs. Further, an impact-effort matrix was developed to help the MSEs to prioritize the affecting factors.

Inheritance of the yeast mitochondrial genome

DEFF Research Database (Denmark)

Piskur, Jure

1994-01-01

Mitochondrion, extrachromosomal genetics, intergenic sequences, genome size, mitochondrial DNA, petite mutation, yeast......Mitochondrion, extrachromosomal genetics, intergenic sequences, genome size, mitochondrial DNA, petite mutation, yeast...

The business environment and phases of development of small and medium-sized enterprises

OpenAIRE

Wach, Krzysztof

2006-01-01

The subject literature distinguishes several factors that determine the establishment, survival , operations and development of micro, small, and medium-sized enterprises in particular regions. In this article, the author presents a classification of these factors in terms of whether they are barriers or stimulators. On this basis, the author explains the influence of regional environment (meso-environment) factors on the development of small and medium-sized enterprises in various phases of ...

THE FORMATION AND MAGNETIC STRUCTURES OF ACTIVE-REGION FILAMENTS OBSERVED BY NVST, SDO, AND HINODE

Energy Technology Data Exchange (ETDEWEB)

Yan, X. L.; Xue, Z. K.; Wang, J. C.; Xiang, Y. Y.; Kong, D. F.; Yang, L. H. [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650216 (China); Pan, G. M. [College of Mathematics Physics and Information Engineering, Jiaxing University, Jiaxing 314001 (China)

2015-08-15

To better understand the properties of solar active-region filaments, we present a detailed study on the formation and magnetic structures of two active-region filaments in active region NOAA 11884 during a period of four days. It is found that the shearing motion of the opposite magnetic polarities and the rotation of the small sunspots with negative polarity play an important role in the formation of two active-region filaments. During the formation of these two active-region filaments, one foot of the filaments was rooted in a small sunspot with negative polarity. The small sunspot rotated not only around another small sunspot with negative polarity, but also around the center of its umbra. By analyzing the nonlinear force-free field extrapolation using the vector magnetic fields in the photosphere, twisted structures were found in the two active-region filaments prior to their eruptions. These results imply that the magnetic fields were dragged by the shearing motion between opposite magnetic polarities and became more horizontal. The sunspot rotation twisted the horizontal magnetic fields and finally formed the twisted active-region filaments.

SMALL INVESTORS: CHALLENGES AND BENEFITS OF IPO - A CASE STUDY IN A SMALL BUSINESS IN THE REGION OF THE CAPÃO REDONDO - SP

Directory of Open Access Journals (Sweden)

Loide Priscila Cacheche

2015-03-01

Full Text Available The purpose of this paper is to analyze the importance of knowledge of managers about market capitals (in terms of benefits and challenges and the relevance of the inclusion of small business context in this market. A case study was conducted by open questions interview with a CEO of a small business in Sao Paulo. Results showed that despite the CEO has knowledge about the capital market; the company was not structurally prepared to accept the challenges of capital markets.

Genetic characterization and phylogenetic relationships based on 18S rRNA and ITS1 region of small form of canine Babesia spp. from India.

Science.gov (United States)

Mandal, M; Banerjee, P S; Garg, Rajat; Ram, Hira; Kundu, K; Kumar, Saroj; Kumar, G V P P S Ravi

2014-10-01

Canine babesiosis is a vector borne disease caused by intra-erythrocytic apicomplexan parasites Babesia canis (large form) and Babesia gibsoni (small form), throughout the globe. Apart from few sporadic reports on the occurrence of B. gibsoni infection in dogs, no attempt has been made to characterize Babesia spp. of dogs in India. Fifteen canine blood samples, positive for small form of Babesia, collected from northern to eastern parts of India, were used for amplification of 18S rRNA gene (∼1665bp) of Babesia sp. and partial ITS1 region (∼254bp) of B. gibsoni Asian genotype. Cloning and sequencing of the amplified products of each sample was performed separately. Based on sequences and phylogenetic analysis of 18S rRNA and ITS1 sequences, 13 were considered to be B. gibsoni. These thirteen isolates shared high sequence identity with each other and with B. gibsoni Asian genotype. The other two isolates could not be assigned to any particular species because of the difference(s) in 18S rRNA sequence with B. gibsoni and closer identity with Babesiaoccultans and Babesiaorientalis. In the phylogenetic tree, all the isolates of B. gibsoni Asian genotype formed a separate major clade named as Babesia spp. sensu stricto clade with high bootstrap support. The two unnamed Babesia sp. (Malbazar and Ludhiana isolates) clustered close together with B. orientalis, Babesia sp. (Kashi 1 isolate) and B. occultans of bovines. It can be inferred from this study that 18S rRNA gene and ITS1 region are highly conserved among 13 B. gibsoni isolates from India. It is the maiden attempt of genetic characterization by sequencing of 18S rRNA gene and ITS1 region of B. gibsoni from India and is also the first record on the occurrence of an unknown Babesia sp. of dogs from south and south-east Asia. Copyright © 2014 Elsevier B.V. All rights reserved.

Advanced technology for future regional transport aircraft

Science.gov (United States)

Williams, L. J.

1982-01-01

In connection with a request for a report coming from a U.S. Senate committee, NASA formed a Small Transport Aircraft Technology (STAT) team in 1978. STAT was to obtain information concerning the technical improvements in commuter aircraft that would likely increase their public acceptance. Another area of study was related to questions regarding the help which could be provided by NASA's aeronautical research and development program to commuter aircraft manufacturers with respect to the solution of technical problems. Attention is given to commuter airline growth, current commuter/region aircraft and new aircraft in development, prospects for advanced technology commuter/regional transports, and potential benefits of advanced technology. A list is provided of a number of particular advances appropriate to small transport aircraft, taking into account small gas turbine engine component technology, propeller technology, three-dimensional wing-design technology, airframe aerodynamics/propulsion integration, and composite structure materials.

Customer Relationship Marketing (CRM) Practices in Danish Small BusinessesCustomer Relationship Marketing (CRM) Practices in Danish Small Businesses

DEFF Research Database (Denmark)

Kuada, John; Serles, Dorthe

2006-01-01

This paper examines the extent to which the adoption of CRM software packages is a pre-requisite of customer orientation strategies of small firms. This is done by conducting an empirical investigation into the internal determinants of CRM adoption behavior of 179 randomly selected small firms...... in the Northern Jutland region of Denmark. The results suggest that top managers in these firms endorse the strategic value of customer orientation to their businesses but do not consider CRM software packages as necessary for building strong relationships with their customers. This suggests that small firms may...... make their CRM adoption/rejection decisions on the basis of a trade-off between expected benefits from using the available CRM packages compared with alternative modes of achieving customer loyalty....

Q fever in small ruminants in Mali. Results of a serological survey

Directory of Open Access Journals (Sweden)

S. S. Sidibé

2013-01-01

Full Text Available In Mali, the loss of reproduction is a major constraint to improving the productivity of small ruminants. The causes of these losses are still poorly known and include infertility, abortions, orchitis and stunting. The purpose of this study was to assess the seroprevalence of Q fever in small ruminant farms where cases of loss of reproduction had been observed, as well as financial losses linked to the recorded abortions. The survey was carried out during the period 2006–2009 in the agropastoral areas of Bougouni (Sikasso Region, Nioro (Kayes Region, Keniebougouwere (Segou Region and Koro (Mopti Region. Out of 718 sera analyzed by indirect ELISA, 155 (21.5 ± 3% tested positive for Coxiella burnetii. The prevalence rate varied according to the site and the birth rank. The highest prevalence rate was observed in Keniebougouwere (35 ± 6%, followed by Nioro (28.5 ± 7.5% and Bougouni (10.8 ± 4.6%, and the lowest in Koro (5.8 ± 3.7%. This study revealed the presence of Q fever in small ruminants in Mali. Complementary investigations that include molecular diagnosis (PCR technique might help understand the etiology of the disease involved in cases of loss of reproduction in small ruminants in Mali. The technical and economical analysis helped to assess the financial value of losses.

Occupational and environmental mercury exposure among small-scale gold miners in the Talensi-Nabdam District of Ghana’s Upper East region

Science.gov (United States)

Paruchuri, Yasaswi; Siuniak, Amanda; Johnson, Nicole; Levin, Elena; Mitchell, Katherine; Goodrich, Jaclyn M.; Renne, Elisha P.; Basu, Niladri

2014-01-01

Mercury use in small-scale gold mining is ubiquitous across Ghana but little is known about the extent to which such activities have contaminated community residents and miners. Here, occupational exposures to elemental mercury (via urine sampling) and dietary exposures to methylmercury (via hair sampling) were assessed among 120 participants recruited from a mining community located in the Talensi-Nabdam District of Ghana’s Upper East region during summer 2009. More than one-fifth of the participants had moderately high levels of urinary mercury (>10 µg/L) and 5% had urine mercury levels that exceeded the WHO guideline value of 50 µg/L. When participants were stratified according to occupation, those active in the mining industry had the highest mercury levels. Specifically, individuals that burned amalgam had urine mercury levels (median: 43.8 µg/L; mean ± SD: 171.1 ± 296.5 µg/L; n=5) significantly higher than median values measured in mechanical operators (11.6 µg/L, n=4), concession managers/owners (5.6 µg/L, n=11), excavators that blast and chisel ore (4.9 µg/L, n=33), individuals that sift and grind crushed ore (2.2 µg/L, n=47), support workers (0.5 µg/L, n=14), and those with no role in the mining sector (2.5 µg/L, n=6). There was a significant positive spearman correlation between fish consumption and hair mercury levels (r = 0.30) but not with urine mercury (r = 0.18) though further studies are needed to document which types of fish are consumed as well as portion sizes. Given that 200,000 people in Ghana are involved in the small-scale gold mining industry and that the numbers are expected to grow in Ghana and many other regions of the world, elucidating mercury exposure pathways in such communities is important to help shape policies and behaviors that may minimize health risks. PMID:20875913

The complex of measures on inclusion of small businesses in innovation clusters

Directory of Open Access Journals (Sweden)

A. V. Kupchinsky

2016-01-01

Full Text Available Modern practice of managing and its display in scientific publications demonstrate that development of world economy with all evidence proves the major role and the importance of sector of small business structures in national economy. In the modern world the national economy in many respects began to be determined by the balanced and sustainable development of the small business structures recognized now as conductors and creators of new opening and technologies, moreover, as the strategic instrument of the structural transformations of a modern economic system of the country often directed to high-quality increase in efficiency of reproduction process of regional economy. Now in Russia the level of development of an innovative entrepreneurship is very low. It is possible to state lack of properly created institutional environment for development of a small entrepreneurship in the innovative sphere. Clasterisation represents process of consolidation of a number of the organizations of various industries for increase in competitiveness, implementation of innovations, effective development and receipt of other benefits. According to separation of economy on real and virtual, the possibility of creation of both real, and virtual clusters increases. Creation and development of regional clusters will help to create the necessary level of activity of small business structures in innovative activities that will favorably affect increase in competitiveness of both regional, and national economy. The package of measures including measures for involvement of small business structures in clusters is developed for development of a cluster initiative and increase in innovative development of the region. Application of this program will allow to reach synergy effect at the expense of high degree of concentration and cooperation of small business structures and increase in effectiveness of their activities.

SMALL AND MEDIUM ENTERPRISES, REGIONAL DEVELOPMENT AND NETWORKING: THE EMERGING FRAMEWORK IN ROMANIA

OpenAIRE

Daniela Luminita Constantin

2002-01-01

Networking is a key word in the recent debates on SMEs and regional policies, pointing out the need and advantages of integrating these businesses in a coherent framework, which creates links, relations, exchanges between them and other actors within the region (banks, universities, research institutes, training centres, consulting firms, chambers of commerce, associations of producers, local public administration). This paper aims to explore the main features and significance of the SME sect...

Second region of stability

International Nuclear Information System (INIS)

Greene, J.M.; Chance, M.S.

1980-10-01

A new type of axisymmetric magnetohydrodynamic equilibrium is presented. It is characterized by a region of pressure and safety factor variation with a short scale length imposed as a perturbation. The equilibrium consistent with these profile variations can be calculated by means of an asymptotic expansion. The flexibility obtained by generating such equilibria allows for a close examination of the mechanisms that are relevant to ballooning instabilities - ideal MHD modes with large toroidal mode number. The so-called first and second regions of stability against these modes are seen well within the limits of validity of the asymptotic expansion. It appears that the modes must be localized in regions with small values of the local shear of the magnetic field. The second region of stability occurs where the local shear is large throughout the range where the magnetic field line curvature is destabilizing

Kuřim–the largest small town in the South-Moravian Region (Czechia)

Czech Academy of Sciences Publication Activity Database

Vaishar, Antonín

2015-01-01

Roč. 8, č. 8 (2015), s. 135-147 ISSN 2084-5456 Institutional support: RVO:68145535 Keywords : small town * suburbanization * Kuřim Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://annalesgeo.up.krakow.pl/article/view/2839/2502

THE ORGANIZATION OF MANAGEMENT ACCOUNTING AT SMALL ENTERPRISES IN UKRAINE

OpenAIRE

Nadiya Khocha

2017-01-01

The purpose of the research is to study the organization of managerial accounting in Ukrainian small enterprises. Methodology. The survey of management accounting is conducted by an interview with the manager/ chief accountant/financial director of small enterprises, or by sending the questionnaires to these persons via the e-mail. The sample of study includes fifty-five small enterprises of the Lviv region in different types of activities and forms of ownership. Results. Analysis of theoreti...

Photometric metallicity map of the Small Magellanic Cloud

Science.gov (United States)

Choudhury, S.; Subramaniam, A.; Cole, A. A.; Sohn, Y.-J.

2018-04-01

We have created an estimated metallicity map of the Small Magellanic Cloud (SMC) using the Magellanic Cloud Photometric Survey (MCPS) and Optical Gravitational Lensing Experiment (OGLE III) photometric data. This is a first of its kind map of metallicity up to a radius of ˜2.5°. We identify the Red Giant Branch (RGB) in the V, (V - I) colour-magnitude diagrams of small sub-regions of varying sizes in both data sets. We use the slope of the RGB as an indicator of the average metallicity of a sub-region and calibrate the RGB slope to metallicity using available spectroscopic data for selected sub-regions. The average metallicity of the SMC is found to be [Fe/H] = -0.94 dex (σ[Fe/H] = 0.09) from OGLE III and [Fe/H] = -0.95 dex (σ[Fe/H] = 0.08) from MCPS. We confirm a shallow but significant metallicity gradient within the inner SMC up to a radius of 2.5° (-0.045 ± 0.004 to -0.067 ± 0.006 dex deg-1).

Trigger algorithms and electronics for the ATLAS muon new small wheel upgrade

International Nuclear Information System (INIS)

Guan, L.

2016-01-01

The New Small Wheel Upgrade for the ATLAS experiment will replace the innermost station of the Muon Spectrometer in the forward region in order to maintain its current performance during high luminosity data-taking after the LHC Phase-I upgrade. The New Small Wheel, comprising Micromegas and small Thin Gap Chambers, will reduce the rate of fake triggers coming from backgrounds in the forward region and significantly improve the Level-1 muon trigger selectivity by providing precise on-line segment measurements with ∼ 1 mrad angular resolution. Such demanding precision, together with the short time (∼ 1 μs) to prepare trigger data and perform on-line reconstruction, implies very stringent requirements on the design of trigger system and trigger electronics. This paper presents an overview of the design of the New Small Wheel trigger system, trigger algorithms and processor hardware

Remotely Sensed Monitoring of Small Reservoir Dynamics: A Bayesian Approach

Directory of Open Access Journals (Sweden)

Dirk Eilander

2014-01-01

Full Text Available Multipurpose small reservoirs are important for livelihoods in rural semi-arid regions. To manage and plan these reservoirs and to assess their hydrological impact at a river basin scale, it is important to monitor their water storage dynamics. This paper introduces a Bayesian approach for monitoring small reservoirs with radar satellite images. The newly developed growing Bayesian classifier has a high degree of automation, can readily be extended with auxiliary information and reduces the confusion error to the land-water boundary pixels. A case study has been performed in the Upper East Region of Ghana, based on Radarsat-2 data from November 2012 until April 2013. Results show that the growing Bayesian classifier can deal with the spatial and temporal variability in synthetic aperture radar (SAR backscatter intensities from small reservoirs. Due to its ability to incorporate auxiliary information, the algorithm is able to delineate open water from SAR imagery with a low land-water contrast in the case of wind-induced Bragg scattering or limited vegetation on the land surrounding a small reservoir.

Croatian small islands – residential and/or leisure area

Directory of Open Access Journals (Sweden)

Josip Faričić

2010-06-01

Full Text Available The paper discusses modern geographic processes on Croatian small inhabited islands. For centuries, Croatian small islands have been continuously inhabited area characterized by different social and economic activities. However, in the last several decades, the islands have experienced a severe depopulation, and on the other hand, the interest for occasional use of that attractive insular space for recreational purposes increased. Consequently, the basic insular functions have changed, which, among other things, contributes to changes of insular landscape and to the changed role of small islands in regional socio-economic systems.

Dynamic magnetic resonance imaging of cervical lymph nodes in patients with oral cancer. Utility of the small region of interest method in evaluating the architecture of cervical lymph nodes

International Nuclear Information System (INIS)

Oomori, Miwako; Fukunari, Fumiko; Kagawa, Toyohiro; Okamura, Kazuhiko; Yuasa, Kenji

2008-01-01

Our purpose was to evaluate the utility of the small region of interest (ROI) method to detect the architecture of cervical lymph nodes and the specificity of time-intensity curves for tissue present in cervical lymph nodes. Specimens were taken from 17 lymph nodes of eight patients (ten sides of the neck) with oral squamous cell carcinoma who underwent dynamic contrast-enhanced magnetic resonance imaging (MRI) and neck dissection between 2005 and 2007 at our hospital. Two methods of constructing time-intensity curves were compared: the conventional method that uses relatively large ROIs, and a new method that uses small ROIs. Curves made with the small ROI method were then compared to histopathological findings for dissected lymph nodes. The small ROI method allowed differences in signal intensity to be discerned at the tissue level, which was not possible with the conventional large ROI method. Curves for normal lymphoid tissue tended to be type I, those for tumor cells tended to be type II, and those for keratinization/necrosis tended to be types III and IV, indicating that time-intensity curves can be specific to tissue type within lymph nodes. The small ROI method was useful for evaluation of the architecture of cervical lymph nodes. (author)

Small regions of overlapping deletions on 6q26 in human astrocytic tumours identified using chromosome 6 tile path array CGH

Science.gov (United States)

Ichimura, Koichi; Mungall, Andrew J; Fiegler, Heike; Pearson, Danita M.; Dunham, Ian; Carter, Nigel P; Collins, V. Peter

2009-01-01

Deletions of chromosome 6 are a common abnormality in diverse human malignancies including astrocytic tumours, suggesting the presence of tumour suppressor genes (TSG). In order to help identify candidate TSGs, we have constructed a chromosome 6 tile path microarray. The array contains 1780 clones (778 PACs and 1002 BACs) that cover 98.3% of the published chromosome 6 sequences. A total of 104 adult astrocytic tumours (10 diffuse astrocytomas, 30 anaplastic astrocytomas (AA), 64 glioblastomas (GB)) were analysed using this array. Single copy number change was successfully detected and the result was in general concordant with a microsatellite analysis. The pattern of copy number change was complex with multiple interstitial deletions/gains. However, a predominance of telomeric 6q deletions was seen. Two small common and overlapping regions of deletion at 6q26 were identified. One was 1002 kb in size and contained PACRG and QKI, while the second was 199 kb and harbours a single gene, ARID1B. The data show that the chromosome 6 tile path array is useful in mapping copy number changes with high resolution and accuracy. We confirmed the high frequency of chromosome 6 deletions in AA and GB, and identified two novel commonly deleted regions that may harbour TSGs. PMID:16205629

A Microbeam Small-Angle X-ray Scattering Study on Enamel Crystallites in Subsurface Lesion

Energy Technology Data Exchange (ETDEWEB)

Yagi, N; Ohta, N; Matsuo, T [Japan Synchrotron Radiation Research Institute, 1-1-1 Kouto, Sayo, Hyogo 679-5198 (Japan); Tanaka, T; Terada, Y; Kamasaka, H; Kometani, T, E-mail: yagi@spring8.or.j [Ezaki Glico Co. Ltd., 4-6-5 Utajima, Nishiyodogawa-ku, Osaka 555-8502 (Japan)

2010-10-01

The early caries lesion in bovine tooth enamel was studied by two different X-ray diffraction systems at the SPring-8 third generation synchrotron radiation facility. Both allowed us simultaneous measurement of the small and large angle regions. The beam size was 6{mu}m at BL40XU and 50{mu}m at BL45XU. The small-angle scattering from voids in the hydroxyapatite crystallites and the wide-angle diffraction from the hydroxyapatite crystals were observed simultaneously. At BL40XU an X-ray image intensifier was used for the small-angle and a CMOS flatpanel detector for the large-angle region. At BL45XU, a large-area CCD detector was used to cover both regions. A linear microbeam scan at BL40XU showed a detailed distribution of voids and crystals and made it possible to examine the structural details in the lesion. The two-dimensional scan at BL45XU showed distribution of voids and crystals in a wider region in the enamel. The simultaneous small- and wide-angle measurement with a microbeam is a powerful tool to elucidate the mechanisms of demineralization and remineralization in the early caries lesion.

A Microbeam Small-Angle X-ray Scattering Study on Enamel Crystallites in Subsurface Lesion

International Nuclear Information System (INIS)

Yagi, N; Ohta, N; Matsuo, T; Tanaka, T; Terada, Y; Kamasaka, H; Kometani, T

2010-01-01

The early caries lesion in bovine tooth enamel was studied by two different X-ray diffraction systems at the SPring-8 third generation synchrotron radiation facility. Both allowed us simultaneous measurement of the small and large angle regions. The beam size was 6μm at BL40XU and 50μm at BL45XU. The small-angle scattering from voids in the hydroxyapatite crystallites and the wide-angle diffraction from the hydroxyapatite crystals were observed simultaneously. At BL40XU an X-ray image intensifier was used for the small-angle and a CMOS flatpanel detector for the large-angle region. At BL45XU, a large-area CCD detector was used to cover both regions. A linear microbeam scan at BL40XU showed a detailed distribution of voids and crystals and made it possible to examine the structural details in the lesion. The two-dimensional scan at BL45XU showed distribution of voids and crystals in a wider region in the enamel. The simultaneous small- and wide-angle measurement with a microbeam is a powerful tool to elucidate the mechanisms of demineralization and remineralization in the early caries lesion.

Tasks of institutional support to increase innovation activity of small business in the region

Directory of Open Access Journals (Sweden)

Igor Aleksandrovich Bayev

2013-03-01

Full Text Available The reasons for the low innovation activity of Russian small enterprises are presented in the article from the standpoint of institutional theory. According to the authors, today the degree of influence of the institutional environment on meso- and mini-levels, as well as informal rules for the development of small forms of entrepreneurship, including their innovative activity are underestimated. The influence of informal component of mini-level institutional environment on the implementation of formal institutions in the examples of the phenomenon of «Old Believers» Entrepreneurship and institutions of the shadow economy is shown. The authors suggest that the shadow nature existing in Russia on mini-level informal institutions to be explained not only by the low level of trust in society (including trust in authority and leadership and the differences between the national mentality, but also inadequate distribution of transaction costs of doing business (including innovation between economic agents. Features of the institutional system of Russia  as well as transaction costs of the domestic system of patenting inventions  are investigated as the key causes of the problem. Methodological principles of institutional support of small innovative businesses are presented.

Scale dependence and small-x behaviour of polarized parton distributions

International Nuclear Information System (INIS)

Ball, R.D.; Forte, S.; Ridolfi, G.

1995-01-01

We discuss perturbative evolution of the polarized structure function g 1 in the (x, Q 2 ) plane, with special regard to the small-x region. We determine g 1 in terms of polarized quark and gluon distributions using coefficient functions to order α s . At small x g 1 then displays substantial scale dependence, which necessarily implies a corresponding scale dependence in the large-x region. This scale dependence has significant consequences for the extraction of the first moment from the experimental data, reducing its value while increasing the error. Conversely, the scale dependence may be used to constrain the size of the polarized gluon distribution. ((orig.))

Scale dependence and small x behaviour of polarized parton distributions

CERN Document Server

Ball, R D; Ridolfi, G; Forte, S; Ridolfi, G

1995-01-01

We discuss perturbative evolution of the polarized structure function g_1 in the (x,Q^2) plane, with special regard to the small-x region. We determine g_1 in terms of polarized quark and gluon distributions using coefficient functions to order alpha_s. At small x g_1 then displays substantial scale dependence, which necessarily implies a corresponding scale dependence in the large-x region. This scale dependence has significant consequences for the extraction of the first moment from the experimental data, reducing its value while increasing the error. Conversely, the scale dependence may be used to constrain the size of the polarized gluon distribution.

Electromagnetic wave scattering by many small particles

International Nuclear Information System (INIS)

Ramm, A.G.

2007-01-01

Scattering of electromagnetic waves by many small particles of arbitrary shapes is reduced rigorously to solving linear algebraic system of equations bypassing the usual usage of integral equations. The matrix elements of this linear algebraic system have physical meaning. They are expressed in terms of the electric and magnetic polarizability tensors. Analytical formulas are given for calculation of these tensors with any desired accuracy for homogeneous bodies of arbitrary shapes. An idea to create a 'smart' material by embedding many small particles in a given region is formulated

Economic feasibility of products from inland West small-diameter timber

Science.gov (United States)

Spelter Henry; Rong Wang; Peter Ince

1996-01-01

A large part of the forests located in the Rocky Mountain region of the U.S. West (inland West) is characterized by densely packed, small-diameter stands. The purpose of this study was to examine the economic feasibility of using small-diameter material from this resource to manufacture various wood products: oriented strandboard (OSB), stud lumber, random-length...

Short communication. Characterization of chloroplast region rrn16-rrn23S from the tropical timber tree Cedrela odorata L. and de novo construction of a transplastomic expression vector suitable for Meliaceae trees and other economically important crops.

Science.gov (United States)

López-Ochoa, L A; Apolinar-Hernández, M M; Peña-Ramírez, Y J

2015-02-20

The forest tree Spanish cedar (Cedrela odorata L.) is well-known for its high-value timber; however, this species is attacked by the shoot borer (Hypsipyla grandella) during its early years of development, resulting in branched stems and making the plants useless for high-quality wood production. The generation of resistant varieties expressing entomotoxic proteins may be an alternative to pesticide treatments. The use of plastid transformation rather than nuclear transformation should be used because it reduces the risk of transgene dissemination by pollen. Chloroplast transformation vectors require an expression cassette flanked by homologous plastid sequences to drive plastome recombination. Thus, C. odorata plastome sequences are a prerequisite. The rrn16-rrn23 plastome region was selected, cloned, and characterized. When the sequence identity among the rrn16-rrn23 regions from C. odorata and Nicotiana tabacum was compared, 3 inDels of 240, 104, and 39 bp were found that might severely affect transformation efficiency. Using this region, a new transformation vector was developed using pUC19 as a backbone by inserting the rrn16-trnI and trnA-rrn23 sequences from C. odorata and adding 2 independent expression cassettes into the trnI-trnA intergenic region, conferring spectinomycin resistance, the ability to express the gfp reporter gene, and a site that can be used to express any other gene of interest.

REMap: Operon Map of M. tuberculosis

Science.gov (United States)

Xia, Fang Fang; Stevens, Rick L.; Bishai, William R.; Lamichhane, Gyanu

2016-01-01

A map of the transcriptional organization of genes of an organism is a basic tool that is necessary to understand and facilitate a more accurate genetic manipulation of the organism. Operon maps are largely generated by computational prediction programs that rely on gene conservation and genome architecture and may not be physiologically relevant. With the widespread use of RNA sequencing (RNAseq), the prediction of operons based on actual transcriptome sequencing rather than computational genomics alone is much needed. Here, we report a validated operon map of Mycobacterium tuberculosis, developed using RNAseq data from both the exponential and stationary phases of growth. At least 58.4% of M. tuberculosis genes are organized into 749 operons. Our prediction algorithm, REMap (RNA Expression Mapping of operons), considers the many cases of transcription coverage of intergenic regions, and avoids dependencies on functional annotation and arbitrary assumptions about gene structure. As a result, we demonstrate that REMap is able to more accurately predict operons, especially those that contain long intergenic regions or functionally unrelated genes, than previous operon prediction programs. The REMap algorithm is publicly available as a user-friendly tool that can be readily modified to predict operons in other bacteria. PMID:27450008

Hydraulic Network Modelling of Small Community Water Distribution ...

African Journals Online (AJOL)

Prof Anyata

... design of a small community (Sakwa) water distribution network in North Eastern geopolitical region of Nigeria using ..... self cleansing drinking water distribution system is set at 0.4m/s, .... distribution network offers advantages over manual ...

Small Spacecraft for Planetary Science

Science.gov (United States)

Baker, John; Castillo-Rogez, Julie; Bousquet, Pierre-W.; Vane, Gregg; Komarek, Tomas; Klesh, Andrew

2016-07-01

As planetary science continues to explore new and remote regions of the Solar system with comprehensive and more sophisticated payloads, small spacecraft offer the possibility for focused and more affordable science investigations. These small spacecraft or micro spacecraft (attitude control and determination, capable computer and data handling, and navigation are being met by technologies currently under development to be flown on CubeSats within the next five years. This paper will discuss how micro spacecraft offer an attractive alternative to accomplish specific science and technology goals and what relevant technologies are needed for these these types of spacecraft. Acknowledgements: Part of this work is being carried out at the Jet Propulsion Laboratory, California Institute of Technology under contract to NASA. Government sponsorship acknowledged.

In Situ and Satellite Observation of CDOM and Chlorophyll-a Dynamics in Small Water Surface Reservoirs in the Brazilian Semiarid Region

Directory of Open Access Journals (Sweden)

Christine Coelho

2017-12-01

Full Text Available We analyzed chlorophyll-a and Colored Dissolved Organic Matter (CDOM dynamics from field measurements and assessed the potential of multispectral satellite data for retrieving water-quality parameters in three small surface reservoirs in the Brazilian semiarid region. More specifically, this work is comprised of: (i analysis of Chl-a and trophic dynamics; (ii characterization of CDOM; (iii estimation of Chl-a and CDOM from OLI/Landsat-8 and RapidEye imagery. The monitoring lasted 20 months within a multi-year drought, which contributed to water-quality deterioration. Chl-a and trophic state analysis showed a highly eutrophic status for the perennial reservoir during the entire study period, while the non-perennial reservoirs ranged from oligotrophic to eutrophic, with changes associated with the first events of the rainy season. CDOM characterization suggests that the perennial reservoir is mostly influenced by autochthonous sources, while allochthonous sources dominate the non-perennial ones. Spectral-group classification assigned the perennial reservoir as a CDOM-moderate and highly eutrophic reservoir, whereas the non-perennial ones were assigned as CDOM-rich and oligotrophic-dystrophic reservoirs. The remote sensing initiative was partially successful: the Chl-a was best modelled using RapidEye for the perennial one; whereas CDOM performed best with Landsat-8 for non-perennial reservoirs. This investigation showed potential for retrieving water quality parameters in dry areas with small reservoirs.

Small target detection using objectness and saliency

Science.gov (United States)

Zhang, Naiwen; Xiao, Yang; Fang, Zhiwen; Yang, Jian; Wang, Li; Li, Tao

2017-10-01

We are motived by the need for generic object detection algorithm which achieves high recall for small targets in complex scenes with acceptable computational efficiency. We propose a novel object detection algorithm, which has high localization quality with acceptable computational cost. Firstly, we obtain the objectness map as in BING[1] and use NMS to get the top N points. Then, k-means algorithm is used to cluster them into K classes according to their location. We set the center points of the K classes as seed points. For each seed point, an object potential region is extracted. Finally, a fast salient object detection algorithm[2] is applied to the object potential regions to highlight objectlike pixels, and a series of efficient post-processing operations are proposed to locate the targets. Our method runs at 5 FPS on 1000*1000 images, and significantly outperforms previous methods on small targets in cluttered background.

Genetic diversity of Streptococcus equi subsp. zooepidemicus and doxycycline resistance in kennelled dogs.

Science.gov (United States)

Chalker, Victoria J; Waller, Andrew; Webb, Katy; Spearing, Emma; Crosse, Patricia; Brownlie, Joe; Erles, Kerstin

2012-06-01

The genetic diversity and antibiotic resistance profiles of 38 Streptococcus equi subsp. zooepidemicus isolates were determined from a kennelled canine population during two outbreaks of hemorrhagic pneumonia (1999 to 2002 and 2007 to 2010). Analysis of the szp gene hypervariable region and the 16S-23S rRNA intergenic spacer region and multilocus sequence typing (MLST) indicated a predominant tetO-positive, doxycycline-resistant ST-10 strain during 1999 to 2002 and a predominant tetM-positive doxycycline-resistant ST-62 strain during 2007 to 2010.

Contamination of Carcasses and Utensils in Small Swine Slaughterhouses by Salmonella in the Northwestern Region of the State of Rio de Janeiro, Brazil.

Science.gov (United States)

Cabral, Claudius Couto; Panzenhagen, Pedro Henrique Nunes; Delgado, Karina Frensel; Silva, Gabriela Rodrigues Alves; Rodrigues, Dália Dos Prazeres; Franco, Robson Maia; Conte-Junior, Carlos Adam

2017-07-01

Salmonella is a major foodborne pathogen that constantly threatens food safety in developed countries and underdeveloped countries such as Brazil, where it is responsible for 38% of notified cases of foodborne illness. Swine are one of the main meat-producing species that may asymptomatically carry Salmonella, periodically shedding the bacteria through feces. The state of Rio de Janeiro is not a major producer of swine meat, but small slaughterhouses are operational and produce meat for consumption within the state, although few studies have been conducted in the region. In this context, this study was designed to evaluate Salmonella contamination in carcasses, lymph nodes, feces, utensils, and the environment of three small slaughterhouses in the state of Rio de Janeiro. A total of 344 samples from carcasses, utensils, equipment, water, and the environment were collected from these slaughterhouses in the northwestern region of Rio de Janeiro. Salmonella was isolated from 36 (10.5%) samples: 10 of 48 carcasses, 19 of 96 lymph nodes, 4 of 48 fecal samples, 2 of 6 water samples, and 1 of 6 bleeding knives; 55 isolates were recovered. Serotyping revealed the predominance of Salmonella Typhimurium (20 isolates) followed by Salmonella Abony (10 isolates), Salmonella Give (7 isolates), Salmonella Heidelberg (4 isolates), and Salmonella Infantis (1 isolate). Ten isolates were only partially typeable, with only their O antigen identified, and three isolates had rough, nontypeable colonies. Despite the overall low prevalence of Salmonella in this study, all three slaughterhouses had poor hygienic and sanitary conditions, providing easy routes for carcass and, consequently, meat contamination. Thus, it is imperative to enforce sanitary inspections in these establishments and to apply good manufacture practices to assure the safety of the produced pork.

Sequence analysis of two alleles reveals that intra-and intergenic recombination played a role in the evolution of the radish fertility restorer (Rfo

Directory of Open Access Journals (Sweden)

Budar Françoise

2010-02-01

Full Text Available Abstract Background Land plant genomes contain multiple members of a eukaryote-specific gene family encoding proteins with pentatricopeptide repeat (PPR motifs. Some PPR proteins were shown to participate in post-transcriptional events involved in organellar gene expression, and this type of function is now thought to be their main biological role. Among PPR genes, restorers of fertility (Rf of cytoplasmic male sterility systems constitute a peculiar subgroup that is thought to evolve in response to the presence of mitochondrial sterility-inducing genes. Rf genes encoding PPR proteins are associated with very close relatives on complex loci. Results We sequenced a non-restoring allele (L7rfo of the Rfo radish locus whose restoring allele (D81Rfo was previously described, and compared the two alleles and their PPR genes. We identified a ca 13 kb long fragment, likely originating from another part of the radish genome, inserted into the L7rfo sequence. The L7rfo allele carries two genes (PPR-1 and PPR-2 closely related to the three previously described PPR genes of the restorer D81Rfo allele (PPR-A, PPR-B, and PPR-C. Our results indicate that alleles of the Rfo locus have experienced complex evolutionary events, including recombination and insertion of extra-locus sequences, since they diverged. Our analyses strongly suggest that present coding sequences of Rfo PPR genes result from intragenic recombination. We found that the 10 C-terminal PPR repeats in Rfo PPR gene encoded proteins result from the tandem duplication of a 5 PPR repeat block. Conclusions The Rfo locus appears to experience more complex evolution than its flanking sequences. The Rfo locus and PPR genes therein are likely to evolve as a result of intergenic and intragenic recombination. It is therefore not possible to determine which genes on the two alleles are direct orthologs. Our observations recall some previously reported data on pathogen resistance complex loci.

Real-Time Quantitative PCR Measurement of Ileal Lactobacillus salivarius Populations from Broiler Chickens To Determine the Influence of Farming Practices▿ †

Science.gov (United States)

Harrow, Sally A.; Ravindran, Velmurugu; Butler, Ruth C.; Marshall, John W.; Tannock, Gerald W.

2007-01-01

A real-time quantitative PCR assay targeting a 16S-23S intergenic spacer region sequence was devised to measure the sizes of populations of Lactobacillus salivarius present in ileal digesta collected from broiler chickens. This species has been associated with deconjugation of bile salts in the small bowel and reduced broiler productivity. The assay was tested as a means of monitoring the sizes of L. salivarius populations from broilers fed diets with different compositions, maintained at different stocking densities, or given the antimicrobial drugs bacitracin and monensin in the feed. Stocking densities did not influence the numbers of L. salivarius cells in the ileum. A diet containing meat and bone meal reduced the size of the L. salivarius population relative to that of chickens given the control diet, as did administration of bacitracin and monensin in the feed. These changes in the target bacterial population were associated with improved broiler weight gain. PMID:17890342

Interactions between finite amplitude small and medium-scale waves in the MLT region.

Science.gov (United States)

Heale, C. J.; Snively, J. B.

2016-12-01

Small-scale gravity waves can propagate high into the thermosphere and deposit significant momentum and energy into the background flow [e.g., Yamada et al., 2001, Fritts et al., 2014]. However, their propagation, dissipation, and spectral evolution can be significantly altered by other waves and dynamics and the nature of these complex interactions are not yet well understood. While many ray-tracing and time-dependent modeling studies have been performed to investigate interactions between waves of varying scales [e.g., Eckermann and Marks .1996, Sartelet. 2003, Liu et al. 2008, Vanderhoff et al., 2008, Senf and Achatz., 2011, Heale et al., 2015], the majority of these have considered waves of larger (tidal) scales, or have simplified one of the waves to be an imposed "background" and discount (or limit) the nonlinear feedback mechanisms between the two waves. In reality, both waves will influence each other, especially at finite amplitudes when nonlinear effects become important or dominant. We present a study of fully nonlinear interactions between small-scale 10s km, 10 min period) and medium-scale wave packets at finite amplitudes, which include feedback between the two waves and the ambient atmosphere. Time-dependence of the larger-scale wave has been identified as an important factor in reducing reflection [Heale et al., 2015] and critical level effects [Sartelet, 2003, Senf and Achatz, 2011], we choose medium-scale waves of different periods, and thus vertical scales, to investigate how this influences the propagation, filtering, and momentum and energy deposition of the small-scale waves, and in turn how these impacts affect the medium-scale waves. We also consider the observable features of these interactions in the mesosphere and lower thermosphere.

Nonlinear gravitational self-force: Field outside a small body

Science.gov (United States)

Pound, Adam

2012-10-01

A small extended body moving through an external spacetime gαβ creates a metric perturbation hαβ, which forces the body away from geodesic motion in gαβ. The foundations of this effect, called the gravitational self-force, are now well established, but concrete results have mostly been limited to linear order. Accurately modeling the dynamics of compact binaries requires proceeding to nonlinear orders. To that end, I show how to obtain the metric perturbation outside the body at all orders in a class of generalized wave gauges. In a small buffer region surrounding the body, the form of the perturbation can be found analytically as an expansion for small distances r from a representative worldline. Given only a specification of the body’s multipole moments, the field obtained in the buffer region suffices to find the metric everywhere outside the body via a numerical puncture scheme. Following this procedure at first and second order, I calculate the field in the buffer region around an arbitrarily structured compact body at sufficiently high order in r to numerically implement a second-order puncture scheme, including effects of the body’s spin. I also define nth-order (local) generalizations of the Detweiler-Whiting singular and regular fields and show that in a certain sense, the body can be viewed as a skeleton of multipole moments.

Prospects for the taxation of small business hotel in Krasnodar Krai

Directory of Open Access Journals (Sweden)

Elena K. Vorobey

2010-10-01

Full Text Available The article raises the question about development of small business in Krasnodar region and its influence on growth of gainful potential of region. The problem is that nowadays enterprises and owners with a low profit have a sufficient tax loading. As a result they work illegally.

Simulation of the ATLAS New Small Wheel (NSW) System

CERN Document Server

Maekawa, Koki; The ATLAS collaboration

2017-01-01

The instantaneous luminosity of the Large Hadron Collider (LHC) at CERN will be increased up to a factor of five with respect to the present design value by undergoing an extensive upgrade program over the coming decade. In order to benefit from the expected high luminosity performance that will be provided by the Phase-1 upgraded LHC, the first station of the ATLAS muon end-cap Small Wheel system will need to be replaced by a New Small Wheel (NSW) detector. The NSW is going to be installed in the ATLAS detector in the forward region of 1.3 < |η| < 2.7 during the second long LHC shutdown. The NSW will have to operate in a high background radiation region, while reconstructing muon tracks with high precision as well as furnishing information for the Level-1 trigger. A detailed study of the final design and validation of the readout electronics for a set of precision tracking (Micromegas) and trigger chambers (small-strip Thin Gap Chambers or sTGC) that are able to work at high rates with excellent real-...

Radiotherapy for stage I-II non-small cell lung cancer

International Nuclear Information System (INIS)

Okamoto, Yoshiaki; Murakami, Masao; Mizowaki, Takashi; Nakajima, Toshifumi; Kuroda, Yasumasa

1999-01-01

Surgery has been regarded as the standard treatment for patients with non-small cell lung cancer in the early stage, while radiotherapy has become an effective alternative for medically inoperable patients and those who refuse surgery. We reviewed the records of 31 patients with stage I-II non-small cell lung cancer treated by radiotherapy between 1980 and 1997. There were 15 patients in stage I and 16 in stage II. The variables analyzed for influence on cause-specific survival and loco-regional control were: age, performance status, clinical stage, tumor size, tumor site, radiation field, radiation dose, and combination with chemotherapy. The overall and cause-specific 1-, 2-, 3-, and 5-years survival rates were 71% and 77%; 63% and 73%; 34% and 48%; and 17% and 32%, respectively. Five-year survival rate for patients with peripheral tumor in the lung was 72%, with 70% loco-regional control, while the 5-year survival rate of patients whose tumor originated in the central region was 20%, with 25% loco-regional control. These differences had marginal significance on univariate analysis (P=0.07), but only tumor site (central vs peripheral) showed marginal significant influence on cause-specific survival (P=0.08) and loco-regional control (P=0.07) on multivariate analysis. There were no fatal complications, including radiation-induced myelopathy. The present series showed satisfactory results with definitive radiotherapy for patients with medically inoperable stage I-II non-small cell lung cancer, with results similar to those in recent reports of radiotherapy. The only significant variable was that patients with peripheral tumors had a better prognosis than patients with central tumors. (author)

MMS Multipoint Electric Field Observations of Small-Scale Magnetic Holes

Science.gov (United States)

Goodrich, Katherine A.; Ergun, Robert E.; Wilder, Frederick; Burch, James; Torbert, Roy; Khotyaintsev, Yuri; Lindqvist, Per-Arne; Russell, Christopher; Strangeway, Robert; Magnus, Werner

2016-01-01

Small-scale magnetic holes (MHs), local depletions in magnetic field strength, have been observed multiple times in the Earths magnetosphere in the bursty bulk flow (BBF) braking region. This particular subset of MHs has observed scale sizes perpendicular to the background magnetic field (B) less than the ambient ion Larmor radius (p(sib i)). Previous observations by Time History of Events and Macroscale Interactions during Substorms (THEMIS) indicate that this subset of MHs can be supported by a current driven by the E x B drift of electrons. Ions do not participate in the E x B drift due to the small-scale size of the electric field. While in the BBF braking region, during its commissioning phase, the Magnetospheric Multiscale (MMS) spacecraft observed a small-scale MH. The electric field observations taken during this event suggest the presence of electron currents perpendicular to the magnetic field. These observations also suggest that these currents can evolve to smaller spatial scales.

The Middle East competitiveness report: regional and territorial analysis

OpenAIRE

Huggins, R; Mahroum, S; Thompson, P

2016-01-01

This report explores the extent to which Middle Eastern regions have generated relatively high or low levels of competitiveness. Whilst many Middle Eastern regions may owe some of their competitiveness to the natural advantages of oil reserves, for others their competitiveness has been achieved through other means. Their small size and high degree of autonomy means that many of the regions are effectively independent states. Middle Eastern nations and their regions have been characterized by ...

Una alternative estratégica en el desarrollo regional

OpenAIRE

Molina , Rubén; Vázquez, Glafira

2008-01-01

Faced to the globalization process, regional development in Mexico shall address new challenges, particularly when referring to the competitiveness of the regions and social survival. Given that in this a country a high percentage of companies are small and medium sized, it is essential to promote their installation in different regions of this country. With the creation of new companies, economic, social,environmental, and territorial development is acquired in many regions. In this sense, t...

Current status and future developments of small and micro hydro in southern Africa

CSIR Research Space (South Africa)

Jonker Klunne, W

2012-05-01

Full Text Available -1 Current status and future developments of small and micro hydro in southern Africa Wim Jonker Klunne Council for Scientific and Industrial Research (CSIR) PO Box 395 Pretoria 0001 South Africa Introduction Small and micro hydropower... are renewable energy technologies that have large potential in the south- ern African region, both for grid and off-grid applications. Within the region a good understanding exists on the potential for large scale hydro with a substantial number of plants...

Semi-inclusive deep inelastic scattering at small-x

International Nuclear Information System (INIS)

Marquet, Cyrille; Xiao, Bo-Wen; Yuan Feng

2009-01-01

We study the semi-inclusive hadron production in deep inelastic scattering at small-x. A transverse-momentum-dependent factorization is found consistent with the results calculated in the small-x approaches, such as the color-dipole framework and the color glass condensate, in the appropriate kinematic region at the lowest order. The transverse-momentum-dependent quark distribution can be studied in this process as a probe for the small-x saturation physics. Especially, the ratio of quark distributions as a function of transverse momentum at different x demonstrates strong dependence on the saturation scale. The Q 2 dependence of the same ratio is also studied by applying the Collins-Soper-Sterman resummation method.

Forward and small-x physics at CMS

International Nuclear Information System (INIS)

Gunnellini, Paolo

2016-01-01

A review of experimental measurements from the Compact Muon Solenoid Experiment at the LHC Run 1 is presented. A particular focus is given to jet results in the central and forward regions, and to measurements sensitive to the behaviour of small-x gluons inside the proton and to double parton scattering

Small unmanned aerial vehicles (micro-UAVs, drones) in plant ecology.

Science.gov (United States)

Cruzan, Mitchell B; Weinstein, Ben G; Grasty, Monica R; Kohrn, Brendan F; Hendrickson, Elizabeth C; Arredondo, Tina M; Thompson, Pamela G

2016-09-01

Low-elevation surveys with small aerial drones (micro-unmanned aerial vehicles [UAVs]) may be used for a wide variety of applications in plant ecology, including mapping vegetation over small- to medium-sized regions. We provide an overview of methods and procedures for conducting surveys and illustrate some of these applications. Aerial images were obtained by flying a small drone along transects over the area of interest. Images were used to create a composite image (orthomosaic) and a digital surface model (DSM). Vegetation classification was conducted manually and using an automated routine. Coverage of an individual species was estimated from aerial images. We created a vegetation map for the entire region from the orthomosaic and DSM, and mapped the density of one species. Comparison of our manual and automated habitat classification confirmed that our mapping methods were accurate. A species with high contrast to the background matrix allowed adequate estimate of its coverage. The example surveys demonstrate that small aerial drones are capable of gathering large amounts of information on the distribution of vegetation and individual species with minimal impact to sensitive habitats. Low-elevation aerial surveys have potential for a wide range of applications in plant ecology.

Thin-section multiplanar reformats from multidetector-row CT data: Utility for assessment of regional tumor extent in non-small cell lung cancer

International Nuclear Information System (INIS)

Higashino, Takanori; Ohno, Yoshiharu; Takenaka, Daisuke; Watanabe, Hirokazu; Nogami, Munenobu; Ohbayashi, Chiho; Yoshimura, Masahiro; Satouchi, Miyako; Nishimura, Yoshihiro; Fujii, Masahiko; Sugimura, Kazuro

2005-01-01

Purpose: To determine the clinical utility of thin-section multiplanar reformats (MPRs) from multidetector-row CT (MDCT) data sets for assessing the extent of regional tumors in non-small cell lung cancer (NSCLC) patients. Materials and methods: Sixty consecutive NSCLC patients, who were considered candidates for surgical treatment, underwent contrast-enhanced MDCT examinations, surgical resection and pathological examinations. All MDCT examinations were performed with a 4-detector row computed tomography (CT). From each raw CT data set, 5 mm section thickness CT images (routine CT), 1.25 mm section thickness CT images (thin-section CT) and 1.25 mm section thickness sagittal (thin-section sagittal MPR) and coronal images (thin-section coronal MPR) were reconstructed. A 4-point visual score was used to assess mediastinal, interlobar and chest wall invasions on each image set. For assessment of utility in routine clinical practice, mean reading times for each image set were compared by means of Fisher's protected least significant difference (PLSD) test. A receiver operator characteristic (ROC) analysis was performed to determine the diagnostic capability of each of the image data sets. Finally, sensitivity, specificity and accuracy of the reconstructed images were compared by McNemar test. Results: Mean reading times for thin-section sagittal and coronal MPRs were significantly shorter than those for routine CT and thin-section CT (p < 0.05). Areas under the curve (Azs) showing interlobar invasion on thin-section sagittal and coronal MPRs were significantly larger than that on routine CT (p = 0.03), and the Az on thin-section sagittal MPR was also significantly larger than that on routine CT (p = 0.02). Accuracy of chest wall invasion by thin-section sagittal MPR was significantly higher than that by routine CT (p = 0.04). Conclusion: Thin-section multiplanar reformats from multidetector-row CT data sets are useful for assessing the extent of regional tumors in non-small

Correlation between the pionization region and the fragmentation region in high energy proton-proton collisions

CERN Document Server

Albrow, M G; Barber, D P; Bogaerts, A; Bosnjakovic, B; Brooks, J R; Clegg, A B; Erné, F C; Gee, C N P; Locke, D H; Loebinger, F K; Murphy, P G; Rudge, A; Sens, Johannes C

1973-01-01

Measurements are reported of two-particle correlations in high energy proton-proton collisions with one particle in the pionization region and the other a proton in the fragmentation region. The correlation function is independent of x of the fragmentation proton for 0.55small x. There is an indication that the correlation is an energy-independent function of x. The measurements for two values of the rapidity of the pionization particle give similar results. (11 refs).

TOF-SEMSANS—Time-of-flight spin-echo modulated small-angle neutron scattering

NARCIS (Netherlands)

Strobl, M.; Tremsin, A.S.; Hilger, A.; Wieder, F.; Kardjilov, N.; Manke, I.; Bouwman, W.G.; Plomp, J.

2012-01-01

We report on measurements of spatial beam modulation of a polarized neutron beam induced by triangular precession regions in time-of-flight mode and the application of this novel technique spin-echo modulated small-angle neutron scattering (SEMSANS) to small-angle neutron scattering in the very

SMALL AND MEDIUM-SIZED ENTERPRISES IN REPUBLIC OF MOLDOVA

Directory of Open Access Journals (Sweden)

Igor G. SÎRODOEV

2009-12-01

Full Text Available The paper examines the role of SME sector in Moldova’s economy and its likely implications in the RD processes. There are emphasized several key features of the relationship between knowledge economy, RD and SMEs, and their effect on regional and local communities. Then, a summary of RD particular features in Moldova is presented.The role of SME sector, examined in terms of its performance by ownership and activity types, as a whole and by main firms’ categories (micro-, small, and medium-sized is analyzed. Small enterprises have been considered as the most adequate solution forpromoting RD in general case. National-level analysis is completed by regional insight into the sector as a whole. Finally, some critical aspects of SMEs’ role in RD in Moldova are discussed.

Perinatal market penetration rate. A tool to evaluate regional perinatal programs.

Science.gov (United States)

Powers, W F; McGill, L

1987-01-01

Very small babies born in tertiary centers fare better than outborn babies referred for tertiary care after birth. Viewing the 1001-1500 gm regional cohort of fetuses as a potential "market" for center delivery, and measuring a center's penetration into this market, quantitates how well a center draws to itself these small, high-risk fetuses for delivery. An Illinois center's annual penetration rate into its regional market for the years 1973-1983 is presented and significant increases are found. The penetration rates of nine Illinois perinatal centers are calculated and wide discrepancies are found. Defining a high-risk regional cohort as a market stresses a perinatal center's obligation to its region. The penetration rate into a defined market measures how well a center fulfills this obligation.

SMALL-SCALE AND GLOBAL DYNAMOS AND THE AREA AND FLUX DISTRIBUTIONS OF ACTIVE REGIONS, SUNSPOT GROUPS, AND SUNSPOTS: A MULTI-DATABASE STUDY

Energy Technology Data Exchange (ETDEWEB)

Muñoz-Jaramillo, Andrés; Windmueller, John C.; Amouzou, Ernest C.; Longcope, Dana W. [Department of Physics, Montana State University, Bozeman, MT 59717 (United States); Senkpeil, Ryan R. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Tlatov, Andrey G. [Kislovodsk Mountain Astronomical Station of the Pulkovo Observatory, Kislovodsk 357700 (Russian Federation); Nagovitsyn, Yury A. [Pulkovo Astronomical Observatory, Russian Academy of Sciences, St. Petersburg 196140 (Russian Federation); Pevtsov, Alexei A. [National Solar Observatory, Sunspot, NM 88349 (United States); Chapman, Gary A.; Cookson, Angela M. [San Fernando Observatory, Department of Physics and Astronomy, California State University Northridge, Northridge, CA 91330 (United States); Yeates, Anthony R. [Department of Mathematical Sciences, Durham University, South Road, Durham DH1 3LE (United Kingdom); Watson, Fraser T. [National Solar Observatory, Tucson, AZ 85719 (United States); Balmaceda, Laura A. [Institute for Astronomical, Terrestrial and Space Sciences (ICATE-CONICET), San Juan (Argentina); DeLuca, Edward E. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Martens, Petrus C. H., E-mail: munoz@solar.physics.montana.edu [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30303 (United States)

2015-02-10

In this work, we take advantage of 11 different sunspot group, sunspot, and active region databases to characterize the area and flux distributions of photospheric magnetic structures. We find that, when taken separately, different databases are better fitted by different distributions (as has been reported previously in the literature). However, we find that all our databases can be reconciled by the simple application of a proportionality constant, and that, in reality, different databases are sampling different parts of a composite distribution. This composite distribution is made up by linear combination of Weibull and log-normal distributions—where a pure Weibull (log-normal) characterizes the distribution of structures with fluxes below (above) 10{sup 21}Mx (10{sup 22}Mx). Additionally, we demonstrate that the Weibull distribution shows the expected linear behavior of a power-law distribution (when extended to smaller fluxes), making our results compatible with the results of Parnell et al. We propose that this is evidence of two separate mechanisms giving rise to visible structures on the photosphere: one directly connected to the global component of the dynamo (and the generation of bipolar active regions), and the other with the small-scale component of the dynamo (and the fragmentation of magnetic structures due to their interaction with turbulent convection)

Small-scale field-aligned currents observed by the AKEBONO (EXOS-D) satellite

International Nuclear Information System (INIS)

Fukunishi, H.; Oya, H.; Kokubun, S.; Tohyama, F.; Mukai, T.; Fujii, R.

1991-01-01

The EXOS-D fluxgate magnetometer data obtained at 3,000-10,000 km altitude have shown that small-scale field-aligned currents always exist in large-scale region 1, region 2, cusp and polar cap current systems. Assuming that these small-scale field-aligned currents have current sheet structure, the width of current sheet is estimated to be 5-20 km at ionospheric altitude. By comparing the magnetometer data with charged particle and high frequency plasma wave data simultaneously obtained from EXOS-D, it is found that small-scale currents have one-to-one correspondence with localized electron precipitation events characterized by flux enhancement over a wide energy range from 10 eV to several keV and broadband electrostatic bursts occasionally extending above local plasma frequencies or electron cyclotron frequencies

Sometimes Overlooked: Women's Small Business Development Center.

Science.gov (United States)

Lariviere, Elizabeth A.

2001-01-01

Describes the development and growth of the Western Reserve Small Business Development Center for Women (Ohio), which promotes the advancement of women-owned businesses in the Northeastern Ohio region by assisting women in starting and maintaining their own businesses. States that the center offers low-cost training programs and counseling by a…

Accessibility of second regions of stability in tokamaks

Energy Technology Data Exchange (ETDEWEB)

Manickam, J.

1985-12-01

Second regions of stability to the ideal ballooning modes have been shown to exist in large-aspect-ratio circular and small-aspect-ratio bean-shaped tokamaks. We report on the existence of these second stability regions in finite-aspect-ratio dee-shaped tokamaks. We also report on the discovery of a second-stable region with respect to the n = 1 external kink mode in a bean-shaped plasma. The role of the shear and current profile in determining these regions of parameter space are discussed. 13 refs., 6 figs.

Accessibility of second regions of stability in tokamaks

International Nuclear Information System (INIS)

Manickam, J.

1985-12-01

Second regions of stability to the ideal ballooning modes have been shown to exist in large-aspect-ratio circular and small-aspect-ratio bean-shaped tokamaks. We report on the existence of these second stability regions in finite-aspect-ratio dee-shaped tokamaks. We also report on the discovery of a second-stable region with respect to the n = 1 external kink mode in a bean-shaped plasma. The role of the shear and current profile in determining these regions of parameter space are discussed. 13 refs., 6 figs

Should a small combined heat and power plant (CHP) open to its regional power and heat networks? Integrated economic, energy, and emergy evaluation of optimization plans for Jiufa CHP

International Nuclear Information System (INIS)

Peng, T.; Lu, H.F.; Wu, W.L.; Campbell, D.E.; Zhao, G.S.; Zou, J.H.; Chen, J.

2008-01-01

The development of industrial ecology has led company managers to increasingly consider their company's niche in the regional system, and to develop optimization plans. We used emergy-based, ecological-economic synthesis to evaluate two optimization plans for the Jiufa Combined Heat and Power (CHP) Plant, Shandong China. In addition, we performed economic input-output analysis and energy analysis on the system. The results showed that appropriately incorporating a firm with temporary extra productivity into its regional system will help maximize the total productivity and improve ecological-economic efficiency and benefits to society, even without technical optimization of the firm itself. In addition, developing a closer relationship between a company and its regional system will facilitate the development of new optimization opportunities. Small coal-based CHP plants have lower-energy efficiency, higher environmental loading, and lower sustainability than large fossil fuel and renewable energy-based systems. The emergy exchange ratio (EER) proved to be an important index for evaluating the vitality of highly developed ecological-economic systems

The Special Interest Tourism Development and the Small Regions

Directory of Open Access Journals (Sweden)

Drita Kruja

2011-04-01

Full Text Available It is easy to attract visitors when you have plenty of resources, nice accommodations, powerful selling techniques, many supporting sectors and of course reliable government support. The challenge starts when you lack most of the above and what you have is only a handful of beautiful natural resources, breathtaking sceneries, goodwill and a great desire and pride to show those visitors what your country is made of. How can we generate income using what we have? The answer is simple. You target that group of customers whom are specifically interested in what you have, beautiful views, heartfelt welcome, home like accommodations and very warm people. These customers do not look for fancy, expensive, overcrowded hotels; they are in search of real beauty and nature. They have special interests and would like to fulfill them toward a reasonable price. Hence starts the development of what is widely known as the special interest tourism whose analysis as a potential tool for the improvement of tourism in the region of Shkodra is the main purpose of this paper.

Molecular detection of toxigenic potential of fungi in peanut samples collected in retail shops in Maringá/PR, Brazil

Directory of Open Access Journals (Sweden)

Alessandra Valéria de Oliveira

2015-02-01

Full Text Available Many foods are susceptible to fungal contamination. Grains, such as peanuts, are commonly affected, with consequences including compromised integrity and infeasibility for human and animal consumption. Furthermore, some fungi may pose a health risk, largely due the production of mycotoxins. Among these, aflatoxins produced by Aspergillus flavus and A. parasiticus produce various carcinogenic, teratogenic, immunosuppressive, hepatotoxic and nephrotoxic effects. Molecular techniques have been used to identify and distinguish fungal species in foods. The objective of this study was molecular detection of Aspergillus species in peanut samples collected in stores in Maringá-PR, by amplification of fungal genetic material with specific primers for the intergenic spacer aflR-aflJ and later cutting with restriction enzymes. Of the 50 peanut samples analyzed, 27 were positive for the intergenic spacer aflR-aflJ, seven of which were identified as Aspergillus flavus. Our results demonstrate that peanuts sold in retail stores in this region have potential for contamination with toxigenic fungi.

Small steps for hydro

International Nuclear Information System (INIS)

Wicke, Peter

1998-01-01

The government in Peru has decided to utilise its gas reserves and restrict hydro to relatively small schemes. A number of reasons for the decision are given. In 1997, the Shell-Mobile-Bechtel-COSAPI consortium was formed and agreements were signed regarding exploiting Gas de Camisea. The country's energy needs to 2010 are being assessed. It is likely that by 2001 the whole of south Peru will be receiving gas from Camisea. The Peru situation is discussed under the headings of (i) existing capacity, (ii) growing demands, (iii) a history of hydro in Peru, (iv) electrification and SHP and (v) outlook. The future for Peru's electric energy development is bright. While most of its new power capacity will come from natural gas, the small hydros also have a part to play. A stronger commitment of national and regional political authorities to consider supplies outside the big cities is said to be needed. (UK)

Safety features in small integral PWR ABV-6

Energy Technology Data Exchange (ETDEWEB)

Baranaev, Youry D. [State Scientific Centre of Russian Federation - Institure for Physics and Power Engineering, Obninsk (Russian Federation)

1996-04-15

Long term operation experience of Bilibin Nuclear Power Plant with four EGP-6 reactors of 48MWth each at Chukotka peninsula, as well as results of manifold feasibility studies showed that Small Reactors (SR) have and will have promising market potential in outlying isolated regions of Russia as viable alternative of fossil fuel energy sources. Detailed design and licensing of the Small Floating Nuclear Power Plant Valamin/1/ with two integral pressurized water reactors ABV-6/2, 3/ is under way in Russia. The basic ABV-6 reactor design performance are presented in Table 1.

New limits to the small scale fluctuations in the cosmic background radiation

International Nuclear Information System (INIS)

Kellermann, K.I.; Fomalont, E.B.; Wall, J.V.

1983-01-01

The VLA has been used at 4.9 GHz to observe a small region of sky in order to extend the radio source count to low flux density (Fomalont et al., these proceedings) and to look for small scale fluctuations in the 2.7 K cosmic microwave background radiation. (Auth.)

A concept of wind-diesel hybrid systems for the electrification of small rural communities in Brazil

Energy Technology Data Exchange (ETDEWEB)

Pinho, J.T.; Bezerra, U.H. [Ag. Nucleo Universitario, Para (Brazil)

1997-12-31

This work presents the concept of a wind-diesel hybrid system for the electrification of a small rural community in the Northern Region of Brazil, which can be used in many other places with similar characteristics. The system consists of two small diesel units and two wind turbines, one of which was designed and developed as a prototype with the purpose of gaining some insight in the field of wind turbine technology. Some considerations about small communities of the Northern Region of Brazil, and about electrification concepts are also made.