Sloan foundation nuclear education program

International Nuclear Information System (INIS)

Kursunoglu, B.N.

1992-01-01

The Alfred P. Sloan Foundation realized the time had come for a real and significant contribution to the enlightenment of university students concerning nuclear matters. The Sloan Foundation chose to educate the youth of four-year colleges and universities with a curriculum established with the resource information sieved from three workshops for professors in these institutions. The three workshops were organized by groups at Harvard-MIT (two-week Summer Program on Nuclear Weapons and Arms Control), the University of California, San Diego (two-week Summer Seminar on Global Security and Arms Control), and the University of Miami (one-week Winter Workshop on Enlightenment: The Best Security in a Nuclear-Armed World). In this report the author focuses on a unified presentation of the basic facts, aims, and results of the Sloan Foundation Nuclear Education Program based on three workshops directed by Jack Ruina (MIT), Herbert York (USCD), and Behram Kursunoglu (UM) and offered from 1983-1990

Topology Analysis of the Sloan Digital Sky Survey. I. Scale and Luminosity Dependence

Science.gov (United States)

Park, Changbom; Choi, Yun-Young; Vogeley, Michael S.; Gott, J. Richard, III; Kim, Juhan; Hikage, Chiaki; Matsubara, Takahiko; Park, Myeong-Gu; Suto, Yasushi; Weinberg, David H.; SDSS Collaboration

2005-11-01

We measure the topology of volume-limited galaxy samples selected from a parent sample of 314,050 galaxies in the Sloan Digital Sky Survey (SDSS), which is now complete enough to describe the fully three-dimensional topology and its dependence on galaxy properties. We compare the observed genus statistic G(νf) to predictions for a Gaussian random field and to the genus measured for mock surveys constructed from new large-volume simulations of the ΛCDM cosmology. In this analysis we carefully examine the dependence of the observed genus statistic on the Gaussian smoothing scale RG from 3.5 to 11 h-1 Mpc and on the luminosity of galaxies over the range -22.50meatball'' (i.e., cluster dominated) topology, while faint galaxies show a positive shift toward a ``bubble'' (i.e., void dominated) topology. The transition from negative to positive shift occurs approximately at the characteristic absolute magnitude Mr*=-20.4. Even in this analysis of the largest galaxy sample to date, we detect the influence of individual large-scale structures, as the shift parameter Δν and cluster multiplicity AC reflect (at ~3 σ) the presence of the Sloan Great Wall and an X-shaped structure that runs for several hundred megaparsecs across the survey volume.

A. P. Sloan Jr. and leadership

Directory of Open Access Journals (Sweden)

Paul Marinescu

2014-05-01

Full Text Available Organizing the manufacturing processes constituted probably the most difficult challenge in the American automotive industry in the 1920s. A. P. Sloan Jr. was one of the greatest captains of industry and shaped General Motors Corporation into the largest automotive manufacturer of the world. His creative approach on how to mix a degree of decentralized responsibility with centralized control remains a useful example for every corporate leader. The aim of our paper is to emphasize the contribution of Sloan Jr. to the development of leadership. The methodological approach is literature review.

Historical Analysis of the Inorganic Chemistry Curriculum Using ACS Examinations as Artifacts

Science.gov (United States)

Srinivasan, Shalini; Reisner, Barbara A.; Smith, Sheila R.; Stewart, Joanne L.; Johnson, Adam R.; Lin, Shirley; Marek, Keith A.; Nataro, Chip; Murphy, Kristen L.; Raker, Jeffrey R.

2018-01-01

ACS Examinations provide a lens through which to examine historical changes in topic coverage via analyses of course-specific examinations. This study is an extension of work completed previously by the ACS Exams Research Staff and collaborators in general chemistry, organic chemistry, and physical chemistry to explore content changes in the…

Erratum: Sloan Magnitudes for the Brightest Stars

Science.gov (United States)

Mallama, A.

2018-06-01

In the article "Sloan Magnitudes for the Brightest Stars" (JAAVSO, 2014, 42, 443), Equation 3 in section A.1. of the Appendix is incorrect; the coefficient of ((R-I) - C1) should be 0.935, rather than 0.953. The mean differences between the new and old results are 0.00 in all cases, and the standard deviations are all 0.00 or 0.01, which is less than the photometric uncertainties of the Johnson or Sloan values. A revised version of the catalog has been published at https://arxiv.org/abs/1805.09324. The revision is proposed as a bright star extension to the APASS database.

The first detection of neutral hydrogen in emission in a strong spiral lens

Science.gov (United States)

Lipnicky, Andrew; Chakrabarti, Sukanya; Wright, Melvyn C. H.; Blitz, Leo; Heiles, Carl; Cotton, William; Frayer, David; Blandford, Roger; Shu, Yiping; Bolton, Adam S.

2018-05-01

We report H I observations of eight spiral galaxies that are strongly lensing background sources. Our targets were selected from the Sloan WFC (Wide Field Camera) Edge-on Late-type Lens Survey (SWELLS) using the Arecibo, Karl G. Jansky Very Large Array, and Green Bank telescopes. We securely detect J1703+2451 at z = 0.063 with a signal-to-noise ratio of 6.7 and W50 = 79 ± 13 km s-1, obtaining the first detection of H I emission in a strong spiral lens. We measure a mass of M_{H I} = (1.77± 0.06^{+0.35}_{-0.75})× 10^9 M_{⊙} for this source. We find that this lens is a normal spiral, with observable properties that are fairly typical of spiral galaxies. For three other sources, we did not secure a detection; however, we are able to place strong constraints on the H I masses of those galaxies. The observations for four of our sources were rendered unusable due to strong radio frequency interference.

New features in MADX thin-lens tracking module

CERN Document Server

Sun, Y; CERN. Geneva. BE Department

2010-01-01

In this note, we introduce several new features of the MADX thin-lens tracking module, which include the new element AC dipole, the new feature ‘NOISE’ attached to the class ‘multipole’, and the offset of the ‘aperture’ model. We also present simulation results for the benchmark between different codes, and some applications with examples.

New features in MADX thin-lens tracking module

CERN Document Server

Sun, YP; CERN. Geneva. BE Department

2010-01-01

In this note, we introduce several new features of the MADX thin-lens tracking module, which include the new element AC dipole, the new feature ‘NOISE’attached to the class ‘multipole’, and the offset of the ‘aperture’ model. We also present simulation results for the benchmark between different codes, and some applications with examples.

75 FR 22423 - Pick-Sloan Missouri Basin Program, Eastern and Western Division Proposed Project Use Power Rate

Science.gov (United States)

2010-04-28

...: Reopening of comment period for review of the Pick-Sloan Missouri Basin Program, Eastern and Western... reopening the comment period for the Pick-Sloan Missouri Basin Program, Eastern and Western Division... DEPARTMENT OF THE INTERIOR Bureau of Reclamation Pick-Sloan Missouri Basin Program, Eastern and...

75 FR 1408 - Pick-Sloan Missouri Basin Program, Eastern and Western Division Proposed Project Use Power Rate

Science.gov (United States)

2010-01-11

... of Proposed Pick-Sloan Missouri Basin Program, Eastern and Western Divisions, Project Use Power Rate...) for Project Use Power for the Pick-Sloan Missouri Basin Program (P-SMBP), Eastern and Western... DEPARTMENT OF THE INTERIOR Bureau of Reclamation Pick-Sloan Missouri Basin Program, Eastern and...

Analysis of incidence and related factors on effusion of anterior chamber after phacoemulsification combined with intraocular lens implantation

Directory of Open Access Journals (Sweden)

Bing-Bing Zhao

2018-02-01

Full Text Available AIM: To investigate the incidence and related factors on effusion of anterior chamber(ACafter phacoemulsification(PEcombined with intraocular lens(IOLimplantation. METHODS: Totally 359 cases of cataract(375 eyesunderwent PE combined with IOL implantation were collected in our hospital. The incidence of AC exudation after operation and related factors were analyzed by single factor and multiple logistic regression analysis. RESULTS: The group was included in 359 cases(375 eyes. The incidence of postoperative AC exudation in the study group was 5.9%(22/375. The preoperative intraocular pressure(IOP, visual acuity before and after surgery, nuclear grades, posterior capsular rupture(PCRrate and ultrasonic accumulated energy complex parameter(AECPof the study group showed statistically significant difference compared with the control group(all P21mmHg, intraoperative pupil diameter 7.25(%×min, the lens nucleus grade ≥ IV were risk factors of AC exudation after PE combined with IOL implantation in patients with cataract(all P21mmHg, ultrasound AECP >7.25 were independent risk factors of AC exudation after PE combined with IOL implantation in patients with cataract(all PCONCLUSION: High myopia, glaucoma, uveitis, the lens nucleus grade ≥ IV, the incidence of intraoperative PCR, preoperative IOP>21mmHg, ultrasonic AECP>7.25 are independent risk factors of AC exudation after PE combined with IOL implantation in patients with cataract, with such risk factors in patients with cataract should be paid closely attention and timely diagnosis and treatment in clinic.

Agreement analysis comparing iPad LCVA and Sloan testing in multiple sclerosis patients.

Science.gov (United States)

Sattarnezhad, Neda; Farrow, Samantha; Kimbrough, Dorlan; Glanz, Bonnie; Healy, Brian; Chitnis, Tanuja

2017-06-01

Visual symptoms are common in multiple sclerosis (MS). Low-contrast visual acuity (LCVA) testing using Sloan charts has demonstrated increased sensitivity for visual deficits compared to high-contrast acuity testing. Computerized testing of visual acuity may facilitate use in the clinic setting. To evaluate the agreement between an iPad-based and Sloan testing of LCVA in a cohort of MS patients. A total of 38 patients with relapsing-remitting MS were enrolled after providing informed written consent at Partners MS Center, Brigham and Women's hospital. Monocular LCVA was measured using retroilluminated Sloan chart and iPad-based LogMAR chart. Number of correct letters and agreement between two measurements were assessed for each eye using Bland-Altman analysis and paired t-test. For both eyes, there was no significant difference in number correct between the two measurements using a paired t-test, and there was high correlation between two measurements (oculus dextrus (OD) r = 0.89, p iPad-based LCVA test shows good agreement with Sloan testing in MS patients.

Customized broadband Sloan-filters for the JST/T250 and JAST/T80 telescopes: measurement summary

Science.gov (United States)

Brauneck, Ulf; Sprengard, Ruediger; Bourquin, Sebastien; Marín-Franch, Antonio

2018-01-01

The Centro de Estudios de Fisica del Cosmos de Aragon will conduct a photometric sky survey with two new telescopes recently set up on the Javalambre mountain in Spain: the JST/T250 is a 2.55-m telescope with a plate scale of 22.67 arc⁢sec/mm and a 3-deg-diameter field of view (FoV) and the auxiliary telescope JAST/T80 with a 82-cm primary mirror and an FoV of 2 deg diameter. A multiple CCD (9k-by-9k array size, 10-μm pixel size) mosaic camera is used in combination with filter trays or filter wheels, each containing a multitude of filters in dimensions of 101.7×96.5 mm or 106.8×106.8 mm. For this project, Schott manufactured 56 specially designed narrow band steep-edged bandpass interference filters and five broadband Sloan-filters which were completed only recently. We report here on the results of the broadband Sloan-filters with transmission bands of 324 to 400 nm (Sloan-u), 400 to 550 nm (Sloan-g), 550 to 700 nm (Sloan-r), 695 to 850 nm (Sloan-i), and 830 to 1200 nm (Sloan-z). The filters are composed of Schott filterglasses and clearglass substrates coated with interference filters and represent an improvement of broadband Sloan filters commonly used in astronomy. In spite of the absorptive elements, the filters show maximum possible transmissions achieved by magnetron sputtered filter coatings. In addition, the blocking of the filters is better than OD5 (transmission <10 to -5) in the range 250 to 1050 nm which was achieved by combining up to three substrates. A high image quality required a low transmitted wavefront error (<λ/8 locally, respectively <λ/2 globally). We report on the spectral and interferometric results measured on the filters.

Medicinal use of earths and minerals from Hippocrates to Sir Hans Sloane and beyond.

Science.gov (United States)

Retsas, Spyros

2012-12-01

In 1931 two pharmaceutical drawers containing mineral specimens, belonging to Sir Hans Sloane, the 18th century collector, Royal Physician, President of the Royal Society and of the Royal College of Physicians of London, were found in the Department of Botany of the Natural History Museum (NHM) of London. The drawers, each divided into 49 compartments, contained a total of 107 mineral pharmaceutical specimens, some labelled as mercury or white arsenic. Their registration, identification with the Sloane Manuscript Catalogues and subsequent transfer to the Mineralogy department of the NHM where one of these drawers is now on public display, had been documented by 1935. In antiquity therapeutic empiricism attributed medicinal properties to animal products, plants and minerals, including the soil of specific geographic locations. This communication traces the medicinal use of certain earths and minerals, listed in Sir Hans Sloane's manuscript catalogues, to classical antiquity with a reference to Arsenic compounds, which in our time are finding application in the treatment of acute promyelocytic leukaemia and to Terra Lemnia, a celebrated antidote of repute spanning twenty centuries, also included in the Sloane collections.

Linear and nonlinear optical properties of a hydrogenic donor in lens-shaped quantum dots

International Nuclear Information System (INIS)

Vahdani, M.R.K.; Rezaei, G.

2009-01-01

Optical transitions in a Lens-Shaped Quantum Dot (LSD) are investigated in the presence of a hydrogenic impurity. The electronic wave functions are obtained analytically and the energy eigenvalues are calculated numerically. The density matrix formulation with the intersubband relaxation are used to evaluate the (linear and third order nonlinear) absorption coefficient (AC) and the change in the refractive indices (RI) analytically. The effect of the size of the LSD and optical intensity on the AC and RI are investigated. It is found that AC and RI are strongly affected by the optical intensity and the size of the LSD.

Linear and nonlinear optical properties of a hydrogenic donor in lens-shaped quantum dots

Energy Technology Data Exchange (ETDEWEB)

Vahdani, M.R.K. [Department of Physics, College of Sciences, Shiraz University, Shiraz 71454 (Iran, Islamic Republic of); Rezaei, G., E-mail: grezaei@mail.yu.ac.i [Department of Physics, College of Sciences, Yasouj University, Yasouj 75914 (Iran, Islamic Republic of)

2009-08-17

Optical transitions in a Lens-Shaped Quantum Dot (LSD) are investigated in the presence of a hydrogenic impurity. The electronic wave functions are obtained analytically and the energy eigenvalues are calculated numerically. The density matrix formulation with the intersubband relaxation are used to evaluate the (linear and third order nonlinear) absorption coefficient (AC) and the change in the refractive indices (RI) analytically. The effect of the size of the LSD and optical intensity on the AC and RI are investigated. It is found that AC and RI are strongly affected by the optical intensity and the size of the LSD.

THE SL2S GALAXY-SCALE LENS SAMPLE. V. DARK MATTER HALOS AND STELLAR IMF OF MASSIVE EARLY-TYPE GALAXIES OUT TO REDSHIFT 0.8

Energy Technology Data Exchange (ETDEWEB)

Sonnenfeld, Alessandro; Treu, Tommaso [Physics Department, University of California, Santa Barbara, CA 93106 (United States); Marshall, Philip J. [Kavli Institute for Particle Astrophysics and Cosmology, P.O. Box 20450, MS29, Stanford, CA 94309 (United States); Suyu, Sherry H. [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 10617, Taiwan (China); Gavazzi, Raphaël [Institut d' Astrophysique de Paris, UMR7095 CNRS-Université Pierre et Marie Curie, 98bis bd Arago, F-75014 Paris (France); Auger, Matthew W. [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Nipoti, Carlo, E-mail: sonnen@physics.ucsb.edu [Department of Physics and Astronomy, Bologna University, viale Berti-Pichat 6/2, I-40127 Bologna (Italy)

2015-02-20

We investigate the cosmic evolution of the internal structure of massive early-type galaxies over half of the age of the universe. We perform a joint lensing and stellar dynamics analysis of a sample of 81 strong lenses from the Strong Lensing Legacy Survey and Sloan ACS Lens Survey and combine the results with a hierarchical Bayesian inference method to measure the distribution of dark matter mass and stellar initial mass function (IMF) across the population of massive early-type galaxies. Lensing selection effects are taken into account. We find that the dark matter mass projected within the inner 5 kpc increases for increasing redshift, decreases for increasing stellar mass density, but is roughly constant along the evolutionary tracks of early-type galaxies. The average dark matter slope is consistent with that of a Navarro-Frenk-White profile, but is not well constrained. The stellar IMF normalization is close to a Salpeter IMF at log M {sub *} = 11.5 and scales strongly with increasing stellar mass. No dependence of the IMF on redshift or stellar mass density is detected. The anti-correlation between dark matter mass and stellar mass density supports the idea of mergers being more frequent in more massive dark matter halos.

Constraint on the post-Newtonian parameter γ on galactic size scales

International Nuclear Information System (INIS)

Bolton, Adam S.; Rappaport, Saul; Burles, Scott

2006-01-01

We constrain the post-Newtonian gravity parameter γ on kiloparsec scales by comparing the masses of 15 elliptical lensing galaxies from the Sloan Lens ACS Survey as determined in two independent ways. The first method assumes only that Newtonian gravity is correct and is independent of γ, while the second uses gravitational lensing which depends on γ. More specifically, we combine Einstein radii and radial surface-brightness gradient measurements of the lens galaxies with empirical distributions for the mass concentration and velocity anisotropy of elliptical galaxies in the local universe to predict γ-dependent probability distributions for the lens-galaxy velocity dispersions. By comparing with observed velocity dispersions, we derive a maximum-likelihood value of γ=0.98±0.07 (68% confidence). This result is in excellent agreement with the prediction of general relativity that γ=1, which has previously been verified to this accuracy only on solar-system length scales

SDSS-IV MaNGA: the spectroscopic discovery of strongly lensed galaxies

Science.gov (United States)

Talbot, Michael S.; Brownstein, Joel R.; Bolton, Adam S.; Bundy, Kevin; Andrews, Brett H.; Cherinka, Brian; Collett, Thomas E.; More, Anupreeta; More, Surhud; Sonnenfeld, Alessandro; Vegetti, Simona; Wake, David A.; Weijmans, Anne-Marie; Westfall, Kyle B.

2018-06-01

We present a catalogue of 38 spectroscopically detected strong galaxy-galaxy gravitational lens candidates identified in the Sloan Digital Sky Survey IV (SDSS-IV). We were able to simulate narrow-band images for eight of them demonstrating evidence of multiple images. Two of our systems are compound lens candidates, each with two background source-planes. One of these compound systems shows clear lensing features in the narrow-band image. Our sample is based on 2812 galaxies observed by the Mapping Nearby Galaxies at APO (MaNGA) integral field unit (IFU). This Spectroscopic Identification of Lensing Objects (SILO) survey extends the methodology of the Sloan Lens ACS Survey (SLACS) and BOSS Emission-Line Survey (BELLS) to lower redshift and multiple IFU spectra. We searched ˜1.5 million spectra, of which 3065 contained multiple high signal-to-noise ratio background emission-lines or a resolved [O II] doublet, that are included in this catalogue. Upon manual inspection, we discovered regions with multiple spectra containing background emission-lines at the same redshift, providing evidence of a common source-plane geometry which was not possible in previous SLACS and BELLS discovery programs. We estimate more than half of our candidates have an Einstein radius ≳ 1.7 arcsec, which is significantly greater than seen in SLACS and BELLS. These larger Einstein radii produce more extended images of the background galaxy increasing the probability that a background emission-line will enter one of the IFU spectroscopic fibres, making detection more likely.

Protection of the eye lens

International Nuclear Information System (INIS)

2015-01-01

The limit of radiation exposure for eye lens is going to decrease dramatically from 150 to 20 mSv as a transposition into the French law of a CIPR (International Commission for Radiation Protection) directive. Sanitary studies have shown that radiologists are more likely by a factor of 3.8 to get eye lens opacities than the rest of the population. The wearing of protective glasses is recommended and in order to get a better monitoring of the radiation dose new dosimeters have been designed, they can be worn on the glass frame of directly stuck on the skin near the eyes. A study has shown that veterinary surgeons that are accustomed to stay near animals to keep them quiet during radiological exams are prone to receive high doses as well as physicians that use hypnosis to decrease the level of anxiety of their patients during radiological exams. Radiation exposure of radiologists can be mitigated through: the use of protective shields and equipment and the optimization of the dose delivered to the patient. (A.C.)

Cosmic Shear With ACS Pure Parallels

Science.gov (United States)

Rhodes, Jason

2002-07-01

Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan textiti {F775W} we will measure for the first time: beginlistosetlength sep0cm setlengthemsep0cm setlengthopsep0cm em the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

Customized broadband sloan-filters for the JST/T250 and JAST/T80 telescopes: summary of results

Science.gov (United States)

Brauneck, U.; Sprengard, R.; Bourquin, S.; Marín-Franch, A.

2017-09-01

The Centro de Estudios de Fisica del Cosmos de Aragon (CEFCA) will conduct a photometric sky survey with 2 new telescopes recently setup on the Javalambre mountain in Spain: the JST/T250 is a 2.55m telescope with a plate scale of 22.67"/mm and a 3° diameter field of view (FoV) and the auxiliary telescope JAST/T80 with a 82cm primary mirror and a FoV of 2 deg diameter. A multiple CCD (9k-by-9k array size, 10μm pixel size) mosaic camera is used in combination with filter trays or filter wheels, each containing a multitude of filters in dimensions of 101.7x96.5mm or 106.8x106.8mm. For this project, SCHOTT manufactured 56 specially designed narrow band steep edged bandpass interference filters and 5 broadband sloan-filters which were completed only recently. We report here on the results of the broadband sloanfilters with transmission bands of 324-400nm (sloan-u), 400-550nm (sloan-g), 550-700nm (sloan-r), 695-850nm (sloan-i) and 830-1200nm (sloan-z). The filters are composed of SCHOTT filterglasses and clearglass substrates coated with interference filters and represent an improvement of broadband sloan filters commonly used in astronomy. Inspite of the absorptive elements, the filters show maximum possible transmissions achieved by magnetron sputtered filter coatings. In addition the blocking of the filters is better than OD5 in the range 250-1050nm. A high image quality required a low transmitted wavefront error (<λ/8 locally, respectively <λ/2 globally) which was achieved by combining up to 2 substrates. We report on the spectral and interferometric results measured on the filters.

The sloan digital sky survey-II supernova survey

DEFF Research Database (Denmark)

Frieman, Joshua A.; Bassett, Bruce; Becker, Andrew

2008-01-01

The Sloan Digital Sky Survey-II (SDSS-II) has embarked on a multi-year project to identify and measure light curves for intermediate-redshift (0.05 < z < 0.35) Type Ia supernovae (SNe Ia) using repeated five-band (ugriz) imaging over an area of 300 sq. deg. The survey region is a stripe 2.5° wide...

Single lens to lens duplication: The missing link

OpenAIRE

Bhatt, Rupal; Jethani, Jitendra; Saluja, Praveen; Bharti, Vinay

2008-01-01

Congenital anomalies of the lens include a wide range from lens coloboma to primary aphakia and doubling of lens. There have been few case reports of double lens; the etiology suggested is metaplastic changes in the surface ectoderm that leads to formation of two lens vesicles and hence resulting in double lens. We report a case with bilobed lens, which raises the possibility of explaining the etiology of double lens.

Aberration design of zoom lens systems using thick lens modules.

Science.gov (United States)

Zhang, Jinkai; Chen, Xiaobo; Xi, Juntong; Wu, Zhuoqi

2014-12-20

A systematic approach for the aberration design of a zoom lens system using a thick lens module is presented. Each component is treated as a thick lens module at the beginning of the design. A thick lens module refers to a thick lens component with a real lens structure, like lens materials, lens curvatures, lens thicknesses, and lens interval distances. All nine third-order aberrations of a thick lens component are considered during the design. The relationship of component aberrations in different zoom positions can be approximated from the aberration shift. After minimizing the aberrations of the zoom lens system, the nine third-order aberrations of every lens component can be determined. Then the thick lens structure of every lens component can be determined after optimization according to their first-order properties and third-order aberration targets. After a third optimization for minimum practical third-order aberrations of a zoom lens system, the aberration design using the thick lens module is complete, which provides a practical zoom lens system with thick lens structures. A double-sided telecentric zoom lens system is designed using the thick lens module in this paper, which shows that this method is practical for zoom lens design.

Sloan Digital Sky Survey Photometric Calibration Revisited

International Nuclear Information System (INIS)

Marriner, John

2012-01-01

The Sloan Digital Sky Survey calibration is revisited to obtain the most accurate photometric calibration. A small but significant error is found in the flat-fielding of the Photometric telescope used for calibration. Two SDSS star catalogs are compared and the average difference in magnitude as a function of right ascension and declination exhibits small systematic errors in relative calibration. The photometric transformation from the SDSS Photometric Telescope to the 2.5 m telescope is recomputed and compared to synthetic magnitudes computed from measured filter bandpasses.

Sloan Digital Sky Survey Photometric Calibration Revisited

Energy Technology Data Exchange (ETDEWEB)

Marriner, John; /Fermilab

2012-06-29

The Sloan Digital Sky Survey calibration is revisited to obtain the most accurate photometric calibration. A small but significant error is found in the flat-fielding of the Photometric telescope used for calibration. Two SDSS star catalogs are compared and the average difference in magnitude as a function of right ascension and declination exhibits small systematic errors in relative calibration. The photometric transformation from the SDSS Photometric Telescope to the 2.5 m telescope is recomputed and compared to synthetic magnitudes computed from measured filter bandpasses.

Cosmic Shear With ACS Pure Parallels. Targeted Portion.

Science.gov (United States)

Rhodes, Jason

2002-07-01

Small distortions in the shapes of background galaxies by foreground mass provide a powerful method of directly measuring the amount and distribution of dark matter. Several groups have recently detected this weak lensing by large-scale structure, also called cosmic shear. The high resolution and sensitivity of HST/ACS provide a unique opportunity to measure cosmic shear accurately on small scales. Using 260 parallel orbits in Sloan i {F775W} we will measure for the first time: the cosmic shear variance on scales Omega_m^0.5, with signal-to-noise {s/n} 20, and the mass density Omega_m with s/n=4. They will be done at small angular scales where non-linear effects dominate the power spectrum, providing a test of the gravitational instability paradigm for structure formation. Measurements on these scales are not possible from the ground, because of the systematic effects induced by PSF smearing from seeing. Having many independent lines of sight reduces the uncertainty due to cosmic variance, making parallel observations ideal.

Comparison of the unitary pole and Adhikari-Sloan expansions in the three nucleon system

International Nuclear Information System (INIS)

Afnan, I.R.; Birrell, N.D.

1977-01-01

The binding energy of 3 H, percentage S-, S'- and D-state probability, and charge form factor of 3 He are calculated using the unitary pole and Adhikari-Sloan separable expansions to the Reid soft core potential. Comparison of the results for the two separable expansions show that the expansion of Adhikari and Sloan has the better convergence property, and the lowest rank expansion considered (equivalent to the unitary pole approximation) gives a good approximation to the binding energy of 3 H and the charge form factor of 3 He, even at large momentum transfer (K 2 -2 ). (Author)

[Pigment dispersion and Artisan implants: crystalline lens rise as a safety criterion].

Science.gov (United States)

Baikoff, G; Bourgeon, G; Jodai, H Jitsuo; Fontaine, A; Vieira Lellis, F; Trinquet, L

2005-06-01

To validate the theoretical notion of a crystalline lens rise as a safety criterion for ARTISAN implants in order to prevent the development of pigment dispersion in the implanted eye. Crystalline lens rise is defined by the distance between the crystalline lens's anterior pole and the horizontal plane joining the opposite iridocorneal recesses. We analyzed the biometric measurements of 87 eyes with an Artisan implant. A comparative analysis of the crystalline lens rise was carried out on the nine eyes having developed pigment dispersion and 78 eyes with no problems. Among the modern anterior segment imaging devices (Artemis, Scheimpflug photography, optical coherence tomography, radiology exploration, magnetic resonance imaging, TDM), an anterior chamber optical coherence tomography (AC-OCT) prototype was used. This working hypothesis was confirmed by this study: the crystalline lens rise must be considered as a new safety criterion for implanting Artisan phakic lenses. Indeed, the higher the crystalline lens's rise, the greater the risk of developing pigment dispersion in the pupil area. This complication is more frequent in hyperopes than in myopes. We can consider that there is little or no risk of pigment dispersion if the rise is below 600 microm; however, at 600 microm or greater, there is a 67% rate of pupillary pigment dispersion. In certain cases, when the implant was loosely fixed, there was no traction on the iris root. This is a complication that can be avoided or delayed. The crystalline lens rise must be part of new safety criteria to be taken into consideration when inserting an Artisan implant. This notion must also be applied to other types of phakic implants. The distance remaining between the crystalline lens rise and a 600-micromm theoretical safety level allows one to calculate a safety time interval.

Pigment dispersion and Artisan phakic intraocular lenses: crystalline lens rise as a safety criterion.

Science.gov (United States)

Baïkoff, Georges; Bourgeon, Grégoire; Jodai, Horacio Jitsuo; Fontaine, Aline; Lellis, Fernando Viera; Trinquet, Laure

2005-04-01

To validate the theory that crystalline lens rise can be used as a safety criterion to prevent pigment dispersion in eyes with an Artisan phakic intraocular lens (IOL) (Ophtec BV). Monticelli Clinic, Marseilles, France. A comparative analysis of crystalline lens rise in 9 eyes with pigment dispersion and 78 eyes without dispersion was performed. All eyes had previous implantation of an Artisan IOL. Anterior segment imaging was done using an anterior chamber optical coherence tomography (AC OCT) prototype. Crystalline lens rise was defined by the distance between the anterior pole of the crystalline lens and the horizontal plane joining the opposite iridocorneal recesses. The study confirmed that crystalline lens rise can be considered a safety criterion for implantation of Artisan-type phakic IOLs. The higher the crystalline lens rise, the greater the risk for developing pigment dispersion in the area of the pupil. This complication occurred more frequently in hyperopic eyes than in myopic eyes. Results indicate there is little or no risk for pigment dispersion if the rise is less than 600 microm; 67% of eyes with a rise of 600 microm or more developed pupillary pigment dispersion. In some cases in which the IOL was loosely fixated, there was no traction on the iris root and dispersion was prevented or delayed. Crystalline lens rise should be considered a new safety criterion for Artisan phakic IOL implantation and should also be applied to other types of phakic IOLs. The distance remaining between the crystalline lens rise and a 600 microm theoretical safety level allows one to calculate how long the IOL can safely remain in the eye.

Lens stem cells may reside outside the lens capsule: an hypothesis

Directory of Open Access Journals (Sweden)

Meyer Rita A

2007-06-01

Full Text Available Abstract In this paper, we consider the ocular lens in the context of contemporary developments in biological ideas. We attempt to reconcile lens biology with stem cell concepts and a dearth of lens tumors. Historically, the lens has been viewed as a closed system, in which cells at the periphery of the lens epithelium differentiate into fiber cells. Theoretical considerations led us to question whether the intracapsular lens is indeed self-contained. Since stem cells generate tumors and the lens does not naturally develop tumors, we reasoned that lens stem cells may not be present within the capsule. We hypothesize that lens stem cells reside outside the lens capsule, in the nearby ciliary body. Our ideas challenge the existing lens biology paradigm. We begin our discussion with lens background information, in order to describe our lens stem cell hypothesis in the context of published data. Then we present the ciliary body as a possible source for lens stem cells, and conclude by comparing the ocular lens with the corneal epithelium.

The Fourteenth Data Release of the Sloan Digital Sky Survey

DEFF Research Database (Denmark)

Abolfathi, Bela; Aguado, D. S.; Aguilar, Gabriela

2018-01-01

The fourth generation of the Sloan Digital Sky Survey (SDSS-IV) has been in operation since 2014 July. This paper describes the second data release from this phase, and the 14th from SDSS overall (making this Data Release Fourteen or DR14). This release makes the data taken by SDSS-IV in its firs...

Photometric redshift requirements for lens galaxies in galaxy-galaxy lensing analyses

Science.gov (United States)

Nakajima, R.; Mandelbaum, R.; Seljak, U.; Cohn, J. D.; Reyes, R.; Cool, R.

2012-03-01

Weak gravitational lensing is a valuable probe of galaxy formation and cosmology. Here we quantify the effects of using photometric redshifts (photo-z) in galaxy-galaxy lensing, for both sources and lenses, both for the immediate goal of using galaxies with photo-z as lenses in the Sloan Digital Sky Survey (SDSS) and as a demonstration of methodology for large, upcoming weak lensing surveys that will by necessity be dominated by lens samples with photo-z. We calculate the bias in the lensing mass calibration as well as consequences for absolute magnitude (i.e. k-corrections) and stellar mass estimates for a large sample of SDSS Data Release 8 (DR8) galaxies. The redshifts are obtained with the template-based photo-z code ZEBRA on the SDSS DR8 ugriz photometry. We assemble and characterize the calibration samples (˜9000 spectroscopic redshifts from four surveys) to obtain photometric redshift errors and lensing biases corresponding to our full SDSS DR8 lens and source catalogues. Our tests of the calibration sample also highlight the impact of observing conditions in the imaging survey when the spectroscopic calibration covers a small fraction of its footprint; atypical imaging conditions in calibration fields can lead to incorrect conclusions regarding the photo-z of the full survey. For the SDSS DR8 catalogue, we find σΔz/(1+z)= 0.096 and 0.113 for the lens and source catalogues, with flux limits of r= 21 and 21.8, respectively. The photo-z bias and scatter is a function of photo-z and template types, which we exploit to apply photo-z quality cuts. By using photo-z rather than spectroscopy for lenses, dim blue galaxies and L* galaxies up to z˜ 0.4 can be used as lenses, thus expanding into unexplored areas of parameter space. We also explore the systematic uncertainty in the lensing signal calibration when using source photo-z, and both lens and source photo-z; given the size of existing training samples, we can constrain the lensing signal calibration (and

A Correlation of Thin Lens Approximation to Thick Lens Design by Using Coddington Factors in Lens Design and Manufacturing

OpenAIRE

FARSAKOĞLU, Ö. Faruk

2014-01-01

The effect of Coddington factors on aberration functions has been analysed using thin lens approximation. Minimizing spherical aberrations of singlet lenses using Coddington factors in lens design depending on lens manufacturing is discussed. Notation of lens test plate pairs used in lens manufacturing is also presented in terms of Coddington shape factors.

The Data Release of the Sloan Digital Sky Survey-II Supernova Survey

DEFF Research Database (Denmark)

Sako, Masao; Bassett, Bruce; C. Becker, Andrew

2014-01-01

This paper describes the data release of the Sloan Digital Sky Survey-II (SDSS-II) Supernova Survey conducted between 2005 and 2007. Light curves, spectra, classifications, and ancillary data are presented for 10,258 variable and transient sources discovered through repeat ugriz imaging of SDSS S...

Immunohistochemical studies of lens crystallins in the dysgenetic lens (dyl) mutant mice

NARCIS (Netherlands)

Brahma, S.K.; Sanyal, S.

1984-01-01

The lens in the dyl mutant mice shows a persistent lens-ectodermal connection as well as degeneration and extrusion of lens materials after the initial differentiation of the fibres. Immunohistochemical investigation of the ontogeny of the lens crystallins in this developing mutant lens has been

Sharing of secondary electrons by in-lens and out-lens detector in low-voltage scanning electron microscope equipped with immersion lens.

Science.gov (United States)

Kumagai, Kazuhiro; Sekiguchi, Takashi

2009-03-01

To understand secondary electron (SE) image formation with in-lens and out-lens detector in low-voltage scanning electron microscopy (LV-SEM), we have evaluated SE signals of an in-lens and an out-lens detector in LV-SEM. From the energy distribution spectra of SEs with various boosting voltages of the immersion lens system, we revealed that the electrostatic field of the immersion lens mainly collects electrons with energy lower than 40eV, acting as a low-pass filter. This effect is also observed as a contrast change in LV-SEM images taken by in-lens and out-lens detectors.

The Sloan Digital Sky Survey: Status and prospects

Energy Technology Data Exchange (ETDEWEB)

Loveday, J.; SDSS Collaboration

1996-05-01

The Sloan Digital Sky Survey (SDSS) is a project to definitively map {pi} steradians of the local Universe. An array of CCD detectors used in drift-scan mode will digitally image the sky in five passbands to a limiting magnitude of r{prime} {approximately} 23. Selected from the imaging survey, 10{sup 6} galaxies and 10{sup 5} quasars will be observed spectroscopically. I describe the current status of the survey, which is due to begin observations early in 1997, and its prospects for constraining models for dark matter in the Universe. 8 refs., 7 figs.

The Sloan-C Pillars: Towards a Balanced Approach to Measuring Organizational Learning

Science.gov (United States)

Yeo, Kee Meng; Mayadas, A. Frank

2010-01-01

The Sloan Pillars have set the standard for university-wide online learning program assessment for more than a dozen years. In this paper, the authors propose the extension of the Pillars to corporate e-learning, offering an alternative to traditional enterprise learning assessments. Claiming that conventional methods stress individual courses or…

A Strong-Lens Survey in AEGIS: the influence of large scalestructure

Energy Technology Data Exchange (ETDEWEB)

Moustakas, Leonidas A.; Marshall, Phil; Newman, Jeffrey A.; Coil,Alison L.; Cooper, Michael C.; Davis, Marc; Fassnacht, Christopher D.; Guhathakurta, Puragra; Hopkins, Andrew; Koekemoer, Anton; Konidaris,Nicholas P.; Lotz, Jennifer M.; Willmer, Christopher N. A.

2006-10-13

We report on the results of a visual search for galaxy-scale strong gravitational lenses over 650 arcmin{sup 2} of HST/ACS (F606W and F814W) imaging in the DEEP2-Extended Groth Strip (EGS). In addition to a previously-known Einstein Cross also found by our search (the 'Cross', HSTJ141735+52264, z{sub lens} = 0.8106, z{sub source} = 3.40), we identify two new strong galaxy-galaxy lenses with multiple extended arcs. The first, HSTJ141820+52361 (the 'Dewdrop'; z{sub lens} = 0.5798), lenses two distinct extended sources into two pairs of arcs (z{sub source} = 0.9818), while the second, HSTJ141833+52435 (the 'Anchor'; z{sub lens} = 0.4625), produces a single pair of arcs (z{sub lens} not yet known). Four less convincing arc/counter-arc and two-image lens candidates are also found and presented for completeness. Lenses are found in a both underdense and overdense local environments, as characterized by a robust measure, 1+{delta}{sub 3}, a normalized density that uses the distance to the third nearest neighbor. All three definite lenses are fit reasonably well by simple singular isothermal ellipsoid models including external shear, giving {chi}{sub {nu}}{sup 2} values close to unity. These shears are much greater than those implied by a simple consideration of the three-dimensional convergence and shear from galaxies along the line of sight, where each galaxy is approximated by a singular isothermal sphere halo truncated at 200 h{sup -1} kpc. This shows how a realistic treatment of galaxies and the large scale structure they are embedded in is necessary, and that simply characterizing the very-local environment may be insufficient.

Contemporary computational mathematics a celebration of the 80th birthday of Ian Sloan

CERN Document Server

Kuo, Frances; Woźniakowski, Henryk

2018-01-01

This book is a tribute to Professor Ian Hugh Sloan on the occasion of his 80th birthday. It consists of nearly 60 articles written by international leaders in a diverse range of areas in contemporary computational mathematics. These papers highlight the impact and many achievements of Professor Sloan in his distinguished academic career. The book also presents state of the art knowledge in many computational fields such as quasi-Monte Carlo and Monte Carlo methods for multivariate integration, multi-level methods, finite element methods, uncertainty quantification, spherical designs and integration on the sphere, approximation and interpolation of multivariate functions, oscillatory integrals, and in general in information-based complexity and tractability, as well as in a range of other topics. The book also tells the life story of the renowned mathematician, family man, colleague and friend, who has been an inspiration to many of us. The reader may especially enjoy the story from the perspective of his fami...

Post-lens tear turbidity and visual quality after scleral lens wear.

Science.gov (United States)

Carracedo, Gonzalo; Serramito-Blanco, Maria; Martin-Gil, Alba; Wang, Zicheng; Rodriguez-Pomar, Candela; Pintor, Jesús

2017-11-01

The aim was to evaluate the turbidity and thickness of the post-lens tear layer and its effect on visual quality in patients with keratoconus after the beginning of lens wear and before lens removal at the end of eight hours. Twenty-six patients with keratoconus (aged 36.95 ± 8.95 years) participated voluntarily in the study. The sample was divided into two groups: patients with intrastromal corneal ring (ICRS group) and patients without ICRS (KC group). Distance visual acuity (VA), contrast sensitivity, pachymetry, post-lens tear layer height and post-lens tear layer turbidity (percentage area occupied and number of particles per mm 2 ) were evaluated with optical coherence tomography before and after wearing a scleral lens. A significant increase of turbidity was found in all groups assessed (p turbidity parameters with distance VA but no correlation between turbidity and post-lens tear layer thickness at the beginning was found (p > 0.05). A strong correlation in all groups between the post-lens tear layer at the beginning and differences of tear layer thickness between two measures was also found (p turbidity. © 2017 Optometry Australia.

Disinfection capacity of PuriLens contact lens cleaning unit against Acanthamoeba.

Science.gov (United States)

Hwang, Thomas S; Hyon, Joon Young; Song, Jae Kyung; Reviglio, Victor E; Spahr, Harry T; O'Brien, Terrence P

2004-01-01

The PuriLens contact lens system is indicated for cleaning and disinfection of soft (hydrophilic) contact lenses by means of subsonic agitation to remove lens deposits and microorganisms, and ultraviolet irradiation of the storage solution for disinfection. The capacity of the PuriLens system to disinfect storage solutions contaminated with known concentrations of Staphylococcus aureus, Pseudomonas aeruginosa, and Acanthamoeba species was evaluated. An in vitro assessment of the antibacterial and antiparasitic efficacy of the PuriLens system was performed. Separated batches of the storage solution for the cleansing system were contaminated with stock strains of S. aureus and P. aeruginosa. A comparison of the microbiologic content was made between the solution before and after the cycle. The PuriLens system effectively eradicated S. aureus and P. aeruginosa organisms after a 15-minute cycle. However, viable cysts of acanthamoeba were recovered in the solution after the 15-minute cycle. The PuriLens system is highly efficient in protecting against contamination with common bacterial ocular pathogens. Acanthamoeba cysts, however, can survive in the solution or contact lens bath undergoing integrated subsonic debridement and indirect ultraviolet light disinfection. Use of chemical disinfecting solutions that contain agents such as chlorhexidine or other cationic antiseptics may be advisable in conjunction with use of the PuriLens device, especially in high-risk settings.

The Effect of the Crystalline Lens on Central Vault After Implantable Collamer Lens Implantation.

Science.gov (United States)

Qi, Meng-Ying; Chen, Qian; Zeng, Qing-Yan

2017-08-01

To identify associations between crystalline lens-related factors and central vault after Implantable Collamer Lens (ICL) (Staar Surgical, Monrovia, CA) implantation. This retrospective clinical study included 320 eyes from 186 patients who underwent ICL implantation surgery. At 1 year after surgery, the central vault was measured using anterior segment optical coherence tomography. Preoperative anterior chamber depth, lens thickness, lens position (lens position = anterior chamber depth + 1/2 lens thickness), and vault were analyzed to investigate the effects of lens-related factors on postoperative vault. The mean vault was 513 ± 215 µm at 1 year after surgery. Vault was positively correlated with preoperative anterior chamber depth (r = 0.495, P lens position (r = 0.371, P lens thickness (r = -0.262, P lens position than eyes in the other two vault groups (which had vaults ≥ 250 µm) (P lens position less than 5.1 mm had greatly reduced vaults (P lens could have an important influence on postoperative vault. Eyes with a shallower anterior chamber and a forward lens position will have lower vaults. [J Refract Surg. 2017;33(8):519-523.]. Copyright 2017, SLACK Incorporated.

Measurement of Crystalline Lens Volume During Accommodation in a Lens Stretcher.

Science.gov (United States)

Marussich, Lauren; Manns, Fabrice; Nankivil, Derek; Maceo Heilman, Bianca; Yao, Yue; Arrieta-Quintero, Esdras; Ho, Arthur; Augusteyn, Robert; Parel, Jean-Marie

2015-07-01

To determine if the lens volume changes during accommodation. The study used data acquired on 36 cynomolgus monkey lenses that were stretched in a stepwise fashion to simulate disaccommodation. At each step, stretching force and dioptric power were measured and a cross-sectional image of the lens was acquired using an optical coherence tomography system. Images were corrected for refractive distortions and lens volume was calculated assuming rotational symmetry. The average change in lens volume was calculated and the relation between volume change and power change, and between volume change and stretching force, were quantified. Linear regressions of volume-power and volume-force plots were calculated. The mean (± SD) volume in the unstretched (accommodated) state was 97 ± 8 mm3. On average, there was a small but statistically significant (P = 0.002) increase in measured lens volume with stretching. The mean change in lens volume was +0.8 ± 1.3 mm3. The mean volume-power and volume-load slopes were -0.018 ± 0.058 mm3/D and +0.16 ± 0.40 mm3/g. Lens volume remains effectively constant during accommodation, with changes that are less than 1% on average. This result supports a hypothesis that the change in lens shape with accommodation is accompanied by a redistribution of tissue within the capsular bag without significant compression of the lens contents or fluid exchange through the capsule.

Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

International Nuclear Information System (INIS)

Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

1997-01-01

The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

Analysis of causes of intraocular lens explantations in the material of Department of Ophthalmology, Medical University of Lodz.

Science.gov (United States)

Wilczyński, Michał; Wilczyńska, Olena; Omulecki, Wojciech

2009-01-01

Implantation of intraocular lenses (IOLS) has become a standard practice in cataract surgery, however, similar to any other type of surgery, using IOLs is not complication-free and sometimes explantation of intraocular lenses may be necessary. This study was to gather data and analyze causes of intraocular lens explantations, performed in the Department of Ophthalmology, Medical University of Łódź. The data were gathered from medical documentation of all patients who underwent intraocular lens removal from January 2003 to July 2006. The examined group consisted of 16 patients (16 eyes): 9 women (fraction 0.56), and 7 men (fraction 0.44), at the age from 21 to 82 years (mean age 62.4 years, SD +/- 15.5). In all patients IOL explantation was performed under local, peribulbar anaesthesia. Two groups of patients were distinguished: patients who had an anterior chamber lens explanted (3 patients, fraction 0.19) and patients who underwent posterior chamber lens explantation (13 patients, fraction 0.81). Causes of AC IOL explantations were: vaulting of the IOL (1 eye, fraction 0.06), luxation of the IOL to the vitreous cavity (1 eye, fraction 0.06), and painful eyeball after anterior chamber lens implantation (1 eye, fraction 0.06). Causes of PC IOL explantations were: subluxation of the IOL (6 eyes, fraction 0.38), luxation of the lens to the vitreous cavity (3 eyes, fraction 0.19), luxation of the lens to the anterior chamber (1 eye, fraction 0.06), endophthalmitis (2 eyes, fraction 0.13) and incorrect lens power (1 eye, fraction 0.06). In the majority of eyes (n = 13, fraction 0.81) the removed implant was replaced by another intraocular lens, but 3 eyes (fraction 0.19) were left aphakic. We did not observe serious intra- or early postoperative complications which might influence the final result of the operation.

AutoLens: Automated Modeling of a Strong Lens's Light, Mass and Source

Science.gov (United States)

Nightingale, J. W.; Dye, S.; Massey, Richard J.

2018-05-01

This work presents AutoLens, the first entirely automated modeling suite for the analysis of galaxy-scale strong gravitational lenses. AutoLens simultaneously models the lens galaxy's light and mass whilst reconstructing the extended source galaxy on an adaptive pixel-grid. The method's approach to source-plane discretization is amorphous, adapting its clustering and regularization to the intrinsic properties of the lensed source. The lens's light is fitted using a superposition of Sersic functions, allowing AutoLens to cleanly deblend its light from the source. Single component mass models representing the lens's total mass density profile are demonstrated, which in conjunction with light modeling can detect central images using a centrally cored profile. Decomposed mass modeling is also shown, which can fully decouple a lens's light and dark matter and determine whether the two component are geometrically aligned. The complexity of the light and mass models are automatically chosen via Bayesian model comparison. These steps form AutoLens's automated analysis pipeline, such that all results in this work are generated without any user-intervention. This is rigorously tested on a large suite of simulated images, assessing its performance on a broad range of lens profiles, source morphologies and lensing geometries. The method's performance is excellent, with accurate light, mass and source profiles inferred for data sets representative of both existing Hubble imaging and future Euclid wide-field observations.

The Sloan-C Pillars and Boundary Objects As a Framework for Evaluating Blended Learning

Science.gov (United States)

Laumakis, Mark; Graham, Charles; Dziuban, Chuck

2009-01-01

The authors contend that blended learning represents a boundary object; a construct that brings together constituencies from a variety of backgrounds with each of these cohorts defining the object somewhat differently. The Sloan-C Pillars (learning effectiveness, access, cost effectiveness, student satisfaction, and faculty satisfaction) provide…

AC Initiation System.

Science.gov (United States)

An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

Optical integration of Pancharatnam-Berry phase lens and dynamical phase lens

International Nuclear Information System (INIS)

Ke, Yougang; Liu, Yachao; Zhou, Junxiao; Liu, Yuanyuan; Luo, Hailu; Wen, Shuangchun

2016-01-01

In the optical system, most elements such as lens, prism, and optical fiber are made of silica glass. Therefore, integrating Pancharatnam-Berry phase elements into silica glass has potential applications in the optical system. In this paper, we take a lens, for example, which integrates a Pancharatnam-Berry phase lens into a conventional plano-convex lens. The spin states and positions of focal points can be modulated by controlling the polarization states of the incident beam. The proposed lens has a high transmission efficiency, and thereby acts as a simple and powerful tool to manipulate spin photons. Furthermore, the method can be conveniently extended to the optical fiber and laser cavity, and may provide a route to the design of the spin-photonic devices.

Converging or Diverging Lens?

Science.gov (United States)

Branca, Mario

2013-01-01

Why does a lens magnify? Why does it shrink objects? Why does this happen? The activities that we propose here are useful in helping us to understand how lenses work, and they show that the same lens can have different magnification capabilities. A converging lens can also act as a diverging lens. (Contains 4 figures.)

Placement of a crystalline lens and intraocular lens: Retinal image quality.

Science.gov (United States)

Siedlecki, Damian; Nowak, Jerzy; Zajac, Marek

2006-01-01

The influence of changes of both crystalline lens and intraocular lens (IOL) misalignment on the retinal image quality was investigated. The optical model of the eye used in investigations was the Liou-Brennan model, which is commonly considered as one of the most anatomically accurate. The original crystalline lens from this model was replaced with an IOL, made of rigid polymethylmethacrylate, in a way that recommend obligatory procedures. The modifications that were made both for crystalline lens and IOL were the longitudinal, the transversal, and the angular displacement.

Finding Clusters of Galaxies in the Sloan Digital Sky Survey using Voronoi Tessellation

International Nuclear Information System (INIS)

Rita S.J., Kim

2001-01-01

The Sloan Digital Sky Survey has obtained 450 square degrees of photometric scan data, in five bands (u', g', r', i', z'), which the authors use to identify clusters of galaxies. They illustrate how they do star-galaxy separation, and present a simple and elegant method of detecting over-densities in the galaxy distribution, using the Voronoi Tessellation

Refractive neutron lens

International Nuclear Information System (INIS)

Petrov, P.V.; Kolchevsky, N.N.

2013-01-01

Model of the refractive neutron lens is proposed. System of N lenses acts as one thin lens with a complex refraction index n*. The maximum number N max of individual lenses for 'thick' neutron lens is calculated. Refractive neutron lens properties (resolution, focal depth) as function of resolution factor F 0 =ρbc/μ and depth of field factor dF 0 =λF 0 =λρbc/μ are calculated. It is shown that micro resolution of the refractive neutron optics is far from the wavelength in size and its open possibilities for progress in refractive neutron optics. (authors)

Exchange of tears under a contact lens is driven by distortions of the contact lens.

Science.gov (United States)

Maki, Kara L; Ross, David S

2014-12-01

We studied the flow of the post-lens tear film under a soft contact lens to understand how the design parameters of contact lenses can affect ocular health. When a soft contact lens is inserted, the blinking eyelid causes the lens to stretch in order to conform to the shape of the eye. The deformed contact lens acts to assume its un-deformed shape and thus generates a suction pressure in the post-lens tear film. In consequence, the post-lens tear fluid moves; it responds to the suction pressure. The suction pressure may draw in fresh fluid from the edge of the lens, or it may eject fluid there, as the lens reassumes its un-deformed shape. In this article, we develop a mathematical model of the flow of the post-lens tear fluid in response to the mechanical suction pressure of a deformed contact lens. We predict the amount of exchange of fluid exchange under a contact lens and we explore the influence of the eye's shape on the rate of exchange of fluid. © The Author 2014. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

Peripheral Defocus of the Monkey Crystalline Lens With Accommodation in a Lens Stretcher

Science.gov (United States)

Maceo Heilman, Bianca; Manns, Fabrice; Ruggeri, Marco; Ho, Arthur; Gonzalez, Alex; Rowaan, Cor; Bernal, Andres; Arrieta, Esdras; Parel, Jean-Marie

2018-01-01

Purpose To characterize the peripheral defocus of the monkey crystalline lens and its changes with accommodation. Methods Experiments were performed on 15 lenses from 11 cynomolgus monkey eyes (age: 3.8–12.4 years, postmortem time: 33.5 ± 15.3 hours). The tissue was mounted in a motorized lens stretcher to allow for measurements of the lens in the accommodated (unstretched) and unaccommodated (stretched) states. A custom-built combined laser ray tracing and optical coherence tomography system was used to measure the paraxial on-axis and off-axis lens power for delivery angles ranging from −20° to +20° (in air). For each delivery angle, peripheral defocus was quantified as the difference between paraxial off-axis and on-axis power. The peripheral defocus of the lens was compared in the unstretched and stretched states. Results On average, the paraxial on-axis lens power was 52.0 ± 3.4 D in the unstretched state and 32.5 ± 5.1 D in the stretched state. In both states, the lens power increased with increasing delivery angle. From 0° to +20°, the relative peripheral lens power increased by 10.7 ± 1.4 D in the unstretched state and 7.5 ± 1.6 D in the stretched state. The change in field curvature with accommodation was statistically significant (P lens has greater curvature or relative peripheral power. Conclusions The cynomolgus monkey lens has significant accommodation-dependent curvature of field, which suggests that the lens asserts a significant contribution to the peripheral optical performance of the eye that also varies with the state of accommodation.

Study on ac losses of HTS coil carrying ac transport current

International Nuclear Information System (INIS)

Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

2005-01-01

Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

Dynamical Black Hole Masses of BL Lac Objects from the Sloan Digital Sky Survey

NARCIS (Netherlands)

Plotkin, Richard M.; Markoff, Sera; Trager, Scott C.; Anderson, Scott F.

2012-01-01

We measure black hole masses for 71 BL Lac objects from the Sloan Digital Sky Survey (SDSS) with redshifts out to z ∼ 0.4. We perform spectral decompositions of their nuclei from their host galaxies and measure their stellar velocity dispersions. Black hole masses are then derived from the black

Compliance among soft contact lens wearers.

Science.gov (United States)

Kuzman, Tomislav; Kutija, Marija Barisić; Masnec, Sanja; Jandroković, Sonja; Mrazovac, Danijela; Jurisić, Darija; Skegro, Ivan; Kalauz, Miro; Kordić, Rajko

2014-12-01

Contact lens compliance is proven to be crucial for preventing lens wear-related complications because of the interdependence of the steps in lens care regime and their influence on lens system microbial contamination. Awareness of the patients' lens handling compliance as well as correct recognition of non-compliant behaviours is the basis for creating more targeted strategies for patient education. The aim of this study was to investigate compliance among soft contact lens (SCL) wearers in different aspects of lens care handling and wearing habits. In our research 50 asymptomatic lens wearers filled out a questionnaire containing demographic data, lens type, hygiene and wearing habits, lenses and lens care system replacement schedule and self-evaluation of contact lens handling hygiene. We established criteria of compliance according to available manufacturer's recommendations, prior literature and our clinical experience. Only 2 (4%) of patients were fully compliant SCL wearers. The most common non-compliant behaviours were insufficient lens solution soaking time (62%), followed by failure to daily exchange lens case solution and showering while wearing lenses. 44% of patients reported storing lenses in saline solution. Mean lens storage case replacement was 3.6 months, with up to 78% patients replacing lens case at least once in 3 months. Average grade in self evaluating level of compliance was very good (4 +/- 0.78) (from 1-poor level of hygiene to 5-great level of hygiene). Lens wearers who reported excessive daily lens wear and more than 10 years of lens wearing experience were also found to be less compliant with other lens system care procedures. (t = -2.99, df=47, p rate, self grading was relatively high. Therefore, these results indicate the need for patient education and encouragement of better lens wearing habits and all of the lens maintenance steps at each patient visit.

Comparison of clear lens extraction and collamer lens implantation in high myopia

Directory of Open Access Journals (Sweden)

Ahmed M Emarah

2010-05-01

Full Text Available Ahmed M Emarah, Mostafa A El-Helw, Hazem M YassinCairo University, Cairo, EgyptAim: To compare the outcomes of clear lens extraction and collamer lens implantation in high myopia.Patients and methods: Myopic patients younger than 40 years old with more than 12 diopters of myopia or who were not fit for laser-assisted in situ keratomileusis were included. Group 1 comprised patients undergoing clear lens extraction and Group 2 patients received the Visian implantable collamer lens. Outcome and complications were evaluated.Results: Postoperative best corrected visual acuity was -0.61 ± 0.18 in Group 1 and 0.79 ± 0.16 in Group 2. In Group 1, 71.4% achieved a postoperative uncorrected visual acuity better than the preoperative best corrected visual acuity, while only 51.8% patients achieved this in Group 2. Intraocular pressure decreased by 12.55% in Group 1, and increased by 15.11% in Group 2. Corneal endothelial cell density decreased by 4.47% in Group 1 and decreased by 5.67% in Group 2. Posterior capsule opacification occurred in Group 1. In Group 2, lens opacification occurred in 11.11%, significant pigment dispersion in 3.7%, and pupillary block glaucoma in 3.7%.Conclusion: Clear lens extraction presents less of a financial load up front, and less likelihood of the need for a secondary intervention in the future. Clear lens extraction is a more viable solution in developing countries with limited financial resources.Keywords: clear lens extraction, implantable collamer lens, myopia

Multi-phase AC/AC step-down converter for distribution systems

Science.gov (United States)

Aeloiza, Eddy C.; Burgos, Rolando P.

2017-10-25

A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

Changes in lens stiffness due to capsular opacification in accommodative lens refilling

NARCIS (Netherlands)

Nibourg, Lisanne M.; Sharma, Prashant K.; van Kooten, Theo G.; Koopmans, Steven A.

Accommodation may be restored to presbyopic lenses by refilling the lens capsular bag with a soft polymer. After this accommodative lens refilling prevention of capsular opacification is a requirement, since capsular opacification leads to a decreased clarity of the refilled lens. It has been

TU-E-201-03: Eye Lens Dosimetry in Radiotherapy Using Contact Lens-Shaped Applicator

Energy Technology Data Exchange (ETDEWEB)

Park, J. [Seoul National University Hospital (Korea, Republic of)

2015-06-15

Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

TU-E-201-03: Eye Lens Dosimetry in Radiotherapy Using Contact Lens-Shaped Applicator

International Nuclear Information System (INIS)

Park, J.

2015-01-01

Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

Contact Lens-Related Eye Infections

Science.gov (United States)

... Español Eye Health / Eye Health A-Z Contact Lens-Related Eye Infections Sections Contact Lens-Related Eye ... Six Steps to Avoid Contact Lens Infections Contact Lens-Related Eye Infections Leer en Español: Infecciones relacionadas ...

Vortex gas lens

Science.gov (United States)

Bogdanoff, David W.; Berschauer, Andrew; Parker, Timothy W.; Vickers, Jesse E.

1989-01-01

A vortex gas lens concept is presented. Such a lens has a potential power density capability of 10 to the 9th - 10 to the 10th w/sq cm. An experimental prototype was constructed, and the divergence half angle of the exiting beam was measured as a function of the lens operating parameters. Reasonably good agreement is found between the experimental results and theoretical calculations. The expanded beam was observed to be steady, and no strong, potentially beam-degrading jets were found to issue from the ends of the lens. Estimates of random beam deflection angles to be expected due to boundary layer noise are presented; these angles are very small.

Primary anterior chamber intraocular lens for the treatment of severe crystalline lens subluxation.

Science.gov (United States)

Hoffman, Richard S; Fine, I Howard; Packer, Mark

2009-10-01

Subluxated cataractous and clear lenses are commonly treated by limbal or pars plana lensectomy followed by primary or secondary intraocular lens (IOL) implantation. Adjunctive capsular prosthetic devices have facilitated lens removal and IOL centration in these challenging cases but have also added complexity and potential complications to the procedure. Although crystalline lens extraction may be required to clear the visual axis in mild to moderate lens subluxations, we propose insertion of a primary anterior chamber IOL without lens extraction in severe subluxations when the eye is optically aphakic or can be made functionally aphakic following neodymium:YAG laser zonulysis. Two cases demonstrating this approach are presented.

AC – AC Converters for UPS

Directory of Open Access Journals (Sweden)

Rusalin Lucian R. Păun

2008-05-01

Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

Performance of AC/graphite capacitors at high weight ratios of AC/graphite

Energy Technology Data Exchange (ETDEWEB)

Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

2008-03-01

The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

Capsular 'pits' in the human lens.

OpenAIRE

Harris, M. L.; Brown, N. A.; Shun-Shin, G. A.; Smith, G. T.

1992-01-01

The lens capsule is an atypical basement membrane surrounding the lens epithelial cells and lens fibres which make up the remainder of the human lens. A seemingly unreported morphological change visible in the lens capsule with the biomicroscope is described.

A Survey of z>5.7 Quasars in the Sloan Digital Sky Survey IV

DEFF Research Database (Denmark)

Fan, Xiaohui; Strauss, Michael A.; Richards, Gordon T.

2005-01-01

We present the discovery of seven quasars at z>5.7, selected from ~2000 deg^2 of multicolor imaging data of the Sloan Digital Sky Survey (SDSS). The new quasars have redshifts z from 5.79 to 6.13. Five are selected as part of a complete flux-limited sample in the SDSS Northern Galactic Cap; two...

A high excitation magnetic quadrupole lens quadruplet incorporating a single octupole lens for a low spherical aberration probe forming lens system

Science.gov (United States)

Dou, Yanxin; Jamieson, David N.; Liu, Jianli; Li, Liyi

2018-03-01

This paper describes the design of a new probe forming lens system consisting of a high excitation magnetic quadrupole lens quadruplet that incorporates a single magnetic octupole lens. This system achieves both a high demagnification and a low spherical aberration compared to conventional high excitation systems and is intended for deployment for the Harbin 300 MeV proton microprobe for applications in space science and ion beam therapy. This relative simplicity of the ion optical design to include a single octupole lens minimizes the risks associated with the constructional and operational precision usually needed for the probe forming lens system and this system could also be deployed in microprobe systems that operate with less magnetically rigid ions. The design of the new system is validated with reference to two independent ion optical computer codes.

Objective lens

Science.gov (United States)

Olczak, Eugene G. (Inventor)

2011-01-01

An objective lens and a method for using same. The objective lens has a first end, a second end, and a plurality of optical elements. The optical elements are positioned between the first end and the second end and are at least substantially symmetric about a plane centered between the first end and the second end.

Searching for white dwarfs candidates in Sloan Digital Sky Survey Data

International Nuclear Information System (INIS)

Nalezyty, Miroslaw; Majczyna, Agnieszka; Ciechanowska, Anna; Madej, Jerzy

2009-01-01

Large amount of observational spectroscopic data are recently available from different observational projects, like Sloan Digital Sky Survey. It's become more urgent to identify white dwarfs stars based on data itself i.e. without modelling white dwarf atmospheres. In particular, existing methods of white dwarfs identification presented in Kleinman et al. (2004) and in Eisenstein et al. (2006) did not allow to find all the white dwarfs in examined data. We intend to test various criteria of searching for white dwarf candidates, based on photometric and spectral features.

Contact Lens Care

Science.gov (United States)

... Consumers Consumer Information by Audience For Women Contact Lens Care Share Tweet Linkedin Pin it More sharing ... www.fda.gov/medwatch Learn More about Contact Lens Care Other Tips on Contact Lenses Decorative Contact ...

Oxygen transport through soft contact lens and cornea: Lens characterization and metabolic modeling

Science.gov (United States)

Chhabra, Mahendra

The human cornea requires oxygen to sustain metabolic processes critical for its normal functioning. Any restriction to corneal oxygen supply from the external environment (e.g., by wearing a low oxygen-permeability contact lens) can lead to hypoxia, which may cause corneal edema (swelling), limbal hyperemia, neovascularization, and corneal acidosis. The need for adequate oxygen to the cornea is a major driving force for research and development of hypertransmissible soft contact lenses (SCLs). Currently, there is no standard technique for measuring oxygen permeability (Dk) of hypertransmissible silicone-hydrogel SCLs. In this work, an electrochemistry-based polarographic apparatus was designed, built, and operated to measure oxygen permeability in hypertransmissible SCLs. Unlike conventional methods where a range of lens thickness is needed for determining oxygen permeabilities of SCLs, this apparatus requires only a single lens thickness. The single-lens permeameter provides a reliable, efficient, and economic tool for measuring oxygen permeabilities of commercial hypertransmissible SCLs. The single-lens permeameter measures not only the product Dk, but, following modification, it measures separately diffusivity, D, and solubility, k, of oxygen in hypertransmissible SCLs. These properties are critical for designing better lens materials that ensure sufficient oxygen supply to the cornea. Metabolism of oxygen in the cornea is influenced by contact-lens-induced hypoxia, diseases such as diabetes, surgery, and drug treatment, Thus, estimation of the in-vivo corneal oxygen consumption rate is essential for gauging adequate oxygen supply to the cornea. Therefore, we have developed an unsteady-state reactive-diffusion model for the cornea-contact-lens system to determine in-vivo human corneal oxygen-consumption rate. Finally, a metabolic model was developed to determine the relation between contact-lens oxygen transmissibility (Dk/L) and corneal oxygen deficiency. A

Crystalline lens power and refractive error.

Science.gov (United States)

Iribarren, Rafael; Morgan, Ian G; Nangia, Vinay; Jonas, Jost B

2012-02-01

To study the relationships between the refractive power of the crystalline lens, overall refractive error of the eye, and degree of nuclear cataract. All phakic participants of the population-based Central India Eye and Medical Study with an age of 50+ years were included. Calculation of the refractive lens power was based on distance noncycloplegic refractive error, corneal refractive power, anterior chamber depth, lens thickness, and axial length according to Bennett's formula. The study included 1885 subjects. Mean refractive lens power was 25.5 ± 3.0 D (range, 13.9-36.6). After adjustment for age and sex, the standardized correlation coefficients (β) of the association with the ocular refractive error were highest for crystalline lens power (β = -0.41; P lens opacity grade (β = -0.42; P lens power (β = -0.95), lower corneal refractive power (β = -0.76), higher lens thickness (β = 0.30), deeper anterior chamber (β = 0.28), and less marked nuclear lens opacity (β = -0.05). Lens thickness was significantly lower in eyes with greater nuclear opacity. Variations in refractive error in adults aged 50+ years were mostly influenced by variations in axial length and in crystalline lens refractive power, followed by variations in corneal refractive power, and, to a minor degree, by variations in lens thickness and anterior chamber depth.

THE SLOAN DIGITAL SKY SURVEY CO-ADD: A GALAXY PHOTOMETRIC REDSHIFT CATALOG

International Nuclear Information System (INIS)

Reis, Ribamar R. R.; Soares-Santos, Marcelle; Annis, James; Dodelson, Scott; Hao Jiangang; Johnston, David; Kubo, Jeffrey; Lin Huan; Seo, Hee-Jong; Simet, Melanie

2012-01-01

We present and describe a catalog of galaxy photometric redshifts (photo-z) for the Sloan Digital Sky Survey (SDSS) Co-add Data. We use the artificial neural network (ANN) technique to calculate the photo-z and the nearest neighbor error method to estimate photo-z errors for ∼13 million objects classified as galaxies in the co-add with r 68 = 0.031. After presenting our results and quality tests, we provide a short guide for users accessing the public data.

Characteristics of the thick, compound refractive lens

International Nuclear Information System (INIS)

Pantell, Richard H.; Feinstein, Joseph; Beguiristain, H. Raul; Piestrup, Melvin A.; Gary, Charles K.; Cremer, Jay T.

2003-01-01

A compound refractive lens (CRL), consisting of a series of N closely spaced lens elements each of which contributes a small fraction of the total focusing, can be used to focus x rays or neutrons. The thickness of a CRL can be comparable to its focal length, whereupon a thick-lens analysis must be performed. In contrast with the conventional optical lens, where the ray inside the lens follows a straight line, the ray inside the CRL is continually changing direction because of the multiple refracting surfaces. Thus the matrix representation for the thick CRL is quite different from that for the thick optical lens. Principal planes can be defined such that the thick-lens matrix can be converted to that of a thin lens. For a thick lens the focal length is greater than for a thin lens with the same lens curvature, but this lengthening effect is less for the CRL than for the conventional optical lens

AcEST: DK949629 [AcEST

Lifescience Database Archive (English)

Full Text Available Thread biopolymer filament subunit gamma OS... 38 0.062 sp|P18490|PCX_DROME Protein pecanex OS=Drosophila me...AMMEGSSSGGHSMYSSSSM 575 >sp|P18490|PCX_DROME Protein pecanex OS=Drosophila melanogaster GN=pcx PE=2 SV=3 Len

TU-E-201-01: Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionists

Energy Technology Data Exchange (ETDEWEB)

Rehani, M. [Massachusetts General Hospital (United States)

2015-06-15

Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

TU-E-201-01: Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionists

International Nuclear Information System (INIS)

Rehani, M.

2015-01-01

Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

DISSECTING THE GRAVITATIONAL LENS B1608+656. I. LENS POTENTIAL RECONSTRUCTION

NARCIS (Netherlands)

Suyu, S. H.; Marshall, P. J.; Blandford, R. D.; Fassnacht, C. D.; Koopmans, L. V. E.; McKean, J. P.; Treu, T.

2009-01-01

Strong gravitational lensing is a powerful technique for probing galaxy mass distributions and for measuring cosmological parameters. Lens systems with extended source-intensity distributions are particularly useful for this purpose since they provide additional constraints on the lens potential (

Intraocular lens fabrication

Energy Technology Data Exchange (ETDEWEB)

Salazar, Mike A. (Albuquerque, NM); Foreman, Larry R. (Los Alamos, NM)

1997-01-01

This invention describes a method for fabricating an intraocular lens made rom clear Teflon.TM., Mylar.TM., or other thermoplastic material having a thickness of about 0.025 millimeters. These plastic materials are thermoformable and biocompatable with the human eye. The two shaped lenses are bonded together with a variety of procedures which may include thermosetting and solvent based adhesives, laser and impulse welding, and ultrasonic bonding. The fill tube, which is used to inject a refractive filling material is formed with the lens so as not to damage the lens shape. A hypodermic tube may be included inside the fill tube.

Straylight Measurements in Contact Lens Wear

NARCIS (Netherlands)

van der Meulen, Ivanka J. E.; Engelbrecht, Leonore A.; van Vliet, Johannes M. J.; Lapid-Gortzak, Ruth; Nieuwendaal, Carla P.; Mourits, Maarten P.; Schlingemann, Reinier O.; van den Berg, Thomas J. T. P.

2010-01-01

Purpose: (1) To quantify the effect of contact lens wear on straylight in rigid and soft contact lens wearers and (2) to relate findings to morphological changes and subjective complaints. Methods: Straylight was measured using the Oculus C-Quant during contact lens wear and after contact lens

Quadrupole magnetic lens

International Nuclear Information System (INIS)

Piskunov, V.A.

1981-01-01

The following connection of windings of electromagnet is suggested for simplification of the design of qUadrupole magnetic lens intended for use in radiotechnical and electron-optical devices. The mentioned windings are connected with each other by a bridge scheme and the variable resistors are switched in its diagonals in the lens containing four electromagnet with windings connected with two variable resistors the mobile contacts of which are connected with a direct current source. Current redistribution between left windings and right windings takes place at shift of mobile contact of variable resistor, and current redistribution between upper and low coils of electromagnets takes place at shifting mobile contact of the other variable resistor. In this case smooth and independent electron-optical misalignment of lens by two mutually perpendicular directions proceeds. Use of the given design of the lens in the oscillograph permits to use printing assembly for alignment plate and to reduce the number of connections at the expense of decreasing the number of resistors

AcEST: BP911450 [AcEST

Lifescience Database Archive (English)

Full Text Available EGU_VZVD Large tegument protein OS=Varicella-zoster virus (strain Dumas) Align length 93 Score (bit) 31.2 E-...8.3 >sp|P09278|TEGU_VZVD Large tegument protein OS=Varicella-zoster virus (strain Dumas) GN=22 PE=3 SV=1 Len

Contact lens surface by electron beam

International Nuclear Information System (INIS)

Shin, Jung Hyuck; Lee, Suk Ju; Hwang, Kwang Ha; Jeon Jin

2011-01-01

Contact lens materials needs good biocompatibility, high refractive index, high optical transparency, high water content etc. Surface treat method by using plasma and radiation can modify the physical and/or chemical properties of the contact lens surface. Radiation technology such as electron beam irradiation can apply to polymerization reaction and enhance the functionality of the polymer.The purpose of this study is to modify of contact lens surface by using Eb irradiation technology. Electron beam was irradiated to the contact lens surface which was synthesized thermal polymerization method and commercial contact lens to modify physical and chemical properties. Ft-IR, XP, UV-vis spectrophotometer, water content, oxygen trans-metastability were used to characterize the surface state, physicochemical, and optical property of the contact lens treated with Eb. The water content and oxygen transmissibility of the contact lens treated with Eb were increased due to increase in the hydrophilic group such as O-C=O and OH group on the contact lens surface which could be produced by possible reaction between carbon and oxygen during the Eb irradiation. All of the lenses showed the high optical transmittance above 90%. In this case of B/Es, TES, Ti contact lens, the optical transmittance decreased about 5% with increasing Eb dose in the wavelength of UV-B region. The contact lens modified by Eb irradiation could improve the physical properties of the contact lens such as water content and oxygen transmissibility

The First Data Release of the Sloan Digital Sky Survey

CERN Document Server

Abazajian, Kevork; Agüeros, Marcel A.; Allam, Sahar S.; Anderson, Scott F.; Annis, James; Bahcall, Neta A.; Baldry, Ivan K.; Bastian, Steven; AndreasBerlind; Bernardi, Mariangela; Blanton, Michael R.; Blythe, Norman; Bochanski, John J.; Boroski, William N.; Brewington, Howard; Briggs, John W.; Brinkmann, J.; Brunner, Robert J.; Budavari, Tamas; Carey, Larry N.; Carr, Michael A.; Castander, Francisco J.; Chiu, Kuenley; Collinge, Matthew J.; Connolly, A. J.; Covey, Kevin R.; Csabai, István; J.Dalcanton, Julianne; Dodelson, Scott; Doi, Mamoru; Dong, Feng; Eisenstein, Daniel J.; L.Evans, Michael; Fan, Xiaohui; Feldman, Paul D.; Finkbeiner, Douglas P.; Friedman, Scott D.; Frieman, JoshuaA.; Fukugita, Masataka; Gal, Roy R.; Gillespie, Bruce; Glazebrook, Karl; F.Gonzalez, Carlos; Gray, Jim; Grebel, Eva K.; Grodnicki, Lauren; Gunn, James E.; K.Gurbani, Vijay; Hall, Patrick B.; Hao, Lei; Harbeck, Daniel; Harris, Frederick H.; C.Harris, Hugh; Harvanek, Michael; Hawley, Suzanne L.; Heckman, Timothy M.; Helmboldt, J. F.; Hendry, John S.; Hennessy, Gregory S.; Hindsley, Robert B.; Hogg, David W.; J.Holmgren, Donald; Holtzman, Jon A.; Homer, Lee; Hui, Lam; Ichikawa, Shin-ichi; Ichikawa, Takashi; Inkmann, John P.; ˇ, Zeljko Ivezíc; Jester, Sebastian; Johnston, David E.; Jordan, Beatrice; Jordan, Wendell P.; Jorgensen, Anders M.; Juríc, Mario; Kauffmann, Guinevere; M.Kent, Stephen; Kleinman, S. J.; Knapp, G. R.; Kniazev, Alexei Yu.; Kron, Richard G.; JurekKrzesinski; Kunszt, Peter Z.; Kuropatkin, Nickolai; Lamb, Donald Q.; Lampeitl, Hubert; Laubscher, Bryan E.; Lee, Brian C.; Leger, R. French; Li, Nolan; Lidz, Adam; Lin, Huan; Loh, Yeong-Shang; Long, Daniel C.; Loveday, Jon; Lupton, Robert H.; Malik, Tanu; BruceMargon; McGehee, Peregrine M.; McKay, Timothy A.; Meiksin, Avery; A.Miknaitis, Gajus; Moorthy, Bhasker K.; Munn, Jeffrey A.; Murphy, Tara; Nakajima, Reiko; Narayanan, VijayK.; Nash, Thomas; Neilsen, Eric H. Jr.; Newberg, Heidi Jo; Newman, Peter R.; Nichol, Robert C.; Nicinski, Tom; Nieto-Santisteban, Maria; Nitta, Atsuko; MichaelOdenkirchen; Okamura, Sadanori; Ostriker, Jeremiah P.; Owen, Russell; NikhilPadmanabhan; Peoples, John; Pier, Jeffrey R.; Pindor, Bartosz; Pope, Adrian C.; R.Quinn, Thomas; Rafikov, R. R.; Raymond, Sean N.; Richards, Gordon T.; Richmond, Michael W.; Rix, Hans-Walter; Rockosi, Constance M.; Schaye, Joop; Schlegel, David J.; P.Schneider, Donald; Schroeder, Joshua; Scranton, Ryan; Sekiguchi, Maki; Seljak, Uros; Sergey, Gary; Sesar, Branimir; Sheldon, Erin; Shimasaku, Kazu; Siegmund, Walter A.; Silvestri, Nicole M.; Sinisgalli, Allan J.; Sirko, Edwin; Smith, J. Allyn; Smolčíc, Vernesa; Snedden, Stephanie A.; Stebbins, Albert; Steinhardt, Charles; Stinson, Gregory; Stoughton, Chris; Strateva, Iskra V.; Strauss, Michael A.; SubbaRao, Mark; Szalay, Alexander S.; Szapudi, István; Szkody, Paula; Tasca, Lidia; Tegmark, Max; Thakar, Aniruddha R.; Tremonti, Christy; Tucker, Douglas L.; Uomoto, Alan; Vanden Berk, Daniel E.; Vandenberg, Jan; Vogeley, Michael S.; WolfgangVoges; Vogt, Nicole P.; Walkowicz, Lucianne M.; Weinberg, David H.; West, Andrew A.; White, Simon D.M.; Wilhite, Brian C.; Willman, Beth; Xu, Yongzhong; Yanny, Brian; JeanYarger; Yasuda, Naoki; Yip, Ching-Wa; Yocum, D. R.; York, Donald G.; L.Zakamska, Nadia; Zehavi, Idit; Zheng, Wei; Zibetti, Stefano; Zucker, Daniel B.

2003-01-01

The Sloan Digital Sky Survey has validated and made publicly available its First Data Release. This consists of 2099 square degrees of five-band (u, g, r, i, z) imaging data, 186,240 spectra of galaxies, quasars, stars and calibrating blank sky patches selected over 1360 square degrees of this area, and tables of measured parameters from these data. The imaging data go to a depth of r ~ 22.6 and are photometrically and astrometrically calibrated to 2% rms and 100 milli-arcsec rms per coordinate, respectively. The spectra cover the range 3800--9200 A, with a resolution of 1800--2100. Further characteristics of the data are described, as are the data products themselves.

Properties of the cathode lens combined with a focusing magnetic/immersion-magnetic lens

International Nuclear Information System (INIS)

Konvalina, I.; Muellerova, I.

2011-01-01

The cathode lens is an electron optical element in an emission electron microscope accelerating electrons from the sample, which serves as a source for a beam of electrons. Special application consists in using the cathode lens first for retardation of an illuminating electron beam and then for acceleration of reflected as well as secondary electrons, made in the directly imaging low energy electron microscope or in its scanning version discussed here. In order to form a real image, the cathode lens has to be combined with a focusing magnetic lens or a focusing immersion-magnetic lens, as used for objective lenses of some commercial scanning electron microscopes. These two alternatives are compared with regards to their optical properties, in particular with respect to predicted aberration coefficients and the spot size, as well as the optimum angular aperture of the primary beam. The important role of the final aperture size on the image resolution is also presented.

Peltier ac calorimeter

OpenAIRE

Jung, D. H.; Moon, I. K.; Jeong, Y. H.

2001-01-01

A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

Intraocular lens fabrication

Energy Technology Data Exchange (ETDEWEB)

Salazar, M.A.; Foreman, L.R.

1997-07-08

This invention describes a method for fabricating an intraocular lens made from clear Teflon{trademark}, Mylar{trademark}, or other thermoplastic material having a thickness of about 0.025 millimeters. These plastic materials are thermoformable and biocompatable with the human eye. The two shaped lenses are bonded together with a variety of procedures which may include thermosetting and solvent based adhesives, laser and impulse welding, and ultrasonic bonding. The fill tube, which is used to inject a refractive filling material is formed with the lens so as not to damage the lens shape. A hypodermic tube may be included inside the fill tube. 13 figs.

Digital model for harmonic interactions in AC/DC/AC systems

Energy Technology Data Exchange (ETDEWEB)

Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

1994-12-31

The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

21 CFR 886.1375 - Bagolini lens.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Bagolini lens. 886.1375 Section 886.1375 Food and... OPHTHALMIC DEVICES Diagnostic Devices § 886.1375 Bagolini lens. (a) Identification. A Bagolini lens is a device that consists of a plane lens containing almost imperceptible striations that do not obscure...

Distribution Of Maximal Luminosity Of Galaxies In The Sloan Digital Sky Survey

CERN Document Server

Regós, E; Rácz, Z; Taghizadeh, M; Ozogany, K

2010-01-01

Extreme value statistics (EVS) is applied to the pixelized distribution of galaxy luminosities in the Sloan Digital Sky Survey (SDSS). We analyze the DR6 Main Galaxy Sample (MGS), divided into red and blue subsamples, as well as the Luminous Red Galaxy Sample (LRGS). A non-parametric comparison of the EVS of the luminosities with the Fisher-Tippett-Gumbel distribution (limit distribution for independent variables distributed by the Press-Schechter law) indicates a good agreement provided uncertainties arising both from the finite size of the samples and from the sample size distribution are accounted for.

The lens and cataracts.

Science.gov (United States)

Matthews, Andrew G

2004-08-01

It is conservatively estimated that some form of lens opacity is present in 5% to 7% of horses with otherwise clinically normal eyes.These opacities can range from small epicapsular remnants of the fetal vasculature to dense and extensive cataract. A cataract is defined technically as any opacity or alteration in the optical homogeneity of the lens involving one or more of the following: anterior epithelium, capsule, cortex, or nucleus. In the horse, cataracts rarely involve the entire lens structure (ie, complete cataracts) and are more usually localized to one anatomic landmark or sector of the lens. Complete cataracts are invariably associated with overt and significant visual disability. Focal or incomplete cataracts alone seldom cause any apparent visual dysfunction in affected horses,however.

A Tribute to Len Barton

Science.gov (United States)

Tomlinson, Sally

2010-01-01

This article constitutes a short personal tribute to Len Barton in honour of his work and our collegial relationship going back over 30 years. It covers how Len saw his intellectual project of providing critical sociological and political perspectives on special education, disability and inclusion, and his own radical political perspectives. Len's…

Photosensitized oxidation in the ocular lens: evidence for photosensitizers endogenous to the human lens

International Nuclear Information System (INIS)

Zigler, J.S. Jr.; Goosey, J.D.

1981-01-01

Numerous investigators have attempted to associate near UV light exposure with various changes which occur to lens crystallins during aging and cataractogenesis. Recently it was shown that in vitro singlet oxygen mediated oxidation of lens crystallins produces effects very similar to those documented for crystallins from old or cataractous lenses and it was suggested that near UV photodynamic effects may play a major role in vivo in aging in the human lens. It has now been shown that certain oxidation products of tryptophan which have been identified in human lens can act as near UV photosensitizers, producing singlet oxygen. The insoluble protein fraction from human cataracts was shown to have the capacity to act as a photosensitizer. An age-related increase in photosensitizing capacity was also demonstrated in the soluble crystallins from human lens. These findings are discussed with respect to development of pigmented nuclear cataracts. (author)

A course in lens design

CERN Document Server

Velzel, Chris

2014-01-01

A Course in Lens Design is an instruction in the design of image-forming optical systems. It teaches how a satisfactory design can be obtained in a straightforward way. Theory is limited to a minimum, and used to support the practical design work. The book introduces geometrical optics, optical instruments and aberrations. It gives a description of the process of lens design and of the strategies used in this process. Half of its content is devoted to the design of sixteen types of lenses, described in detail from beginning to end. This book is different from most other books on lens design because it stresses the importance of the initial phases of the design process: (paraxial) lay-out and (thin-lens) pre-design. The argument for this change of accent is that in these phases much information can be obtained about the properties of the lens to be designed. This information can be used in later phases of the design. This makes A Course in Lens Design a useful self-study book, and a suitable basis for an intro...

Development of Fresnel lens for improvement of rear visibility; Shikai kojo Fresnel lens no kaihatsu

Energy Technology Data Exchange (ETDEWEB)

Iwamoto, K; Sanada, C; Tsukino, M [Nissan Motor Co. Ltd., Tokyo (Japan)

1997-10-01

Fresnel lenses have been widely used to increase the visual field around vehicles for drivers. However, internal reflection in these lenses has been an obstacle in producing dear images. This internal glow is generated by incident light from an unexpected direction reflecting on the non-lens surface or radiating from the non-lens surface of the Fresnel lens. The cause of internal glow has been made dear combining louver film with the lens. The newly developed technology removes obstacles in producing dear images by reducing internal glow. 7 figs.

ACS Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2005-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

Vitrectorhexis and lens aspiration with posterior chamber intraocular lens implantation in spherophakia.

Science.gov (United States)

Al-Haddad, Christiane; Khatib, Lama

2012-07-01

We describe a technique that uses the vitrector to perform successful lens aspiration and posterior chamber intraocular lens (IOL) implantation in children with spherophakia and anterior lens subluxation. After an anterior chamber maintainer is placed, the ocutome is introduced through a limbal incision to perform a circular vitrectorhexis to avoid excessive manipulation of the unstable lens followed by gentle cortex aspiration. A foldable IOL is injected into the sulcus (3-piece IOL) or bag (1-piece IOL) if the capsule is sufficiently stable. Through a pars plana incision, the ocutome is then used to perform a posterior capsulotomy to prevent late posterior capsule opacification. In our patient, sulcus IOL placement was more stable than in-the-bag placement. Neither author has a financial or proprietary interest in any material or method mentioned. Copyright © 2012 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

Pentacam Scheimpflug quantitative imaging of the crystalline lens and intraocular lens.

Science.gov (United States)

Rosales, Patricia; Marcos, Susana

2009-05-01

To implement geometrical and optical distortion correction methods for anterior segment Scheimpflug images obtained with a commercially available system (Pentacam, Oculus Optikgeräte GmbH). Ray tracing algorithms were implemented to obtain corrected ocular surface geometry from the original images captured by the Pentacam's CCD camera. As details of the optical layout were not fully provided by the manufacturer, an iterative procedure (based on imaging of calibrated spheres) was developed to estimate the camera lens specifications. The correction procedure was tested on Scheimpflug images of a physical water cell model eye (with polymethylmethacrylate cornea and a commercial IOL of known dimensions) and of a normal human eye previously measured with a corrected optical and geometrical distortion Scheimpflug camera (Topcon SL-45 [Topcon Medical Systems Inc] from the Vrije University, Amsterdam, Holland). Uncorrected Scheimpflug images show flatter surfaces and thinner lenses than in reality. The application of geometrical and optical distortion correction algorithms improves the accuracy of the estimated anterior lens radii of curvature by 30% to 40% and of the estimated posterior lens by 50% to 100%. The average error in the retrieved radii was 0.37 and 0.46 mm for the anterior and posterior lens radii of curvature, respectively, and 0.048 mm for lens thickness. The Pentacam Scheimpflug system can be used to obtain quantitative information on the geometry of the crystalline lens, provided that geometrical and optical distortion correction algorithms are applied, within the accuracy of state-of-the art phakometry and biometry. The techniques could improve with exact knowledge of the technical specifications of the instrument, improved edge detection algorithms, consideration of aspheric and non-rotationally symmetrical surfaces, and introduction of a crystalline gradient index.

Luneburg lens in silicon photonics.

Science.gov (United States)

Di Falco, Andrea; Kehr, Susanne C; Leonhardt, Ulf

2011-03-14

The Luneburg lens is an aberration-free lens that focuses light from all directions equally well. We fabricated and tested a Luneburg lens in silicon photonics. Such fully-integrated lenses may become the building blocks of compact Fourier optics on chips. Furthermore, our fabrication technique is sufficiently versatile for making perfect imaging devices on silicon platforms.

Crystalline lens and refractive development.

Science.gov (United States)

Iribarren, Rafael

2015-07-01

Individual refractive errors usually change along lifespan. Most children are hyperopic in early life. This hyperopia is usually lost during growth years, leading to emmetropia in adults, but myopia also develops in children during school years or during early adult life. Those subjects who remain emmetropic are prone to have hyperopic shifts in middle life. And even later, at older ages, myopic shifts are developed with nuclear cataract. The eye grows from 15 mm in premature newborns to approximately 24 mm in early adult years, but, in most cases, refractions are maintained stable in a clustered distribution. This growth in axial length would represent a refractive change of more than 40 diopters, which is compensated by changes in corneal and lens powers. The process which maintains the balance between the ocular components of refraction during growth is still under study. As the lens power cannot be measured in vivo, but can only be calculated based on the other ocular components, there have not been many studies of lens power in humans. Yet, recent studies have confirmed that the lens loses power during growth in children, and that hyperopic and myopic shifts in adulthood may be also produced by changes in the lens. These studies in children and adults give a picture of the changing power of the lens along lifespan. Other recent studies about the growth of the lens and the complexity of its internal structure give clues about how these changes in lens power are produced along life. Copyright © 2015 Elsevier Ltd. All rights reserved.

Modern lens antennas for communications engineering

CERN Document Server

Thornton, John

2012-01-01

The aim of this book is to present the modern design principles and analysis of lens antennas. It gives graduates and RF/Microwave professionals the design insights in order to make full use of lens antennas.  Why do we want to write a book in lens antennas? Because this topic has not been thoroughly publicized, its importance is underestimated. As antennas play a key role in communication systems, recent development in wireless communications would indeed benefit from the characteristics of lens antennas: low profile, and low cost etc.  The major advantages of lens antennas are na

Changes in monkey crystalline lens spherical aberration during simulated accommodation in a lens stretcher.

Science.gov (United States)

Maceo Heilman, Bianca; Manns, Fabrice; de Castro, Alberto; Durkee, Heather; Arrieta, Esdras; Marcos, Susana; Parel, Jean-Marie

2015-02-10

The purpose of this study was to quantify accommodation-induced changes in the spherical aberration of cynomolgus monkey lenses. Twenty-four lenses from 20 cynomolgus monkeys (Macaca fascicularis; 4.4-16.0 years of age; postmortem time 13.5 ± 13.0 hours) were mounted in a lens stretcher. Lens spherical aberration was measured in the unstretched (accommodated) and stretched (relaxed) states with a laser ray tracing system that delivered 51 equally spaced parallel rays along 1 meridian of the lens over the central 6-mm optical zone. A camera mounted below the lens was used to measure the ray height at multiple positions along the optical axis. For each entrance ray, the change in ray height with axial position was fitted with a third-order polynomial. The effective paraxial focal length and Zernike spherical aberration coefficients corresponding to a 6-mm pupil diameter were extracted from the fitted values. The unstretched lens power decreased with age from 59.3 ± 4.0 diopters (D) for young lenses to 45.7 ± 3.1 D for older lenses. The unstretched lens shifted toward less negative spherical aberration with age, from -6.3 ± 0.7 μm for young lenses to -5.0 ± 0.5 μm for older lenses. The power and spherical aberration of lenses in the stretched state were independent of age, with values of 33.5 ± 3.4 D and -2.6 ± 0.5 μm, respectively. Spherical aberration is negative in cynomolgus monkey lenses and becomes more negative with accommodation. These results are in good agreement with the predicted values using computational ray tracing in a lens model with a reconstructed gradient refractive index. The spherical aberration of the unstretched lens becomes less negative with age. Copyright 2015 The Association for Research in Vision and Ophthalmology, Inc.

Genus Topology of Structure in the Sloan Digital Sky Survey: Model Testing

Science.gov (United States)

Gott, J. Richard, III; Hambrick, D. Clay; Vogeley, Michael S.; Kim, Juhan; Park, Changbom; Choi, Yun-Young; Cen, Renyue; Ostriker, Jeremiah P.; Nagamine, Kentaro

2008-03-01

We measure the three-dimensional topology of large-scale structure in the Sloan Digital Sky Survey (SDSS). This allows the genus statistic to be measured with unprecedented statistical accuracy. The sample size is now sufficiently large to allow the topology to be an important tool for testing galaxy formation models. For comparison, we make mock SDSS samples using several state-of-the-art N-body simulations: the Millennium run of Springel et al. (10 billion particles), the Kim & Park CDM models (1.1 billion particles), and the Cen & Ostriker hydrodynamic code models (8.6 billion cell hydro mesh). Each of these simulations uses a different method for modeling galaxy formation. The SDSS data show a genus curve that is broadly characteristic of that produced by Gaussian random-phase initial conditions. Thus, the data strongly support the standard model of inflation where Gaussian random-phase initial conditions are produced by random quantum fluctuations in the early universe. But on top of this general shape there are measurable differences produced by nonlinear gravitational effects and biasing connected with galaxy formation. The N-body simulations have been tuned to reproduce the power spectrum and multiplicity function but not topology, so topology is an acid test for these models. The data show a "meatball" shift (only partly due to the Sloan Great Wall of galaxies) that differs at the 2.5 σ level from the results of the Millenium run and the Kim & Park dark halo models, even including the effects of cosmic variance.

THE REDSHIFT DISTRIBUTION OF GIANT ARCS IN THE SLOAN GIANT ARCS SURVEY

International Nuclear Information System (INIS)

Bayliss, Matthew B.; Gladders, Michael D.; Koester, Benjamin P.; Oguri, Masamune; Hennawi, Joseph F.; Sharon, Keren; Dahle, Haakon

2011-01-01

We measure the redshift distribution of a sample of 28 giant arcs discovered as a part of the Sloan Giant Arcs Survey. Gemini/GMOS-North spectroscopy provides precise redshifts for 24 arcs, and 'redshift desert' constrains for the remaining 4 arcs. This is a direct measurement of the redshift distribution of a uniformly selected sample of bright giant arcs, which is an observable that can be used to inform efforts to predict giant arc statistics. Our primary giant arc sample has a median redshift z = 1.821 and nearly two-thirds of the arcs, 64%, are sources at z ∼> 1.4, indicating that the population of background sources that are strongly lensed into bright giant arcs resides primarily at high redshift. We also analyze the distribution of redshifts for 19 secondary strongly lensed background sources that are not visually apparent in Sloan Digital Sky Survey imaging, but were identified in deeper follow-up imaging of the lensing cluster fields. Our redshift sample for the secondary sources is not spectroscopically complete, but combining it with our primary giant arc sample suggests that a large fraction of all background galaxies that are strongly lensed by foreground clusters reside at z ∼> 1.4. Kolmogorov-Smirnov tests indicate that our well-selected, spectroscopically complete primary giant arc redshift sample can be reproduced with a model distribution that is constructed from a combination of results from studies of strong-lensing clusters in numerical simulations and observational constraints on the galaxy luminosity function.

Symmetric lens with extended depth of focus

OpenAIRE

Cho, Sung Nae

2008-01-01

The lens surface profile is derived based on the instantaneous focal length versus the lens radius data. The lens design based on instantaneous focal length versus the lens radius data has many useful applications in software assisted image focusing technology.

[Congenital lens subluxation: visual acuity outcomes and intraocular lens postoperative position].

Science.gov (United States)

Arraes, Caroline; Endriss, Daniela; Lobato, Francisco; Arraes, João; Ventura, Marcelo

2010-01-01

To evaluate the visual acuity outcomes and to investigate the intraocular lens (IOL) and endocapsular ring positions with ultrasound biomicroscopy in 17 eyes of 10 patients with congenital lens subluxation who underwent the same surgical technique, by the same surgeon. The study was performed in the ''Hospital de Olhos de Pernambuco'' and ''Fundação Altino Ventura''. The surgical technique consisted of phacoaspiration with implant of endocapsular ring and intraocular lens with one loop haptic amputated. The age varied from 7 to 22 years. Data on visual acuity (VA) before and after surgery, surgery follow-up period, and complications were analyzed. All patients underwent ultrasound biomicroscopy. The mean follow-up period was 2.8 years. There was a VA improvement in 17 (100%) eyes: in 12 eyes (70.6%) the visual acuity was better than 20/40; 4 (23.5%) ranged from 20/40 to 20/100, and 1 (5.9%) had visual acuity worse than 20/100, however better than the preoperative visual acuity. The posterior capsular opacification occurred in 10 eyes (58.9%). Ultrasound biomicroscopy showed that all IOL were partially decentralized, however without surpassing the pupil border limit. Endocapsular ring position was correct and there was a good capsular support in all cases. The evaluated surgical treatment provided good intraocular lens and endocapsular ring position, with VA improvement Thus, this technique is a viable, effective and safe option for the visual rehabilitation of patients with congenital lens subluxation.

The influence of end of day silicone hydrogel daily disposable contact lens fit on ocular comfort, physiology and lens wettability.

Science.gov (United States)

Wolffsohn, James; Hall, Lee; Mroczkowska, Stephanie; Hunt, Olivia A; Bilkhu, Paramdeep; Drew, Tom; Sheppard, Amy

2015-10-01

To quantify the end-of-day silicone-hydrogel daily disposable contact lens fit and its influence of on ocular comfort, physiology and lens wettability. Thirty-nine subjects (22.1±3.5 years) were randomised to wear each of 3 silicone-hydrogel daily-disposable contact lenses (narafilcon A, delefilcon A and filcon II 3), bilaterally, for one week. Lens fit was assessed objectively using a digital video slit-lamp at 8, 12 and 16h after lens insertion. Hyperaemia, non-invasive tear break-up time, tear meniscus height and comfort were also evaluated at these timepoints, while corneal and conjunctival staining were assessed on lens removal. Lens fit assessments were not different between brands (P>0.05), with the exception of the movement at blink where narafilcon A was more mobile. Overall, lag reduced but push-up speed increased from 8 to 12h (P0.05). Movement-on-blink was unaffected by wear-time (F=0.403, P=0.670). A more mobile lens fit with one brand did not indicate that person would have a more mobile fit with another brand (r=-0.06 to 0.63). Lens fit was not correlated with comfort, ocular physiology or lens wettability (P>0.01). Among the lenses tested, objective lens fit changed between 8h and 12h of lens wear. The weak correlation in individual lens fit between brands indicates that fit is dependent on more than ocular shape. Consequently, substitution of a different lens brand with similar parameters will not necessarily provide comparable lens fit. Copyright © 2015 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

Low Offset AC Correlator.

Science.gov (United States)

This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

AC power supply systems

International Nuclear Information System (INIS)

Law, H.

1987-01-01

An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

Anarchic desires : deconstructing sexual and moral representations in Joe Orton's entertaining mr. sloane

OpenAIRE

Werner Almeida Alves

2007-01-01

A presente dissertação tem como objetivo apresentar uma leitura da peça Entertaining Mr. Sloane do dramaturgo inglês Joe Orton, investigando de que formas os artifícios literários são construídos para interromper as representações normativas sobre sexualidade e moralidade. Na obra de Orton, os comportamentos e discursos das personagens ignoram autoridades representativas de instituições que, como a família, trabalham para ratificar a noção de modos sexuais ligados à matrix heterossexual que c...

Refractive lens exchange with a multifocal diffractive aspheric intraocular lens

Directory of Open Access Journals (Sweden)

Teresa Ferrer-Blasco

2012-06-01

Full Text Available PURPOSE: To evaluate the safety, efficacy and predictability after refractive lens exchange with multifocal diffractive aspheric intraocular lens implantation. METHODS: Sixty eyes of 30 patients underwent bilateral implantation with AcrySof® ReSTOR® SN6AD3 intraocular lens with +4.00 D near addition. Patients were divided into myopic and hyperopic groups. Monocular best corrected visual acuity at distance and near and monocular uncorrected visual acuity at distance and near were measured before and 6 months postoperatively. RESULTS: After surgery, uncorrected visual acuity was 0.08 ± 0.15 and 0.11 ± 0.14 logMAR for the myopic and hyperopic groups, respectively (50% and 46.67% of patients had an uncorrected visual acuity of 20/20 or better in the myopic and hyperopic groups, respectively. The safety and efficacy indexes were 1.05 and 0.88 for the myopic and 1.01 and 0.86 for the hyperopic groups at distance vision. Within the myopic group, 20 eyes remained unchanged after the surgery, and 3 gained >2 lines of best corrected visual acuity. For the hyperopic group, 2 eyes lost 2 lines of best corrected visual acuity, 21 did not change, and 3 eyes gained 2 lines. At near vision, the safety and efficacy indexes were 1.23 and 1.17 for the myopic and 1.16 and 1.13 for the hyperopic groups. Best corrected near visual acuity improved after surgery in both groups (from 0.10 logMAR to 0.01 logMAR in the myopic group, and from 0.10 logMAR to 0.04 logMAR in the hyperopic group. CONCLUSIONS: The ReSTOR® SN6AD3 intraocular lens in refractive lens exchange demonstrated good safety, efficacy, and predictability in correcting high ametropia and presbyopia.

21 CFR 886.5844 - Prescription spectacle lens.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Prescription spectacle lens. 886.5844 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Therapeutic Devices § 886.5844 Prescription spectacle lens. (a) Identification. A prescription spectacle lens is a glass or plastic device that is a lens intended to be worn by...

ACS Photometric Zero Point Verification

Science.gov (United States)

Dolphin, Andrew

2003-07-01

The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

The Eighth Data Release of the Sloan Digital Sky Survey: First Data from SDSS-III

Energy Technology Data Exchange (ETDEWEB)

Aihara, Hiroaki; /Tokyo U.; Prieto, Carlos Allende; /Laguna U., Tenerife; An, Deokkeun; /Ewha Women' s U., Seoul; Anderson, Scott F.; /Washington U., Seattle, Astron. Dept.; Aubourg, Eric; /APC, Paris /DAPNIA, Saclay; Balbinot, Eduardo; /Rio Grande do Sul U. /Rio de Janeiro Observ.; Beers, Timothy C.; /Michigan State U.; Berlind, Andreas A.; /Vanderbilt U.; Bickerton, Steven J.; /Princeton U.; Bizyaev, Dmitry; /Apache Point Observ.; Blanton, Michael R.; /New York U., CCPP /Penn State U.

2011-01-01

The Sloan Digital Sky Survey (SDSS) started a new phase in August 2008, with new instrumentation and new surveys focused on Galactic structure and chemical evolution, measurements of the baryon oscillation feature in the clustering of galaxies and the quasar Ly{alpha} forest, and a radial velocity search for planets around {approx}8000 stars. This paper describes the first data release of SDSS-III (and the eighth counting from the beginning of the SDSS). The release includes 5-band imaging of roughly 5200 deg{sup 2} in the Southern Galactic Cap, bringing the total footprint of the SDSS imaging to 14,555 deg{sup 2}, or over a third of the Celestial Sphere. All the imaging data have been reprocessed with an improved sky-subtraction algorithm and a final, self-consistent recalibration and flat-field determination. This release also includes all data from the second phase of the Sloan Extension for Galactic Understanding and Evolution (SEGUE-2), consisting of spectroscopy of approximately 118,000 stars at both high and low Galactic latitudes. All the more than half a million stellar spectra obtained with the SDSS spectrograph have been reprocessed through an improved stellar parameters pipeline, which has better determination of metallicity for high metallicity stars.

The prevention and eradication of smallpox: a commentary on Sloane (1755) ‘An account of inoculation’

Science.gov (United States)

Weiss, Robin A.; Esparza, José

2015-01-01

Sir Hans Sloane's account of inoculation as a means to protect against smallpox followed several earlier articles published in Philosophical Transactions on this procedure. Inoculation (also called ‘variolation’) involved the introduction of small amounts of infectious material from smallpox vesicles into the skin of healthy subjects, with the goal of inducing mild symptoms that would result in protection against the more severe naturally acquired disease. It began to be practised in England in 1721 thanks to the efforts of Lady Mary Wortley Montagu who influenced Sloane to promote its use, including the inoculation of the royal family's children. When Edward Jenner's inoculation with the cow pox (‘vaccination’) followed 75 years later as a safer yet equally effective procedure, the scene was set for the eventual control of smallpox epidemics culminating in the worldwide eradication of smallpox in 1977, officially proclaimed by WHO in 1980. Here, we discuss the significance of variolation and vaccination with respect to scientific, public health and ethical controversies concerning these ‘weapons of mass protection’. This commentary was written to celebrate the 350th anniversary of the journal Philosophical Transactions of the Royal Society. PMID:25750241

Plasma Lens for Muon and Neutrino Beams

International Nuclear Information System (INIS)

Kahn, S.A.; Korenev, S.; Bishai, M.; Diwan, M.; Gallardo, J.C.; Hershcovitch, A.; Johnson, B.M.

2008-01-01

The plasma lens is examined as an alternate to focusing horns and solenoids for use in a neutrino or muon beam facility. The plasma lens concept is based on a combined high-energy lens/target configuration. The current is fed at electrodes located upstream and downstream from the target where pion capturing is needed. The current flows primarily in the plasma, which has a lower resistivity than the target. A second plasma lens section, with an additional current feed, follows the target to provide shaping of the plasma for optimum focusing. The plasma lens is immersed in an additional solenoid magnetic field to facilitate the plasma stability. The geometry of the plasma is shaped to provide optimal pion capture. Simulations of this plasma lens system have shown a 25% higher neutrino production than the horn system. Plasma lenses have the additional advantage of negligible pion absorption and scattering by the lens material and reduced neutrino contamination during anti-neutrino running. Results of particle simulations using plasma lens will be presented

Lens decenter and tilt measurement by interferogram

Science.gov (United States)

Hung, Min-Wei; Wu, Wen-Hong; Huang, Kuo-Cheng

2009-11-01

For the recent years, the vigorous development of the electro-optic industry, particularly the digital camera and the cellular phone camera, has placed a larger and larger demand for the optical devices. Among the optical lens, the aspherical optical lens plays the key component because the aspherical lens may provide better imaging quality then the spherical lens does. For the manufacturing reason, the aspherical lens is prone to a decenter or tilt issue with respect to the optical axes of its two surfaces. To measure decenter and tile error specifically would help to obviate the deficient lens, but most of the present measuring method can't provide this function. This paper proposed a new method to specifically measure the decenter and tile of lens by observing the interferogram of each surface. And the corresponding measuring instrument, which contains interferometer and motion stages, was introduced as well.

Clinical study of foldable intraocular lens secondary implantation after lens-vitrectomy in residual capsular with traumatic eyes

Directory of Open Access Journals (Sweden)

Ru-Fa Meng

2015-07-01

Full Text Available AIM: To investigate the operation methods and clinical effects of foldable intraocular lens secondary implantation after lens-vitrectomy in residual capsular with traumatic eyes.METHODS: During January 2012 to January 2014, foldable intraocular lens was implanted on 47 cases following lens-vitrectomy in residual capsular with traumatic eyes 3～6mo. Follow-up period was 6～12mo, averaged(8.21±2.63mo. RESULTS:All of 47 eyes had successful operation at one time, and position deviation was not appeared. The naked vision of the last postoperative follow-up was(0.44±0.19. Compared with best corrected visual acuity(0.41±0.23, and There was no significant difference between visual acuity of preoperative and last follow-up period(t=0.879, P=0.342. No severe complication was found. CONCLUSION: Secondary implantation of foldable intraocular lens is a safe and reliable method for correcting ametropia after lens-vitrectomy in residual capsular with traumatic eyes.

21 CFR 886.3600 - Intraocular lens.

Science.gov (United States)

2010-04-01

... DEVICES OPHTHALMIC DEVICES Prosthetic Devices § 886.3600 Intraocular lens. (a) Identification. An intraocular lens is a device made of materials such as glass or plastic intended to be implanted to replace the natural lens of an eye. (b) Classification. Class III. (c) Date PMA or notice of completion of a...

We’re Working On It: Transferring the Sloan Digital Sky Survey from Laboratory to Library

OpenAIRE

Sands, Ashley E.; Borgman, Christine L.; Traweek, Sharon; Wynholds, Laura A.

2014-01-01

This article reports on the transfer of a massive scientific dataset from a national laboratory to a university library, and from one kind of workforce to another. We use the transfer of the Sloan Digital Sky Survey (SDSS) archive to examine the emergence of a new workforce for scientific research data management. Many individuals with diverse educational backgrounds and domain experience are involved in SDSS data management: domain scientists, computer scientists, software and systems engin...

Developing the Regulatory Utility of the Exposome: Mapping Exposures for Risk Assessment through Lifestage Exposome Snapshots (LEnS).

Science.gov (United States)

Shaffer, Rachel M; Smith, Marissa N; Faustman, Elaine M

2017-08-07

Exposome-related efforts aim to document the totality of human exposures across the lifecourse. This field has advanced rapidly in recent years but lacks practical application to risk assessment, particularly for children's health. Our objective was to apply the exposome to children's health risk assessment by introducing the concept of Lifestage Exposome Snapshots (LEnS). Case studies are presented to illustrate the value of the framework. The LEnS framework encourages organization of exposome studies based on windows of susceptibility for particular target organ systems. Such analyses will provide information regarding cumulative impacts during specific critical periods of the life course. A logical extension of this framework is that regulatory standards should analyze exposure information by target organ, rather than for a single chemical only or multiple chemicals grouped solely by mechanism of action. The LEnS concept is a practical refinement to the exposome that accounts for total exposures during particular windows of susceptibility in target organ systems. Application of the LEnS framework in risk assessment and regulation will improve protection of children's health by enhancing protection of sensitive developing organ systems that are critical for lifelong health and well-being. https://doi.org/10.1289/EHP1250.

Impact of lens case hygiene guidelines on contact lens case contamination.

Science.gov (United States)

Wu, Yvonne T; Teng, Yuu Juan; Nicholas, Mary; Harmis, Najat; Zhu, Hua; Willcox, Mark D P; Stapleton, Fiona

2011-10-01

Lens case contamination is a risk factor for microbial keratitis. The effectiveness of manufacturers' lens case cleaning guidelines in limiting microbial contamination has not been evaluated in vivo. This study compared the effectiveness of manufacturers' guidelines and an alternative cleaning regimen. A randomized cross-over clinical trial with two phases (n = 40) was performed. Participants used the lens types of their choice in conjunction with the provided multipurpose solution (containing polyhexamethylene biguanide) for daily wear. In the manufacturers' guideline phase, cases were rinsed with multipurpose solution and air dried. In the alternative regimen phase, cases were rubbed, rinsed with solution, tissue wiped, and air-dried face down. The duration of each phase was 1 month. Lens cases were collected at the end of each phase for microbiological investigation. The levels of microbial contamination were compared, and compliance to both regimens was assessed. The case contamination rate was 82% (32/39) in the manufacturers' guideline group, compared with 72% (28/39) in the alternative regimen group. There were significantly fewer (p = 0.004) colony forming units (CFU) of bacteria from cases used by following the alternative regimen (CFU range of 0 to 10, and median of 12 CFU per well) compared with that of the manufacturer's guidelines (CFU range of 0 to 10, and median of 28 CFU per well). The compliance level between both guidelines was not significantly different (p > 0.05). The alternative guidelines are more effective in eliminating microbial contamination from lens cases than that of the current manufacturer's guideline. Simply incorporating rubbing and tissue-wiping steps in daily case hygiene reduces viable organism contamination.

21 CFR 886.1400 - Maddox lens.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Maddox lens. 886.1400 Section 886.1400 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1400 Maddox lens. (a) Identification. A Maddox lens is a device...

Intracapsular lens extraction for the treatment of pupillary block glaucoma associated with anterior subluxation of the crystalline lens.

Science.gov (United States)

Kim, Yong Joon; Ha, Seung Joo

2013-01-01

To report a case of pupillary block glaucoma associated with spontaneous crystalline lens subluxation into the anterior chamber in a 34-year-old man. Dry vitrectomy was performed for securing enough retrolental space, and an intracapsular lens extraction was then performed via a corneolimbal incision. Additional endothelial cell damage was avoided with an injection of viscoelastics and gentle extraction of the crystalline lens. After deepening of the anterior chamber, scleral fixation of the intraocular lens was performed with an ab externo technique. Two months after the operation, a well-fixated intraocular lens was observed and intraocular pressure was stable. The postoperative corneal astigmatism was -3.5 dpt, and the patient had a best-corrected visual acuity of 20/25. Postoperative complications included decreased endothelial cell count and sector iris paralysis near the incision site. An anteriorly subluxated crystalline lens can cause pupillary block glaucoma in healthy young adults. To prevent intraoperative complications, intracapsular lens extraction with dry vitrectomy can be a good surgical option. The endothelial cell density should be closely monitored after surgery.

RELICS: Strong Lens Models for Five Galaxy Clusters from the Reionization Lensing Cluster Survey

Science.gov (United States)

Cerny, Catherine; Sharon, Keren; Andrade-Santos, Felipe; Avila, Roberto J.; Bradač, Maruša; Bradley, Larry D.; Carrasco, Daniela; Coe, Dan; Czakon, Nicole G.; Dawson, William A.; Frye, Brenda L.; Hoag, Austin; Huang, Kuang-Han; Johnson, Traci L.; Jones, Christine; Lam, Daniel; Lovisari, Lorenzo; Mainali, Ramesh; Oesch, Pascal A.; Ogaz, Sara; Past, Matthew; Paterno-Mahler, Rachel; Peterson, Avery; Riess, Adam G.; Rodney, Steven A.; Ryan, Russell E.; Salmon, Brett; Sendra-Server, Irene; Stark, Daniel P.; Strolger, Louis-Gregory; Trenti, Michele; Umetsu, Keiichi; Vulcani, Benedetta; Zitrin, Adi

2018-06-01

Strong gravitational lensing by galaxy clusters magnifies background galaxies, enhancing our ability to discover statistically significant samples of galaxies at {\\boldsymbol{z}}> 6, in order to constrain the high-redshift galaxy luminosity functions. Here, we present the first five lens models out of the Reionization Lensing Cluster Survey (RELICS) Hubble Treasury Program, based on new HST WFC3/IR and ACS imaging of the clusters RXC J0142.9+4438, Abell 2537, Abell 2163, RXC J2211.7–0349, and ACT-CLJ0102–49151. The derived lensing magnification is essential for estimating the intrinsic properties of high-redshift galaxy candidates, and properly accounting for the survey volume. We report on new spectroscopic redshifts of multiply imaged lensed galaxies behind these clusters, which are used as constraints, and detail our strategy to reduce systematic uncertainties due to lack of spectroscopic information. In addition, we quantify the uncertainty on the lensing magnification due to statistical and systematic errors related to the lens modeling process, and find that in all but one cluster, the magnification is constrained to better than 20% in at least 80% of the field of view, including statistical and systematic uncertainties. The five clusters presented in this paper span the range of masses and redshifts of the clusters in the RELICS program. We find that they exhibit similar strong lensing efficiencies to the clusters targeted by the Hubble Frontier Fields within the WFC3/IR field of view. Outputs of the lens models are made available to the community through the Mikulski Archive for Space Telescopes.

Plasma Lens for Muon and Neutrino Beams

Science.gov (United States)

Kahn, Stephen; Korenev, Sergey; Bishai, Mary; Diwan, Milind; Gallardo, Juan; Hershcovitch, Ady; Johnson, Brant

2008-04-01

The plasma lens is examined as an alternate to focusing horns and solenoids for use in a neutrino or muon beam facility. The plasma lens concept is based on a combined high-current lens/target configuration. The current is fed at electrodes located upstream and downstream from the target where pion capturing is needed. The current flows primarily in the plasma, which has a lower resistivity than the target. A second plasma lens section, with an additional current feed, follows the target to provide shaping of the plasma stability. The geometry of the plasma is shaped to provide optimal pion capture. Simulations of this plasma lens system have shown a 25% higher neutrino production than the horn system. A plasma lens has additional advantage: larger axial current than horns, minimal neutrino contamination during antineutrino running, and negligible pion absorption or scattering. Results from particle simulations using a plasma lens will be presented.

FLUIDIC AC AMPLIFIERS.

Science.gov (United States)

Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems

78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

Science.gov (United States)

2013-08-13

...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

RADIO-SELECTED QUASARS IN THE SLOAN DIGITAL SKY SURVEY

International Nuclear Information System (INIS)

McGreer, Ian D.; Helfand, David J.; White, Richard L.

2009-01-01

We have conducted a pilot survey for z > 3.5 quasars by combining the FIRST radio survey with the Sloan Digital Sky Survey (SDSS). While SDSS already targets FIRST sources for spectroscopy as quasar candidates, our survey includes fainter quasars and greatly improves the discovery rate by using strict astrometric criteria for matching the radio and optical positions. Our method allows for selection of high-redshift quasars with less color bias than with optical selection, as using radio selection essentially eliminates stellar contamination. We report the results of spectroscopy for 45 candidates, including 29 quasars in the range 0.37 3.5. We compare quasars selected using radio and optical criteria, and find that radio-selected quasars have a much higher fraction of moderately reddened objects. We derive a radio-loud quasar luminosity function at 3.5 < z < 4.0, and find that it is in good agreement with expectations from prior SDSS results.

[Representation and mathematical analysis of human crystalline lens].

Science.gov (United States)

Tălu, Stefan; Giovanzana, Stefano; Tălu, Mihai

2011-01-01

The surface of human crystalline lens can be described and analyzed using mathematical models based on parametric representations, used in biomechanical studies and 3D solid modeling of the lens. The mathematical models used in lens biomechanics allow the study and the behavior of crystalline lens on variables and complex dynamic loads. Also, the lens biomechanics has the potential to improve the results in the development of intraocular lenses and cataract surgery. The paper presents the most representative mathematical models currently used for the modeling of human crystalline lens, both optically and biomechanically.

Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

International Nuclear Information System (INIS)

Fang Minggang; Nie, Yingchao; Theilmann, David A.

2009-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

Development of a hardware-based AC microgrid for AC stability assessment

Science.gov (United States)

Swanson, Robert R.

As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

[Intraocular lens implantation with one loop haptic amputated: a new propose to the subluxation lens surgical treatment].

Science.gov (United States)

Ventura, Marcelo; Endriss, Daniela

2010-01-01

To evaluate the postoperative results of congenital lens subluxation corrected by a new technique. Retrospective chart review of 21 eyes of 13 patients with no traumatic lens subluxation who underwent surgery in Altino Ventura Foundation from April, 1999 to April, 2004. The mean age was 8.7 +/- 5.4 years old, and the mean follow-up period was 21.5 +/- 19.3 months. Patients underwent phacoaspiration, endocapsular ring and intraocular lens (IOL) implantation. The implanted IOL had one loop haptic excised and was supported above the ring, inside the capsular bag promoting intraocular lens centralization. Visual acuity improvement was observed in all cases. There was a significant reduction of the spherical equivalent and spherical component comparing the pre and postoperative refraction (psubluxation surgical treatment, promoting lens centralization and postoperative visual acuity improvement.

Role of Aquaporin 0 in lens biomechanics

Energy Technology Data Exchange (ETDEWEB)

Sindhu Kumari, S.; Gupta, Neha [Physiology and Biophysics, Stony Brook University, Stony Brook, NY (United States); Shiels, Alan [Washington University School of Medicine, St. Louis, MO (United States); FitzGerald, Paul G. [Cell Biology and Human Anatomy, School of Medicine, University of California, Davis, CA (United States); Menon, Anil G. [University of Cincinnati College of Medicine, Cincinnati, OH (United States); Mathias, Richard T. [Physiology and Biophysics, Stony Brook University, Stony Brook, NY (United States); SUNY Eye Institute, NY (United States); Varadaraj, Kulandaiappan, E-mail: kulandaiappan.varadaraj@stonybrook.edu [Physiology and Biophysics, Stony Brook University, Stony Brook, NY (United States); SUNY Eye Institute, NY (United States)

2015-07-10

Maintenance of proper biomechanics of the eye lens is important for its structural integrity and for the process of accommodation to focus near and far objects. Several studies have shown that specialized cytoskeletal systems such as the beaded filament (BF) and spectrin-actin networks contribute to mammalian lens biomechanics; mutations or deletion in these proteins alters lens biomechanics. Aquaporin 0 (AQP0), which constitutes ∼45% of the total membrane proteins of lens fiber cells, has been shown to function as a water channel and a structural cell-to-cell adhesion (CTCA) protein. Our recent ex vivo study on AQP0 knockout (AQP0 KO) mouse lenses showed the CTCA function of AQP0 could be crucial for establishing the refractive index gradient. However, biomechanical studies on the role of AQP0 are lacking. The present investigation used wild type (WT), AQP5 KO (AQP5{sup −/−}), AQP0 KO (heterozygous KO: AQP0{sup +/−}; homozygous KO: AQP0{sup −/−}; all in C57BL/6J) and WT-FVB/N mouse lenses to learn more about the role of fiber cell AQPs in lens biomechanics. Electron microscopic images exhibited decreases in lens fiber cell compaction and increases in extracellular space due to deletion of even one allele of AQP0. Biomechanical assay revealed that loss of one or both alleles of AQP0 caused a significant reduction in the compressive load-bearing capacity of the lenses compared to WT lenses. Conversely, loss of AQP5 did not alter the lens load-bearing ability. Compressive load-bearing at the suture area of AQP0{sup +/−} lenses showed easy separation while WT lens suture remained intact. These data from KO mouse lenses in conjunction with previous studies on lens-specific BF proteins (CP49 and filensin) suggest that AQP0 and BF proteins could act co-operatively in establishing normal lens biomechanics. We hypothesize that AQP0, with its prolific expression at the fiber cell membrane, could provide anchorage for cytoskeletal structures like BFs and

Role of Aquaporin 0 in lens biomechanics

International Nuclear Information System (INIS)

Sindhu Kumari, S.; Gupta, Neha; Shiels, Alan; FitzGerald, Paul G.; Menon, Anil G.; Mathias, Richard T.; Varadaraj, Kulandaiappan

2015-01-01

Maintenance of proper biomechanics of the eye lens is important for its structural integrity and for the process of accommodation to focus near and far objects. Several studies have shown that specialized cytoskeletal systems such as the beaded filament (BF) and spectrin-actin networks contribute to mammalian lens biomechanics; mutations or deletion in these proteins alters lens biomechanics. Aquaporin 0 (AQP0), which constitutes ∼45% of the total membrane proteins of lens fiber cells, has been shown to function as a water channel and a structural cell-to-cell adhesion (CTCA) protein. Our recent ex vivo study on AQP0 knockout (AQP0 KO) mouse lenses showed the CTCA function of AQP0 could be crucial for establishing the refractive index gradient. However, biomechanical studies on the role of AQP0 are lacking. The present investigation used wild type (WT), AQP5 KO (AQP5 −/− ), AQP0 KO (heterozygous KO: AQP0 +/− ; homozygous KO: AQP0 −/− ; all in C57BL/6J) and WT-FVB/N mouse lenses to learn more about the role of fiber cell AQPs in lens biomechanics. Electron microscopic images exhibited decreases in lens fiber cell compaction and increases in extracellular space due to deletion of even one allele of AQP0. Biomechanical assay revealed that loss of one or both alleles of AQP0 caused a significant reduction in the compressive load-bearing capacity of the lenses compared to WT lenses. Conversely, loss of AQP5 did not alter the lens load-bearing ability. Compressive load-bearing at the suture area of AQP0 +/− lenses showed easy separation while WT lens suture remained intact. These data from KO mouse lenses in conjunction with previous studies on lens-specific BF proteins (CP49 and filensin) suggest that AQP0 and BF proteins could act co-operatively in establishing normal lens biomechanics. We hypothesize that AQP0, with its prolific expression at the fiber cell membrane, could provide anchorage for cytoskeletal structures like BFs and together they help to

New white dwarf and subdwarf stars in the Sloan Digital Sky Survey Data Release 12

OpenAIRE

Kepler, S. O.; Pelisoli, Ingrid; Koester, Detlev; Ourique, Gustavo; Romero, Alejandra Daniela; Reindl, Nicole; Kleinman, Scot J.; Eisenstein, Daniel J.; Valois, A. Dean M.; Amaral, Larissa A.

2015-01-01

We report the discovery of 6576 new spectroscopically confirmed white dwarf and subdwarf stars in the Sloan Digital Sky Survey Data Release 12. We obtain Teff, log g and mass for hydrogen atmospherewhite dwarf stars (DAs) and helium atmospherewhite dwarf stars (DBs), estimate the calcium/helium abundances for the white dwarf stars with metallic lines (DZs) and carbon/helium for carbon-dominated spectra (DQs). We found one central star of a planetary nebula, one ultracompact helium binary (AM ...

Constraints on cosmological models from strong gravitational lensing systems

International Nuclear Information System (INIS)

Cao, Shuo; Pan, Yu; Zhu, Zong-Hong; Biesiada, Marek; Godlowski, Wlodzimierz

2012-01-01

Strong lensing has developed into an important astrophysical tool for probing both cosmology and galaxies (their structure, formation, and evolution). Using the gravitational lensing theory and cluster mass distribution model, we try to collect a relatively complete observational data concerning the Hubble constant independent ratio between two angular diameter distances D ds /D s from various large systematic gravitational lens surveys and lensing by galaxy clusters combined with X-ray observations, and check the possibility to use it in the future as complementary to other cosmological probes. On one hand, strongly gravitationally lensed quasar-galaxy systems create such a new opportunity by combining stellar kinematics (central velocity dispersion measurements) with lensing geometry (Einstein radius determination from position of images). We apply such a method to a combined gravitational lens data set including 70 data points from Sloan Lens ACS (SLACS) and Lens Structure and Dynamics survey (LSD). On the other hand, a new sample of 10 lensing galaxy clusters with redshifts ranging from 0.1 to 0.6 carefully selected from strong gravitational lensing systems with both X-ray satellite observations and optical giant luminous arcs, is also used to constrain three dark energy models (ΛCDM, constant w and CPL) under a flat universe assumption. For the full sample (n = 80) and the restricted sample (n = 46) including 36 two-image lenses and 10 strong lensing arcs, we obtain relatively good fitting values of basic cosmological parameters, which generally agree with the results already known in the literature. This results encourages further development of this method and its use on larger samples obtained in the future

Constraints on cosmological models from strong gravitational lensing systems

Energy Technology Data Exchange (ETDEWEB)

Cao, Shuo; Pan, Yu; Zhu, Zong-Hong [Department of Astronomy, Beijing Normal University, Beijing 100875 (China); Biesiada, Marek [Department of Astrophysics and Cosmology, Institute of Physics, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Godlowski, Wlodzimierz, E-mail: baodingcaoshuo@163.com, E-mail: panyu@cqupt.edu.cn, E-mail: biesiada@us.edu.pl, E-mail: godlowski@uni.opole.pl, E-mail: zhuzh@bnu.edu.cn [Institute of Physics, Opole University, Oleska 48, 45-052 Opole (Poland)

2012-03-01

Strong lensing has developed into an important astrophysical tool for probing both cosmology and galaxies (their structure, formation, and evolution). Using the gravitational lensing theory and cluster mass distribution model, we try to collect a relatively complete observational data concerning the Hubble constant independent ratio between two angular diameter distances D{sub ds}/D{sub s} from various large systematic gravitational lens surveys and lensing by galaxy clusters combined with X-ray observations, and check the possibility to use it in the future as complementary to other cosmological probes. On one hand, strongly gravitationally lensed quasar-galaxy systems create such a new opportunity by combining stellar kinematics (central velocity dispersion measurements) with lensing geometry (Einstein radius determination from position of images). We apply such a method to a combined gravitational lens data set including 70 data points from Sloan Lens ACS (SLACS) and Lens Structure and Dynamics survey (LSD). On the other hand, a new sample of 10 lensing galaxy clusters with redshifts ranging from 0.1 to 0.6 carefully selected from strong gravitational lensing systems with both X-ray satellite observations and optical giant luminous arcs, is also used to constrain three dark energy models (ΛCDM, constant w and CPL) under a flat universe assumption. For the full sample (n = 80) and the restricted sample (n = 46) including 36 two-image lenses and 10 strong lensing arcs, we obtain relatively good fitting values of basic cosmological parameters, which generally agree with the results already known in the literature. This results encourages further development of this method and its use on larger samples obtained in the future.

AcEST: DK948593 [AcEST

Lifescience Database Archive (English)

Full Text Available DKLSHFNYVVDVLIPYPIHLEI 163 >sp|A4QKR2|MATK_CRUWA Maturase K OS=Crucihimalaya wallichii GN=matK PE=3 SV=2 Len..._LOBMA Maturase K OS=Lobularia maritima GN=matK PE... 32 2.3 sp|A4QKR2|MATK_CRUWA Maturase K OS=Crucihimal...aya wallichii GN=ma... 32 3.0 sp|Q9GF51|MATK_ARAHA Maturase K OS=Arabidopsis haller

Algorithm design of liquid lens inspection system

Science.gov (United States)

Hsieh, Lu-Lin; Wang, Chun-Chieh

2008-08-01

In mobile lens domain, the glass lens is often to be applied in high-resolution requirement situation; but the glass zoom lens needs to be collocated with movable machinery and voice-coil motor, which usually arises some space limits in minimum design. In high level molding component technology development, the appearance of liquid lens has become the focus of mobile phone and digital camera companies. The liquid lens sets with solid optical lens and driving circuit has replaced the original components. As a result, the volume requirement is decreased to merely 50% of the original design. Besides, with the high focus adjusting speed, low energy requirement, high durability, and low-cost manufacturing process, the liquid lens shows advantages in the competitive market. In the past, authors only need to inspect the scrape defect made by external force for the glass lens. As to the liquid lens, authors need to inspect the state of four different structural layers due to the different design and structure. In this paper, authors apply machine vision and digital image processing technology to administer inspections in the particular layer according to the needs of users. According to our experiment results, the algorithm proposed can automatically delete non-focus background, extract the region of interest, find out and analyze the defects efficiently in the particular layer. In the future, authors will combine the algorithm of the system with automatic-focus technology to implement the inside inspection based on the product inspective demands.

Bioinspired adaptive gradient refractive index distribution lens

Science.gov (United States)

Yin, Kezhen; Lai, Chuan-Yar; Wang, Jia; Ji, Shanzuo; Aldridge, James; Feng, Jingxing; Olah, Andrew; Baer, Eric; Ponting, Michael

2018-02-01

Inspired by the soft, deformable human eye lens, a synthetic polymer gradient refractive index distribution (GRIN) lens with an adaptive geometry and focal power has been demonstrated via multilayer coextrusion and thermoforming of nanolayered elastomeric polymer films. A set of 30 polymer nanolayered films comprised of two thermoplastic polyurethanes having a refractive index difference of 0.05 were coextruded via forced-assembly technique. The set of 30 nanolayered polymer films exhibited transmission near 90% with each film varying in refractive index by 0.0017. An adaptive GRIN lens was fabricated from a laminated stack of the variable refractive index films with a 0.05 spherical GRIN. This lens was subsequently deformed by mechanical ring compression of the lens. Variation in the optical properties of the deformable GRIN lens was determined, including 20% variation in focal length and reduced spherical aberration. These properties were measured and compared to simulated results by placido-cone topography and ANSYS methods. The demonstration of a solid-state, dynamic focal length, GRIN lens with improved aberration correction was discussed relative to the potential future use in implantable devices.

Radiation dose to the lens and cataract formation

International Nuclear Information System (INIS)

Henk, J.M.; Whitelocke, R.A.F.; Warrington, A.P.; Bessell, E.M.

1993-01-01

The purpose of this work was to determine the radiation tolerance of the lens of the eye and the incidence of radiation-induced lens changes in patients treated by fractionated supervoltage radiation therapy for orbital tumors. Forty patients treated for orbital lymphoma and pseudotumor with tumor doses of 20--40 Gy were studied. The lens was partly shielded using lead cylinders in most cases. The dose to the germinative zone of the lens was estimated by measurements in a tissue equivalent phantom using both film densitometry and thermoluminescent dosimetry. Opthalmological examination was performed at 6 monthly intervals after treatment. The lead shield was found to reduce the dose to the germinative zone of the lens to between 36--50% of the tumor dose for Cobalt beam therapy, and to between 11--18% for 5 MeV x-rays. Consequently, the lens doses were in the range 4.5--30 Gy in 10--20 fractions. Lens opacities first appeared from between 3 and 9 years after irradiation. Impairment of visual acuity ensued in 74% of the patients who developed lens opacities. The incidence of lens changes was strongly dose-related. None was seen after doses of 5 Gy or lower, whereas doses of 16.5 Gy or higher were all followed by lens opacities which impaired visual acuity. The largest number of patients received a maximum lens dose of 15 Gy; in this group the actuarial incidence of lens opacities at 8 years was 57% with visual impairment in 38%. The adult lens can tolerate a total dose of 5 Gy during a fractionated course of supervoltage radiation therapy without showing any changes. Doses of 16.5 Gy or higher will almost invariably lead to visual impairment. The dose which causes a 50% probability of visual impairment is approximately 15 Gy. 10 refs., 4 figs., 1 tab

Stretchable Binary Fresnel Lens for Focus Tuning

NARCIS (Netherlands)

Li, X.; Wei, L.; Poelma, R.H.; Vollebregt, S.; Wei, J.; Urbach, Paul; Sarro, P.M.; Zhang, G.Q.

2016-01-01

This paper presents a tuneable binary amplitude Fresnel lens produced by wafer-level microfabrication. The Fresnel lens is fabricated by encapsulating lithographically defined vertically aligned carbon nanotube (CNT) bundles inside a polydimethyl-siloxane (PDMS) layer. The composite lens material

21 CFR 886.1390 - Flexible diagnostic Fresnel lens.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Flexible diagnostic Fresnel lens. 886.1390 Section... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1390 Flexible diagnostic Fresnel lens. (a) Identification. A flexible diagnostic Fresnel lens is a device that is a very thin lens which has...

A catoptric lens

International Nuclear Information System (INIS)

Rambauske, W.R.

1973-01-01

The invention relates to a catoptric lens for combining energies transmitted by several sources such as lasers; said lens comprising mirrors, the reflective surfaces of which have their focuses spaced from a common axis of symmetry. By means of these reflecting surfaces, which are generated by the nutation of portions of quadratic conics about the axis of symmetry, it is possible to focus the energy emmited by several lasers at the focus of the exit-mirror reflecting surface. This can be applied to thermonuclear fusion [fr

Estimating BrAC from transdermal alcohol concentration data using the BrAC estimator software program.

Science.gov (United States)

Luczak, Susan E; Rosen, I Gary

2014-08-01

Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.

21 CFR 886.1395 - Diagnostic Hruby fundus lens.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Diagnostic Hruby fundus lens. 886.1395 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1395 Diagnostic Hruby fundus lens. (a) Identification. A diagnostic Hruby fundus lens is a device that is a 55 diopter lens intended for use in the...

The Role of Aquaporins in Ocular Lens Homeostasis

Science.gov (United States)

Schey, Kevin L.; Petrova, Rosica S.; Gletten, Romell B.; Donaldson, Paul J.

2017-01-01

Aquaporins (AQPs), by playing essential roles in the maintenance of ocular lens homeostasis, contribute to the establishment and maintenance of the overall optical properties of the lens over many decades of life. Three aquaporins, AQP0, AQP1 and AQP5, each with distinctly different functional properties, are abundantly and differentially expressed in the different regions of the ocular lens. Furthermore, the diversity of AQP functionality is increased in the absence of protein turnover by age-related modifications to lens AQPs that are proposed to alter AQP function in the different regions of the lens. These regional differences in AQP functionality are proposed to contribute to the generation and directionality of the lens internal microcirculation; a system of circulating ionic and fluid fluxes that delivers nutrients to and removes wastes from the lens faster than could be achieved by passive diffusion alone. In this review, we present how regional differences in lens AQP isoforms potentially contribute to this microcirculation system by highlighting current areas of investigation and emphasizing areas where future work is required. PMID:29231874

21 CFR 886.1380 - Diagnostic condensing lens.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Diagnostic condensing lens. 886.1380 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1380 Diagnostic condensing lens. (a) Identification. A diagnostic condensing lens is a device used in binocular indirect ophthalmoscopy (a procedure...

Bacterial transmission from lens storage cases to contact lenses-Effects of lens care solutions and silver impregnation of cases.

Science.gov (United States)

Vermeltfoort, Pit B J; Hooymans, Johanna M M; Busscher, Henk J; van der Mei, Henny C

2008-10-01

The killing efficacies of multipurpose lens care solutions on planktonic and biofilm bacteria grown in polypropylene contact lens storage cases with and without silver impregnation and effects on bacterial transmission from storage cases to silicone hydrogel contact lenses were investigated. For transmission studies, biofilms of Staphylococcus aureus 835 or Pseudomonas aeruginosa no. 3 were grown on lens storage cases and incubated with a contact lens in different multipurpose lens care solutions (Opti-Free(R)Express(R), ReNu(R) MultiPlus(R), and SoloCare Aquatrade mark) or 0.9% NaCl. In addition, planktonic bacteria were directly suspended in multipurpose solutions and their killing efficacies were determined. The numbers of transmitted live and dead bacteria on the lenses were measured using a combination of plate counting and fluorescence microscopy. The highest killing efficacies were shown by Opti-Free(R) Express(R) for planktonic as well as for biofilm bacteria. Silver impregnation of lens cases in combination with the prescribed solution increased the killing efficacy for P. aeruginosa in biofilms, whereas effects for S. aureus were minor. Lowest numbers of live and dead bacteria were transmitted to a lens in Opti-Free(R) Express(R) multipurpose solution, with no significant differences between lens types and no effects of silver impregnation. (c) 2008 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater 2008. (c) 2008 Wiley Periodicals, Inc.

Iris reconstruction combined with iris-claw intraocular lens implantation for the management of iris-lens injured patients.

Science.gov (United States)

Hu, Shufang; Wang, Mingling; Xiao, Tianlin; Zhao, Zhenquan

2016-03-01

To study the efficiency and safety of iris reconstruction combined with iris-claw intraocular lens (IOL) implantation in the patients with iris-lens injuries. Retrospective, noncomparable consecutive case series study. Eleven patients (11 eyes) following iris-lens injuries underwent iris reconstructions combined with iris-claw IOL implantations. Clinical data, such as cause and time of injury, visual acuity (VA), iris and lens injuries, surgical intervention, follow-up period, corneal endothelial cell count, and optical coherence tomography, were collected. Uncorrected VA (UCVA) in all injured eyes before combined surgery was equal to or iris returned to its natural round shape or smaller pupil, and the iris-claw IOLs in the 11 eyes were well-positioned on the anterior surface of reconstructed iris. No complications occurred in those patients. Iris reconstruction combined with iris-claw IOL implantation is a safe and efficient procedure for an eye with iris-lens injury in the absence of capsular support.

Wide-range tunable magnetic lens for tabletop electron microscope

International Nuclear Information System (INIS)

Chang, Wei-Yu; Chen, Fu-Rong

2016-01-01

A tabletop scanning electron microscope (SEM) utilizes permanent magnets as condenser lenses to minimize its size, but this sacrifices the tunability of condenser lenses such that a tabletop system can only be operated with a fixed accelerating voltage. In contrast, the traditional condenser lens utilizes an electromagnetic coil to adjust the optical properties, but the size of the electromagnetic lens is inevitably larger. Here, we propose a tunable condenser lens for a tabletop SEM that uses a combination of permanent magnets and electromagnetic coils. The overall dimensions of the newly designed lens are the same as the original permanent magnet lens, but the new lens allows the tabletop SEM to be operated at different accelerating voltages between 1 kV and 15 kV. - Highlights: • A compact condenser lens combines both permanent magnet and coils. • A tunable lens is designed to keep the same focal point for voltage 1 to 15 kV. • A miniature tunable lens which can directly fit into tabletop SEM.

Wide-range tunable magnetic lens for tabletop electron microscope

Energy Technology Data Exchange (ETDEWEB)

Chang, Wei-Yu; Chen, Fu-Rong, E-mail: fchen1@me.com

2016-12-15

A tabletop scanning electron microscope (SEM) utilizes permanent magnets as condenser lenses to minimize its size, but this sacrifices the tunability of condenser lenses such that a tabletop system can only be operated with a fixed accelerating voltage. In contrast, the traditional condenser lens utilizes an electromagnetic coil to adjust the optical properties, but the size of the electromagnetic lens is inevitably larger. Here, we propose a tunable condenser lens for a tabletop SEM that uses a combination of permanent magnets and electromagnetic coils. The overall dimensions of the newly designed lens are the same as the original permanent magnet lens, but the new lens allows the tabletop SEM to be operated at different accelerating voltages between 1 kV and 15 kV. - Highlights: • A compact condenser lens combines both permanent magnet and coils. • A tunable lens is designed to keep the same focal point for voltage 1 to 15 kV. • A miniature tunable lens which can directly fit into tabletop SEM.

21 CFR 886.1420 - Ophthalmic lens gauge.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ophthalmic lens gauge. 886.1420 Section 886.1420...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1420 Ophthalmic lens gauge. (a) Identification. An ophthalmic lens gauge is a calibrated device intended to manually measure the curvature of a...

RHIC spin flipper AC dipole controller

Energy Technology Data Exchange (ETDEWEB)

Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

2011-03-28

The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

Adaptive mechanical-wetting lens actuated by ferrofluids

Science.gov (United States)

Cheng, Hui-Chuan; Xu, Su; Liu, Yifan; Levi, Shoshana; Wu, Shin-Tson

2011-04-01

We report an adaptive mechanical-wetting lens actuated by ferrofluids. The ferrofluids works like a piston to pump liquids in and out from the lens chamber, which in turn reshapes the lens curvature and changes the focal length. Both positive and negative lenses are demonstrated experimentally. The ferrofluid-actuated mechanical-wetting lens exhibits some attractive features, such as high resolution, fast response time, low power consumption, simple structure and electronic control, weak gravity effect, and low cost. Its potential applications in medical imaging, surveillance, and commercial electronics are foreseeable.

Numerical studies on the ramped density plasma lens

International Nuclear Information System (INIS)

Williams, R.L.; Katsouleas, T.

1992-01-01

We consider the so-called adiabatic plasma lens when the plasma density is ramped too quickly to be considered adiabatic. The lens length can be much shorter in such a case, but the final spot size is shown to be larger by a factor of √1+α 2 than for a slowly ramped plasma lens with the same initial and final density (where α=-β'/2 is proportional to the plasma density gradient). We find that the final spot size is the same whether or not the Courant-Snyder parameters of the beam (α and β) are matched to the lens. However, matched beams allow the plasma density to be lower while unmatched beams allow the lens to be shorter (for the same α and for the same final to initial plasma density ratio). Finally, we find that a smaller spot size can be obtained for a given lens length and density ratio by starting at smaller α and increasing α along the lens

LASL lens design procedure: simple, fast, precise, versatile

International Nuclear Information System (INIS)

Brixner, B.

1978-11-01

The Los Alamos Scientific Laboratory general-purpose lens design procedure optimizes specific lens prescriptions to obtain the smallest possible image spots and therefore near-spherical wave fronts of light converging on all images in the field of view. Optical image errors are analyzed in much the same way that they are measured on the optical bench. This lens design method is made possible by using the full capabilities of large electronic computers. First, the performance of the whole lens is sampled with many precisely traced skew rays. Next, lens performance is analyzed with spot diagrams generated by the many rays. Third, lens performance is optimized with a least squares system aimed at reducing all image errors to zero. This statistical approach to lens design uses skew rays and precisely measured ray deviations from ideal image points to achieve greater accuracy than was possible with the classical procedure, which is based on approximate expressions derived from simplified ray traces developed for pencil-and-paper calculations

High Dk piggyback contact lens system for contact lens-intolerant keratoconus patients.

Science.gov (United States)

Sengor, Tomris; Kurna, Sevda Aydin; Aki, Suat; Ozkurt, Yelda

2011-01-01

The aim of the study was to examine the clinical success of high Dk (oxygen permeability) piggyback contact lens (PBCL) systems for the correction of contact lens intolerant keratoconus patients. Sixteen patients (29 eyes) who were not able to wear gas-permeable rigid lenses were included in this study. Hyper Dk silicone hydrogel (oxygen transmissibility or Dk/t = 150 units) and fluorosilicone methacrylate copolymer (Dk/t = 100 units) lenses were chosen as the PBCL systems. The clinical examinations included visual acuity and corneal observation by biomicroscopy, keratometer reading, and fluorescein staining before and after fitting the PBCL system. INDICATIONS FOR USING PBCL SYSTEM WERE: lens stabilization and comfort, improving comfort, and adding protection to the cone. Visual acuities increased significantly in all of the patients compared with spectacles (P = 0). Improvement in visual acuity compared with rigid lenses alone was recorded in 89.7% of eyes and no alteration of the visual acuity was observed in 10.3% of the eyes. Wearing time of PBCL systems for most of the patients was limited time (mean 6 months, range 3-12 months); thereafter they tolerated rigid lenses alone except for 2 patients. The PBCL system is a safe and effective method to provide centering and corneal protection against mechanical trauma by the rigid lenses for keratoconus patients and may increase contact lens tolerance.

Development of Powerhouse Using Fresnel lens

Directory of Open Access Journals (Sweden)

Al-Dohani Nawar Saif

2018-01-01

Full Text Available Solar energy is an alternative source of renewable energy. Sultanate of Oman government showed initiation on utilization of solar energy for domestic and industrial applications. Fresnel lens is one of the methods to collect maximum energy by gathering heat of the sun in the concentrated form (using solar collectors. Earlier research work discloses that Fresnel lens gave better result in terms of power output and produces lower heat loss as compared to linear –parabolic solar collectors. In this work, development of a proto Fresnel lens power house was made to generate electricity. The focused heat from Fresnel lens was used to heat the molten salt in a heat exchanger to produce the steam. The generated steam was used to rotate the steam engine coupled to a generator. In the current work, a maximum power of 30 W was produced. In addition, comparative study was carried out regarding solar salts and heat exchanger materials to understand the Fresnel powerhouse performance. Overall the present study gave valuable information regarding usage of Fresnel lens for electricity generation in Oman.

Orbiting objective lens telescope system and method

International Nuclear Information System (INIS)

Crooks, J.W. Jr.

1984-01-01

A large objective lens is placed in a highly eccentric orbit about the earth. The orbit and orientation of the lens are carefully chosen so that it focuses light or other radiation from a preselected astronomical object into an image which slowly moves across the surface of the earth. A row of optical sensing units is located on the surface of the earth so that the image focused by the orbiting objective lens will travel substantially perpendicularly across the row during an observation. Output data generated from the sensing units may be multiplexed and fed to a real time processor which produces display signals. Each of the sensing units provides one scan line of the image being observed. The display signals are fed to a suitable display device which produces a picture of the preselected astronomical object. The objective lens may comprise a large flexible Fresnel zone plate or a flexible convex lens carried by a bicycle wheel-type supporting structure. The lens and supporting structure may be unfolded from compact cargo configurations and rotated after being placed into orbit

Transient anterior subcapsular vacuolar change of the crystalline lens in patients after posterior chamber phakic intraocular lens implantation.

Science.gov (United States)

Chung, Jin Kwon; Shin, Jin Hee; Lee, Sung Jin

2013-10-25

We present two cases of transient vacuolar changes in the anterior subcapsular space of the crystalline lens in patients after posterior chamber phakic intraocular lens implantation. Implantable collamer lenses (ICL) were implanted in healthy myopic patients. Vacuolar changes developed just after the irrigating procedure through the narrow space between the ICL and the crystalline lens. Slit-lamp examinations and spectral domain optical coherence tomography showed bleb-like lesions in the anterior subcapsular space of one eye in each case, though the lesions gradually improved without visual deterioration. Consequently, the lesions turned into a few anterior subcapsular small faint opacities. Direct irrigation of the narrow space confined by the ICL and the crystalline lens is at risk for the development of vacuolar changes in the crystalline lens. The observed spontaneous reversal indicates that surgeons should not rush to surgical intervention but rather opt for close follow over several weeks.

Rat silicone hydrogel contact lens model: effects of high- versus low-Dk lens wear.

Science.gov (United States)

Zhang, Yunfan; Gabriel, Manal M; Mowrey-McKee, Mary F; Barrett, Ronald P; McClellan, Sharon; Hazlett, Linda D

2008-11-01

This study used a rat contact lens (CL) model to test if high- versus low-Dk lens wear caused changes in (1) conjunctival Langerhans cell (LC) number or location; (2) Bcl-2 expression; and (3) infection risk. Female, Lewis rats wore a high- or low-Dk CL continuously for 2 weeks. Afterward, corneas were harvested and processed for ADPase activity to identify LCs, for immunostaining and for real time-polymerase chain reaction. Contact lens-wearing rats also were challenged with Pseudomonas aeruginosa by placing a bacterial-soaked CL on the eye followed by topical delivery of bacteria. After 48 hrs, slit lamp examination and real time-polymerase chain reaction were used to evaluate the corneal response. Conjunctival LC were significantly increased after low- versus high-Dk CL wear (PDk lens wearing group. Bcl-2 mRNA levels were significantly decreased in low- versus high-Dk CL wearing rats, while Bax, FasL, caspase 3, and caspase 9 levels were unchanged. Immunostaining for Bcl-2 showed fewer positively stained epithelial cells in the low- versus high-Dk lens wearing group. After bacterial challenge, 30% of low- versus none of the high-Dk CL wearing corneas became infected and showed increased mRNA levels for several proinflammatory cytokines/chemokines, inducible nitric oxide synthase and matrix metalloproteinase-9. Low- versus high-Dk or non-CL wear led to an increased number of conjunctival LC, decreased Bcl-2 levels, and increased the risk of bacterial infection.

Properties of the cathode lens combined with a focusing magnetic/immersion-magnetic lens

Czech Academy of Sciences Publication Activity Database

Konvalina, Ivo; Müllerová, Ilona

2011-01-01

Roč. 645, č. 1 (2011), s. 55-59 ISSN 0168-9002 R&D Projects: GA ČR GAP102/10/1410; GA AV ČR IAA100650902; GA MŠk ED0017/01/01 Institutional research plan: CEZ:AV0Z20650511 Keywords : cathode lens * compound objective lens * aberration coefficients * spot size * field calculations Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.207, year: 2011

The Sloan Digital Sky Survey COADD: 275 deg2 of deep Sloan Digital Sky Survey imaging on stripe 82

International Nuclear Information System (INIS)

Annis, James; Soares-Santos, Marcelle; Dodelson, Scott; Hao, Jiangang; Jester, Sebastian; Johnston, David E.; Kubo, Jeffrey M.; Lampeitl, Hubert; Lin, Huan; Miknaitis, Gajus; Yanny, Brian; Strauss, Michael A.; Gunn, James E.; Lupton, Robert H.; Becker, Andrew C.; Ivezić, Željko; Fan, Xiaohui; Jiang, Linhua; Seo, Hee-Jong; Simet, Melanie

2014-01-01

We present details of the construction and characterization of the coaddition of the Sloan Digital Sky Survey (SDSS) Stripe 82 ugriz imaging data. This survey consists of 275 deg 2 of repeated scanning by the SDSS camera over –50° ≤ α ≤ 60° and –1.°25 ≤ δ ≤ +1.°25 centered on the Celestial Equator. Each piece of sky has ∼20 runs contributing and thus reaches ∼2 mag fainter than the SDSS single pass data, i.e., to r ∼ 23.5 for galaxies. We discuss the image processing of the coaddition, the modeling of the point-spread function (PSF), the calibration, and the production of standard SDSS catalogs. The data have an r-band median seeing of 1.''1 and are calibrated to ≤1%. Star color-color, number counts, and PSF size versus modeled size plots show that the modeling of the PSF is good enough for precision five-band photometry. Structure in the PSF model versus magnitude plot indicates minor PSF modeling errors, leading to misclassification of stars as galaxies, as verified using VVDS spectroscopy. There are a variety of uses for this wide-angle deep imaging data, including galactic structure, photometric redshift computation, cluster finding and cross wavelength measurements, weak lensing cluster mass calibrations, and cosmic shear measurements.

Sloan Digital Sky Survey IV: Mapping the Milky Way, Nearby Galaxies, and the Distant Universe

Science.gov (United States)

Blanton, Michael R.; Bershady, Matthew A.; Abolfathi, Bela; Albareti, Franco D.; Allende Prieto, Carlos; Almeida, Andres; Alonso-García, Javier; Anders, Friedrich; Anderson, Scott F.; Andrews, Brett; Aquino-Ortíz, Erik; Aragón-Salamanca, Alfonso; Argudo-Fernández, Maria; Armengaud, Eric; Aubourg, Eric; Avila-Reese, Vladimir; Badenes, Carles; Bailey, Stephen; Barger, Kathleen A.; Barrera-Ballesteros, Jorge; Bartosz, Curtis; Bates, Dominic; Baumgarten, Falk; Bautista, Julian; Beaton, Rachael; Beers, Timothy C.; Belfiore, Francesco; Bender, Chad F.; Berlind, Andreas A.; Bernardi, Mariangela; Beutler, Florian; Bird, Jonathan C.; Bizyaev, Dmitry; Blanc, Guillermo A.; Blomqvist, Michael; Bolton, Adam S.; Boquien, Médéric; Borissova, Jura; van den Bosch, Remco; Bovy, Jo; Brandt, William N.; Brinkmann, Jonathan; Brownstein, Joel R.; Bundy, Kevin; Burgasser, Adam J.; Burtin, Etienne; Busca, Nicolás G.; Cappellari, Michele; Delgado Carigi, Maria Leticia; Carlberg, Joleen K.; Carnero Rosell, Aurelio; Carrera, Ricardo; Chanover, Nancy J.; Cherinka, Brian; Cheung, Edmond; Gómez Maqueo Chew, Yilen; Chiappini, Cristina; Doohyun Choi, Peter; Chojnowski, Drew; Chuang, Chia-Hsun; Chung, Haeun; Cirolini, Rafael Fernando; Clerc, Nicolas; Cohen, Roger E.; Comparat, Johan; da Costa, Luiz; Cousinou, Marie-Claude; Covey, Kevin; Crane, Jeffrey D.; Croft, Rupert A. C.; Cruz-Gonzalez, Irene; Garrido Cuadra, Daniel; Cunha, Katia; Damke, Guillermo J.; Darling, Jeremy; Davies, Roger; Dawson, Kyle; de la Macorra, Axel; Dell'Agli, Flavia; De Lee, Nathan; Delubac, Timothée; Di Mille, Francesco; Diamond-Stanic, Aleks; Cano-Díaz, Mariana; Donor, John; Downes, Juan José; Drory, Niv; du Mas des Bourboux, Hélion; Duckworth, Christopher J.; Dwelly, Tom; Dyer, Jamie; Ebelke, Garrett; Eigenbrot, Arthur D.; Eisenstein, Daniel J.; Emsellem, Eric; Eracleous, Mike; Escoffier, Stephanie; Evans, Michael L.; Fan, Xiaohui; Fernández-Alvar, Emma; Fernandez-Trincado, J. G.; Feuillet, Diane K.; Finoguenov, Alexis; Fleming, Scott W.; Font-Ribera, Andreu; Fredrickson, Alexander; Freischlad, Gordon; Frinchaboy, Peter M.; Fuentes, Carla E.; Galbany, Lluís; Garcia-Dias, R.; García-Hernández, D. A.; Gaulme, Patrick; Geisler, Doug; Gelfand, Joseph D.; Gil-Marín, Héctor; Gillespie, Bruce A.; Goddard, Daniel; Gonzalez-Perez, Violeta; Grabowski, Kathleen; Green, Paul J.; Grier, Catherine J.; Gunn, James E.; Guo, Hong; Guy, Julien; Hagen, Alex; Hahn, ChangHoon; Hall, Matthew; Harding, Paul; Hasselquist, Sten; Hawley, Suzanne L.; Hearty, Fred; Gonzalez Hernández, Jonay I.; Ho, Shirley; Hogg, David W.; Holley-Bockelmann, Kelly; Holtzman, Jon A.; Holzer, Parker H.; Huehnerhoff, Joseph; Hutchinson, Timothy A.; Hwang, Ho Seong; Ibarra-Medel, Héctor J.; da Silva Ilha, Gabriele; Ivans, Inese I.; Ivory, KeShawn; Jackson, Kelly; Jensen, Trey W.; Johnson, Jennifer A.; Jones, Amy; Jönsson, Henrik; Jullo, Eric; Kamble, Vikrant; Kinemuchi, Karen; Kirkby, David; Kitaura, Francisco-Shu; Klaene, Mark; Knapp, Gillian R.; Kneib, Jean-Paul; Kollmeier, Juna A.; Lacerna, Ivan; Lane, Richard R.; Lang, Dustin; Law, David R.; Lazarz, Daniel; Lee, Youngbae; Le Goff, Jean-Marc; Liang, Fu-Heng; Li, Cheng; Li, Hongyu; Lian, Jianhui; Lima, Marcos; Lin, Lihwai; Lin, Yen-Ting; Bertran de Lis, Sara; Liu, Chao; de Icaza Lizaola, Miguel Angel C.; Long, Dan; Lucatello, Sara; Lundgren, Britt; MacDonald, Nicholas K.; Deconto Machado, Alice; MacLeod, Chelsea L.; Mahadevan, Suvrath; Geimba Maia, Marcio Antonio; Maiolino, Roberto; Majewski, Steven R.; Malanushenko, Elena; Malanushenko, Viktor; Manchado, Arturo; Mao, Shude; Maraston, Claudia; Marques-Chaves, Rui; Masseron, Thomas; Masters, Karen L.; McBride, Cameron K.; McDermid, Richard M.; McGrath, Brianne; McGreer, Ian D.; Medina Peña, Nicolás; Melendez, Matthew; Merloni, Andrea; Merrifield, Michael R.; Meszaros, Szabolcs; Meza, Andres; Minchev, Ivan; Minniti, Dante; Miyaji, Takamitsu; More, Surhud; Mulchaey, John; Müller-Sánchez, Francisco; Muna, Demitri; Munoz, Ricardo R.; Myers, Adam D.; Nair, Preethi; Nandra, Kirpal; Correa do Nascimento, Janaina; Negrete, Alenka; Ness, Melissa; Newman, Jeffrey A.; Nichol, Robert C.; Nidever, David L.; Nitschelm, Christian; Ntelis, Pierros; O'Connell, Julia E.; Oelkers, Ryan J.; Oravetz, Audrey; Oravetz, Daniel; Pace, Zach; Padilla, Nelson; Palanque-Delabrouille, Nathalie; Alonso Palicio, Pedro; Pan, Kaike; Parejko, John K.; Parikh, Taniya; Pâris, Isabelle; Park, Changbom; Patten, Alim Y.; Peirani, Sebastien; Pellejero-Ibanez, Marcos; Penny, Samantha; Percival, Will J.; Perez-Fournon, Ismael; Petitjean, Patrick; Pieri, Matthew M.; Pinsonneault, Marc; Pisani, Alice; Poleski, Radosław; Prada, Francisco; Prakash, Abhishek; Queiroz, Anna Bárbara de Andrade; Raddick, M. Jordan; Raichoor, Anand; Barboza Rembold, Sandro; Richstein, Hannah; Riffel, Rogemar A.; Riffel, Rogério; Rix, Hans-Walter; Robin, Annie C.; Rockosi, Constance M.; Rodríguez-Torres, Sergio; Roman-Lopes, A.; Román-Zúñiga, Carlos; Rosado, Margarita; Ross, Ashley J.; Rossi, Graziano; Ruan, John; Ruggeri, Rossana; Rykoff, Eli S.; Salazar-Albornoz, Salvador; Salvato, Mara; Sánchez, Ariel G.; Aguado, D. S.; Sánchez-Gallego, José R.; Santana, Felipe A.; Santiago, Basílio Xavier; Sayres, Conor; Schiavon, Ricardo P.; da Silva Schimoia, Jaderson; Schlafly, Edward F.; Schlegel, David J.; Schneider, Donald P.; Schultheis, Mathias; Schuster, William J.; Schwope, Axel; Seo, Hee-Jong; Shao, Zhengyi; Shen, Shiyin; Shetrone, Matthew; Shull, Michael; Simon, Joshua D.; Skinner, Danielle; Skrutskie, M. F.; Slosar, Anže; Smith, Verne V.; Sobeck, Jennifer S.; Sobreira, Flavia; Somers, Garrett; Souto, Diogo; Stark, David V.; Stassun, Keivan; Stauffer, Fritz; Steinmetz, Matthias; Storchi-Bergmann, Thaisa; Streblyanska, Alina; Stringfellow, Guy S.; Suárez, Genaro; Sun, Jing; Suzuki, Nao; Szigeti, Laszlo; Taghizadeh-Popp, Manuchehr; Tang, Baitian; Tao, Charling; Tayar, Jamie; Tembe, Mita; Teske, Johanna; Thakar, Aniruddha R.; Thomas, Daniel; Thompson, Benjamin A.; Tinker, Jeremy L.; Tissera, Patricia; Tojeiro, Rita; Hernandez Toledo, Hector; de la Torre, Sylvain; Tremonti, Christy; Troup, Nicholas W.; Valenzuela, Octavio; Martinez Valpuesta, Inma; Vargas-González, Jaime; Vargas-Magaña, Mariana; Vazquez, Jose Alberto; Villanova, Sandro; Vivek, M.; Vogt, Nicole; Wake, David; Walterbos, Rene; Wang, Yuting; Weaver, Benjamin Alan; Weijmans, Anne-Marie; Weinberg, David H.; Westfall, Kyle B.; Whelan, David G.; Wild, Vivienne; Wilson, John; Wood-Vasey, W. M.; Wylezalek, Dominika; Xiao, Ting; Yan, Renbin; Yang, Meng; Ybarra, Jason E.; Yèche, Christophe; Zakamska, Nadia; Zamora, Olga; Zarrouk, Pauline; Zasowski, Gail; Zhang, Kai; Zhao, Gong-Bo; Zheng, Zheng; Zheng, Zheng; Zhou, Xu; Zhou, Zhi-Min; Zhu, Guangtun B.; Zoccali, Manuela; Zou, Hu

2017-07-01

We describe the Sloan Digital Sky Survey IV (SDSS-IV), a project encompassing three major spectroscopic programs. The Apache Point Observatory Galactic Evolution Experiment 2 (APOGEE-2) is observing hundreds of thousands of Milky Way stars at high resolution and high signal-to-noise ratios in the near-infrared. The Mapping Nearby Galaxies at Apache Point Observatory (MaNGA) survey is obtaining spatially resolved spectroscopy for thousands of nearby galaxies (median z˜ 0.03). The extended Baryon Oscillation Spectroscopic Survey (eBOSS) is mapping the galaxy, quasar, and neutral gas distributions between z˜ 0.6 and 3.5 to constrain cosmology using baryon acoustic oscillations, redshift space distortions, and the shape of the power spectrum. Within eBOSS, we are conducting two major subprograms: the SPectroscopic IDentification of eROSITA Sources (SPIDERS), investigating X-ray AGNs and galaxies in X-ray clusters, and the Time Domain Spectroscopic Survey (TDSS), obtaining spectra of variable sources. All programs use the 2.5 m Sloan Foundation Telescope at the Apache Point Observatory; observations there began in Summer 2014. APOGEE-2 also operates a second near-infrared spectrograph at the 2.5 m du Pont Telescope at Las Campanas Observatory, with observations beginning in early 2017. Observations at both facilities are scheduled to continue through 2020. In keeping with previous SDSS policy, SDSS-IV provides regularly scheduled public data releases; the first one, Data Release 13, was made available in 2016 July.

The AC photovoltaic module is here!

Science.gov (United States)

Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

1997-02-01

This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

Freeform lens design for LED collimating illumination.

Science.gov (United States)

Chen, Jin-Jia; Wang, Te-Yuan; Huang, Kuang-Lung; Liu, Te-Shu; Tsai, Ming-Da; Lin, Chin-Tang

2012-05-07

We present a simple freeform lens design method for an application to LED collimating illumination. The method is derived from a basic geometric-optics analysis and construction approach. By using this method, a highly collimating lens with LED chip size of 1.0 mm × 1.0 mm and optical simulation efficiency of 86.5% under a view angle of ± 5 deg is constructed. To verify the practical performance of the lens, a prototype of the collimator lens is also made, and an optical efficiency of 90.3% with a beam angle of 4.75 deg is measured.

Questions and Answers about School-Age Children in Self-Care: A Sloan Work and Family Research Network Fact Sheet

Science.gov (United States)

Sloan Work and Family Research Network, 2009

2009-01-01

The Sloan Work and Family Research Network has prepared Fact Sheets that provide statistical answers to some important questions about work-family and work-life issues. This Fact Sheet includes statistics about Children in Self-Care, and answers the following questions about school-age children in self-care: (1) How many school-age children are in…

HST/ACS IMAGING OF OMEGA CENTAURI: OPTICAL COUNTERPARTS OF CHANDRA X-RAY SOURCES

International Nuclear Information System (INIS)

Cool, Adrienne M.; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Haggard, Daryl; Anderson, Jay

2013-01-01

We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central ∼10' × 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ∼40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M 625 =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in ω Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in ω to Cen 20, the largest number yet known in any globular cluster.

HST/ACS Imaging of Omega Centauri: Optical Counterparts of Chandra X-Ray Sources

Science.gov (United States)

Cool, Adrienne M.; Haggard, Daryl; Arias, Tersi; Brochmann, Michelle; Dorfman, Jason; Gafford, April; White, Vivian; Anderson, Jay

2013-02-01

We present results of a search for optical counterparts of X-ray sources in and toward the globular cluster Omega Centauri (NGC 5139) using the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope. The ACS data consist of a mosaic of Wide Field Channel images obtained using F625W, F435W, and F658N filters; with nine pointings we cover the central ~10' × 10' of the cluster and encompass 109 known Chandra sources. We find promising optical counterparts for 59 of the sources, ~40 of which are likely to be associated with the cluster. These include 27 candidate cataclysmic variables (CVs), 24 of which are reported here for the first time. Fourteen of the CV candidates are very faint, with absolute magnitudes in the range M 625 =10.4-12.6, making them comparable in brightness to field CVs near the period minimum discovered in the Sloan Digital Sky Survey. Additional optical counterparts include three BY Dra candidates, a possible blue straggler, and a previously reported quiescent low-mass X-ray binary. We also identify 3 foreground stars and 11 probable active galactic nuclei. Finally, we report the discovery of a group of seven stars whose X-ray properties are suggestive of magnetically active binaries, and whose optical counterparts lie on or very near the metal-rich anomalous giant and subgiant branches in ω Cen. If the apparent association between these seven stars and the RGB/SGB-a stars is real, then the frequency of X-ray sources in this metal-rich population is enhanced by a factor of at least five relative to the other giant and subgiant populations in the cluster. If these stars are not members of the metal-rich population, then they bring the total number of red stragglers (also known as sub-subgiants) that have been identified in ω to Cen 20, the largest number yet known in any globular cluster.

The low-field permanent magnet electrostatic plasma lens

International Nuclear Information System (INIS)

Goncharov, A.; Gorshkov, V.; Maslov, V.; Zadorozhny, V.; Brown, I.

2004-01-01

We describe the status of ongoing research and development of the electrostatic plasma lens as used for the manipulation of high current broad beams of heavy ions of moderate energy. In some collaborative work at Lawrence Berkeley National Laboratory the lens was used to good effect for carrying out high dose ion implantation processing. In the process of this work a very narrow range of low magnetic field was found for which the ion-optical characteristics of the lens improved markedly. Subsequent theoretical analysis and computer modeling has led to an understanding of this phenomenon. These serendipitous results open up some attractive possibilities for the development of a new compact and low cost plasma lens based on permanent magnets rather than on current-driven field coils surrounding the lens volume. The development of this kind of lens, including both very low noise and minimal spherical aberration effects, may lead to a tool suitable for use in the injection beam lines of high current heavy ion linear accelerators. Here we briefly review the lens fundamentals, some characteristics of focusing heavy ion beams at low magnetic fields, and summarize recent theoretical and experimental developments, with emphasis on the relevance and suitability of the lens for accelerator injection application

Precision lens assembly with alignment turning system

Science.gov (United States)

Ho, Cheng-Fang; Huang, Chien-Yao; Lin, Yi-Hao; Kuo, Hui-Jean; Kuo, Ching-Hsiang; Hsu, Wei-Yao; Chen, Fong-Zhi

2017-10-01

The poker chip assembly with high precision lens barrels is widely applied to ultra-high performance optical system. ITRC applies the poker chip assembly technology to the high numerical aperture objective lenses and lithography projection lenses because of its high efficiency assembly process. In order to achieve high precision lens cell for poker chip assembly, an alignment turning system (ATS) is developed. The ATS includes measurement, alignment and turning modules. The measurement module is equipped with a non-contact displacement sensor (NCDS) and an autocollimator (ACM). The NCDS and ACM are used to measure centration errors of the top and the bottom surface of a lens respectively; then the amount of adjustment of displacement and tilt with respect to the rotational axis of the turning machine for the alignment module can be determined. After measurement, alignment and turning processes on the ATS, the centration error of a lens cell with 200 mm in diameter can be controlled within 10 arcsec. Furthermore, a poker chip assembly lens cell with three sub-cells is demonstrated, each sub-cells are measured and accomplished with alignment and turning processes. The lens assembly test for five times by each three technicians; the average transmission centration error of assembly lens is 12.45 arcsec. The results show that ATS can achieve high assembly efficiency for precision optical systems.

THE BOSS EMISSION-LINE LENS SURVEY. IV. SMOOTH LENS MODELS FOR THE BELLS GALLERY SAMPLE

Energy Technology Data Exchange (ETDEWEB)

Shu, Yiping [National Astronomical Observatories, Chinese Academy of Sciences, 20A Datun Road, Chaoyang District, Beijing 100012 (China); Bolton, Adam S.; Montero-Dorta, Antonio D.; Cornachione, Matthew A.; Zheng, Zheng; Brownstein, Joel R. [Department of Physics and Astronomy, University of Utah, 115 South 1400 East, Salt Lake City, UT 84112 (United States); Mao, Shude [Physics Department and Tsinghua Centre for Astrophysics, Tsinghua University, Beijing 100084 (China); Kochanek, Christopher S. [Department of Astronomy and Center for Cosmology and Astroparticle Physics, Ohio State University, Columbus, OH 43210 (United States); Pérez-Fournon, Ismael; Marques-Chaves, Rui [Instituto de Astrofísica de Canarias, C/Vía Láctea, s/n, E-38205 San Cristóbal de La Laguna, Tenerife (Spain); Oguri, Masamune [Research Center for the Early Universe, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Ménard, Brice, E-mail: yiping.shu@nao.cas.cn [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD 21218 (United States)

2016-12-20

We present Hubble Space Telescope F606W-band imaging observations of 21 galaxy-Ly α emitter lens candidates in the Baryon Oscillation Spectroscopic Survey Emission-Line Lens Survey (BELLS) for the GALaxy-Ly α EmitteR sYstems (BELLS GALLERY) survey. Seventeen systems are confirmed to be definite lenses with unambiguous evidence of multiple imaging. The lenses are primarily massive early-type galaxies (ETGs) at redshifts of approximately 0.55, while the lensed sources are Ly α emitters (LAEs) at redshifts from two to three. Although most of the lens systems are well fit by smooth lens models consisting of singular isothermal ellipsoids in an external shear field, a thorough exploration of dark substructures in the lens galaxies is required. The Einstein radii of the BELLS GALLERY lenses are, on average, 60% larger than those of the BELLS lenses because of the much higher source redshifts. This will allow for a detailed investigation of the radius evolution of the mass profile in ETGs. With the aid of the average ∼13× lensing magnification, the LAEs are frequently resolved into individual star-forming knots with a wide range of properties. They have characteristic sizes from less than 100 pc to several kiloparsecs, rest-frame far-UV apparent AB magnitudes from 29.6 to 24.2, and typical projected separations of 500 pc to 2 kpc.

Role of Aquaporin 0 in lens biomechanics.

Science.gov (United States)

Sindhu Kumari, S; Gupta, Neha; Shiels, Alan; FitzGerald, Paul G; Menon, Anil G; Mathias, Richard T; Varadaraj, Kulandaiappan

2015-07-10

Maintenance of proper biomechanics of the eye lens is important for its structural integrity and for the process of accommodation to focus near and far objects. Several studies have shown that specialized cytoskeletal systems such as the beaded filament (BF) and spectrin-actin networks contribute to mammalian lens biomechanics; mutations or deletion in these proteins alters lens biomechanics. Aquaporin 0 (AQP0), which constitutes ∼45% of the total membrane proteins of lens fiber cells, has been shown to function as a water channel and a structural cell-to-cell adhesion (CTCA) protein. Our recent ex vivo study on AQP0 knockout (AQP0 KO) mouse lenses showed the CTCA function of AQP0 could be crucial for establishing the refractive index gradient. However, biomechanical studies on the role of AQP0 are lacking. The present investigation used wild type (WT), AQP5 KO (AQP5(-/-)), AQP0 KO (heterozygous KO: AQP0(+/-); homozygous KO: AQP0(-/-); all in C57BL/6J) and WT-FVB/N mouse lenses to learn more about the role of fiber cell AQPs in lens biomechanics. Electron microscopic images exhibited decreases in lens fiber cell compaction and increases in extracellular space due to deletion of even one allele of AQP0. Biomechanical assay revealed that loss of one or both alleles of AQP0 caused a significant reduction in the compressive load-bearing capacity of the lenses compared to WT lenses. Conversely, loss of AQP5 did not alter the lens load-bearing ability. Compressive load-bearing at the suture area of AQP0(+/-) lenses showed easy separation while WT lens suture remained intact. These data from KO mouse lenses in conjunction with previous studies on lens-specific BF proteins (CP49 and filensin) suggest that AQP0 and BF proteins could act co-operatively in establishing normal lens biomechanics. We hypothesize that AQP0, with its prolific expression at the fiber cell membrane, could provide anchorage for cytoskeletal structures like BFs and together they help to confer

THE SLACS SURVEY. VIII. THE RELATION BETWEEN ENVIRONMENT AND INTERNAL STRUCTURE OF EARLY-TYPE GALAXIES

NARCIS (Netherlands)

Treu, Tommaso; Gavazzi, Raphael; Gorecki, Alexia; Marshall, Philip J.; Koopmans, Leon V. E.; Bolton, Adam S.; Moustakas, Leonidas A.; Burles, Scott

2009-01-01

We study the relation between the internal structure of early-type galaxies and their environment using 70 strong gravitational lenses from the SLACS Survey. The Sloan Digital Sky Survey (SDSS) database is used to determine two measures of overdensity of galaxies around each lens-the projected

Effect of infusion bottle height on lens power after lens refilling with and without a plug

NARCIS (Netherlands)

Koopmans, SA; Terwee, T; Haitjema, HJ; Kooijman, AC; Barkhof, J

2003-01-01

Purpose: To evaluate the influence of intraoperative infusion bottle height on the power of refilled pig lenses. Setting: Research Laboratory, Pharmacia Intraocular Lens Manufacturing Plant, Groningen, The Netherlands. Methods: This study comprised 2 groups of pig eyes. In 1 group, the lens was

Chapter 03: Correct use of a hand lens

Science.gov (United States)

Alex Wiedenhoeft

2011-01-01

A hand lens is a powerful tool for the identification of wood, but like all tools it must be used correctly to take full advantage of its powers. The hand lens has two main parts, a lens that magnifies the object of interest (generally we use 10X or 14X lenses in wood identification; a 14X lens is recommended for use with this manual) and a housing to hold and protect...

The neutron silicon lens. An update of the thermal neutron lens results

International Nuclear Information System (INIS)

Johnson, M.W.; Daymond, M.R.

2001-01-01

This paper introduces the concept of the Neutron Silicon Lens (NSL) and provides and update on the experimental results achieved to date. The NSL design is a cylindrical neutron lens based on the use of multiple neutron mirrors supported and separated by silicon wafers. Such lenses would have many applications in both the primary and scattered beams on neutron instruments, and would lead to immediate improvements where the sample to be illuminated is small, as in high pressure or engineering strain scanning instruments. (author)

The neutron silicon lens. An update of the thermal neutron lens results

Energy Technology Data Exchange (ETDEWEB)

Johnson, M.W.; Daymond, M.R. [Rutherford Appleton Laboratory, Chilton, Didcot, Oxfordshire (United Kingdom)

2001-03-01

This paper introduces the concept of the Neutron Silicon Lens (NSL) and provides and update on the experimental results achieved to date. The NSL design is a cylindrical neutron lens based on the use of multiple neutron mirrors supported and separated by silicon wafers. Such lenses would have many applications in both the primary and scattered beams on neutron instruments, and would lead to immediate improvements where the sample to be illuminated is small, as in high pressure or engineering strain scanning instruments. (author)

Changes in the accommodation-convergence relationship after the Artisan phakic intraocular lens implantation for myopic patients.

Science.gov (United States)

Ryu, Ik Hee; Han, Jinu; Lee, Hyung Keun; Kim, Jin Kook; Han, Sueng-Han

2014-04-01

To evaluate the change of accommodation-convergence parameters after implantation of Artisan phakic intraocular lens (PIOL). Prospective study for the patients with the Artisan PIOL implantation was performed. A total of 37 patients (3 males and 34 females) enrolled the study. Preoperatively, convergence amplitude, the stimulus accommodative convergence per unit of accommodation (AC/A) ratio and the near point of convergence (NPC) were evaluated. After the Artisan PIOL implantation, the identical evaluations were repeated at 1 week, 1, 3, and 6 months after the surgery. Mean age was 24.3 ± 4.8 years old, and preoperative refractive error was -8.92 ± 4.13 diopters (D). After the implantation, mean refractive errors significantly decreased to within ±1.00 D, and noticeable complications were not found. The convergence amplitude and the stimulus AC/A ratio increased 1 month after the surgery, but progressively stabilized afterward to near preoperative values. NPC didn't show any significant change over follow-up period up to 6 months. These results regarding implantation of the Artisan PIOL revealed the increase of accommodation-convergence relationship within first 1 month after the surgery, but progressive stabilization was noted during follow-up periods.

Levitação acústica

OpenAIRE

Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar

2015-01-01

A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

DEFF Research Database (Denmark)

Ljusev, Petar; Andersen, Michael Andreas E.

2004-01-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

Introduction to AC machine design

CERN Document Server

Lipo, Thomas A

2018-01-01

AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

The RNA-binding protein Celf1 post-transcriptionally regulates p27Kip1 and Dnase2b to control fiber cell nuclear degradation in lens development.

Directory of Open Access Journals (Sweden)

Archana D Siddam

2018-03-01

Full Text Available Opacification of the ocular lens, termed cataract, is a common cause of blindness. To become transparent, lens fiber cells undergo degradation of their organelles, including their nuclei, presenting a fundamental question: does signaling/transcription sufficiently explain differentiation of cells progressing toward compromised transcriptional potential? We report that a conserved RNA-binding protein Celf1 post-transcriptionally controls key genes to regulate lens fiber cell differentiation. Celf1-targeted knockout mice and celf1-knockdown zebrafish and Xenopus morphants have severe eye defects/cataract. Celf1 spatiotemporally down-regulates the cyclin-dependent kinase (Cdk inhibitor p27Kip1 by interacting with its 5' UTR and mediating translation inhibition. Celf1 deficiency causes ectopic up-regulation of p21Cip1. Further, Celf1 directly binds to the mRNA of the nuclease Dnase2b to maintain its high levels. Together these events are necessary for Cdk1-mediated lamin A/C phosphorylation to initiate nuclear envelope breakdown and DNA degradation in fiber cells. Moreover, Celf1 controls alternative splicing of the membrane-organization factor beta-spectrin and regulates F-actin-crosslinking factor Actn2 mRNA levels, thereby controlling fiber cell morphology. Thus, we illustrate new Celf1-regulated molecular mechanisms in lens development, suggesting that post-transcriptional regulatory RNA-binding proteins have evolved conserved functions to control vertebrate oculogenesis.

Novel Scanning Lens Instrument for Evaluating Fresnel Lens Performance: Equipment Development and Initial Results (Presentation)

Energy Technology Data Exchange (ETDEWEB)

Herrero, R.; Miller, D. C.; Kurtz, S. R.; Anton, I.; Sala, G.

2013-07-01

A system dedicated to the optical transmittance characterization of Fresnel lenses has been developed at NREL, in collaboration with the UPM. The system quantifies the optical efficiency of the lens by generating a performance map. The shape of the focused spot may also be analyzed to understand change in the lens performance. The primary instrument components (lasers and CCD detector) have been characterized to confirm their capability for performing optical transmittance measurements. Measurements performed on SoG and PMMA lenses subject to a variety of indoor conditions (e.g., UV and damp heat) identified differences in the optical efficiency of the evaluated lenses, demonstrating the ability of the Scanning Lens Instrument (SLI) to distinguish between the aged lenses.

Method for producing an isoplanatic aspheric monofocal intraocular lens, and resul ting lens

OpenAIRE

Barbero, Sergio; Marcos, Susana; Dorronsoro, Carlos; Montejo, Javier; Salazar Salegui, Pedro

2010-01-01

[EN] The invention can be used to obtain isoplanatic aspheric mono focal intraocular lenses in a viewing range of up to 25° (preferably up to 10°). The method comprises the following steps: l. mathematical defmition of an aphakic eye model; 2. mathematical definition of an intraocular lens model; 3. mathematical defmition of the implantation of the lens; 4. mathematical defmition of the merit function; 5. definition of the contour conditions; 6. defmition of a measurement for charact...

The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

International Nuclear Information System (INIS)

Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

2001-11-01

Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

A Class I UV-Blocking (senofilcon A) Soft Contact Lens Prevents UVA-induced Yellow Fluorescence and NADH loss in the Rabbit Lens Nucleus in vivo

Science.gov (United States)

Giblin, Frank J.; Lin, Li-Ren; Simpanya, Mukoma F.; Leverenz, Victor R.; Fick, Catherine E.

2012-01-01

It is known that fluorescence, much of it caused by UVA light excitation, increases in the aging human lens, resulting in loss of sharp vision. This study used an in vivo animal model to investigate UVA-excited fluorescence in the rabbit lens, which contains a high level of the UVA chromophore NADH, existing both free and bound to λ-crystallin. Also, the ability of a Class I (senofilcon A) soft contact lens to protect against UVA-induced effects on the rabbit lens was tested. Rabbit eyes were irradiated with UVA light in vivo (100 mW/cm2 on the cornea) for 1 hour using monochromatic 365 nm light. Irradiation was conducted in the presence of either a senofilcon A contact lens, a minimally UV-absorbing lotrafilcon A contact lens, or no contact lens at all. Eyes irradiated without a contact lens showed blue 365 nm-excited fluorescence initially, but this changed to intense yellow fluorescence after 1 hour. Isolated, previously irradiated lenses exhibited yellow fluorescence originating from the lens nucleus when viewed under 365 nm light, but showed normal blue fluorescence arising from the cortex. Previously irradiated lenses also exhibited a faint yellow color when observed under visible light. The senofilcon A contact lens protected completely against the UVA-induced effects on fluorescence and lens yellowing, whereas the lotrafilcon A lens showed no protection. The UVA-exposure also produced a 53% loss of total NADH (free plus bound) in the lens nucleus, with only a 13% drop in the anterior cortex. NADH loss in the nucleus was completely prevented with use of a senofilcon A contact lens, but no significant protection was observed with a lotrafilcon A lens. Overall, the senofilcon A lens provided an average of 67% protection against UVA-induced loss of four pyridine nucleotides in four different regions of the lens. HPLC analysis with fluorescence detection indicated a nearly six-fold increase in 365 nm-excited yellow fluorescence arising from lens nuclear �

AcMNPV ac143 (odv-e18) is essential for mediating budded virus production and is the 30th baculovirus core gene

International Nuclear Information System (INIS)

McCarthy, Christina B.; Theilmann, David A.

2008-01-01

Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription

Multipoint photonic doppler velocimetry using optical lens elements

Science.gov (United States)

Frogget, Brent Copely; Romero, Vincent Todd

2014-04-29

A probe including a fisheye lens is disclosed to measure the velocity distribution of a moving surface along many lines of sight. Laser light, directed to the surface and then reflected back from the surface, is Doppler shifted by the moving surface, collected into fisheye lens, and then directed to detection equipment through optic fibers. The received light is mixed with reference laser light and using photonic Doppler velocimetry, a continuous time record of the surface movement is obtained. An array of single-mode optical fibers provides an optic signal to an index-matching lens and eventually to a fisheye lens. The fiber array flat polished and coupled to the index-matching lens using index-matching gel. Numerous fibers in a fiber array project numerous rays through the fisheye lens which in turn project many measurement points at numerous different locations to establish surface coverage over a hemispherical shape with very little crosstalk.

Disassembly of the lens fiber cell nucleus to create a clear lens: the p27 descent

Science.gov (United States)

The eye lens is unique among tissues: it is transparent, does not form tumors, and the majority of its cells degrade their organelles, including their cell nuclei. A mystery for over a century, there has been considerable recent progress in elucidating mechanisms of lens fiber cell denucleation (LFC...

Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

Energy Technology Data Exchange (ETDEWEB)

Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

2008-07-01

Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

Automated Fresnel lens tester system

Energy Technology Data Exchange (ETDEWEB)

Phipps, G.S.

1981-07-01

An automated data collection system controlled by a desktop computer has been developed for testing Fresnel concentrators (lenses) intended for solar energy applications. The system maps the two-dimensional irradiance pattern (image) formed in a plane parallel to the lens, whereas the lens and detector assembly track the sun. A point detector silicon diode (0.5-mm-dia active area) measures the irradiance at each point of an operator-defined rectilinear grid of data positions. Comparison with a second detector measuring solar insolation levels results in solar concentration ratios over the image plane. Summation of image plane energies allows calculation of lens efficiencies for various solar cell sizes. Various graphical plots of concentration ratio data help to visualize energy distribution patterns.

Perubahan Sosial Berbasis Tasawuf: Studi Kasus Fethullah Gülen Dan Gülen Movement

Directory of Open Access Journals (Sweden)

Sulaiman Sulaiman

2016-06-01

Full Text Available Abstract: This article aims at analyzing Fethullah Gülen and the Gülen Movement which have succeeded in performing social change based on the teaching of Sufism. He did Sufism creativity in order that Sufism teaching was able to respond the changes that occur in the modernlife. He believed that, only by reinterpretation and contextualization of Sufism, the spiritual dimension of Islam would be able to perform the transformation or social change among the Muslims. Therefore, by using Max Weber’s theory of social action, this paper will analyze three key teachings of Sufism of Gülen: ascetic (zuhd, inbisat (expansion, and hizmet. Based on the Weber's theory, Gülen occupied a very central and authoritative position: agent/actor, action and meaning. As a source of meaning and interpreter of meaning, the key concepts of Sufism were transformed by Gülen to the internal and external communities so that they had made a move to do social movements and humanity. For the followers of Gülen, the movement was called the Gülen Movement or the Hizmet Movement which was engaged in the fields of education, health care, humanitarian assistance, and the mass media. All forms of movement were entirely based on the spiritual values of Islam that had been formulated by Gülen. الملخص: يهدف هذا البحث إلى تحليل شخصية فتح الله غولن وحركته الذي تمكن من القيام بالتغيير الاجتماعي على أساس التعاليم الصوفية. إن فتح الله غولن قام بإحياء التصوف في صورته الجدّية والحيوية في حياة الإنسان المعاصر. ويعتقد أن إعادة التفسير لتعاليم التصوف مع مراعاة الواقع قادرة على التغيير الاجتماعي بين المسلمين. من أجل ذلك، أن استخدام نظرية ويبر، يمكن تحليل تعاليم التصوف الثلاثة �

An Improved Photometric Calibration of the Sloan Digital SkySurvey Imaging Data

Energy Technology Data Exchange (ETDEWEB)

Padmanabhan, Nikhil; Schlegel, David J.; Finkbeiner, Douglas P.; Barentine, J.C.; Blanton, Michael R.; Brewington, Howard J.; Gunn, JamesE.; Harvanek, Michael; Hogg, David W.; Ivezic, Zeljko; Johnston, David; Kent, Stephen M.; Kleinman, S.J.; Knapp, Gillian R.; Krzesinski, Jurek; Long, Dan; Neilsen Jr., Eric H.; Nitta, Atsuko; Loomis, Craig; Lupton,Robert H.; Roweis, Sam; Snedden, Stephanie A.; Strauss, Michael A.; Tucker, Douglas L.

2007-09-30

We present an algorithm to photometrically calibrate widefield optical imaging surveys, that simultaneously solves for thecalibration parameters and relative stellar fluxes using overlappingobservations. The algorithm decouples the problem of "relative"calibrations from that of "absolute" calibrations; the absolutecalibration is reduced to determining a few numbers for the entiresurvey. We pay special attention to the spatial structure of thecalibration errors, allowing one to isolate particular error modes indownstream analyses. Applying this to the SloanDigital Sky Survey imagingdata, we achieve ~;1 percent relative calibration errors across 8500sq.deg/ in griz; the errors are ~;2 percent for the u band. These errorsare dominated by unmodelled atmospheric variations at Apache PointObservatory. These calibrations, dubbed ubercalibration, are now publicwith SDSS Data Release 6, and will be a part of subsequent SDSS datareleases.

Characteristics of soft X-ray lens

International Nuclear Information System (INIS)

Qin Yi

2007-12-01

A soft X-lens was devised with waveguide X-ray optics of total external reflection (TER). The lens consists of a stack of 1 387 TER waveguides with inner diameter of 0.45 mm and outer diameter of 0.60 mm. With the help of plasma sources of soft X-ray radiation, high density of pure soft X-ray radiation (without plasma expansion fragments) with broad-band spectral range can be obtained at the focus of the lens. As laser-plasma is considered, the radiation density of 1.3 x 10 5 W/cm 2 is obtained, the transmission coefficient is 18.6%, the ratio of the density at the focus with and without the lens is 1000 and the radiation capture is 28.9 degree. The density of 0.5 TW/cm 2 can be obtained as far as Qiang-Guang I facility is considered. (authors)

High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

Science.gov (United States)

Abbas, Qamar; Béguin, François

2016-06-01

We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

Development of an accommodating intra-ocular lens - In vitro prevention of re-growth of pig and rabbit lens capsule epithelial cells

NARCIS (Netherlands)

van Kooten, Theo G.; Koopmans, Steven; Terwee, Thom; Norrby, Sverker; Hooymans, J. M. M.; Busscher, Henk J.

2006-01-01

Cataract surgery is routinely performed to replace the clouded lens by a rigid polymeric intra-ocular lens unable to accommodate. By implanting a silicone gel into an intact capsular bag the accommodating properties of the natural lens can be maintained or enhanced. The implantation success of

Effects of x-irradiation on lens reducing systems

International Nuclear Information System (INIS)

Giblin, F.J.; Chakrapani, B.; Reddy, V.N.

1978-01-01

Studies have been made of the effects of x ray on various lens reducing systems including the levels of NADPH and glutathione (GSH), the activity of the hexose monophosphate shunt (HMS), and the activities of certain enzymes including glutathion reductase, glutathione peroxidase, and glucose-6-phosphate dehydrogenase (G-6-PD). It was found that during several weeks following x irradiation but prior to cataract formation there was very little change in the number of reduced -SH groups per unit weight of lens protein but that, with the appearance of cataract, there was a sudden loss of protein -SH groups. In contrast, the concentration of GSH in the x-rayed lens decreased throughout the experimental period. Similarly, the concentration of NADPH in the x-rayed lens was found to decrease significantly relative to controls one week prior to cataract formation and the ratio of NADPH to NADP + in the lens shifted at this time period from a value greater than 1.0 in the control lens to less than 1.0 in the x-rayed lens. A corresponding decrease occurred in the activity of the HMS in x-rayed lenses as measured by culture in the presence of 1- 14 C-labelled glucose. G-6-PD was partially inactivated in the x-rayed lens. Of the eight enzymes studied, G-6-PD appeared to be the most sensitive to x-irradiation. The data indicate that x-irradiation results in a steady decrease in the effectiveness of lens reducing systems and that, when these systems reach a critically low point, sudden oxidation of protein -SH groups and formation of high molecular weight protein aggregates may be initiated

AcEST: DK954361 [AcEST

Lifescience Database Archive (English)

Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

Photon nanojet lens: design, fabrication and characterization

International Nuclear Information System (INIS)

Xu, Chen; Zhang, Sichao; Shao, Jinhai; Lu, Bing-Rui; Chen, Yifang; Mehfuz, Reyad; Drakeley, Stacey; Huang, Fumin

2016-01-01

In this paper, a novel nanolens with super resolution, based on the photon nanojet effect through dielectric nanostructures in visible wavelengths, is proposed. The nanolens is made from plastic SU-8, consisting of parallel semi-cylinders in an array. This paper focuses on the lens designed by numerical simulation with the finite-difference time domain method and nanofabrication of the lens by grayscale electron beam lithography combined with a casting/bonding/lift-off transfer process. Monte Carlo simulation for injected charge distribution and development modeling was applied to define the resultant 3D profile in PMMA as the template for the lens shape. After the casting/bonding/lift-off process, the fabricated nanolens in SU-8 has the desired lens shape, very close to that of PMMA, indicating that the pattern transfer process developed in this work can be reliably applied not only for the fabrication of the lens but also for other 3D nanopatterns in general. The light distribution through the lens near its surface was initially characterized by a scanning near-field optical microscope, showing a well defined focusing image of designed grating lines. Such focusing function supports the great prospects of developing a novel nanolithography based on the photon nanojet effect. (paper)

Protein synthesis in x-irradiated rabbit lens

International Nuclear Information System (INIS)

Garadi, R.; Foltyn, A.R.; Giblin, F.J.; Reddy, V.N.

1984-01-01

The present study deals with the incorporation of 35 S methionine into lens crystallins as a function of time after x-irradiation. Crystallin synthesis is first affected approximately 4 weeks following x-irradiation. This coincides with the time period at which the ratio of the two cations in the lens is affected, as shown in earlier studies. A greater decrease in 35 S-methionine incorporation into crystallins is observed between 5-7 weeks following x-irradiation in good agreement with a cation imbalance at these time intervals. These studies also revealed for the first time that the change in cation distribution can affect not only crystallin synthesis, but also the synthesis of certain polypeptides of lens membranes. No alteration in protein synthesis could be detected in lens epithelium even after 7 weeks following irradiation. In addition to the effect of Na+ and K+ levels on protein synthesis, an impaired transport of amino acids into the x-rayed lens was also found to be a factor in the observed reduction in synthesis of the crystallin, cytoskeletal and membrane proteins of the fiber cells. It is concluded that Na+/K+ ratio as well as the availability of amino acids in the lens are important factors in protein synthesis of x-ray cataracts

21 CFR 886.4440 - AC-powered magnet.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

21 CFR 886.1410 - Ophthalmic trial lens clip.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ophthalmic trial lens clip. 886.1410 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1410 Ophthalmic trial lens clip. (a) Identification. An ophthalmic trial lens clip is a device intended to hold prisms, spheres, cylinders, or...

21 CFR 886.1415 - Ophthalmic trial lens frame.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ophthalmic trial lens frame. 886.1415 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1415 Ophthalmic trial lens frame. (a) Identification. An opthalmic trial lens frame is a mechanical device intended to hold trial lenses for vision...

An adjustable electron achromat for cathode lens microscopy

Energy Technology Data Exchange (ETDEWEB)

Tromp, R.M., E-mail: rtromp@us.ibm.com [IBM T.J. Watson Research Center, 1101 Kitchawan Road, Yorktown Heights, NY 10598 (United States); Leiden Institute of Physics, Kamerlingh Onnes Laboratory, Niels Bohrweg 2, 2333 CA Leiden (Netherlands)

2015-12-15

Chromatic aberration correction in light optics began with the invention of a two-color-corrected achromatic crown/flint lens doublet by Chester Moore Hall in 1730. Such color correction is necessary because any single glass shows dispersion (i.e. its index of refraction changes with wavelength), which can be counteracted by combining different glasses with different dispersions. In cathode lens microscopes (such as Photo Electron Emission Microscopy – PEEM) we encounter a similar situation, where the chromatic aberration coefficient of the cathode lens shows strong dispersion, i.e. depends (non-linearly) on the energy with which the electrons leave the sample. Here I show how a cathode lens in combination with an electron mirror can be configured as an adjustable electron achromat. The lens/mirror combination can be corrected at two electron energies by balancing the settings of the electron mirror against the settings of the cathode lens. The achromat can be adjusted to deliver optimum performance, depending on the requirements of a specific experiment. Going beyond the achromat, an apochromat would improve resolution and transmission by a very significant margin. I discuss the requirements and outlook for such a system, which for now remains a wish waiting for fulfilment. - Highlights: • The properties of cathode objective lens plus electron mirror are discussed. • In analogy with light-optical achromats, cathode lens plus mirror can be configured as an electron achromat. • Unlike light optics, the electron achromat can be adjusted to best fulfill experimental requirements.

Fermat's least-time principle and the embedded transparent lens

Science.gov (United States)

Kantowski, R.; Chen, B.; Dai, X.

2013-10-01

We present a simplified version of the lowest-order embedded point mass gravitational lens theory and then make the extension of this theory to any embedded transparent lens. Embedding a lens effectively reduces the gravitational potential’s range, i.e., partially shields the lensing potential because the lens mass is made a contributor to the mean mass density of the Universe and not simply superimposed upon it. We give the time-delay function for the embedded point mass lens from which we can derive the simplified lens equation by applying Fermat’s least-time principle. Even though rigorous derivations are only made for the point mass in a flat background, the generalization of the lens equation to lowest order for any distributed lens in any homogeneous background is obvious. We find from this simplified theory that embedding can introduce corrections above the few percent level in weak lensing shears caused by large clusters but only at large impacts. The potential part of the time delay is also affected in strong lensing at the few percent level. Additionally we again confirm that the presence of a cosmological constant alters the gravitational deflection of passing photons.

Lens regeneration in axolotl: new evidence of developmental plasticity

Directory of Open Access Journals (Sweden)

Suetsugu-Maki Rinako

2012-12-01

Full Text Available Abstract Background Among vertebrates lens regeneration is most pronounced in newts, which have the ability to regenerate the entire lens throughout their lives. Regeneration occurs from the dorsal iris by transdifferentiation of the pigment epithelial cells. Interestingly, the ventral iris never contributes to regeneration. Frogs have limited lens regeneration capacity elicited from the cornea during pre-metamorphic stages. The axolotl is another salamander which, like the newt, regenerates its limbs or its tail with the spinal cord, but up until now all reports have shown that it does not regenerate the lens. Results Here we present a detailed analysis during different stages of axolotl development, and we show that despite previous beliefs the axolotl does regenerate the lens, however, only during a limited time after hatching. We have found that starting at stage 44 (forelimb bud stage lens regeneration is possible for nearly two weeks. Regeneration occurs from the iris but, in contrast to the newt, regeneration can be elicited from either the dorsal or the ventral iris and, occasionally, even from both in the same eye. Similar studies in the zebra fish concluded that lens regeneration is not possible. Conclusions Regeneration of the lens is possible in the axolotl, but differs from both frogs and newts. Thus the axolotl iris provides a novel and more plastic strategy for lens regeneration.

21 CFR 886.1405 - Ophthalmic trial lens set.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ophthalmic trial lens set. 886.1405 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1405 Ophthalmic trial lens set. (a) Identification. An ophthalmic trial lens set is a device that is a set of lenses of various dioptric powers...

Computer optimization of retarding lens systems for ESCA spectrometers

International Nuclear Information System (INIS)

Wannberg, B.; Skoellermo, A.

1977-01-01

The performance of four-element electrostatic lenses as retarding systems between source and analyzer in ESCA spectrometers is calculated. The potential distribution in the lens is defined by an axial potential of the type phi(z)=V 0 +Σ(Vsub(i)-Vsub(i-1))/2 - tanh (ω/asub(i)(z-zsub(i))). For a given general shape of the lens and a given retardation ratio, the potentials of the two middle electrodes are fitted to give a paraxial image with a prescribed magnification at the exit slit of the lens system. The equipotential surfaces forming the electrodes are found by calculating the potential in an off-axis point, using the series expansion. All third-order geometrical and first-order chromatic aberrations of the lenses are calculated and used together with the second-order aberrations of the analyzer to calculate optimum dimensions of the lens elements and of the emittance-defining slits. A computer program, of which one part calculates the lens properties and one the properties of the entire system lens-analyzer, is described. Two lens systems are presented in some detail. The first one is intended for use with a hemispherical electrostatic analyzer. The angular acceptance is here defined by an aperture stop inside the lens. In this system, the image position and magnification can be kept constant for retardation ratios at least between 1:2 and 60:1, with moderate potentials on the middle electrodes. The second lens system is designed for a magnetic spectrometer of the π√2-type. Here, the central trajectory in the lens is slightly curved by the magnetic field, and the angular acceptance is defined by a baffle after the lens. This system is optimized for a constant retardation ratio of 5:1. (Auth.)

Candidate gravitational microlensing events for future direct lens imaging

International Nuclear Information System (INIS)

Henderson, C. B.; Gould, A.; Gaudi, B. S.; Park, H.; Han, C.; Sumi, T.; Koshimoto, N.; Udalski, A.; Tsapras, Y.; Bozza, V.; Abe, F.; Fukunaga, D.; Itow, Y.; Masuda, K.; Bennett, D. P.; Bond, I. A.; Ling, C. H.; Botzler, C. S.; Freeman, M.; Fukui, A.

2014-01-01

The mass of the lenses giving rise to Galactic microlensing events can be constrained by measuring the relative lens-source proper motion and lens flux. The flux of the lens can be separated from that of the source, companions to the source, and unrelated nearby stars with high-resolution images taken when the lens and source are spatially resolved. For typical ground-based adaptive optics (AO) or space-based observations, this requires either inordinately long time baselines or high relative proper motions. We provide a list of microlensing events toward the Galactic bulge with high relative lens-source proper motion that are therefore good candidates for constraining the lens mass with future high-resolution imaging. We investigate all events from 2004 to 2013 that display detectable finite-source effects, a feature that allows us to measure the proper motion. In total, we present 20 events with μ ≳ 8 mas yr –1 . Of these, 14 were culled from previous analyses while 6 are new, including OGLE-2004-BLG-368, MOA-2005-BLG-36, OGLE-2012-BLG-0211, OGLE-2012-BLG-0456, MOA-2012-BLG-532, and MOA-2013-BLG-029. In ≲12 yr from the time of each event the lens and source of each event will be sufficiently separated for ground-based telescopes with AO systems or space telescopes to resolve each component and further characterize the lens system. Furthermore, for the most recent events, comparison of the lens flux estimates from images taken immediately to those estimated from images taken when the lens and source are resolved can be used to empirically check the robustness of the single-epoch method currently being used to estimate lens masses for many events.

Candidate gravitational microlensing events for future direct lens imaging

Energy Technology Data Exchange (ETDEWEB)

Henderson, C. B.; Gould, A.; Gaudi, B. S. [Department of Astronomy, The Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Park, H.; Han, C. [Department of Physics, Institute for Astrophysics, Chungbuk National University, Cheongju 371-763 (Korea, Republic of); Sumi, T.; Koshimoto, N. [Department of Earth and Space Science, Osaka University, Osaka 560-0043 (Japan); Udalski, A. [Warsaw University Observatory, Al. Ujazdowskie 4, 00-478 Warszawa (Poland); Tsapras, Y. [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Goleta, CA 93117 (United States); Bozza, V. [Department of Physics, University of Salerno, I-84084 Fisciano (Italy); Abe, F.; Fukunaga, D.; Itow, Y.; Masuda, K. [Solar-Terrestrial Environment Laboratory, Nagoya University, Nagoya 464-8601 (Japan); Bennett, D. P. [Department of Physics, University of Notre Dame, 225 Nieuwland Science Hall, Notre Dame, IN 46556-5670 (United States); Bond, I. A.; Ling, C. H. [Institute of Information and Mathematical Sciences, Massey University, Private Bag 102-904, North Shore Mail Centre, Auckland 0745 (New Zealand); Botzler, C. S.; Freeman, M. [Department of Physics, University of Auckland, Private Bag 92-019, Auckland 1001 (New Zealand); Fukui, A. [School of Chemical and Physical Sciences, Victoria University, Wellington 6140 (New Zealand); Collaboration: MOA Collaboration; OGLE Collaboration; μFUN Collaboration; RoboNet Collaboration; and others

2014-10-10

The mass of the lenses giving rise to Galactic microlensing events can be constrained by measuring the relative lens-source proper motion and lens flux. The flux of the lens can be separated from that of the source, companions to the source, and unrelated nearby stars with high-resolution images taken when the lens and source are spatially resolved. For typical ground-based adaptive optics (AO) or space-based observations, this requires either inordinately long time baselines or high relative proper motions. We provide a list of microlensing events toward the Galactic bulge with high relative lens-source proper motion that are therefore good candidates for constraining the lens mass with future high-resolution imaging. We investigate all events from 2004 to 2013 that display detectable finite-source effects, a feature that allows us to measure the proper motion. In total, we present 20 events with μ ≳ 8 mas yr{sup –1}. Of these, 14 were culled from previous analyses while 6 are new, including OGLE-2004-BLG-368, MOA-2005-BLG-36, OGLE-2012-BLG-0211, OGLE-2012-BLG-0456, MOA-2012-BLG-532, and MOA-2013-BLG-029. In ≲12 yr from the time of each event the lens and source of each event will be sufficiently separated for ground-based telescopes with AO systems or space telescopes to resolve each component and further characterize the lens system. Furthermore, for the most recent events, comparison of the lens flux estimates from images taken immediately to those estimated from images taken when the lens and source are resolved can be used to empirically check the robustness of the single-epoch method currently being used to estimate lens masses for many events.

Optofluidic lens actuated by laser-induced solutocapillary forces

Science.gov (United States)

Malyuk, A. Yu.; Ivanova, N. A.

2017-06-01

We demonstrate an adaptive liquid lens controlled by laser-induced solutocapillary forces. The liquid droplet serving as a lens is formed in a thin layer of binary liquid mixture by surface tension driven flows caused by the thermal action of laser irradiation. The shape of droplet, its aperture and the focal length are reversibly changed without hysteresis by varying the intensity of the laser beam. The focal length variation range of the droplet-lens lies in between infinity (a flat layer) to 15 mm (a curved interface). The droplet-lens is capable to adjust the in-plane lateral position in response to a displacement of the laser beam. The proposed laser controlled droplet-lens will enable to develop smart liquid optical devices, which can imitate the accommodation reflex and pupillary light reflex of the eye.

EDEL: ENEA dosemeter for eye lens

International Nuclear Information System (INIS)

Ferrari, Paolo; Mariotti, Francesca; Campani, Lorenzo

2016-01-01

Since the publication of International Commission on Radiological Protection statement in 2011 on tissue reaction, eye lens radiation protection played an important role in exposed personnel dosimetry. For this reason, the Italian National Agency for New Technologies, Energy and Sustainable Economic Development (ENEA) Individual Monitoring Service decided to study a prototype to fulfil specific requests (e.g. for survey in interventional department and intercomparisons). On the basis of such preliminary investigation, a new eye lens dosemeter was developed. The new dosemeter, named EDEL (ENEA Dosemeter for Eye Lens), was characterised in terms of H p (3), the operational quantity related to eye lens monitoring. The investigation was performed experimentally and optimised using the Monte Carlo MCNP6 code. The new prototype was thought to fulfil two main requests: the reliability of the dosimetric data and the portability of the dosemeter itself. The new dosemeter will soon be supplied to the collaborating hospitals for workplace test measurements. (authors)

Gravitational lens effect and pregalactic halo objects

International Nuclear Information System (INIS)

Bontz, R.J.

1979-01-01

The changes in flux, position, and size of a distant extended (galaxy, etc.) source that result from the gravitational lens action of a massive opaque object are discussed. The flux increase is described by a single function of two parameters. One of these parameters characterizes the strength of the gravitational lens, the other describes the alignment of source and lens object. This function also describes the relative intensity of the images formed by lens. ( A similar formalism is discussed by Bourassa et al. for a point source). The formalism is applied to the problem of the galactic halo. It appears that a massive (10 1 2 M/sub sun/) spherical halo surrounding the visible part of the galaxy is consistent with the observable properties of extragalactic sources

Tinting of intraocular lens implants

International Nuclear Information System (INIS)

Zigman, S.

1982-01-01

Intraocular lens (IOL) implants of polymethyl methacrylate (PMMA) lack an important yellow pigment useful as a filter in the visual process and in the protection of the retina from short-wavelength radiant energy. The ability to produce a yellow pigment in the PMMA used in IOL implants by exposure to near-ultraviolet (UV) light was tested. It was found that the highly cross-linked material in Copeland lens blanks was tinted slightly because of this exposure. The absorptive properties of lens blanks treated with near-UV light in this way approached that of the absorptive properties of human lenses. This finding shows that it is possible to alter IOL implants simply so as to induce a pale-yellow pigment in them to improve the visual process and to protect the retinas of IOL users

Tinting of intraocular lens implants

Energy Technology Data Exchange (ETDEWEB)

Zigman, S.

1982-06-01

Intraocular lens (IOL) implants of polymethyl methacrylate (PMMA) lack an important yellow pigment useful as a filter in the visual process and in the protection of the retina from short-wavelength radiant energy. The ability to produce a yellow pigment in the PMMA used in IOL implants by exposure to near-ultraviolet (UV) light was tested. It was found that the highly cross-linked material in Copeland lens blanks was tinted slightly because of this exposure. The absorptive properties of lens blanks treated with near-UV light in this way approached that of the absorptive properties of human lenses. This finding shows that it is possible to alter IOL implants simply so as to induce a pale-yellow pigment in them to improve the visual process and to protect the retinas of IOL users.

Acid phosphatase and lipid peroxidation in human cataractous lens epithelium

Directory of Open Access Journals (Sweden)

Vasavada Abhay

1993-01-01

Full Text Available The anterior lens epithelial cells undergo a variety of degenerative and proliferative changes during cataract formation. Acid phosphatase is primarily responsible for tissue regeneration and tissue repair. The lipid hydroperoxides that are obtained by lipid peroxidation of polysaturated or unsaturated fatty acids bring about deterioration of biological membranes at cellular and tissue levels. Acid phosphatase and lipid peroxidation activities were studied on the lens epithelial cells of nuclear cataract, posterior subcapsular cataract, mature cataract, and mixed cataract. Of these, mature cataractous lens epithelium showed maximum activity for acid phosphatase (516.83 moles of p-nitrophenol released/g lens epithelium and maximum levels of lipid peroxidation (86.29 O.D./min/g lens epithelium. In contrast, mixed cataractous lens epithelium showed minimum activity of acid phosphatase (222.61 moles of p-nitrophenol released/g lens epithelium and minimum levels of lipid peroxidation (54.23 O.D./min/g lens epithelium. From our study, we correlated the maximum activity of acid phosphatase in mature cataractous lens epithelium with the increased areas of superimposed cells associated with the formation of mature cataract. Likewise, the maximum levels of lipid peroxidation in mature cataractous lens epithelium was correlated with increased permeability of the plasma membrane. Conversely, the minimum levels of lipid peroxidation in mixed cataractous lens epithelium makes us presume that factors other than lipid peroxidation may also account for the formation of mixed type of cataract.

The partial coherence modulation transfer function in testing lithography lens

Science.gov (United States)

Huang, Jiun-Woei

2018-03-01

Due to the lithography demanding high performance in projection of semiconductor mask to wafer, the lens has to be almost free in spherical and coma aberration, thus, in situ optical testing for diagnosis of lens performance has to be established to verify the performance and to provide the suggesting for further improvement of the lens, before the lens has been build and integrated with light source. The measurement of modulation transfer function of critical dimension (CD) is main performance parameter to evaluate the line width of semiconductor platform fabricating ability for the smallest line width of producing tiny integrated circuits. Although the modulation transfer function (MTF) has been popularly used to evaluation the optical system, but in lithography, the contrast of each line-pair is in one dimension or two dimensions, analytically, while the lens stand along in the test bench integrated with the light source coherent or near coherent for the small dimension near the optical diffraction limit, the MTF is not only contributed by the lens, also by illumination of platform. In the study, the partial coherence modulation transfer function (PCMTF) for testing a lithography lens is suggested by measuring MTF in the high spatial frequency of in situ lithography lens, blended with the illumination of partial and in coherent light source. PCMTF can be one of measurement to evaluate the imperfect lens of lithography lens for further improvement in lens performance.

Intraocular Lens Calcification; a Clinicopathologic Report

Directory of Open Access Journals (Sweden)

Mozhgan Rezaei-Kanavi

2009-04-01

Full Text Available

PURPOSE: To describe the clinical and pathological features of a case of hydrogel intraocular lens (IOL calcification. CASE REPORT: A 48-year-old man underwent explantation of a single-piece hydrophilic acrylic intraocular lens in his left eye because of decreased visual acuity and milky white opalescence of the IOL. The opacified lens was exchanged uneventfully with a hydrophobic acrylic IOL. Gross examination of the explanted IOL disclosed opacification of the optic and haptics. Full-thickness sections of the lens optic were stained with hematoxylin and eosin (H&E, von Kossa and Gram Tworts'. Microscopic examination of the sections revealed fine and diffuse basophilic granular deposits of variable size within the lens optic parallel to the lens curvature but separated from the surface by a moderately clear zone. The deposits were of high calcium content as evident by dark brown staining with von Kossa. Gram Tworts' staining disclosed no microorganisms. CONCLUSION: This report further contributes to the existing literature on hydrogel IOL calcification.

Contact lens rehabilitation following repaired corneal perforations

Science.gov (United States)

Titiyal, Jeewan S; Sinha, Rajesh; Sharma, Namrata; Sreenivas, V; Vajpayee, Rasik B

2006-01-01

Background Visual outcome following repair of post-traumatic corneal perforation may not be optimal due to presence of irregular keratometric astigmatism. We performed a study to evaluate and compare rigid gas permeable contact lens and spectacles in visual rehabilitation following perforating corneal injuries. Method Eyes that had undergone repair for corneal perforating injuries with or without lens aspiration were fitted rigid gas permeable contact lenses. The fitting pattern and the improvement in visual acuity by contact lens over spectacle correction were noted. Results Forty eyes of 40 patients that had undergone surgical repair of posttraumatic corneal perforations were fitted rigid gas permeable contact lenses for visual rehabilitation. Twenty-four eyes (60%) required aphakic contact lenses. The best corrected visual acuity (BCVA) of ≥ 6/18 in the snellen's acuity chart was seen in 10 (25%) eyes with spectacle correction and 37 (92.5%) eyes with the use of contact lens (p < 0.001). The best-corrected visual acuity with spectacles was 0.20 ± 0.13 while the same with contact lens was 0.58 ± 0.26. All the patients showed an improvement of ≥ 2 lines over spectacles in the snellen's acuity chart with contact lens. Conclusion Rigid gas permeable contact lenses are better means of rehabilitation in eyes that have an irregular cornea due to scars caused by perforating corneal injuries. PMID:16536877

Effect of contact lens use on Computer Vision Syndrome.

Science.gov (United States)

Tauste, Ana; Ronda, Elena; Molina, María-José; Seguí, Mar

2016-03-01

To analyse the relationship between Computer Vision Syndrome (CVS) in computer workers and contact lens use, according to lens materials. Cross-sectional study. The study included 426 civil-service office workers, of whom 22% were contact lens wearers. Workers completed the Computer Vision Syndrome Questionnaire (CVS-Q) and provided information on their contact lenses and exposure to video display terminals (VDT) at work. CVS was defined as a CVS-Q score of 6 or more. The covariates were age and sex. Logistic regression was used to calculate the association (crude and adjusted for age and sex) between CVS and individual and work-related factors, and between CVS and contact lens type. Contact lens wearers are more likely to suffer CVS than non-lens wearers, with a prevalence of 65% vs 50%. Workers who wear contact lenses and are exposed to the computer for more than 6 h day(-1) are more likely to suffer CVS than non-lens wearers working at the computer for the same amount of time (aOR = 4.85; 95% CI, 1.25-18.80; p = 0.02). Regular contact lens use increases CVS after 6 h of computer work. © 2016 The Authors Ophthalmic & Physiological Optics © 2016 The College of Optometrists.

The effect of compliance on contact lens case contamination.

Science.gov (United States)

Tilia, Daniel; Lazon de la Jara, Percy; Zhu, Hua; Naduvilath, Thomas J; Holden, Brien A

2014-03-01

To determine the efficacy of written instructions on contact lens case hygiene and to quantify the effect of noncompliance on contact lens case contamination. Data were retrospectively analyzed from 16 prospective, 3-month daily-wear studies during which six commercially available silicone hydrogel contact lenses and seven lens care solutions (LCS) were tested following a similar protocol. Verbal instructions regarding case hygiene (rinse case with LCS, not tap water) were given in nine studies, while the same instructions were given verbally and in written format in seven studies. A survey on contact lens, LCS, and lens case hygiene was completed at 1- and 3-month visits and compliance with case hygiene instructions was determined. Regular contact lens cases were used for 1 month and collected for microbial analysis at the 1- and 3-month visits. The rate of case contamination and the types of microbes contaminating cases were evaluated. Participants given verbal and written instructions were more likely to be compliant with case hygiene instructions than those just given verbal instructions (odds ratio [OR]: 2.19, p hygiene can be improved by effective communication of instructions. Contact lens wearers should be actively discouraged from rinsing contact lens cases with tap water because of the increased risk of GNB contamination.

Lens dislocation has a possible relationship with laser iridotomy

Directory of Open Access Journals (Sweden)

Mutoh T

2012-12-01

Full Text Available Tetsuya Mutoh,1,2 Kevin F Barrette,2 Yukihiro Matsumoto,1 Makoto Chikuda11Department of Ophthalmology, Dokkyo Medical University Koshigaya Hospital, Koshigaya City, Saitama, Japan; 2Department of Ophthalmology, Boston University School of Medicine, Boston, MA, USAAbstract: We report our recent experience of four eyes with spontaneous lens dislocation in four patients with no history of trauma or any systemic disease associated with zonular dialysis. Lens dislocation developed with 0.5 to 6 months following laser iridotomy. All patients were male and two eyes were complicated with acute primary angle closure glaucoma preoperatively. Case 1 showed bilateral lens dislocation, while cases 2 and 3 involved unilateral lens dislocation. Cases 2 and 3 showed lenses completely dislocated into the vitreous cavity. All cases needed lens removal and scleral fixation of intraocular lenses. Final visual acuity was 1.2 in all cases. We suspect that laser iridotomy may induce localized zonular dialysis that results in progressive zonular weakness, leading to lens dislocation.Keywords: lens dislocation, laser iridotomy, primary angle closure glaucoma

Surgical effect of traumatic lens dislocation with secondary glaucoma

Directory of Open Access Journals (Sweden)

Xiao-Dan Zhang

2014-10-01

Full Text Available AIM: To retrospectively evaluate the effect of lens extraction combined with vitrectomy to treat traumatic lens dislocation with secondary glaucoma.METHODS:Thirty-one eyes(31 casesof lens dislocation caused by blunt trauma with secondary glaucoma were treated respectively with cataract extraction combined with anterior vitrectomy, trabeculectomy and intraocular lens implantation. The visual acuity and pressure were observed 1wk, 1 and 3mo after operative. RESULTS:Thirty-one eyes were all complete the operation successfully, and 6 eyes were given combined trabeculectomy, 9 eyes were implanted anterior chamber intraocular lens implantation(IOLand 15 eyes were given posterior chamber suture fixation. Sixteen eyes were implanted in one-stage operation, while 8 eyes were implanted in two-stage operation. All intraocular pressure(IOPwere controlled to the normal level after operation and 23 eyes had visual acuity of more than 0.3.CONCLUSION:Lens extraction combined with vitrectomy is an effective method for treatment of lens dislocation with secondary glaucoma. In order to control the IOP and get well visual function, we should choose IOL implantation or trabeculectomy according to the patient's condition.

Lens transmission measurement for an absolute radiation thermometer

International Nuclear Information System (INIS)

Hao, X.; Yuan, Z.; Lu, X.

2013-01-01

The lens transmission for the National Institute of Metrology of China absolute radiation thermometer is measured by a hybrid method. The results of the lens transmission measurements are 99.002% and 86.792% for filter radiometers with center wavelengths 633 nm and 900 nm, respectively. These results, after correcting for diffraction factors and the size-of-source effect when the lens is incorporated within the radiometer, can be used for measurement of thermodynamic temperature. The expanded uncertainty of the lens transmission measurement system has been evaluated. It is 1.3×10 −3 at 633 nm and 900 nm, respectively

Chemical performance of multi-environment trials in lens (Lens culinaris M.).

Science.gov (United States)

Karadavut, Ufuk; Palta, Cetin

2010-01-15

Genotype-environment (GE) interaction has been a major effect to determine stable lens (Lens culinaris (Medik.) Merr.) cultivars for chemical composition in Turkey. Utilization of the lines depends on their agronomic traits and stability of the chemical composition in diverse environments. The objectives of this study were: (i) to evaluate the influence of year and location on the chemical composition of lens genotypes; and (ii) to determine which cultivar is the most stable. Genotypes were evaluated over 3 years (2005, 2006 and 2007) at four locations in Turkey. Effects of year had the largest impact on all protein contents. GE interaction was analyzed by using linear regression techniques. Stability was estimated using the Eberhart and Russell method. 'Kişlik Kirmizi51' was the most stable cultivar for grain yield. The highest protein was obtained from 'Kişlik Kirmizi51' (4.6%) across environments. According to stability analysis, 'Firat 87' had the most stable chemical composition. This genotype had a regression coefficient (b(i) = 1) around unity, and deviations from regression values (delta(ij) = 0) around zero. Chemical composition was affected by year in this study. Temperature might have an effect on protein, oil, carbohydrate, fibre and ash. Firat 87 could be recommended for favourable environments. Copyright (c) 2009 Society of Chemical Industry.

The Second Data Release of the Sloan Digital Sky Survey

CERN Document Server

Abazajian, Kevork; ̈ueros, Marcel A. Ag; Allam, Sahar S.; Anderson, KurtS. J.; Anderson, Scott F.; Annis, James; Bahcall, Neta A.; Baldry, Ivan K.; StevenBastian; Berlind, Andreas; Bernardi, Mariangela; Blanton, Michael R.; BochanskiJr., John J.; Boroski, William N.; Briggs, John W.; Brinkmann, J.; Brunner, Robert J.; ́ari, Tam ́asBudav; Carey, Larry N.; Carliles, Samuel; Castander, Francisco J.; Connolly, A. J.; Csabai, Istvan; Doi, Mamoru; Dong, Feng; Eisenstein, Daniel J.; Evans, Michael L.; Fan, Xiaohui; Finkbeiner, Douglas P.; Friedman, Scott D.; Frieman, Joshua A.; Fukugita, Masataka; Gal, RoyR.; Gillespie, Bruce; Glazebrook, Karl; Gray, Jim; Grebel, Eva K.; Gunn, James E.; Gurbani, Vijay K.; Hall, Patrick B.; Hamabe, Masaru; Harris, Frederick H.; C.Harris, Hugh; Harvanek, Michael; Heckman, Timothy M.; Hendry, John S.; Hennessy, Gregory S.; Hindsley, Robert B.; Hogan, Craig J.; Hogg, David W.; Holmgren, Donald J.; Ichikawa, Shin-ichi; Ichikawa, Takashi; Ivezic, Zeljko; Jester, Sebastian; Johnston, David E.; Jorgensen, AndersM.; Kent, Stephen M.; Kleinman, S. J.; Knapp, G. R.; Kniazev, Alexei Yu.; Kron, Richard G.; Krzesinski, Jurek; Kunszt, Peter Z.; Kuropatkin, Nickolai; Q.Lamb, Donald; Lampeitl, Hubert; Lee, Brian C.; Leger, R. French; Li, Nolan; Lin, Huan; Loh, Yeong-Shang; Long, Daniel C.; Loveday, Jon; Lupton, Robert H.; Malik, Tanu; BruceMargon; Matsubara, Takahiko; McGehee, Peregrine M.; McKay, Timothy A.; AveryMeiksin; Munn, Jeffrey A.; Nakajima, Reiko; Nash, Thomas; Neilsen, Eric H. Jr.; JoNewberg, Heidi; Newman, Peter R.; Nichol, Robert C.; Nicinski, Tom; Nieto-Santisteban, Maria; Nitta, Atsuko; Okamura, Sadanori; O'Mullane, William; Ostriker, Jeremiah P.; Owen, Russell; Padmanabhan, Nikhil; Peoples, John; Pier, Jeffrey R.; Pope, Adrian C.; Quinn, Thomas R.; Richards, Gordon T.; Richmond, Michael W.; Rix, Hans-Walter; Rockosi, Constance M.; Schlegel, David J.; Schneider, Donald P.; Scranton, Ryan; Sekiguchi, Maki; Seljak, Uros; Sergey, Gary; Sesar, Branimir; Sheldon, Erin; Shimasaku, Kazu; Siegmund, Walter A.; Silvestri, Nicole M.; Smith, J. Allyn; ́c, Vernesa Smolči; Snedden, Stephanie A.; AlbertStebbins; Stoughton, Chris; Strauss, Michael A.; SubbaRao, Mark; Szalay, Alexander S.; Szapudi, Istv ́an; Szkody, Paula; Szokoly, Gyula P.; Tegmark, Max; Teodoro, Luis; Thakar, AniruddhaR.; Tremonti, Christy; Tucker, Douglas L.; Uomoto, Alan; Vanden Berk, Daniel E.; Vandenberg, Jan; Vogeley, Michael S.; Voges, Wolfgang; Vogt, Nicole P.; M.Walkowicz, Lucianne; Wang, Shu-i; Weinberg, David H.; West, Andrew A.; White, Simon D.M.; Wilhite, BrianC.; Xu, Yongzhong; Yanny, Brian; Yasuda, Naoki; Yip, Ching-Wa; Yocum, D. R.; York, Donald G.; Zehavi, Idit; Zibetti, Stefano; Zucker, Daniel B.

2004-01-01

The Sloan Digital Sky Survey has validated and made publicly available its Second Data Release. This data release consists of 3324 square degrees of five-band (u g r i z) imaging data with photometry for over 88 million unique objects, 367,360 spectra of galaxies, quasars, stars and calibrating blank sky patches selected over 2627 degrees of this area, and tables of measured parameters from these data. The imaging data reach a depth of r ~ 22.2 (95% completeness limit for point sources) and are photometrically and astrometrically calibrated to 2% rms and 100 milli-arcsec rms per coordinate, respectively. The imaging data have all been processed through a new version of the SDSS imaging pipeline, in which the most important improvement since the last data release is fixing an error in the model fits to each object. The result is that model magnitudes are now a good proxy for point spread function (PSF) magnitudes for point sources, and Petrosian magnitudes for extended sources. The spectroscopy extends from 38...

Ensemble Properties of Comets in the Sloan Digital Sky Survey

Energy Technology Data Exchange (ETDEWEB)

Solontoi, Michael; /Adler Planetarium, Chicago; Ivezic, Zeljko; /Washington U., Seattle, Astron. Dept.; Juric, Mario; /Harvard Coll. Observ.; Becker, Andrew C.; /Washington U., Seattle, Astron. Dept.; Jones, Lynne; /Washington U., Seattle, Astron. Dept.; West, Andrew A.; /Boston U.; Kent, Steve; /Fermilab; Lupton, Robert H.; /Princeton U. Observ.; Claire, Mark; /Washington U., Seattle, Astron. Dept.; Knapp, Gillian R.; /Princeton U. Observ.; Quinn, Tom; /Washington U., Seattle, Astron. Dept. /Princeton U. Observ.

2012-02-01

We present the ensemble properties of 31 comets (27 resolved and 4 unresolved) observed by the Sloan Digital Sky Survey (SDSS). This sample of comets represents about 1 comet per 10 million SDSS photometric objects. Five-band (u, g, r, i, z) photometry is used to determine the comets colors, sizes, surface brightness profiles, and rates of dust production in terms of the Afp formalism. We find that the cumulative luminosity function for the Jupiter Family Comets in our sample is well fit by a power law of the form N(

IMPROVED BACKGROUND SUBTRACTION FOR THE SLOAN DIGITAL SKY SURVEY IMAGES

International Nuclear Information System (INIS)

Blanton, Michael R.; Kazin, Eyal; Muna, Demitri; Weaver, Benjamin A.; Price-Whelan, Adrian

2011-01-01

We describe a procedure for background subtracting Sloan Digital Sky Survey (SDSS) imaging that improves the resulting detection and photometry of large galaxies on the sky. Within each SDSS drift scan run, we mask out detected sources and then fit a smooth function to the variation of the sky background. This procedure has been applied to all SDSS-III Data Release 8 images, and the results are available as part of that data set. We have tested the effect of our background subtraction on the photometry of large galaxies by inserting fake galaxies into the raw pixels, reanalyzing the data, and measuring them after background subtraction. Our technique results in no size-dependent bias in galaxy fluxes up to half-light radii r 50 ∼ 100 arcsec; in contrast, for galaxies of that size the standard SDSS photometric catalog underestimates fluxes by about 1.5 mag. Our results represent a substantial improvement over the standard SDSS catalog results and should form the basis of any analysis of nearby galaxies using the SDSS imaging data.

Accelerating convergence in automatic lens design

International Nuclear Information System (INIS)

Brixner, B.

1981-01-01

Among the various factors that slow lens optimization-insufficient performance targets, the absence of a unique solution, false local minima, a poorly scaled change vector, failure to find the optimum damping number, and failure to equalize the parameter gradients-the importance of parameter gradient equalization has been insufficiently recognized. Gradients can be approximately equalized by scaling the lens to a suitable size while it is being optimized. For best results, the size of the damping number should also be optimized during each iteration. If these two procedures are followed, scaling the change vector is usually not crucial. To illustrate the importance of parameter equalization, a lens optimization is analyzed

Nuclear magnetic resonance studies of lens transparency

International Nuclear Information System (INIS)

Beaulieu, C.F.

1989-01-01

Transparency of normal lens cytoplasm and loss of transparency in cataract were studied by nuclear magnetic resonance (NMR) methods. Phosphorus ( 31 P) NMR spectroscopy was used to measure the 31 P constituents and pH of calf lens cortical and nuclear homogenates and intact lenses as a function of time after lens enucleation and in opacification produced by calcium. Transparency was measured with laser spectroscopy. Despite complete loss of adenosine triphosphate (ATP) within 18 hrs of enucleation, the homogenates and lenses remained 100% transparent. Additions of calcium to ATP-depleted cortical homogenates produced opacification as well as concentration-dependent changes in inorganic phosphate, sugar phosphates, glycerol phosphorylcholine and pH. 1 H relaxation measurements of lens water at 200 MHz proton Larmor frequency studied temperature-dependent phase separation of lens nuclear homogenates. Preliminary measurements of T 1 and T 2 with non-equilibrium temperature changes showed a change in the slope of the temperature dependence of T 1 and T 2 at the phase separation temperature. Subsequent studies with equilibrium temperature changes showed no effect of phase separation on T 1 or T 2 , consistent with the phase separation being a low-energy process. 1 H nuclear magnetic relaxation dispersion (NMRD) studies (measurements of the magnetic field dependence of the water proton 1/T 1 relaxation rates) were performed on (1) calf lens nuclear and cortical homogenates (2) chicken lens homogenates, (3) native and heat-denatured egg white and (4) pure proteins including bovine γ-II crystallin bovine serum albumin (BSA) and myoglobin. The NMRD profiles of all samples exhibited decreases in 1/T 1 with increasing magnetic field

Lubricant effects on low Dk and silicone hydrogel lens comfort.

Science.gov (United States)

Ozkan, Jerome; Papas, Eric

2008-08-01

To investigate the influence of three lubricants of varying viscosity, on postinsertion and 6 h comfort with contact lens wear. Comfort and associated symptoms of dryness were assessed in 15 experienced contact lens wearers. Subjects wore a low Dk lens in one eye and a silicone hydrogel in the other and participated in four separate trials involving no lubricant (baseline), saline, and two commercially available lubricants of differing viscosity. The in-eye lubricants were used immediately following lens insertion and every 2 h postinsertion for a 6 h wear period. Postlens insertion comfort was significantly better for both lens types when lubricants or saline were used compared with no lubricant use. After 6 h lens wear, comfort was influenced by lens type and not by in-eye lubricant or saline use. Also after 6 h lens wear, less dryness sensation was reported for silicone hydrogel lenses when using lubricants but not saline. Although lubricant use does help reduce dryness symptoms with silicone hydrogel lens wear, there appears to be minimal longer-term benefit to comfort. Furthermore, increased lubricant viscosity did not lead to improved longer-term comfort.

Composite modified Luneburg model of human eye lens.

Science.gov (United States)

Gómez-Correa, J E; Balderas-Mata, S E; Pierscionek, B K; Chávez-Cerda, S

2015-09-01

A new lens model based on the gradient-index Luneburg lens and composed of two oblate half spheroids of different curvatures is presented. The spherically symmetric Luneburg lens is modified to create continuous isoindicial contours and to incorporate curvatures that are similar to those found in a human lens. The imaging capabilities of the model and the changes in the gradient index profile are tested for five object distances, for a fixed geometry and for a fixed image distance. The central refractive index decreases with decreasing object distance. This indicates that in order to focus at the same image distance as is required in the eye, a decrease in refractive power is needed for rays from closer objects that meet the lens surface at steeper angles compared to rays from more distant objects. This ensures a highly focused image with no spherical aberration.

Focusing properties of a square electrostatic rainbow lens

International Nuclear Information System (INIS)

Telečki, I.; Petrović, S.; Beličev, P.; Rađenović, B.; Balvanović, R.; Bojović, B.; Nešković, N.

2012-01-01

This paper is devoted to the focusing properties of a square electrostatic rainbow lens, which is a novel ion beam optical element. We consider the transmission of parallel and non-parallel proton beams of the initial kinetic energy of 10 keV through this lens. The potential of the electrodes of the lens is chosen to be 2 kV. The electrostatic potential and components of the electric field in the region of the lens are calculated using a three-dimensional finite element computer code. We investigate the spatial and angular distributions of protons propagating through the lens and in the drift space after it. It is confirmed that the evolutions of these distributions are determined by the evolutions of the corresponding rainbow lines, generated using the theory of crystal rainbows. The beam is separated into two components. One beam component, appearing as a beam core, is generated dominantly by the focused protons. Its boundary line in the transverse position plane can be very well approximated by a hypotrochoid. The other beam component is generated dominantly by the defocused protons. We present the focusing coefficient of the lens, the confining coefficients of the lens for the focused and defocused protons, the density of the beam core, the vertical or horizontal emittance of the beam core, and the brightness of the beam core.

A Class I UV-blocking (senofilcon A) soft contact lens prevents UVA-induced yellow fluorescence and NADH loss in the rabbit lens nucleus in vivo.

Science.gov (United States)

Giblin, Frank J; Lin, Li-Ren; Simpanya, Mukoma F; Leverenz, Victor R; Fick, Catherine E

2012-09-01

It is known that fluorescence, much of it caused by UVA light excitation, increases in the aging human lens, resulting in loss of sharp vision. This study used an in vivo animal model to investigate UVA-excited fluorescence in the rabbit lens, which contains a high level of the UVA chromophore NADH, existing both free and bound to λ-crystallin. Also, the ability of a Class I (senofilcon A) soft contact lens to protect against UVA-induced effects on the rabbit lens was tested. Rabbit eyes were irradiated with UVA light in vivo (100 mW/cm(2) on the cornea) for 1 h using monochromatic 365 nm light. Irradiation was conducted in the presence of either a senofilcon A contact lens, a minimally UV-absorbing lotrafilcon A contact lens, or no contact lens at all. Eyes irradiated without a contact lens showed blue 365 nm-excited fluorescence initially, but this changed to intense yellow fluorescence after 1 h. Isolated, previously irradiated lenses exhibited yellow fluorescence originating from the lens nucleus when viewed under 365 nm light, but showed normal blue fluorescence arising from the cortex. Previously irradiated lenses also exhibited a faint yellow color when observed under visible light. The senofilcon A contact lens protected completely against the UVA-induced effects on fluorescence and lens yellowing, whereas the lotrafilcon A lens showed no protection. The UVA-exposure also produced a 53% loss of total NADH (free plus bound) in the lens nucleus, with only a 13% drop in the anterior cortex. NADH loss in the nucleus was completely prevented with use of a senofilcon A contact lens, but no significant protection was observed with a lotrafilcon A lens. Overall, the senofilcon A lens provided an average of 67% protection against UVA-induced loss of four pyridine nucleotides in four different regions of the lens. HPLC analysis with fluorescence detection indicated a nearly six-fold increase in 365 nm-excited yellow fluorescence arising from lens nuclear �

Simultaneous distribution of AC and DC power

Science.gov (United States)

Polese, Luigi Gentile

2015-09-15

A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

Lens Model

DEFF Research Database (Denmark)

Nash, Ulrik William

2014-01-01

Firms consist of people who make decisions to achieve goals. How do these people develop the expectations which underpin the choices they make? The lens model provides one answer to this question. It was developed by cognitive psychologist Egon Brunswik (1952) to illustrate his theory of probabil...

TESS Lens-Bezel Assembly Modal Testing

Science.gov (United States)

Dilworth, Brandon J.; Karlicek, Alexandra

2017-01-01

The Transiting Exoplanet Survey Satellite (TESS) program, led by the Kavli Institute for Astrophysics and Space Research at the Massachusetts Institute of Technology (MIT) will be the first-ever spaceborne all-sky transit survey. MIT Lincoln Laboratory is responsible for the cameras, including the lens assemblies, detector assemblies, lens hoods, and camera mounts. TESS is scheduled to be launched in August of 2017 with the primary goal to detect small planets with bright host starts in the solar neighborhood, so that detailed characterizations of the planets and their atmospheres can be performed. The TESS payload consists of four identical cameras and a data handling unit. Each camera consists of a lens assembly with seven optical elements and a detector assembly with four charge-coupled devices (CCDs) including their associated electronics. The optical prescription requires that several of the lenses are in close proximity to a neighboring element. A finite element model (FEM) was developed to estimate the relative deflections between each lens-bezel assembly under launch loads to predict that there are adequate clearances preventing the lenses from making contact. Modal tests using non-contact response measurements were conducted to experimentally estimate the modal parameters of the lens-bezel assembly, and used to validate the initial FEM assumptions. Key Words Non-contact measurements, modal analysis, model validation

Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

Directory of Open Access Journals (Sweden)

LISTYA UTAMI KARMAWAN

2009-03-01

Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

Surface Fourier-transform lens using a metasurface

International Nuclear Information System (INIS)

Li, Yun Bo; Cai, Ben Geng; Cheng, Qiang; Cui, Tie Jun

2015-01-01

We propose a surface (or 2D) Fourier-transform lens using a gradient refractive index (GRIN) metasurface in the microwave band, which is composed of sub-wavelength quasi-periodical metallic patches on a grounded dielectric substrate. Such a metasurface supports the transverse magnetic (TM) modes of surface waves. To gradually change the size of textures, we obtain different surface refractive indices, which can be tailored to fit the required refractive-index profile of a surface Fourier-transform lens. According to the theory of spatial Fourier transformation, we make use of the proposed lens to realize surface plane-wave scanning under different feeding locations. The simulation and experimental results jointly confirm the validity of the surface Fourier-transform lens. The proposed method can also be extended to the terahertz frequency. (paper)

Universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2000-01-01

The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

APASS Landolt-Sloan BVgri photometry of Rave stars. I. Data, effective temperatures, and reddenings

Energy Technology Data Exchange (ETDEWEB)

Munari, U.; Siviero, A. [INAF Osservatorio Astronomico di Padova, I-36012 Asiago (VI) (Italy); Henden, A. [AAVSO, Cambridge, MA (United States); Frigo, A. [ANS Collaboration, c/o Astronomical Observatory, Padova (Italy); Zwitter, T. [Faculty of Mathematics and Physics, University of Ljubljana, 1000 Ljubljana (Slovenia); Bienaymé, O.; Siebert, A. [Observatoire Astronomique, Université de Strasbourg, CNRS, 11 rue de l' université F-67000 Strasbourg (France); Bland-Hawthorn, J. [Sydney Institute for Astronomy, University of Sydney, NSW 2006 (Australia); Boeche, C.; Grebel, E. K. [Astronomisches Rechen-Institut, Zentrum für Astronomie der Universität Heidelberg, Mönchhofstr. 12-14, D-69120 Heidelberg (Germany); Freeman, K. C. [Mount Stromlo Observatory, RSAA, Australian National University, Weston Creek, Canberra, ACT 2611 (Australia); Gibson, B. K. [Jeremiah Horrocks Institute, University of Central Lancashire, Preston, PR1 2HE (United Kingdom); Gilmore, G.; Kordopatis, G. [Institute of Astronomy, Cambridge University, Madingley Road, Cambridge CB3 0HA (United Kingdom); Helmi, A. [Kapteyn Astronomical Institute, University of Groningen, PO Box 800, 9700 AV Groningen (Netherlands); Levine, S. E. [Lowell Observatory, Flagstaff, AZ (United States); Navarro, J. F. [Department of Physics and Astronomy, University of Victoria, Victoria, BC V8P 5C2 (Canada); Parker, Q. A.; Reid, W. [Department of Physics and Astronomy, Macquarie University, NSW 2109 (Australia); Seabroke, G. M. [Mullard Space Science Laboratory, University College London, Holmbury St. Mary, Dorking, RH5 6NT (United Kingdom); and others

2014-11-01

We provide AAVSO Photometric All-Sky Survey (APASS) photometry in the Landolt BV and Sloan g'r'i' bands for all 425,743 stars included in the fourth RAVE Data Release. The internal accuracy of the APASS photometry of RAVE stars, expressed as the error of the mean of data obtained and separately calibrated over a median of four distinct observing epochs and distributed between 2009 and 2013, is 0.013, 0.012, 0.012, 0.014, and 0.021 mag for the B, V, g', r', and i' bands, respectively. The equally high external accuracy of APASS photometry has been verified on secondary Landolt and Sloan photometric standard stars not involved in the APASS calibration process and on a large body of literature data on field and cluster stars, confirming the absence of offsets and trends. Compared with the Carlsberg Meridian Catalog (CMC-15), APASS astrometry of RAVE stars is accurate to a median value of 0.098 arcsec. Brightness distribution functions for the RAVE stars have been derived in all bands. APASS photometry of RAVE stars, augmented by 2MASS JHK infrared data, has been χ{sup 2} fitted to a densely populated synthetic photometric library designed to widely explore temperature, surface gravity, metallicity, and reddening. Resulting T {sub eff} and E {sub B–V}, computed over a range of options, are provided and discussed, and will be kept updated in response to future APASS and RAVE data releases. In the process, we find that the reddening caused by a homogeneous slab of dust, extending for 140 pc on either side of the Galactic plane and responsible for E{sub B−V}{sup poles} = 0.036 ± 0.002 at the Galactic poles, is a suitable approximation of the actual reddening encountered at Galactic latitudes |b| ≥ 25°.

APASS Landolt-Sloan BVgri Photometry of RAVE Stars. I. Data, Effective Temperatures, and Reddenings

Science.gov (United States)

Munari, U.; Henden, A.; Frigo, A.; Zwitter, T.; Bienaymé, O.; Bland-Hawthorn, J.; Boeche, C.; Freeman, K. C.; Gibson, B. K.; Gilmore, G.; Grebel, E. K.; Helmi, A.; Kordopatis, G.; Levine, S. E.; Navarro, J. F.; Parker, Q. A.; Reid, W.; Seabroke, G. M.; Siebert, A.; Siviero, A.; Smith, T. C.; Steinmetz, M.; Templeton, M.; Terrell, D.; Welch, D. L.; Williams, M.; Wyse, R. F. G.

2014-11-01

We provide AAVSO Photometric All-Sky Survey (APASS) photometry in the Landolt BV and Sloan g'r'i' bands for all 425,743 stars included in the fourth RAVE Data Release. The internal accuracy of the APASS photometry of RAVE stars, expressed as the error of the mean of data obtained and separately calibrated over a median of four distinct observing epochs and distributed between 2009 and 2013, is 0.013, 0.012, 0.012, 0.014, and 0.021 mag for the B, V, g', r', and i' bands, respectively. The equally high external accuracy of APASS photometry has been verified on secondary Landolt and Sloan photometric standard stars not involved in the APASS calibration process and on a large body of literature data on field and cluster stars, confirming the absence of offsets and trends. Compared with the Carlsberg Meridian Catalog (CMC-15), APASS astrometry of RAVE stars is accurate to a median value of 0.098 arcsec. Brightness distribution functions for the RAVE stars have been derived in all bands. APASS photometry of RAVE stars, augmented by 2MASS JHK infrared data, has been χ2 fitted to a densely populated synthetic photometric library designed to widely explore temperature, surface gravity, metallicity, and reddening. Resulting T eff and E B - V , computed over a range of options, are provided and discussed, and will be kept updated in response to future APASS and RAVE data releases. In the process, we find that the reddening caused by a homogeneous slab of dust, extending for 140 pc on either side of the Galactic plane and responsible for EpolesB-V = 0.036 ± 0.002 at the Galactic poles, is a suitable approximation of the actual reddening encountered at Galactic latitudes |b| >= 25°.

The Correlation between Daily Lens Wear Duration and Dry Eye Syndrome.

Science.gov (United States)

Lubis, Rodiah Rahmawaty; Gultom, Monica Tumiar Hanna

2018-05-20

To analyze the correlation between the daily lens wear duration and dry eye syndrome. This study was an analytic cross sectional study using consecutive sampling conducted among the students in Economy and Bussiness Faculty and Faculty of Humanities in University of Sumatera Utara aged between 17 to 23 that wore contact lens continously for at least a year and 5 days a week. The symptoms were assessed using Contact Lens Dry Eye Questionnaire-8 (CLDEQ-8) and interview about their contact lens comfort; eye drops usage, contact lens washing habit, daily circumstances, places to buy contact lens and personal experince in wearing contact lens. The questionnaire was completed by 53 students. All of them were female and wore softlens wearers. The mean duration of daily wear was 8.19 ± 2.20 hours. The most common symptom experienced was dry eye and the least symptom experienced was removing lens. The most frequent symptom experienced was closing eyes and the least frequent symptom experienced was removing lenses. This study used Exact Test as analysis statistic method. The result was p > 0.05 which means there is no correlation between daily lens wear duration and dry eye syndrome. This study showed that dry eye syndrome was not correlated with daily lens wear duration, but affected by many factors such as contact lens, lens care solution, eye drops usage and environment.

Measuring and correcting aberrations of a cathode objective lens

International Nuclear Information System (INIS)

Tromp, R.M.

2011-01-01

In this paper I discuss several theoretical and practical aspects related to measuring and correcting the chromatic and spherical aberrations of a cathode objective lens as used in Low Energy Electron Microscopy (LEEM) and Photo Electron Emission Microscopy (PEEM) experiments. Special attention is paid to the various components of the cathode objective lens as they contribute to chromatic and spherical aberrations, and affect practical methods for aberration correction. This analysis has enabled us to correct a LEEM instrument for the spherical and chromatic aberrations of the objective lens. -- Research highlights: → Presents a comprehensive theory of the relation between chromatic aberration and lens current in a cathode objective lens. → Presents practical methods for measuring both spherical and chromatic aberrations of a cathode objective lens. → Presents measurements of these aberrations in good agreement with theory. → Presents practical methods for measuring and correcting these aberrations with an electron mirror.

Gravitational-Like Lens Based on Graphene Ripple.

Science.gov (United States)

Liu, Daqing; Chen, Shuyue; Ma, Ning; Zhao, Xiang; Xu, Zhuo

2015-10-01

We conducted a semiclassical study on carrier movement in curved graphene. A previous attempt was made to show that curved graphene is a readily available and cheap laboratory material used to study general relativity effects, especially if the electron energies satisfy 4μeV ≪ |E| ≪ 3eV. Furthermore, a gravitational-like lens can be constructed based on a special graphene ripple; this lens has neither chromatic nor cometic aberration. One can design an ideal electron lens using a graphene ripple.

Gabor lens focusing of a negative ion beam

International Nuclear Information System (INIS)

Palkovic, J.A.; Mills, F.E.; Schmidt, C.; Young, D.E.

1989-05-01

Gabor or plasma lenses have previously been used to focus intense beams of positive ions at energies from 10 keV to 5 MeV. It is the large electrostatic field of the non-neutral plasma in the Gabor lens which is responsible for the focusing. Focusing an ion beam with a given sign of charge in a Gabor lens requires a non-neutral plasma with the opposite sign of charge as the beam. A Gabor lens constructed at Fermilab has been used to focus a 30 keV proton beam with good optical quality. We discuss studies of the action of a Gabor lens on a beam of negative ions. A Gabor lens has been considered for matching an H/sup /minus// beam into an RFQ in the redesign of the low energy section of the Fermilab linac. 9 refs., 3 figs., 1 tab

Daily disposable contact lens prescribing around the world.

Science.gov (United States)

Efron, Nathan; Morgan, Philip B; Helland, Magne; Itoi, Motozumi; Jones, Deborah; Nichols, Jason J; van der Worp, Eef; Woods, Craig A

2010-10-01

Daily disposable contact lenses were introduced into the market 16 years ago. Data that we have gathered from annual contact lens fitting surveys conducted in Australia, Canada, Japan, The Netherlands, Norway, the UK and the USA between 2000 and 2008 indicates an overall increase in daily disposable lens fitting during this period. Daily disposable lenses are especially popular in Japan, Norway and the UK. There is a trend for these lenses to be fitted on a part-time basis. Males are over-represented in daily disposable lens fitting-a trend that is especially evident in Canada. Daily disposable lens wearers are about two years younger than wearers of reusable lenses in Japan and The Netherlands. The convenience and health benefits of daily disposable lenses are expected to fuel continued growth in this sector. Copyright (c) 2010 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)

Science.gov (United States)

Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.

2012-01-01

The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.

A novel lens epithelium gene, LEP503, is highly conserved in different vertebrate species and is developmentally regulated in postnatal rat lens.

Science.gov (United States)

Wen, Y; Sachs, G; Athmann, C

2000-02-01

The development of the lens is dependent on the proliferation of lens epithelial cells and their differentiation into fiber cells near the lens bow/equator. Identification of genes specifically expressed in the lens epithelial cells and their functions may provide insight into molecular events that regulate the processes of lens epithelial cell differentiation. In this study, a novel lens epithelium gene product, LEP503, identified from rat by a subtractive cDNA cloning strategy was investigated in the genome organization, mRNA expression and protein localization. The genomic sequences for LEP503 isolated from rat, mouse and human span 1754 bp, 1694 bp and 1895 bp regions encompassing the 5'-flanking region, two exons, one intron and 3'-flanking region. All exon-intron junction sequences conform to the GT/AG rule. Both mouse and human LEP503 genes show very high identity (93% for mouse and 79% for human) to rat LEP503 gene in the exon 1 that contains an open reading frame coding for a protein of 61 amino acid residues with a leucine-rich domain. The deduced protein sequences also show high identity (91% between mouse and rat and 77% between human and rat). Western blot shows that LEP503 is present as a specific approximately 6.9 kDa band in the water-insoluble-urea-soluble fraction of lens cortex where lens epithelium is included. Immuno-staining shows that LEP503 is localized in the epithelial cells along the entire anterior surface of rat lens. Developmentally, LEP503 is expressed at a low level at newborn, and then the expression level increases by about ten-fold around postnatal day 14 and remains at this high level for about 25 days before it drops back to the low level by postnatal day 84. These data suggest that the LEP503 may be an important lens epithelial cell gene involving the processes of epithelial cell differentiation. Copyright 2000 Academic Press.

A lazy way to design infrared lens

Science.gov (United States)

Qiu, RongSheng; Wu, JianDong; Chen, LongJiang; Yu, Kun; Pang, HaoJun; Hu, BaiZhen

2017-08-01

We designed a compact middle-wave infrared (MWIR) lens with a large focal length ratio (about 1.5:1), used in the 3.7 to 4.8 μm range. The lens is consisted of a compact front group and a re-imaging group. Thanks to the compact front group configuration, it is possible to install a filter wheel mechanism in such a tight space. The total track length of the lens is about 50mm, which includes a 2mm thick protective window and a cold shield of 12mm. The full field of view of the lens is about 3.6°, and F number is less than 1.6, the image circle is about 4.6mm in diameter. The design performance of the lens reaches diffraction limitation, and doesn't change a lot during a temperature range of -40°C +60°C. This essay proposed a stepwise design method of infrared optical system guided by the qualitative approach. The method fully utilize the powerful global optimization ability, with a little effort to write code snippet in optical design software, frees optical engineer from tedious calculation of the original structure.

AcMNPV

African Journals Online (AJOL)

USER

2010-08-16

Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...

Modeling and reliability analysis of three phase z-source AC-AC converter

Directory of Open Access Journals (Sweden)

Prasad Hanuman

2017-12-01

Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

Contact Lens Related Corneal Ulcer

OpenAIRE

Loh, KY; Agarwal, P

2010-01-01

A corneal ulcer caused by infection is one of the major causes of blindness worldwide. One of the recent health concerns is the increasing incidence of corneal ulcers associated with contact lens user especially if the users fail to follow specific instruction in using their contact lenses. Risk factors associated with increased risk of contact lens related corneal ulcers are: overnight wear, long duration of continuous wear, lower socio-economic classes, smoking, dry eye and poor hygiene. Th...

Adaptive Lens Inspired by Bio-Visual Systems

National Research Council Canada - National Science Library

Lo, Yu-Hwa

2004-01-01

...: (a) We have identified and demonstrated the merits of PDMS elastomer for lens membranes. The PDMS-based fluidic lens process has been proven to be simple, controllable, and scalable to form lenses from 10 urn to several centimeters in diameter. (b...

Multiocular image sensor with on-chip beam-splitter and inner meta-micro-lens for single-main-lens stereo camera.

Science.gov (United States)

Koyama, Shinzo; Onozawa, Kazutoshi; Tanaka, Keisuke; Saito, Shigeru; Kourkouss, Sahim Mohamed; Kato, Yoshihisa

2016-08-08

We developed multiocular 1/3-inch 2.75-μm-pixel-size 2.1M- pixel image sensors by co-design of both on-chip beam-splitter and 100-nm-width 800-nm-depth patterned inner meta-micro-lens for single-main-lens stereo camera systems. A camera with the multiocular image sensor can capture horizontally one-dimensional light filed by both the on-chip beam-splitter horizontally dividing ray according to incident angle, and the inner meta-micro-lens collecting the divided ray into pixel with small optical loss. Cross-talks between adjacent light field images of a fabricated binocular image sensor and of a quad-ocular image sensor are as low as 6% and 7% respectively. With the selection of two images from one-dimensional light filed images, a selective baseline for stereo vision is realized to view close objects with single-main-lens. In addition, by adding multiple light field images with different ratios, baseline distance can be tuned within an aperture of a main lens. We suggest the electrically selective or tunable baseline stereo vision to reduce 3D fatigue of viewers.

Effects of x-irradiation on lens reducing systems. [Rabbits

Energy Technology Data Exchange (ETDEWEB)

Giblin, F.J.; Chakrapani, B.; Reddy, V.N.

1978-01-01

Studies have been made of the effects of x ray on various lens reducing systems including the levels of NADPH and glutathione (GSH), the activity of the hexose monophosphate shunt (HMS), and the activities of certain enzymes including glutathion reductase, glutathione peroxidase, and glucose-6-phosphate dehydrogenase (G-6-PD). It was found that during several weeks following x irradiation but prior to cataract formation there was very little change in the number of reduced -SH groups per unit weight of lens protein but that, with the appearance of cataract, there was a sudden loss of protein -SH groups. In contrast, the concentration of GSH in the x-rayed lens decreased throughout the experimental period. Similarly, the concentration of NADPH in the x-rayed lens was found to decrease significantly relative to controls one week prior to cataract formation and the ratio of NADPH to NADP/sup +/ in the lens shifted at this time period from a value greater than 1.0 in the control lens to less than 1.0 in the x-rayed lens. A corresponding decrease occurred in the activity of the HMS in x-rayed lenses as measured by culture in the presence of 1-/sup 14/C-labelled glucose. G-6-PD was partially inactivated in the x-rayed lens. Of the eight enzymes studied, G-6-PD appeared to be the most sensitive to x-irradiation. The data indicate that x-irradiation results in a steady decrease in the effectiveness of lens reducing systems and that, when these systems reach a critically low point, sudden oxidation of protein -SH groups and formation of high molecular weight protein aggregates may be initiated.

Active liquid-crystal deflector and lens with Fresnel structure

Science.gov (United States)

Shibuya, Giichi; Yamano, Shohei; Yoshida, Hiroyuki; Ozaki, Masanori

2017-02-01

A new type of tunable Fresnel deflector and lens composed of liquid crystal was developed. Combined structure of multiple interdigitated electrodes and the high-resistivity (HR) layer implements the saw-tooth distribution of electrical potential with only the planar surfaces of the transparent substrates. According to the numerical calculation and design, experimental devices were manufactured with the liquid crystal (LC) material sealed into the sandwiched flat glass plates of 0.7 mm thickness with rubbed alignment layers set to an anti-parallel configuration. Fabricated beam deflector with no moving parts shows the maximum tilt angle of +/-1.3 deg which can apply for optical image stabilizer (OIS) of micro camera. We also discussed and verified their lens characteristics to be extended more advanced applications. Transparent interdigitated electrodes were concentrically aligned on the lens aperture with the insulator gaps under their boundary area. The diameter of the lens aperture was 30 mm and the total number of Fresnel zone was 100. Phase retardation of the beam wavefront irradiated from the LC lens device can be evaluated by polarizing microscope images with a monochromatic filter. Radial positions of each observed fringe are plotted and fitted with 2nd degree polynomial approximation. The number of appeared fringes is over 600 in whole lens aperture area and the correlation coefficients of all approximations are over 0.993 that seems enough ideal optical wavefront. The obtained maximum lens powers from the approximations are about +/-4 m-1 which was satisfied both convex and concave lens characteristics; and their practical use for the tunable lens grade eyeglasses became more prospective.

A Model of the Effect of Lens Development on Refraction in Schoolchildren.

Science.gov (United States)

He, Ji C

2017-12-01

The study provides a new theory on the mechanism underlying myopia development, and it could be useful in clinical practice to control myopia development in schoolchildren. To model the effect of the crystalline lens on refractive development in schoolchildren. The Zemax 13 was used to calculate Zernike aberrations and refractions across 50° horizontal visual fields. Optical effects of the anterior chamber depth, lens thickness, and radii of curvature of the lens surfaces on refractions were modeled. Refractive changes induced by lens development in emmetropic and myopic eyes, based on a previous longitudinal study from literature, were calculated. A lens thickness reduction with an anterior chamber depth deepening caused a hyperopic shift over the visual fields and even more at the periphery. Opposite effects were found when the lens was thinned without any change of the anterior chamber depth. While a flattening of the anterior lens surface produced hyperopic refractions overall, a posterior lens flattening caused a myopic shift at the periphery, but a hyperopic shift of the central refraction. In the myopic eye, lens development induced refractive change toward more hyperopic over the visual fields and more at the periphery. Lens thinning and lens axial movement participate in peripheral refractive development in schoolchildren, and lens development with a deeper anterior chamber depth and a flatter lens surface in the myopic eye could generate extra hyperopia over visual fields. The myopic lens development could be due to a backward movement of the lens, driven by a backward growth of the ciliary process, which might be a causative factor of myopia development.

Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

Proportional-Integral-Resonant AC Current Controller

Directory of Open Access Journals (Sweden)

STOJIC, D.

2017-02-01

Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

Particle swarm optimization applied to automatic lens design

Science.gov (United States)

Qin, Hua

2011-06-01

This paper describes a novel application of Particle Swarm Optimization (PSO) technique to lens design. A mathematical model is constructed, and merit functions in an optical system are employed as fitness functions, which combined radiuses of curvature, thicknesses among lens surfaces and refractive indices regarding an optical system. By using this function, the aberration correction is carried out. A design example using PSO is given. Results show that PSO as optical design tools is practical and powerful, and this method is no longer dependent on the lens initial structure and can arbitrarily create search ranges of structural parameters of a lens system, which is an important step towards automatic design with artificial intelligence.

Transglutaminase involvement in UV-A damage to the eye lens

International Nuclear Information System (INIS)

Weinreb, Orly; Dovrat, A.

1996-01-01

Solar radiation is believed to be one of the major environmental factors involved in lens cataractogenesis. The purpose of the study was to investigate the mechanisms by which UV-A at 365 nm causes damage to the eye lens. Bovine lenses were placed in special culture cells for pre-incubation of 24 hr. The lenses were positioned so that the anterior surface faced the incident UV-A radiation source and were maintained in the cells during irradiation. After irradiation, lens optical quality was monitored throughout the culture period and lens epithelium, cortex and nuclear samples were taken for biochemical analysis. Transglutaminase activity in the lens was affected by the radiation. The activity of transglutaminase in lens epithelium cortex and nucleus increased as a result of the irradiation and then declined towards control levels during the culture period, as the lens recovered from the UV-A damage. Specific lens proteins αB and βB1 crystallins (the enzyme substrates) were analyzed by SDS polyacrylamid gel electrophoreses and immunoblotting with specific antibodies. Seventy-two hours after irradiation of 44.8 J cm -2 UV-A, αB crystallins were affected as was shown by the appearance of aggregation and degradation products. Some protein changes seem to be reversible. It appears that transglutaminase may be involved in the mechanism by which UV-A causes damage to the eye lens. (Author)

Integrated Lens Antennas for Multi-Pixel Receivers

Science.gov (United States)

Lee, Choonsup; Chattopadhyay, Goutam

2011-01-01

Future astrophysics and planetary experiments are expected to require large focal plane arrays with thousands of detectors. Feedhorns have excellent performance, but their mass, size, fabrication challenges, and expense become prohibitive for very large focal plane arrays. Most planar antenna designs produce broad beam patterns, and therefore require additional elements for efficient coupling to the telescope optics, such as substrate lenses or micromachined horns. An antenna array with integrated silicon microlenses that can be fabricated photolithographically effectively addresses these issues. This approach eliminates manual assembly of arrays of lenses and reduces assembly errors and tolerances. Moreover, an antenna array without metallic horns will reduce mass of any planetary instrument significantly. The design has a monolithic array of lens-coupled, leaky-wave antennas operating in the millimeter- and submillimeter-wave frequencies. Electromagnetic simulations show that the electromagnetic fields in such lens-coupled antennas are mostly confined in approximately 12 15 . This means that one needs to design a small-angle sector lens that is much easier to fabricate using standard lithographic techniques, instead of a full hyper-hemispherical lens. Moreover, this small-angle sector lens can be easily integrated with the antennas in an array for multi-pixel imager and receiver implementation. The leaky antenna is designed using double-slot irises and fed with TE10 waveguide mode. The lens implementation starts with a silicon substrate. Photoresist with appropriate thickness (optimized for the lens size) is spun on the substrate and then reflowed to get the desired lens structure. An antenna array integrated with individual lenses for higher directivity and excellent beam profile will go a long way in realizing multi-pixel arrays and imagers. This technology will enable a new generation of compact, low-mass, and highly efficient antenna arrays for use in multi

Mathematical Lens: How Much Can You Bench?

Science.gov (United States)

Bolognese, Chris A.

2013-01-01

"How Much Can You Bench?" appears in the "Mathematical Lens" section of "Mathematics Teacher." "Mathematical Lens" uses photographs as a springboard for mathematical inquiry and appears in every issue of "Mathematics Teacher." This month the mathematics behind the photograph includes finding areas…

Bacterial transmission from lens storage cases to contact lenses - Effects of lens care solutions and silver impregnation of cases

NARCIS (Netherlands)

Vermeltfoort, Pit B. J.; Hooymans, Johanna M. M.; Busscher, Henk J.; van der Mei, Henny C.

2008-01-01

The killing efficacies of multipurpose lens care solutions on planktonic and biofilm bacteria grown in polypropylene contact lens storage cases with and without silver impregnation and effects on bacterial transmission from storage cases to silicone hydrogel contact lenses were investigated. For

Piggyback intraocular lens implantation to correct pseudophakic refractive error after segmental multifocal intraocular lens implantation.

Science.gov (United States)

Venter, Jan A; Oberholster, Andre; Schallhorn, Steven C; Pelouskova, Martina

2014-04-01

To evaluate refractive and visual outcomes of secondary piggyback intraocular lens implantation in patients diagnosed as having residual ametropia following segmental multifocal lens implantation. Data of 80 pseudophakic eyes with ametropia that underwent Sulcoflex aspheric 653L intraocular lens implantation (Rayner Intraocular Lenses Ltd., East Sussex, United Kingdom) to correct residual refractive error were analyzed. All eyes previously had in-the-bag zonal refractive multifocal intraocular lens implantation (Lentis Mplus MF30, models LS-312 and LS-313; Oculentis GmbH, Berlin, Germany) and required residual refractive error correction. Outcome measurements included uncorrected distance visual acuity, corrected distance visual acuity, uncorrected near visual acuity, distance-corrected near visual acuity, manifest refraction, and complications. One-year data are presented in this study. The mean spherical equivalent ranged from -1.75 to +3.25 diopters (D) preoperatively (mean: +0.58 ± 1.15 D) and reduced to -1.25 to +0.50 D (mean: -0.14 ± 0.28 D; P < .01). Postoperatively, 93.8% of eyes were within ±0.50 D and 98.8% were within ±1.00 D of emmetropia. The mean uncorrected distance visual acuity improved significantly from 0.28 ± 0.16 to 0.01 ± 0.10 logMAR and 78.8% of eyes achieved 6/6 (Snellen 20/20) or better postoperatively. The mean uncorrected near visual acuity changed from 0.43 ± 0.28 to 0.19 ± 0.15 logMAR. There was no significant change in corrected distance visual acuity or distance-corrected near visual acuity. No serious intraoperative or postoperative complications requiring secondary intraocular lens removal occurred. Sulcoflex lenses proved to be a predictable and safe option for correcting residual refractive error in patients diagnosed as having pseudophakia. Copyright 2014, SLACK Incorporated.

Effects of Coupling Lens on Optical Refrigeration of Semiconductors

International Nuclear Information System (INIS)

Kai, Ding; Yi-Ping, Zeng

2008-01-01

Optical refrigeration of semiconductors is encountering efficiency difficulties caused by nonradiative recombination and luminescence trapping. A commonly used approach for enhancing luminescence efficiency of a semiconductor device is coupling a lens with the device. We quantitatively study the effects of a coupling lens on optical refrigeration based on rate equations and photon recycling, and calculated cooling efficiencies of different coupling mechanisms and of different lens materials. A GaAs/GaInP heterostructure coupled with a homo-epitaxial GaInP hemispherical lens is recommended. (condensed matter: electronic structure, electrical, magnetic, and optical properties)

Single lens laser beam shaper

Science.gov (United States)

Liu, Chuyu [Newport News, VA; Zhang, Shukui [Yorktown, VA

2011-10-04

A single lens bullet-shaped laser beam shaper capable of redistributing an arbitrary beam profile into any desired output profile comprising a unitary lens comprising: a convex front input surface defining a focal point and a flat output portion at the focal point; and b) a cylindrical core portion having a flat input surface coincident with the flat output portion of the first input portion at the focal point and a convex rear output surface remote from the convex front input surface.

Narrow absorption lines with two observations from the Sloan Digital Sky Survey

Science.gov (United States)

Chen, Zhi-Fu; Gu, Qiu-Sheng; Chen, Yan-Mei; Cao, Yue

2015-07-01

We assemble 3524 quasars from the Sloan Digital Sky Survey (SDSS) with repeated observations to search for variations of the narrow C IV λ λ 1548,1551 and Mg II λ λ 2796,2803 absorption doublets in spectral regions shortward of 7000 Å in the observed frame, which corresponds to time-scales of about 150-2643 d in the quasar rest frame. In these quasar spectra, we detect 3580 C IV absorption systems with zabs = 1.5188-3.5212 and 1809 Mg II absorption systems with zabs = 0.3948-1.7167. In term of the absorber velocity (β) distribution in the quasar rest frame, we find a substantial number of C IV absorbers with β Hacker et al. However, in our Mg II absorption sample, we find that neither shows variable absorption with confident levels of >4σ for λ2796 lines and >3σ for λ2803 lines.

Analytic models of plausible gravitational lens potentials

International Nuclear Information System (INIS)

Baltz, Edward A.; Marshall, Phil; Oguri, Masamune

2009-01-01

Gravitational lenses on galaxy scales are plausibly modelled as having ellipsoidal symmetry and a universal dark matter density profile, with a Sérsic profile to describe the distribution of baryonic matter. Predicting all lensing effects requires knowledge of the total lens potential: in this work we give analytic forms for that of the above hybrid model. Emphasising that complex lens potentials can be constructed from simpler components in linear combination, we provide a recipe for attaining elliptical symmetry in either projected mass or lens potential. We also provide analytic formulae for the lens potentials of Sérsic profiles for integer and half-integer index. We then present formulae describing the gravitational lensing effects due to smoothly-truncated universal density profiles in cold dark matter model. For our isolated haloes the density profile falls off as radius to the minus fifth or seventh power beyond the tidal radius, functional forms that allow all orders of lens potential derivatives to be calculated analytically, while ensuring a non-divergent total mass. We show how the observables predicted by this profile differ from that of the original infinite-mass NFW profile. Expressions for the gravitational flexion are highlighted. We show how decreasing the tidal radius allows stripped haloes to be modelled, providing a framework for a fuller investigation of dark matter substructure in galaxies and clusters. Finally we remark on the need for finite mass halo profiles when doing cosmological ray-tracing simulations, and the need for readily-calculable higher order derivatives of the lens potential when studying catastrophes in strong lenses

ANALYTICAL SOLUTIONS OF SINGULAR ISOTHERMAL QUADRUPOLE LENS

International Nuclear Information System (INIS)

Chu Zhe; Lin, W. P.; Yang Xiaofeng

2013-01-01

Using an analytical method, we study the singular isothermal quadrupole (SIQ) lens system, which is the simplest lens model that can produce four images. In this case, the radial mass distribution is in accord with the profile of the singular isothermal sphere lens, and the tangential distribution is given by adding a quadrupole on the monopole component. The basic properties of the SIQ lens have been studied in this Letter, including the deflection potential, deflection angle, magnification, critical curve, caustic, pseudo-caustic, and transition locus. Analytical solutions of the image positions and magnifications for the source on axes are derived. We find that naked cusps will appear when the relative intensity k of quadrupole to monopole is larger than 0.6. According to the magnification invariant theory of the SIQ lens, the sum of the signed magnifications of the four images should be equal to unity, as found by Dalal. However, if a source lies in the naked cusp, the summed magnification of the left three images is smaller than the invariant 1. With this simple lens system, we study the situations where a point source infinitely approaches a cusp or a fold. The sum of the magnifications of the cusp image triplet is usually not equal to 0, and it is usually positive for major cusps while negative for minor cusps. Similarly, the sum of magnifications of the fold image pair is usually not equal to 0 either. Nevertheless, the cusp and fold relations are still equal to 0 in that the sum values are divided by infinite absolute magnifications by definition.

Mass Models and Environment of the New Quadruply Lensed Quasar SDSS J1330+1810

Energy Technology Data Exchange (ETDEWEB)

Oguri, Masamune; Inada, Naohisa; Blackburne, Jeffrey A.; Shin, Min-Su; Kayo, Issha; Strauss, Michael A.; Schneider, Donald P.; York, Donald G.

2008-09-09

We present the discovery of a new quadruply lensed quasar. The lens system, SDSS J1330+1810 at z{sub s} = 1.393, was identified as a lens candidate from the spectroscopic sample of the Sloan Digital Sky Survey. Optical and near-infrared images clearly show four quasar images with a maximum image separation of 1.76 inch, as well as a bright lensing galaxy. We measure a redshift of the lensing galaxy of z{sub 1} = 0.373 from absorption features in the spectrum. We find a foreground group of galaxies at z = 0.31 centred {approx} 120 inch southwest of the lens system. Simple mass models fit the data quite well, including the flux ratios between images, although the lens galaxy appears to be {approx} 1 mag brighter than expected by the Faber-Jackson relation. Our mass modeling suggests that shear from nearby structure is affecting the lens potential.

Examining the Extent and Nature of Online Learning in American K-12 Education: The Research Initiatives of the Alfred P. Sloan Foundation

Science.gov (United States)

Picciano, Anthony G.; Seaman, Jeff; Shea, Peter; Swan, Karen

2012-01-01

In 1992, the Alfred P. Sloan Foundation began its "Anytime, Anyplace Learning Program", the purpose of which was to explore educational alternatives for people who wanted to pursue an education via Internet technology. Part of this grant activity was a research award to the Babson College Survey Research Group to examine online learning in…

CONTACT LENS RELATED CORNEAL ULCER

Directory of Open Access Journals (Sweden)

AGARWAL P

2010-01-01

Full Text Available A corneal ulcer caused by infection is one of the major causes of blindness worldwide. One of the recent health concerns is the increasing incidence of corneal ulcers associated with contact lens user especially if the users fail to follow specific instruction in using their contact lenses. Risk factors associated with increased risk of contact lens related corneal ulcers are:overnight wear, long duration of continuous wear, lower socio-economic classes, smoking, dry eye and poor hygiene. The presenting symptoms of contact lens related corneal ulcers include eye discomfort, foreign body sensation and lacrimation. More serious symptoms are redness (especially circum-corneal injection, severe pain, photophobia, eye discharge and blurring of vision. The diagnosis is established by a thorough slit lamp microscopic examination with fluorescein staining and corneal scraping for Gram stain and culture of the infective organism. Delay in diagnosing and treatment can cause permanent blindness, therefore an early referral to ophthalmologist and commencing of antimicrobial therapy can prevent visual loss.

Low ac loss geometries in YBCO coated conductors

International Nuclear Information System (INIS)

Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.

2007-01-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders

Low ac loss geometries in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)

2007-10-01

Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.

Combined 23-gauge transconjunctival vitrectomy and scleral fixation of intraocular lens without conjunctival dissection in managing lens complications.

Science.gov (United States)

Yeung, Ling; Wang, Nan-Kai; Wu, Wei-Chi; Chen, Kuan-Jen

2018-04-23

To evaluate the safety and efficacy of combined 23-gauge transconjunctival pars plana vitrectomy and scleral fixation of intraocular lens (IOL) without conjunctival dissection. A retrospective study in Chang Gung Memorial Hospital, Keelung and Taoyuan, Taiwan. Patients receiving combined 23-gauge transconjunctival pars plana vitrectomy and scleral fixation of IOL without conjunctival dissection were enrolled. The ocular findings, causes of lens complication, surgical procedures, type of IOL used, and complications were documented. We included 40 eyes from 39 patients (27 male, 12 female) with a mean age of 59.5 [standard deviation (±) 14.8] years old. The mean follow-up duration was 6.8 ± 5.4 months. The cause of lens complications was ocular trauma in 24 (60%) eyes, cataract surgery complications in 11 (28%) eyes, and spontaneous subluxation of crystalline lens in 5 (13%) eyes. The overall best corrected visual acuity (BCVA) (logMAR) improved from 1.359 ± 0.735 to 0.514 ± 0.582 (p IOL decentration was found in 3 (8%) eyes and 1 (3%) eye respectively. Combined 23-gauge transconjunctival vitrectomy and scleral fixation of IOL without conjunctival dissection is effective and safe in managing a wide variety of lens complications, with good postoperative comfort and visual recovery. Retrospective study, not applicable.

Tunable Focus Liquid Lens with Radial-Patterned Electrode

Directory of Open Access Journals (Sweden)

Miao Xu

2015-08-01

Full Text Available A dielectric liquid lens is prepared based on our previous work. By optimizing the device structure, the liquid lens presents a converging focus with good resolution and changes its focal length over a broad range with a low driving voltage. For a liquid lens with ~2.3 mm diameter in the relaxed state, it can resolve ~40 lp/mm. The resolution does not degrade during focus change. Its focal length can be varied from ~12 to ~5 mm when the applied voltage is changed from 0 to 28 Vrms. The response time of one cycle is ~2.5 s. Our liquid lens, with a low driving voltage for a large dynamic range, has potential applications in imaging, biometrics, optoelectronic, and lab-on-chip devices.

Development of a Laue lens for nuclear astrophysics

International Nuclear Information System (INIS)

Barriere, N.

2008-04-01

The Laue lenses we study focuses in the domain of 0.1-1 MeV thanks to Bragg diffraction in the volume of a large number of small crystal tiles. The focal length of a typical Laue lens system is of the order of 100 m. This requirement calls for two formation flying satellites maintaining lens and detector at the focal distance. The major breakthrough of Laue lenses is to decouple collecting area from detector area. Concentrating a signal from the large area of a Laue lens onto a small focal spot dramatically increases the signal over background ratio with respect to present technologies. Here is the reason for the long awaited leap in sensitivity. The objective of the present thesis was to improve the concept, finding viable technical solutions towards a future space mission. Two aspects of the lens development have been highlighted in this thesis: the first one is an analytical model of the lens that is used to calculate and improve the performance of a certain configuration, the second aspect concerns the search and the characterization of diffracting media of interest. The lens model developed relies on a fast semi-analytical simulation library, permitting to build several design- and optimisation-tools. For the configuration of a given lens, this code computes the resulting effective area and point spread function in a handful of seconds. The model helps finding lens configurations (mass, pack ratio of the lens rings,...) which are automatically refined to match with effective area and energy coverage constraints. These tools have been used to investigate various design aspects, such as the influence of focal length, size, mosaic spread, structure and materials of crystals, etc... The central evaluation criterion in the model is a figure of merit, based on the compactness of the focal spot and the intensity of the collected signal. The second part of this work addresses the actual search and characterization of crystals potentially interesting for Laue lenses

TU-E-201-02: Eye Lens Dosimetry From CT Perfusion Studies

Energy Technology Data Exchange (ETDEWEB)

Zhang, D. [Toshiba America Medical Systems (United States)

2015-06-15

Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

TU-E-201-00: Eye Lens Dosimetry for Patients and Staff

Energy Technology Data Exchange (ETDEWEB)

NONE

2015-06-15

Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

TU-E-201-02: Eye Lens Dosimetry From CT Perfusion Studies

International Nuclear Information System (INIS)

Zhang, D.

2015-01-01

Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

TU-E-201-00: Eye Lens Dosimetry for Patients and Staff

International Nuclear Information System (INIS)

2015-01-01

Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

Calpain expression and activity during lens fiber cell differentiation.

Science.gov (United States)

De Maria, Alicia; Shi, Yanrong; Kumar, Nalin M; Bassnett, Steven

2009-05-15

In animal models, the dysregulated activity of calcium-activated proteases, calpains, contributes directly to cataract formation. However, the physiological role of calpains in the healthy lens is not well defined. In this study, we examined the expression pattern of calpains in the mouse lens. Real time PCR and Western blotting data indicated that calpain 1, 2, 3, and 7 were expressed in lens fiber cells. Using controlled lysis, depth-dependent expression profiles for each calpain were obtained. These indicated that, unlike calpain 1, 2, and 7, which were most abundant in cells near the lens surface, calpain 3 expression was strongest in the deep cortical region of the lens. We detected calpain activities in vitro and showed that calpains were active in vivo by microinjecting fluorogenic calpain substrates into cortical fiber cells. To identify endogenous calpain substrates, membrane/cytoskeleton preparations were treated with recombinant calpain, and cleaved products were identified by two-dimensional difference electrophoresis/mass spectrometry. Among the calpain substrates identified by this approach was alphaII-spectrin. An antibody that specifically recognized calpain-cleaved spectrin was used to demonstrate that spectrin is cleaved in vivo, late in fiber cell differentiation, at or about the time that lens organelles are degraded. The generation of the calpain-specific spectrin cleavage product was not observed in lens tissue from calpain 3-null mice, indicating that calpain 3 is uniquely activated during lens fiber differentiation. Our data suggest a role for calpains in the remodeling of the membrane cytoskeleton that occurs with fiber cell maturation.

Contact lens wear and dry eyes: challenges and solutions

Directory of Open Access Journals (Sweden)

Markoulli M

2017-02-01

Full Text Available Maria Markoulli, Sailesh Kolanu School of Optometry and Vision Science, University of New South Wales, Sydney, NSW, Australia Abstract: The number of contact lens wearers worldwide has remained relatively stable over the past decade, despite the investment that has gone into contact lens technology. This is largely because 10%–50% of wearers dropout of contact lens wear within 3 years of commencement; the most common reason cited being contact lens discomfort (CLD. Of the symptoms reported, sensation of dry eye is the most common. Given the outcome of reduced wearing time, increased chair time, and ultimate contact lens discontinuation, the challenge is to identify the warning signs of CLD early on. Clinically detectable changes such as conjunctival staining, conjunctival indentation, conjunctival epithelial flap formation, lid wiper epitheliopathy, Demodex blepharitis, and meibomian gland dysfunction have been linked to CLD, highlighting the need to perform regular aftercare visits to identify these changes. At a cellular level, conjunctival metaplasia and reduced goblet cell density have been linked to CLD, leading to a downstream effect on the tear film breakup time of contact lens wearers. These factors suggest a strong link between CLD and friction, raising the need to target this as a means of minimizing CLD. The purpose of this review is to identify the clinical signs that relate to CLD as a means of earlier detection and management in order to combat contact lens dropout. Keywords: contact lens discomfort, dry eye disease, lid wiper epitheliopathy, tear film biomarkers, meibomian gland dysfunction

Customer loyalty among daily disposable contact lens wearers.

Science.gov (United States)

Patel, Neelam I; Naroo, Shehzad A; Eperjesi, Frank; Rumney, Nicholas J

2015-02-01

Optometric practices offer contact lenses as cash sale items or as part of monthly payment plans. With the contact lens market becoming increasingly competitive, patients are opting to purchase lenses from supermarkets and Internet suppliers. Monthly payment plans are often implemented to improve loyalty. This study aimed to compare behavioural loyalty between monthly payment plan members and non-members. BBR Optometry Ltd offers a monthly payment plan (Eyelife™) to their contact lens wearers. A retrospective audit of 38 Eyelife™ members (mean±SD: 42.7±15.0 years) and 30 non-members (mean±SD: 40.8±16.7 years) was conducted. Revenue and profits generated, service uptake and product sales between the two groups were compared over a fixed period of 18 months. Eyelife™ members generated significantly higher professional fee revenue (Ployalty among contact lens wearers, particularly service uptake and volume of lens purchases. Additionally the greater professional fees generated, render monthly payment plans an attractive business model and practice builder. Copyright © 2014 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

Design of LED projector based on gradient-index lens

Science.gov (United States)

Qian, Liyong; Zhu, Xiangbing; Cui, Haitian; Wang, Yuanhang

2018-01-01

In this study, a new type of projector light path is designed to eliminate the deficits of existing projection systems, such as complex structure and low collection efficiency. Using a three-color LED array as the lighting source, by means of the special optical properties of a gradient-index lens, the complex structure of the traditional projector is simplified. Traditional components, such as the color wheel, relay lens, and mirror, become unnecessary. In this way, traditional problems, such as low utilization of light energy and loss of light energy, are solved. With the help of Zemax software, the projection lens is optimized. The optimized projection lens, LED, gradient-index lens, and digital micromirror device are imported into Tracepro. The ray tracing results show that both the utilization of light energy and the uniformity are improved significantly.

AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile

Science.gov (United States)

El-Nahass, M. M.; Ali, H. A. M.

2012-06-01

AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.

[Lens luxation in dogs: a retrospective study of 134 dogs (2000-2011)].

Science.gov (United States)

Betschart; Hässig; Spiess

2014-03-01

This retrospective study evaluated cases of lens luxation in dogs that were documented at the University of Zurich Veterinary Teaching Hospital between 2000 and 2011. A total 134 dogs were included in the study. This population of dogs with lens luxation represents 0.41 % of all dogs presented to the Zurich Veterinary Teaching Hospital (32'523) and 3.02 % of all dogs presented to the ophthalmology service during the same time period. The 134 dogs represented over 40 different breeds, including mixed breeds. 63 of the dogs were male, 71 were female. The 134 dogs were divided in primary lens luxation (86 of the 134 dogs, 64 %) and secondary lens luxation (48 dogs, 36 %). The most frequent causes for secondary lens luxation were glaucoma (58 %), cataract (19 %) and trauma (17 %). This study shows the predisposition for primary lens luxations in terrier breeds, Chinese Crested dogs, Pinscher and Spitz. In contrast, Siberian Huskies, Basset Hounds, Bearded Collies, Cairn Terriers, mixed breed dogs, Bolonka Zwetna, Boston Terriers, Borzoi, Doberman, Eurasian, Leonberg, Luzerner Niederlaufhund and Weimaraner suffered significantly more often from secondary lens luxation. There was no sex predilection for primary or secondary lens luxation. Dogs with primary lens luxation were on average 7.39 ± 3.02 years old, which is significantly younger than the dogs with secondary lens luxation (9.12 ± 3.38 years). Dogs with primary lens luxation showed a significantly higher rate of a bilateral development than those with secondary lens luxation (85.5 % of the dogs with primary lens luxation and only 14.5 % of the dogs with secondary lens luxation showed it in both their eyes).

Applanation tonometry in silicone hydrogel contact lens wearers.

Science.gov (United States)

Allen, R J; Dev Borman, A; Saleh, G M

2007-12-01

Previous studies have investigated intraocular pressure (IOP) measurements through conventional soft (hydrogel) therapeutic contact lenses, and have found that an accurate IOP can be recorded in normal eyes, and in eyes with abnormal anterior segments. The IOP measurement through soft contact lenses may be affected by the water content and centre thickness of the lens. Silicone hydrogel contact lenses are now being used as therapeutic contact lenses due to their high oxygen permeability. The purpose of this study is to investigate if IOP can be accurately measured in a subject wearing a silicone hydrogel contact lens. In a cohort study, the IOP was measured with a Goldmann applanation tonometer without a contact lens and then repeated with a hydrogel contact lens in situ. The IOP of 20 eyes of 10 volunteers with no ocular pathology was measured. The mean difference (+/-S.D.) found between IOP measurement with (mean 15.55+/-1.70 mmHg) and without (mean 16.05+/-1.90 mmHg) contact lens was found to be -0.5+/-0.89 mmHg. Statistical analysis was performed which revealed a correlation coefficient of 0.89. No significant statistical difference was found between the two groups with paired t-test (p=0.19). Accurate measurement of IOP by applanation tonometry can be achieved through a silicone hydrogel contact lens.

Dark secrets behind the shimmer of contact lens: the Indian scenario

Directory of Open Access Journals (Sweden)

Singh Deepak

2009-05-01

Full Text Available Abstract Background We studied the bacteriological profile of soft contact lens and its accessories among the asymptomatic subjects and monitored the compliance level with the lens use and its cleaning protocol. Findings A total of 115 (104 daily wear and 11 extended wear subjects using contact lens were studied. Data regarding the duration of use and frequency and method of cleaning were recorded. Contact lens, lens cases, preserving solutions and tips of solution bottles were the samples collected. The isolates were identified on the basis of their phenotypic characters. Samples from 24 subjects (21 daily wear and 3 extended wear were found contaminated. Of the 24 contaminated cases, 23 showed medium adherence to the cleaning protocol. Contamination rate was higher among the 56 daily wear lens users who used same lens for 2 years and more, than the 48 users who used their lenses for less than 2 years. Lens case contamination was found in all the 24 cases. The bacteria isolated were Citrobacter freundii, Escherichia coli, Klebsiella pneumoniae, Pseudomonas aeruginosa, Staphylococcus epidermidis and Streptococcus pneumoniae. In extended wear lens users, there was no change in microbial flora on repeating the cultures on day 7 and 14. Conclusion Non-compliance with contact lens use may lead to invitation of microbial flora. The accumulation of these bacteria may act as a precursor to biofilm formation, thus colonizing the lens accessories as well. The bacteria isolated in this study were similar to the ones causing microbial keratitis thus, predisposing the otherwise asymptomatic subjects to permanent visual damage.

CMU DeepLens: deep learning for automatic image-based galaxy-galaxy strong lens finding

Science.gov (United States)

Lanusse, François; Ma, Quanbin; Li, Nan; Collett, Thomas E.; Li, Chun-Liang; Ravanbakhsh, Siamak; Mandelbaum, Rachel; Póczos, Barnabás

2018-01-01

Galaxy-scale strong gravitational lensing can not only provide a valuable probe of the dark matter distribution of massive galaxies, but also provide valuable cosmological constraints, either by studying the population of strong lenses or by measuring time delays in lensed quasars. Due to the rarity of galaxy-scale strongly lensed systems, fast and reliable automated lens finding methods will be essential in the era of large surveys such as Large Synoptic Survey Telescope, Euclid and Wide-Field Infrared Survey Telescope. To tackle this challenge, we introduce CMU DeepLens, a new fully automated galaxy-galaxy lens finding method based on deep learning. This supervised machine learning approach does not require any tuning after the training step which only requires realistic image simulations of strongly lensed systems. We train and validate our model on a set of 20 000 LSST-like mock observations including a range of lensed systems of various sizes and signal-to-noise ratios (S/N). We find on our simulated data set that for a rejection rate of non-lenses of 99 per cent, a completeness of 90 per cent can be achieved for lenses with Einstein radii larger than 1.4 arcsec and S/N larger than 20 on individual g-band LSST exposures. Finally, we emphasize the importance of realistically complex simulations for training such machine learning methods by demonstrating that the performance of models of significantly different complexities cannot be distinguished on simpler simulations. We make our code publicly available at https://github.com/McWilliamsCenter/CMUDeepLens.

Phacoemulsification using iris hooks and scleral fixation of the intraocular lens in patients with secondary glaucoma associated with lens subluxation.

Science.gov (United States)

Ma, K T; Lee, H K; Seong, G J; Kim, C Y

2008-09-01

We described the techniques and results of phacoemulsification using iris hook and scleral fixation of intraocular lens (IOL) in patients with secondary glaucoma associated with lens subluxation. Eight eyes of seven patients with secondary glaucoma associated with lens dislocation, who had undergone the surgery, were retrospectively reviewed. At a mean of 23.5 months+/-13.6 (SD) after the surgery, the mean best-corrected visual acuity improved from 0.24+/-0.21 to 0.83+/-0.3, and mean intraocular pressure (IOP) was changed from 38.4+/-11.4 to 15.5+/-1.8 mmHg at the final examination. There were no vitreoretinal complications except cystoid macular oedema in one eye. The technique appears to be safe and effective in terms of visual rehabilitation and controlling IOP in patients with secondary glaucoma associated with lens subluxation.

ECTOPIC LENS EXTRACTION IN CHILDREN

Directory of Open Access Journals (Sweden)

Vladimir Pfeifer

2002-12-01

Full Text Available Background. Ectopia lentis continues to be a therapeutic challenge for ophthalmologists. It can occur as an isolated condition, after ocular trauma, in association with other ocular disorders, as part of a systemic mesodermal disease or a complication of general metabolic disorders. Minimal subluxation of the lens may cause no visual symptoms, but in more advanced cases serious optical disturbances arise. The most important is amblyopia. Surgical treatment options include iris manipulation, lens discission, aspiration, intracapsular or extracapsular extraction, and pars plana lensectomy. The choice of surgical technique remains controversial, in part because of the historically poor visual results and high rate of perioperative complications, including vitreous loss and retinal detachment.Methods. We describe a surgical technique based on the use of the Cionni endocapsular tension ring, dry irrigation aspiration of lens material, centration of the capsular bag and foldable intraocular lens implantation into the bag. With mentioned surgical technique 8 patients were operated; 4 boys and 4 girls, together 11 eyes.Results. The final BCVA after follow up period improved in 9 eyes and it remained the same as before operation in one eye. Statistical comparison of preoperative and postoperative visual acuities showed significant improvement. On the other hand there was no correlation between preoperative and postoperative visual acuity.Conclusions. This surgical procedure is an alternative approach in solving this challenging cases of ectopia lentis with good postoperative visual rehabilitation.

Review on prevention of bacterial adhesion on contact lens using plasma treatment

Science.gov (United States)

Ramli, N. A. H.; Zaaba, S. K.; Mustaffa, M. T.; Zakaria, A.; Shahriman A., B.

2017-03-01

Many researches had been conducted to enhance the properties of contact lens. Most of the research conducted discussed on the factors that affect the adhesion process to contact lenses, rate of contact lens contamination, and type of microbe that adhere on the contact lens surface and contact lens casing. Studies on the proposed strategies or technology that can be used to slower down the formation of bacteria on contact lens are being explored. New technologies or strategies to prevent or slow down the adhesion of bacteria on contact lens have become a priority in this area. This review paper covers two main aspects, namely factor that affect the bacteria adhesion on contact lens and also the introduction of plasma treatment as a potential method for contact lens treatment.

Effect of infrared radiation on the lens

Directory of Open Access Journals (Sweden)

Aly Eman

2011-01-01

Full Text Available Background: Infrared (IR radiation is becoming more popular in industrial manufacturing processes and in many instruments used for diagnostic and therapeutic application to the human eye. Aim : The present study was designed to investigate the effect of IR radiation on rabbit′s crystalline lens and lens membrane. Materials and Methods: Fifteen New Zealand rabbits were used in the present work. The rabbits were classified into three groups; one of them served as control. The other two groups were exposed to IR radiation for 5 or 10 minutes. Animals from these two irradiated groups were subdivided into two subgroups; one of them was decapitated directly after IR exposure, while the other subgroup was decapitated 1 hour post exposure. IR was delivered from a General Electric Lamp model 250R 50/10, placed 20 cm from the rabbit and aimed at each eye. The activity of Na + -K + ATPase was measured in the lens membrane. Soluble lens proteins were extracted and the following measurements were carried out: estimation of total soluble protein, sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE and Fourier transform infrared (FTIR spectroscopy. For comparison between multiple groups, analysis of variance was used with significance level set at P < 0.001. Results: The results indicated a change in the molecular weight of different lens crystalline accompanied with changes in protein backbone structure. These changes increased for the groups exposed to IR for 10 minutes. Moreover, the activity of Na + -K + ATPase significantly decreased for all groups. Conclusions: The protein of eye lens is very sensitive to IR radiation which is hazardous and may lead to cataract.

Tomographic method for measurement of the gradient refractive index of the crystalline lens. I. The spherical fish lens.

Science.gov (United States)

Acosta, Eva; Vazquez, Daniel; Garner, Leon; Smith, George

2005-03-01

We present an iterative tomographic algorithm to reconstruct refractive-index profiles for meridional planes of the lens of the spherical fish eye from measurements of deflection angles of refracted rays. Numerical simulations show that the algorithm allows accuracy up to the fourth decimal place, provided that the refractive index can be regarded as an analytical function of the radial coordinate and the experimental errors are neglected. An experimental demonstration is given by applying the algorithm to retrieve the refractive-index profile of a spherical fish lens. The method is conceptually simple and does not require matching of the index of the surrounding medium to that of the surface of the lens, and the related iterative algorithm rapidly converges.

Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.

Science.gov (United States)

Han, Xiaomin; Li, Guojing; Zhang, Shuqun

2017-01-01

Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.

ASSESSMENT OF LENS THICKNESS IN ANGLE CLOSURE DISEASE

Directory of Open Access Journals (Sweden)

Nishat Sultana Khayoom

2016-08-01

Full Text Available BACKGROUND Anterior chamber depth and lens thickness have been considered as important biometric determinants in primary angle-closure glaucoma. Patients with primary narrow angle may be classified as a primary angle closure suspect (PACS, or as having primary angle closure (PAC or primary angle closure glaucoma (PACG. 23.9% of patients with primary angle closure disease are in India, which highlights the importance of understanding the disease, its natural history, and its underlying pathophysiology, so that we may try to establish effective methods of treatment and preventative measures to delay, or even arrest, disease progression, thereby reducing visual morbidity. AIM To determine the lens thickness using A-scan biometry and its significance in various stages of angle closure disease. MATERIALS AND METHODS Patients attending outpatient department at Minto Ophthalmic Hospital between October 2013 to May 2015 were screened for angle closure disease and subsequently evaluated at glaucoma department. In our study, lens thickness showed a direct correlation with shallowing of the anterior chamber by determining the LT/ ACD ratio. A decrease in anterior chamber depth is proportional to the narrowing of the angle which contributes to the progression of the angle closure disease from just apposition to occlusion enhancing the risk for optic nerve damage and visual field loss. Hence, if the lens thickness values are assessed earlier in the disease process, appropriate intervention can be planned. CONCLUSION Determination of lens changes along with anterior chamber depth and axial length morphometrically can aid in early detection of angle closure. The role of lens extraction for PACG is a subject of increased interest. Lens extraction promotes the benefits of anatomical opening of the angle, IOP reduction and improved vision. This potential intervention may be one among the armamentarium of approaches for PACG. Among the current treatment modalities

Which soft lens power is better for piggyback in keratoconus? Part II.

Science.gov (United States)

Romero-Jiménez, Miguel; Santodomingo-Rubido, Jacinto; González-Meijóme, Jose-Manuel; Flores-Rodriguez, Patricia; Villa-Collar, Cesar

2015-02-01

To evaluate how soft lens power affects rigid gas-permeable (RGP) lens power and visual acuity (VA) in piggyback fittings for keratoconus. Sixteen keratoconus subjects (30 eyes) were included in the study. Piggyback contact lens fittings combining Senofilcon-A soft lenses of -6.00, -3.00, +3.00 and +6.00 D with Rose K2 RGP contact lenses were performed. Corneal topography was taken on the naked eye and over each soft contact lens before fitting RGP lenses. Mean central keratometry, over-refraction, RGP back optic zone radius (BOZR) and estimated final power as well as VA were recorded and analyzed. In comparison to the naked eye, the mean central keratometry flattened with both negative lens powers (psoft lens power (p=1.0); and steepened with the +6.00 soft lens power (p=0.02). Rigid gas-permeable over-refraction did not change significantly between different soft lens powers (all p>0.05). RGP's BOZR decreased significantly with both positive in comparison with both negative soft lens powers (all ppowers separately (both p>0.05). Estimated RGP's final power increased significantly with positive in comparison with negative lens powers (all ppowers separately (both p>0.05). Visual acuity did not change significantly between the different soft lens powers assessed (all p>0.05). The use of negative-powered soft lenses in piggyback fitting reduces RGP lens power without impacting VA in keratoconus subjects. Copyright © 2014 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

Microbial contamination of soft contact lenses & accessories in asymptomatic contact lens users

Directory of Open Access Journals (Sweden)

Deeksha V Thakur

2014-01-01

Full Text Available Background & objectives: With increasing use of soft contact lenses the incidence of contact lens induced infections is also increasing. This study was aimed to assess the knowledge of new and existing contact lens users about the risk of microbial contamination associated with improper use and maintenance of contact lenses, type of microbial flora involved and their potential to cause ophthalmic infections. Methods: Four samples each from 50 participants (n=200 were collected from the lenses, lens care solutions, lens care solution bottles and lens cases along with a questionnaire regarding their lens use. The samples were inoculated onto sheep blood agar, Mac Conkey′s agar and Sabouraud′s dextrose agar. Organisms were identified using standard laboratory protocols. Results: Overall rate of microbial contamination among the total samples was 52 per cent. The most and the least contaminated samples were found to be lens cases (62% and lens care solution (42%, respectively. The most frequently isolated contaminant was Staphylococcus aureus (21% followed by Pseudomonas species (19.5%. Majority (64% of the participants showed medium grade of compliance to lens cleaning practices. Rate of contamination was 100 and 93.75 per cent respectively in those participants who showed low and medium compliance to lens care practices as compared to those who had high level of compliance (43.75% ( p0 <0.05. Interpretation & conclusions: Lens care practices amongst the participants were not optimum which resulted into high level contamination. Hence, creating awareness among the users about the lens care practices and regular cleaning and replacements of lens cases are required.

Effect of chronic smoking on lens nucleus as assessed by Pentacam HR lens densitometry in young adults.

Science.gov (United States)

Pekel, Gökhan; Cetin, Ebru Nevin; Acer, Semra; Yagci, Ramazan; Altintas, Seher; Ongun, Gülin Tugba

2014-06-01

To evaluate the effects of chronic tobacco smoking on lens nucleus by Pentacam HR lens densitometry (LD) in young adults. Prospective cross-sectional case series. Thirty subjects (23 M, 7 F) who were chronic cigarette smokers (≥10 cigarettes/day for at least 2 years) (group 1) and another 30 subjects (23 M, 7 F) who did not smoke (group 2), were included in this study. The patients were matched for age and sex between the groups. The exclusion criteria were any history of ocular surgery, any systemic disorders and any ocular diseases except for mild refractive disorders. Lens densitometry measurements were done with the Pentacam HR (Oculus, Wetzlar, Germany). The Schirmer test and pachymetry measurements were also performed. Mean age of the patients for both groups was 28.90 ± 8.20 years (range: 18-40 years). Mean lens densitometry (LD) measurements of Group 1 (chronic cigarette smoking group) were higher than those of Group 2 (control group) in all LD techniques; however only mean "peak" LD measurements showed a statistically significant difference between these two groups (Group 1: 8.67 ± 0.61, Group 2: 8.44 ± 0.70, p = 0.04). The mean Schirmer test value was 12.43 ± 5.60 mm in Group 1 and 13.00 ± 4.26 mm in Group 2 (p = 0.55). The mean central corneal thickness (CCT) value was 564.23 ± 34.61 µm in Group 1 and 550.47 ± 32.94 µm in Group 2 (p = 0.03). The Pentacam HR LD seems to be an important option for the evaluation of lens nucleus in young adults, because it gives objective and quantitative data. Although chronic smoking increases lens nucleus density in young adults, the effect is not statistically significant when compared with the control group.

A planar parabolic refractive nickel lens for high-energy X-rays

International Nuclear Information System (INIS)

Andrejczuk, Andrzej; Nagamine, Masaru; Sakurai, Yoshiharu; Itou, Masayoshi

2013-01-01

A compound refractive nickel lens focusing 174 keV X-rays to 5 µm with a gain of 4 is presented. A compound refractive lens made of nickel and designed for focusing high-energy synchrotron X-rays is presented. The lens consists of 600 parabolic grooves and focuses X-rays in one plane only (planar lens). The lenses made and investigated by us earlier exhibited low transmission and irregularities in the focused beam profile. Since then, improvements in lens manufacturing technology have been made. The present lens gives an almost Gaussian profile and produces four times higher intensity at its maximum compared with the intensity of primary X-ray beams of 174 keV

Design of a hyperbolic microwave metallic lens

International Nuclear Information System (INIS)

Uckan, T.

1979-12-01

Due to problems caused by multiple reflections in the cavity walls of the EBT fusion research device, the use of a horn becomes important for the directivity of waves in the millimetric range. An ordinary dielectric lens cannot be used because of plasma-wall interactions. Microwave metallic lenses, designed to focus the energy into a plane wave, can improve the directivity considerably. By implementing a 70-GHz standard-gain horn with a delay-type hyperbolic lens, which consists of a solid metallic disk with a number of equal size small holes has indicated a gain of 15 dB over the no lens case

3D printed helical antenna with lens

KAUST Repository

Farooqui, Muhammad Fahad

2016-12-19

The gain of an antenna can be enhanced through the integration of a lens, however this technique has traditionally been restricted to planar antennas due to fabrication limitations of standard manufacturing processes. Here, with a unique combination of 3D and 2D inkjet printing of dielectric and metallic inks respectively, we demonstrate a Fresnel lens that has been monolithically integrated to a non-planar antenna (helix) for the first time. Antenna measurements show that the integration of a Fresnel lens enhances the gain of a 2-turn helix by around 4.6 dB giving a peak gain of about 12.9 dBi at 8.8 GHz.

Magnetic lens apparatus for a low-voltage high-resolution electron microscope

Science.gov (United States)

Crewe, Albert V.

1996-01-01

A lens apparatus in which a beam of charged particles of low accelerating voltage is brought to a focus by a magnetic field, the lens being situated behind the target position. The lens comprises an electrically-conducting coil arranged around the axis of the beam and a magnetic pole piece extending along the axis of the beam at least within the space surrounded by the coil. The lens apparatus comprises the sole focusing lens for high-resolution imaging in a low-voltage scanning electron microscope.

Lens system for SIMS analysis

International Nuclear Information System (INIS)

Martinez, G.; Sancho, M.; Garcia-Galan, J.C.

1987-01-01

A powerful version of the charge-density method is applied to the study of a combined objective and emission lens, suitable for highly localized analysis of a flat sample surface. This lens can extract secondary ions of equal or opposite polarity to that of the primary particles. A computer simulation of the ion trajectories for both modes is made. The behaviour for different values of the geometric parameters and polarizations is analyzed and useful data for design such as primary beam demagnification and secondary image position are given. (author) 4 refs

Variable-focus liquid lens for portable applications

NARCIS (Netherlands)

Kuiper, S.; Hendriks, B.H.W.; Huijbregts, L.J.; Hirschberg, A.; Renders, C.A.; As, van M.A.J.; Mouroulis, P.Z.; Smith, W.J.; Johnson, R.B.

2004-01-01

The meniscus between two immiscible liquids can be used as an optical lens. A change in curvature of this meniscus by electrowetting leads to a change in focal distance. We demonstrate that two liquids in a tube form a self-centered tunable lens of high optical quality. Several properties were

21 CFR 886.4300 - Intraocular lens guide.

Science.gov (United States)

2010-04-01

...) MEDICAL DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4300 Intraocular lens guide. (a) Identification. An intraocular lens guide is a device intended to be inserted into the eye during surgery to direct... lenses, the device is exempt from the premarket notification procedures in subpart E of part 807 of this...

Treatment of contact lens related dry eye with antibacterial honey.

Science.gov (United States)

Wong, Daniel; Albietz, Julie M; Tran, Huan; Du Toit, Cimonette; Li, Anita Hui; Yun, Tina; Han, Jee; Schmid, Katrina L

2017-12-01

Contact lens induced dry eye affects approximately 50% of contact lens wearers. The aim was to assess the effects of Manuka (Leptospermum sp.) honey eye drops (Optimel, Melcare, Australia) on dry eye in contact lens wearers. The safety of the honey eye drops in contact lens wear and contact lens wearers' compliance were also evaluated. Prospective, randomised, cross over study, examiner masked, pilot treatment trial. Twenty-four participants aged 20 to 55 years with contact lens related dry eye were recruited and randomised to two treatment groups; 20 completed the study. One group used Optimel eye drops twice a day for two weeks followed by conventional lubricant (Systane Ultra, Alcon) therapy for two weeks; the other group completed the treatments in the reverse order. Before and after each treatment dry eye symptomology, ocular surface inflammation, and tear quantity and quality were assessed. Participants completed a daily log detailing their usage of treatments and any issues. Dry eye symptoms improved significantly after Optimel treatment. Patients with more severe symptoms at baseline showed a greater improvement in symptoms. No significant differences were observed in the objective signs of dry eye; presumably because of the short treatment duration. Seventy-five% of contact lens wearers reported good adherence to Optimel treatment and 95% reported no issues using this product. Optimel Eye Drops reduce the symptoms of dry eye in contact lens wearers and are safe to use. A longer treatment period to assess the effect on clinical signs of dry eye is required. Copyright © 2017 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

Gram negative bacteria and contact lens induced acute red eye

Directory of Open Access Journals (Sweden)

Sankaridurg Padmaja

1996-01-01

Full Text Available Two patients using hydrogel contact lenses on a daily wear schedule slept overnight with the lenses and woke up with a Contact Lens Induced Acute Red Eye (CLARE. The contact lenses recovered aseptically at the time of the event grew significant colonies of Pseudomonas aeruginosa and Aeromonas hydrophila in patient A and Pseudomonas aeruginosa and Serratia liquefaciens from patient B. Similar organisams from the contact lenses were recovered from the lens case and lens care solutions of patient B. In both the patients the condition resolved on discontinuation of lens wear. Patient compliance as a requirement for successful contact lens wear is highlighted with the illustration of these cases.

An all-silicone zoom lens in an optical imaging system

Science.gov (United States)

Zhao, Cun-Hua

2013-09-01

An all-silicone zoom lens is fabricated. A tunable metal ringer is fettered around the side edge of the lens. A nylon rope linking a motor is tied, encircling the notch in the metal ringer. While the motor is operating, the rope can shrink or release to change the focal length of the lens. A calculation method is developed to obtain the focal length and the zoom ratio. The testing is carried out in succession. The testing values are compared with the calculated ones, and they tally with each other well. Finally, the imaging performance of the all-silicone lens is demonstrated. The all-silicone lens has potential uses in cellphone cameras, notebook cameras, micro monitor lenses, etc.

Minimizing and measuring lens dose when giving cranial irradiation

International Nuclear Information System (INIS)

Woo, S.Y.; Donaldson, S.S.; Heck, R.J.; Nielson, K.L.; Shostak, C.

1989-01-01

Three different techniques of administering cranial irradiation were used to determine the dose to the lens as measured in the Rando phantom. The techniques employed were as follows: (1) the central axis of the radiation beam was placed at the thickest portion of the cranium; (2) the central axis of the radiation beam was placed at the lateral orbital rim (bon canthus); (3) the central axis of the radiation beam was placed at the thickest portion of the cranium but with the beam angled 5deg posteriorly away from the eye. Thermal luminescent dosimeters (TLD) were placed in a phantom, at a point determined from a life-sized anatomical section of the plane through the midsection of the eye, to be at the location of the posterior capsule of the lens. In addition, TLDs were placed on the outer surface of the phantom head, directly lateral to the location determined to be where the lens would lie. With equally weighted lateral opposed beams, delivering a midplane dose of 200cGy, the TLDs at the point of the lens measured 21, 9.9 and 10.6% of the midplane doses from the three techniques respectively. TLDs placed directly lateral to the lens on the surface of the phantom head gave an approximation of the lens dose, particularly when techniques 2 and 3 were used. Isodose curve generated by a General Electric treatment planning computer gave lens doses similar to those of the phantom data for each of the three different radiotherapy techniques. Cranial irradiation should be carried out by either technique 2 or technique 3 to minimize radiation dose to the lens. (author). 11 refs.; 2 figs.; 3 tabs

Qualification of a Null Lens Using Image-Based Phase Retrieval

Science.gov (United States)

Bolcar, Matthew R.; Aronstein, David L.; Hill, Peter C.; Smith, J. Scott; Zielinski, Thomas P.

2012-01-01

In measuring the figure error of an aspheric optic using a null lens, the wavefront contribution from the null lens must be independently and accurately characterized in order to isolate the optical performance of the aspheric optic alone. Various techniques can be used to characterize such a null lens, including interferometry, profilometry and image-based methods. Only image-based methods, such as phase retrieval, can measure the null-lens wavefront in situ - in single-pass, and at the same conjugates and in the same alignment state in which the null lens will ultimately be used - with no additional optical components. Due to the intended purpose of a Dull lens (e.g., to null a large aspheric wavefront with a near-equal-but-opposite spherical wavefront), characterizing a null-lens wavefront presents several challenges to image-based phase retrieval: Large wavefront slopes and high-dynamic-range data decrease the capture range of phase-retrieval algorithms, increase the requirements on the fidelity of the forward model of the optical system, and make it difficult to extract diagnostic information (e.g., the system F/#) from the image data. In this paper, we present a study of these effects on phase-retrieval algorithms in the context of a null lens used in component development for the Climate Absolute Radiance and Refractivity Observatory (CLARREO) mission. Approaches for mitigation are also discussed.

A Personal Reflection on the History of Radiation Oncology at Memorial Sloan-Kettering Cancer Center

International Nuclear Information System (INIS)

Chu, Florence C.H.

2011-01-01

Purpose: To provide a historical and personal narrative of the development of radiation oncology at Memorial Sloan-Kettering Cancer Center (MSKCC), from its founding more than 100 years ago to the present day. Methods and Materials: Historical sources include the Archives of MSKCC, publications by members of MSKCC, the author's personal records and recollections, and her communications with former colleagues, particularly Dr. Basil Hilaris, Dr. Zvi Fuks, and Dr. Beryl McCormick. Conclusions: The author, who spent 38 years at MSKCC, presents the challenges and triumphs of MSKCC's Radiation Oncology Department and details MSKCC's breakthroughs in radiation oncology. She also describes MSKCC's involvement in the founding of the American Society for Therapeutic Radiology and Oncology.

Plasmonic leak-free focusing lens under radially polarized illumination

International Nuclear Information System (INIS)

Li, Xiaowei; Tan, Qiaofeng; Bai, Benfeng; Jin, Guofan

2010-01-01

A plasmonic leak-free focusing lens with two asymmetric concentric ring slits under radially polarized illumination is proposed. Each ring slit in the plasmonic lens is designed to generate surface plasmon polaritons (SPPs) with a relative initial phase controlled by the ring slit parameters. Through mutual interference of the SPPs with different phases excited by the two concentric ring slits at the output metal–dielectric interface, the field intensity towards the center of the focusing lens can be enhanced while that leaking to the counter-focus direction is effectively suppressed. The optimal parameters of the plasmonic leak-free lens are theoretically obtained by satisfying the above condition and its focusing performance is demonstrated by numerical simulation. Furthermore, a plasmonic leak-free lens with multiple double-slit groups is proposed and discussed, which exhibits a higher energy density at the focusing spot of the output interface

Development of a 3D finite element model of lens microcirculation

Directory of Open Access Journals (Sweden)

Vaghefi Ehsan

2012-09-01

Full Text Available Abstract Background It has been proposed that in the absence of a blood supply, the ocular lens operates an internal microcirculation system. This system delivers nutrients, removes waste products and maintains ionic homeostasis in the lens. The microcirculation is generated by spatial differences in membrane transport properties; and previously has been modelled by an equivalent electrical circuit and solved analytically. While effective, this approach did not fully account for all the anatomical and functional complexities of the lens. To encapsulate these complexities we have created a 3D finite element computer model of the lens. Methods Initially, we created an anatomically-correct representative mesh of the lens. We then implemented the Stokes and advective Nernst-Plank equations, in order to model the water and ion fluxes respectively. Next we complemented the model with experimentally-measured surface ionic concentrations as boundary conditions and solved it. Results Our model calculated the standing ionic concentrations and electrical potential gradients in the lens. Furthermore, it generated vector maps of intra- and extracellular space ion and water fluxes that are proposed to circulate throughout the lens. These fields have only been measured on the surface of the lens and our calculations are the first 3D representation of their direction and magnitude in the lens. Conclusion Values for steady state standing fields for concentration and electrical potential plus ionic and fluid fluxes calculated by our model exhibited broad agreement with observed experimental values. Our model of lens function represents a platform to integrate new experimental data as they emerge and assist us to understand how the integrated structure and function of the lens contributes to the maintenance of its transparency.

Two-laser thermal-lens determination of phosphorus in silicon

International Nuclear Information System (INIS)

Grishko, V.I.; Gol'dshtein, M.M.; Grishko, V.P.; Yudelevich, I.G.

1986-01-01

Laser thermal-lens spectrophotometry is a high-sensitivity method of measuring absorptivity, where the signal is the relative intensity change at the beam center after passage through the medium, which absorbs at the laser wavelength. The two-lens method is discussed here which employs a high-power laser to induce the lens, while the absorptivity is measured from the intensity change in the beam from a continous wave low-power test laser at a wavelength different from that for the inducing one. This paper uses two-laser thermal-lens techniques to determine phosphorus in silicon. Phosphorus is determined as the ionic association of molybdophosphoric acid with auramine

[Phacoemulsification of subluxated lens with capsular tension ring implantation].

Science.gov (United States)

Dorecka, Mariola; Rokicki, Wojciech; Nita, Malgorzata; Krysik, Katarzyna; Nita, Ewa; Sikorska, Aleksandra; Romaniuk, Wanda

2007-01-01

To evaluate long term results of phacoemulsification with PC IOL and capsular tension ring (CTR) implantation in lens subluxation. The study comprised of 134 patients--146 eyes with subluxated lens. In all cases phacoemulsification with PC IOL and CTR implantation was performed. No intaroperative complications has occured. Postoperative complications included: inflammation in the anterior chamber in 3 eyes (2.1%), retinal detachment in 2 eyes (1.4%). In all cases there was no PC IOL decentration. (1) CTR facilitates phacoemulsification with PC IOL implantation in lens subluxation. (2) Phacoemulsification of subluxated lens with PC IOL and CTR implantation seems to be safe and effective procedure.

The Mars Hand Lens Imager (MAHLI) aboard the Mars rover, Curiosity

Science.gov (United States)

Edgett, K. S.; Ravine, M. A.; Caplinger, M. A.; Ghaemi, F. T.; Schaffner, J. A.; Malin, M. C.; Baker, J. M.; Dibiase, D. R.; Laramee, J.; Maki, J. N.; Willson, R. G.; Bell, J. F., III; Cameron, J. F.; Dietrich, W. E.; Edwards, L. J.; Hallet, B.; Herkenhoff, K. E.; Heydari, E.; Kah, L. C.; Lemmon, M. T.; Minitti, M. E.; Olson, T. S.; Parker, T. J.; Rowland, S. K.; Schieber, J.; Sullivan, R. J.; Sumner, D. Y.; Thomas, P. C.; Yingst, R. A.

2009-08-01

The Mars Science Laboratory (MSL) rover, Curiosity, is expected to land on Mars in 2012. The Mars Hand Lens Imager (MAHLI) will be used to document martian rocks and regolith with a 2-megapixel RGB color CCD camera with a focusable macro lens mounted on an instrument-bearing turret on the end of Curiosity's robotic arm. The flight MAHLI can focus on targets at working distances of 20.4 mm to infinity. At 20.4 mm, images have a pixel scale of 13.9 μm/pixel. The pixel scale at 66 mm working distance is about the same (31 μm/pixel) as that of the Mars Exploration Rover (MER) Microscopic Imager (MI). MAHLI camera head placement is dependent on the capabilities of the MSL robotic arm, the design for which presently has a placement uncertainty of ~20 mm in 3 dimensions; hence, acquisition of images at the minimum working distance may be challenging. The MAHLI consists of 3 parts: a camera head, a Digital Electronics Assembly (DEA), and a calibration target. The camera head and DEA are connected by a JPL-provided cable which transmits data, commands, and power. JPL is also providing a contact sensor. The camera head will be mounted on the rover's robotic arm turret, the DEA will be inside the rover body, and the calibration target will be mounted on the robotic arm azimuth motor housing. Camera Head. MAHLI uses a Kodak KAI-2020CM interline transfer CCD (1600 x 1200 active 7.4 μm square pixels with RGB filtered microlenses arranged in a Bayer pattern). The optics consist of a group of 6 fixed lens elements, a movable group of 3 elements, and a fixed sapphire window front element. Undesired near-infrared radiation is blocked using a coating deposited on the inside surface of the sapphire window. The lens is protected by a dust cover with a Lexan window through which imaging can be ac-complished if necessary, and targets can be illuminated by sunlight or two banks of two white light LEDs. Two 365 nm UV LEDs are included to search for fluores-cent materials at night. DEA

Improved integrating-sphere throughput with a lens and nonimaging concentrator.

Science.gov (United States)

Chenault, D B; Snail, K A; Hanssen, L M

1995-12-01

A reflectometer design utilizing an integrating sphere with a lens and nonimaging concentrator is described. Compared with previous designs where a collimator was used to restrict the detector field of view, the concentrator-lens combination significantly increases the throughput of the reflectometer. A procedure for designing lens-concentrators is given along with the results of parametric studies. The measured angular response of a lens-concentrator system is compared with ray-trace predictions and with the response of an ideal system.

RNA interference suppression of mucin 5AC (MUC5AC reduces the adhesive and invasive capacity of human pancreatic cancer cells

Directory of Open Access Journals (Sweden)

Yamada Nobuya

2010-05-01

Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.

Primary intraocular lens implantation for penetrating lens trauma in Africa.

Science.gov (United States)

Bowman, R J; Yorston, D; Wood, M; Gilbert, C; Foster, A

1998-09-01

This study aimed to audit the surgical strategy of primary posterior chamber intraocular lens implantation for cases of recent penetrating trauma involving the lens in an African population. Retrospective, noncomparative case series. Seventy-two cases are reported, including all patients who underwent primary intraocular lens implantation for traumatic cataract extraction performed within 1 month of injury between 1988 and 1996. Demographic characteristics and follow-up attendance rates are analyzed. Surgical technique and the occurrence of intraoperative and postoperative complications are reported. Visual outcomes are reported with detailed analysis for cases of poor visual outcome. Mean age was 14.3 years (standard deviation = 11.1), 57 (79%) were male and 15 (21%) were female (chi-square = 23.66, P capsule had been breached by the trauma in 27 (38%) cases, and 15 of these required anterior vitrectomy. Capsular fixation of the implant was achieved in 49% of patients, the remainder having sulcus fixation. Intraoperative rupture of the posterior capsule occurred in four cases. The only common postoperative complication was acute fibrinous anterior uveitis, which occurred in 29 (40%) patients, and 32% of patients followed up for at least 6 months required secondary posterior capsulotomy. This was more common in younger patients (chi-square = 4.2, P < 0.05). Corrected postoperative visual acuities were available for 51 patients, of which 71% achieved 20/60 or better visual acuity. Patients 6 years of age or younger were less likely to achieve 20/60 (chi-square = 6.61, P = 0.01). This surgical strategy has proved successful, producing good visual results and causing no sight-threatening complications. Primary posterior capsulotomy may be appropriate for younger patients.

Gamma-irradiation produces active chlorine species (ACS) in physiological solutions: Secoisolariciresinol diglucoside (SDG) scavenges ACS - A novel mechanism of DNA radioprotection.

Science.gov (United States)

Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo

2016-09-01

Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged

Hopping models and ac universality

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2002-01-01

Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

Electronic states in a quantum lens

International Nuclear Information System (INIS)

Rodriguez, Arezky H.; Trallero-Giner, C.; Ulloa, S. E.; Marin-Antuna, J.

2001-01-01

We present a model to find analytically the electronic states in self-assembled quantum dots with a truncated spherical cap (''lens'') geometry. A conformal analytical image is designed to map the quantum dot boundary into a dot with semispherical shape. The Hamiltonian for a carrier confined in the quantum lens is correspondingly mapped into an equivalent operator and its eigenvalues and eigenfunctions for the corresponding Dirichlet problem are analyzed. A modified Rayleigh-Schro''dinger perturbation theory is presented to obtain analytical expressions for the energy levels and wave functions as a function of the spherical cap height b and radius a of the circular cross section. Calculations for a hard wall confinement potential are presented, and the effect of decreasing symmetry on the energy values and eigenfunctions of the lens-shape quantum dot is studied. As the degeneracies of a semicircular geometry are broken for b≠a, our perturbation approach allows tracking of the split states. Energy states and electronic wave functions with m=0 present the most pronounced influence on the reduction of the lens height. The method and expressions presented here can be straightforwardly extended to deal with more general Hamiltonians, including strains and valence-band coupling effects in Group III--V and Group II--VI self-assembled quantum dots

Forensic Analysis of a Contact Lens in a Murder Case.

Science.gov (United States)

Zwerling, Charles S

2016-03-01

Contact lenses have had rare relevance in trials and/or investigations. After 5 years of burial, orbital remnants were retrieved from an exhumed body and subsequently identified as a key piece of material evidence in a murder trial. The exhumed case materials were evaluated under laboratory conditions and were determined to be contact lens remnants. Contact lens fracture and burial simulation studies were performed to provide additional corroboration of the physical findings of the exhumed contact lens remnants. This material evidence was instrumental in providing factual proof refuting the defendant's testimony in the murder trial. A brief history of contact lens composition and use is provided for understanding the methods and observational results. This forensic case study represents the first published documentation of a contact lens from an exhumed body being used in a murder investigation and establishes an operational procedure for future forensic contact lens examinations. © 2016 American Academy of Forensic Sciences.

Chitah: Strong-gravitational-lens hunter in imaging surveys

Energy Technology Data Exchange (ETDEWEB)

Chan, James H. H.; Suyu, Sherry H.; Chiueh, Tzihong; More, Anupreeta; Marshall, Philip J.; Coupon, Jean; Oguri, Masamune; Price, Paul

2015-07-07

Strong gravitationally lensed quasars provide powerful means to study galaxy evolution and cosmology. Current and upcoming imaging surveys will contain thousands of new lensed quasars, augmenting the existing sample by at least two orders of magnitude. To find such lens systems, we built a robot, Chitah, that hunts for lensed quasars by modeling the configuration of the multiple quasar images. Specifically, given an image of an object that might be a lensed quasar, Chitah first disentangles the light from the supposed lens galaxy and the light from the multiple quasar images based on color information. A simple rule is designed to categorize the given object as a potential four-image (quad) or two-image (double) lensed quasar system. The configuration of the identified quasar images is subsequently modeled to classify whether the object is a lensed quasar system. We test the performance of Chitah using simulated lens systems based on the Canada–France–Hawaii Telescope Legacy Survey. For bright quads with large image separations (with Einstein radius ${r}_{\\mathrm{ein}}\\gt 1\\buildrel{\\prime\\prime}\\over{.} 1$) simulated using Gaussian point-spread functions, a high true-positive rate (TPR) of $\\sim 90\\%$ and a low false-positive rate of $\\sim 3\\%$ show that this is a promising approach to search for new lens systems. We obtain high TPR for lens systems with ${r}_{\\mathrm{ein}}\\gtrsim 0\\buildrel{\\prime\\prime}\\over{.} 5$, so the performance of Chitah is set by the seeing. We further feed a known gravitational lens system, COSMOS 5921+0638, to Chitah, and demonstrate that Chitah is able to classify this real gravitational lens system successfully. Our newly built Chitah is omnivorous and can hunt in any ground-based imaging surveys.

Compound refractive X-ray lens

International Nuclear Information System (INIS)

Nygren, D.R.; Cahn, R.; Cederstrom, B.; Danielsson, M.; Vestlund, J.

2000-01-01

An apparatus and method are disclosed for focusing X-rays. In one embodiment, his invention is a commercial-grade compound refractive X-ray lens. The commercial-grade compound refractive X-ray lens includes a volume of low-Z material. The volume of low-Z material has a first surface which is adapted to receive X-rays of commercially-applicable power emitted from a commercial-grade X-ray source. The volume of low-Z material also has a second surface from which emerge the X-rays of commercially-applicable power which were received at the first surface. Additionally, the commercial-grade compound refractive X-ray lens includes a plurality of openings which are disposed between the first surface and the second surface. The plurality of openings are oriented such that the X-rays of commercially-applicable power which are received at the first surface, pass through the volume of low-Z material and through the plurality openings. In so doing, the X-rays which emerge from the second surface are refracted to a focal point

Compound refractive X-ray lens

Science.gov (United States)

Nygren, David R.; Cahn, Robert; Cederstrom, Bjorn; Danielsson, Mats; Vestlund, Jonas

2000-01-01

An apparatus and method for focusing X-rays. In one embodiment, his invention is a commercial-grade compound refractive X-ray lens. The commercial-grade compound refractive X-ray lens includes a volume of low-Z material. The volume of low-Z material has a first surface which is adapted to receive X-rays of commercially-applicable power emitted from a commercial-grade X-ray source. The volume of low-Z material also has a second surface from which emerge the X-rays of commercially-applicable power which were received at the first surface. Additionally, the commercial-grade compound refractive X-ray lens includes a plurality of openings which are disposed between the first surface and the second surface. The plurality of openings are oriented such that the X-rays of commercially-applicable power which are received at the first surface, pass through the volume of low-Z material and through the plurality openings. In so doing, the X-rays which emerge from the second surface are refracted to a focal point.

Transport AC losses in YBCO coated conductors

Energy Technology Data Exchange (ETDEWEB)

Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

2007-09-15

Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

In vivo study of lens regeneration in Rana cyanophlyctis under ...

African Journals Online (AJOL)

SAM

2014-03-12

Mar 12, 2014 ... enhanced the percentage lens regeneration not only in young tadpoles but also in froglets. Lens regeneration ability ... Influence of vitamin A and ascorbic acid on lens regeneration in young, mature tadpoles and froglets of the frog Rana cyanophlyctis. Group .... ingested by macrophages. Dorsal iris cells ...

Color corrected Fresnel lens for solar concentration

International Nuclear Information System (INIS)

Kritchman, E.M.

1979-01-01

A new linear convex Fresnel lens with its groove side down is described. The design philosophy is similar to the highly concentrating two focal Fresnel lens but including a correction for chromatic aberration. A solar concentration ratio as high as 80 is achieved. For wide acceptance angles the concentration nears the theoretical maximum. (author)

The significance of oxygen during contact lens wear.

Science.gov (United States)

Papas, Eric B

2014-12-01

In order to establish the relevance of oxygen to contemporary contact lens practice, a review of the literature was conducted. The results indicate that there are a number of processes occurring in the normal healthy eye where oxygen is required and which are potentially affected by the presence of a contact lens. These activities appear to take place at all corneal levels, as well as at the limbus. Evidence from laboratory, clinical and modelling studies indicates that what constitutes normal oxygenation (normoxia) depends on, among other things, the physiological system under consideration, corneal location and the state of eye closure. This diversity is reflected in the wide range of minimum lens oxygen transmissibility (Dk/t) requirements that are present in a literature. Copyright © 2014 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

An acoustic Maxwell’s fish-eye lens based on gradient-index metamaterials

International Nuclear Information System (INIS)

Yuan Bao-guo; Tian Ye; Cheng Ying; Liu Xiao-jun

2016-01-01

We have proposed a two-dimensional acoustic Maxwell’s fish-eye lens by using the gradient-index metamaterials with space-coiling units. By adjusting the structural parameters of the units, the refractive index can be gradually varied, which is key role to design the acoustic fish-eye lens. As predicted by ray trajectories on a virtual sphere, the proposed lens has the capability to focus the acoustic wave irradiated from a point source at the surface of the lens on the diametrically opposite side of the lens. The broadband and low loss performance is further demonstrated for the lens. The proposed acoustic fish-eye lens is expected to have the potential applications in directional acoustic coupler or coherent ultrasonic imaging. (paper)

Variable wide range of lens power and its improvement in a liquid-crystal lens using highly resistive films divided into two regions with different diameters

Science.gov (United States)

Kawamura, Marenori; Sato, Susumu

2018-05-01

The variable range of lens power of a liquid-crystal (LC) lens driven by two voltages is discussed on the basis of calculated and experimental results. The LC lens has two electrodes, which are a circularly hole-patterned electrode and a circular electrode, in addition to a common electrode, and highly resistive transparent films. The variable range of lens power increases with increasing driving voltage applied across the circularly hole-patterned electrode and the common electrode, and with decreasing diameter of highly resistive films. However, the optical-phase retardation profile tends to deviate from a parabolic curve in these cases. As a method to improve the trade-off properties, the highly resistive film is divided into two regions with different diameters, where the sheet resistance of an outer film is larger than that of an inner one. The improved LC lens has a lens power that varies in a wide range, and it exhibits a good parabolic phase retardation profile.

Corneal ring infiltration in contact lens wearers

Directory of Open Access Journals (Sweden)

Seyed Ali Tabatabaei

2017-01-01

Full Text Available To report a case of atypical sterile ring infiltrates during wearing soft silicone hydrogel contact lens due to poor lens care. A 29-year-old woman presented with complaints of pain, redness, and morning discharge. She was wearing soft silicone hydrogel contact lens previously; her current symptoms began 1 week before presentation. On examination, best-corrected visual acuity was 20/40 in that eye. Slit-lamp examination revealed dense, ring-shaped infiltrate involving both the superficial and deep stromal layers with lucid interval to the limbus, edema of the epithelium, epithelial defect, and vascularization of the superior limbus. Cornea-specific in vivo laser confocal microscopy (Heidelberg Retina Tomograph 2 Rostock Cornea Module, HRT 2-RCM, Heidelberg Engineering GmbH, Dossenheim, Germany revealed Langerhans cells and no sign of Acanthamoeba or fungal features, using lid scraping and anti-inflammatory drops; her vision completely recovered. We reported an atypical case of a sterile corneal ring infiltrate associated with soft contact lens wearing; smear, culture, and confocal microscopy confirmed a sterile inflammatory reaction.

The gravitational lens effect and its optical equivalents

International Nuclear Information System (INIS)

Freitas, L.R. de.

1987-01-01

This work presents the evolution of the use of the so called gravitational lens effect from a simple observational teste of the General Relativity theory to an instrument to measure cosmological parameters. A detailed analysis of how a gravitational ''lens'' deflects light without forming images is shown for the case of the deflector with spherical symmetry. In addition, the exact optical equivalent of a cylindrical gravitational lens, which forms true images, is proposed. Finally the problem of the formation of multiple images and the related astronomical observations is discussed. (author) [pt

Multiplexing schemes for an achromatic programmable diffractive lens

Energy Technology Data Exchange (ETDEWEB)

Millan, M S; Perez-Cabre, E; Oton, J [Technical University of Catalonia, Dep. Optics and Optometry, Terrassa-Barcelona, 08222 (Spain)], E-mail: millan@oo.upc.edu

2008-11-01

A multiplexed programmable diffractive lens, displayed on a pixelated liquid crystal device under broadband illumination, is proposed to compensate for the severe chromatic aberration that affects diffractive elements. The proposed lens is based on multiplexing a set of sublenses with a common focal length for different wavelengths. We consider different types of integration of the optical information (spatial only, temporal only and hybrid spatial-temporal) combined with a proper selection of the spectral bandwidth. The properties and limits of the achromatic programmable multiplexed lens are described. Experimental results are presented and discussed.

Multiplexing schemes for an achromatic programmable diffractive lens

International Nuclear Information System (INIS)

Millan, M S; Perez-Cabre, E; Oton, J

2008-01-01

A multiplexed programmable diffractive lens, displayed on a pixelated liquid crystal device under broadband illumination, is proposed to compensate for the severe chromatic aberration that affects diffractive elements. The proposed lens is based on multiplexing a set of sublenses with a common focal length for different wavelengths. We consider different types of integration of the optical information (spatial only, temporal only and hybrid spatial-temporal) combined with a proper selection of the spectral bandwidth. The properties and limits of the achromatic programmable multiplexed lens are described. Experimental results are presented and discussed.

Repertoire of free-living protozoa in contact lens solutions.

Science.gov (United States)

Bouchoucha, Ibtissem; Aziz, Aurore; Hoffart, Louis; Drancourt, Michel

2016-10-29

The repertoire of free-living protozoa in contact lens solutions is poorly known despite the fact that such protozoa may act as direct pathogens and may harbor intra-cellular pathogens. Between 2009 and 2014, the contact lens solutions collected from patients presenting at our Ophthalmology Department for clinically suspected keratitis, were cultured on non-nutrient agar examined by microscope for the presence of free-living protozoa. All protozoa were identified by 18S rRNA gene sequencing. A total of 20 of 233 (8.6 %) contact lens solution specimens collected from 16 patients were cultured. Acanthamoeba amoeba in 16 solutions (80 %) collected from 12 patients and Colpoda steini, Cercozoa sp., Protostelium sp. and a eukaryotic more closely related to Vermamoeba sp., were each isolated in one solution. Cercozoa sp., Colpoda sp., Protostelium sp. and Vermamoeba sp. are reported for the first time as contaminating contact lens solutions. The repertoire of protozoa in contact lens solutions is larger than previously known.

Design of a nonimaging Fresnel lens for solar concentrators

Energy Technology Data Exchange (ETDEWEB)

Leutz, R.; Akisawa, Atushi; Kashiwagi, Takao [Tokyo University of Agriculture and Technology (Japan). Dept. of Mechanical Systems Engineering; Suzuki, Akio [UNESCO, Paris (France)

1999-04-01

An optimum convex shaped nonimaging Fresnel lens is designed following the edge ray principle. The lens is evaluated by tracing rays and calculating a projective optical concentration ratio. This Fresnel lens is intended for use in evacuated tube type solar concentrators, generating mid-temperature heat to drive sorption cycles, or provide industrial process heat. It can also be used along with a secondary concentrator in photovoltaic applications. (author)

Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Pijar Riza Anugerah

2015-10-01

Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

Lens autofluorescence is not increased at high altitude

DEFF Research Database (Denmark)

Kessel, Line; Kofoed, Peter Kristian; Zubieta-Calleja, Gustavo

2010-01-01

in Denmark. RESULTS: No significant differences in lens fluorescence or transmittance were found between Bolivian and Danish volunteers. CONCLUSION: Age-corrected lens fluorescence and transmittance were comparable for healthy participants living at high altitude near the equator and healthy volunteers...

Isofocusing and immunological investigations on cephalopod lens proteins

NARCIS (Netherlands)

Brahma, S.K.; Lancieri, M.

1979-01-01

Soluble lens proteins from Octopus vulgaris, Sepia officinalis, and Loligo vulgaris were analyzed by thin-layer isoelectric focusing and compared by various immunochemical methods using antibodies directed against total soluble lens protein antigens from the said three species. The results show

Research progress on the measurement of human lens thickness in vivo

Directory of Open Access Journals (Sweden)

Yu-Huan Yang

2017-05-01

Full Text Available The precise measurement in lens thickness in vivo, provides great application value for intraocular accommodation and ametropia development mechanism research. And it has great clinical significance for the diagnosis and treatment of glaucoma and cataract. Currently, many ultrasonic methods and optical methods are used in measuring lens thickness. The measurement principles, advantages, disadvantages and the accuracy of the instruments are summarized in this paper. Among these methods, Orbscan II, Pentacam, Lenstar and AS-OCT can be used to measure lens thickness instead of A-scan. More important is the fact that UL-OCT can dynamically monitor the change of the lens thickness with intraocular accommodation. Choosing an instrument with higher measuring accuracy to examine the lens thickness, can provide more accurate and convincing lens thickness data for clinical and scientific research.

Infrared observations of the dark matter lens candidate Q2345+007

Science.gov (United States)

Mcleod, Brian; Rieke, Marcia; Weedman, Daniel

1994-01-01

Deep K-band observations are presented of the double image quasar Q2345+007. This has the largest separation (7.1 sec) of any quasar image pair considered as gravitationally lensed, so the required lens is massive (10(exp 13) solar masses). No lens has been detected in previous deep images at visible wavelengths, and we find no lens to limiting K magnitude 20.0 in the infrared image. This constrains any lens to being much less luminous than brightest cluster galaxies, while the lens must be much more massive than such galaxies to produce the observed separation. Because spectral data indicate exceptional intrinsic similarity in the quasar image components, this pair remains as the most intriguing example of an observed configuration requiring the presence of massive, concentrated dark matter acting as a gravitational lens.

Severe pigment dispersion after iris-claw phakic intraocular lens implantation.

Science.gov (United States)

Galvis, Virgilio; Carreño, Néstor I; Tello, Alejandro; Laiton, Andrea N

2017-12-01

A 23-year-old female patient presented 3 months after the implantation of an Artisan® phakic intraocular lens with a severe depigmentation of the iris and peripheral anterior synechiae. Explantation of the intraocular lens and goniosynechialysis were performed. Eleven months after the explantation appearance of the iris significantly improved. There was no loss of lines of corrected distance visual acuity. Severe pigment dispersion after the implantation of an Artisan® phakic intraocular lens may happen and may require explantation of the lens. Iris depigmentation may improve with time.

Severe pigment dispersion after iris-claw phakic intraocular lens implantation

Directory of Open Access Journals (Sweden)

Virgilio Galvis

2017-01-01

Full Text Available A 23-year-old female patient presented 3 months after the implantation of an Artisan® phakic intraocular lens with a severe depigmentation of the iris and peripheral anterior synechiae. Explantation of the intraocular lens and goniosynechialysis were performed. Eleven months after the explantation appearance of the iris significantly improved. There was no loss of lines of corrected distance visual acuity. Severe pigment dispersion after the implantation of an Artisan® phakic intraocular lens may happen and may require explantation of the lens. Iris depigmentation may improve with time.

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Cytokine changes in tears and relationship to contact lens discomfort.

Science.gov (United States)

Willcox, Mark D P; Zhao, Zhenjun; Naduvilath, Thomas; Lazon de la Jara, Percy

2015-01-01

To determine the reproducibility of a multiplex bead assay for measuring cytokines in tears and correlations between ocular discomfort with or without contact lens wear and the concentration of cytokines in tears. Ninety participants (divided into two groups) were enrolled in this prospective study. They were asked to rate their ocular comfort and collect their tears in the morning and just before sleep for 10 days with or without contact lenses. The participants collected their tears using a glass microcapillary tube for both stages. Galyfilcon A lenses were worn on a daily disposable basis during the contact lens stage, and comfort scores and tears were collected before lens insertion and prior to lens removal at the end of the day. Tears were analyzed for cytokine concentrations using a 27-plex multibead assay. Correlations were sought between cytokine concentrations and comfort. There was a significant (p-0.5 Log pg/ml, p-0.2 Log pg/ml, ptears was correlated to ocular comfort, but this was not changed by contact lens wear. Ocular comfort during the day is magnified by contact lens wear. However, the increase in the change in comfort during lens wear was not associated with changes in 15 cytokines in the tear film.

Eye lens radiation exposure in Greek interventional cardiology personnel

International Nuclear Information System (INIS)

Thrapsanioti, Zoi; Askounis, Panagiotis; Carinou, Eleftheria; Datseris, Ioannis; Diamanti, Ramza Anastasia; Papathanasiou, Miltiadis

2017-01-01

The lens of the eye is one of the radiosensitive tissues of the human body; if exposed to ionizing radiation can develop radiation-induced cataract at early ages. This study was held in Greece and included 44 Interventional Cardiologists (ICs) and an unexposed to radiation control group of 22 persons. Of the note, 26 ICs and the unexposed individuals underwent special eye examinations. The detected lens opacities were classified according to LOCS III protocol. Additionally, the lens doses of the ICs were measured using eye lens dosemeters. The mean dose to the lenses of the ICs per month was 0.83 ± 0.59 mSv for the left and 0.35 ± 0.38 mSv for the right eye, while the annual doses ranged between 0.7 and 11 mSv. Regarding the lens opacities, the two groups did not differ significantly in the prevalence of either nuclear or cortical lens opacities, whereas four ICs were detected with early stage subcapsular sclerosis. Though no statistically difference was observed in the cohort, the measured doses indicate that the eye doses received from the ICs can be significant. To minimize the radiation-induced risk at the eye lenses, the use of protective equipment and appropriate training on this issue is highly recommended. (authors)

Ocular surface and tear film status among contact lens wearers and non-wearers who use VDT at work: comparing three different lens types.

Science.gov (United States)

Tauste, Ana; Ronda, Elena; Baste, Valborg; Bråtveit, Magne; Moen, Bente E; Seguí Crespo, María-Del-Mar

2018-04-01

To analyze differences in the ocular surface appearance and tear film status of contact lens wearers and non-wearers in a group of visual display terminals (VDT) workers and additionally to assess differences between lens materials. Cross-sectional study of 236 office workers, of whom 92 were contact lens wearers. Workers provided information on their contact lenses (conventional hydrogel, silicone hydrogel or rigid gas permeable lenses) and exposure to VDT at work. Ocular surface and tear film status were determined by the presence of bulbar, limbal and lid redness, lid roughness and corneal staining type, and by Schirmer's and tear break-up time tests (TBUT). A generalized linear model was used to calculate the crude (cRR) and age- and sex-adjusted (aRR) relative risk to measure the association between ocular surface and tear film abnormalities and contact lens use and type. The aRR of ocular surface abnormalities was higher in contact lens wearers compared to non-wearers: bulbar redness (aRR 1.69; 95% CI 1.25-2.30), limbal redness (aRR 2.87; 1.88-4.37), lid redness (aRR 2.53; 1.35-4.73) and lid roughness (aRR 7.03; 1.31-37.82). VDT exposure > 4 h/day increased wearers' risk of limbal and lid redness. Conventional hydrogel wearers had the highest risk of ocular surface abnormalities, followed by silicone hydrogel wearers. Both contact and non-contact lens wearers had a high prevalence of altered TBUT (77.3 and 75.7% respectively) and Schirmer (51.8 and 41.3%). Regular contact lens use during VDT exposure at work increases risk of bulbar, limbal and lid redness, and lid roughness, especially in soft contact lens wearers. The high prevalence of altered TBUT and Schirmer's results in all participants suggests that VDT use greatly affects tear film characteristics.

THERMIONIC AC GENERATION

Science.gov (United States)

is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

Evolution and the Calcite Eye Lens

OpenAIRE

Williams, Vernon L.

2013-01-01

Calcite is a uniaxial, birefringent crystal, which in its optically transparent form, has been used for animal eye lenses, the trilobite being one such animal. Because of the calcite birefringence there is a difficulty in using calcite as a lens. When the propagation direction of incoming light is not exactly on the c-axis, the mages blur. In this paper, calcite blurring is evaluated, and the non-blurring by a crystallin eye lens is compared to a calcite one.

An all-silicone zoom lens in an optical imaging system

International Nuclear Information System (INIS)

Zhao Cun-Hua

2013-01-01

An all-silicone zoom lens is fabricated. A tunable metal ringer is fettered around the side edge of the lens. A nylon rope linking a motor is tied, encircling the notch in the metal ringer. While the motor is operating, the rope can shrink or release to change the focal length of the lens. A calculation method is developed to obtain the focal length and the zoom ratio. The testing is carried out in succession. The testing values are compared with the calculated ones, and they tally with each other well. Finally, the imaging performance of the all-silicone lens is demonstrated. The all-silicone lens has potential uses in cellphone cameras, notebook cameras, micro monitor lenses, etc. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

Hyperelastic modelling of the crystalline lens: Accommodation and presbyopia

Science.gov (United States)

Lanchares, Elena; Navarro, Rafael; Calvo, Begoña

2012-01-01

Purpose The modification of the mechanical properties of the human crystalline lens with age can be a major cause of presbyopia. Since these properties cannot be measured in vivo, numerical simulation can be used to estimate them. We propose an inverse method to determine age-dependent change in the material properties of the tissues composing the human crystalline lens. Methods A finite element model of a 30-year-old lens in the accommodated state was developed. The force necessary to achieve full accommodation in a 30-year-old lens of known external geometry was computed using this model. Two additional numerical models of the lens corresponding to the ages of 40 and 50 years were then built. Assuming that the accommodative force applied to the lens remains constant with age, the material properties of nucleus and cortex were estimated by inverse analysis. Results The zonular force necessary to reshape the model of a 30-year-old lens from the accommodated to the unaccommodated geometry was 0.078 newton (N). Both nucleus and cortex became stiffer with age. The stiffness of the nucleus increased with age at a higher rate than the cortex. Conclusions In agreement with the classical theory of Helmholtz, on which we based our model, our results indicate that a major cause of presbyopia is that both nucleus and cortex become stiffer with age; therefore, a constant value of the zonular forces with aging does not achieve full accommodation, that is, the accommodation capability decreases.

21 CFR 880.6320 - AC-powered medical examination light.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...

Lens Dk/t influences the clinical response in overnight orthokeratology.

Science.gov (United States)

Lum, Edward; Swarbrick, Helen A

2011-04-01

To investigate the influence of lens oxygen transmissibility (Dk/t) on the clinical response to overnight (ON) orthokeratology (OK) lens wear over 2 weeks. Eleven subjects (age, 20 to 39 years) were fitted with OK lenses (BE; Capricornia Contact Lens) in both eyes. Lenses in matched design/fitting but different materials (Boston EO and XO; nominal Dk/t: 26 and 46 ISO Fatt, respectively) were worn ON only in the two eyes over a 2-week period. Changes in logarithm of the minimum angle of resolution visual acuity, subjective refraction (spherical equivalent), corneal apical radius ro and asphericity Q (Medmont E300), and central stromal thickness (Holden-Payor optical pachometer) were measured. There were statistically significant differences in outcomes between the two lens materials (analysis of variance, p 0.05). An increase in lens Dk/t appears to increase the clinical effects of ON reverse-geometry lens wear over the medium term. This adds further support to the recommendation that high Dk materials should be used for ON OK not only to provide physiological advantages but also to optimize clinical outcomes.

β1-integrin controls cell fate specification in early lens development

Science.gov (United States)

Pathania, Mallika; Wang, Yan; Simirskii, Vladimir N.; Duncan, Melinda K.

2016-01-01

Integrins are heterodimeric cell surface molecules that mediate cell-extracellular matrix (ECM) adhesion, ECM assembly, and regulation of both ECM and growth factor induced signaling. However, the developmental context of these diverse functions is not clear. Loss of β1-integrin from the lens vesicle (mouse E10.5) results in abnormal exit of anterior lens epithelial cells (LECs) from the cell cycle and their aberrant elongation toward the presumptive cornea by E12.5. These cells lose expression of LEC markers and initiate expression of the Maf (also known as c-Maf) and Prox1 transcription factors as well as other lens fiber cell markers, β1-integrin null LECs also upregulate the ERK, AKT and Smad1/5/8 phosphorylation indicative of BMP and FGF signaling. By E14.5, β1-integrin null lenses have undergone a complete conversion of all lens epithelial cells into fiber cells. These data suggest that shortly after lens vesicle closure, β1-integrin blocks inappropriate differentiation of the lens epithelium into fibers, potentially by inhibiting BMP and/or FGF receptor activation. Thus, β1-integrin has an important role in fine-tuning the response of the early lens to the gradient of growth factors that regulate lens fiber cell differentiation. PMID:27596755

An exploration into diffusion tensor imaging in the bovine ocular lens

Directory of Open Access Journals (Sweden)

Ehsan eVaghefi

2013-03-01

Full Text Available We describe our development of the diffusion tensor imaging modality for the bovine ocular lens. Diffusion gradients were added to a spin-echo pulse sequence and the relevant parameters of the sequence were refined to achieve good diffusion weighting in the lens tissue, which demonstrated heterogeneous regions of diffusive signal attenuation. Decay curves for b-value (loosely summarizes the strength of diffusion weighting and TE (determines the amount of MRI-obtained signal were used to estimate apparent diffusion coefficients (ADC and T2 in different lens regions. The ADCs varied by over an order of magnitude and revealed diffusive anisotropy in the lens. Up to 30 diffusion gradient directions, and 8 signal acquisition averages, were applied to lenses in culture in order to improve maps of diffusion tensor eigenvalues, equivalent to ADC, across the lens. From these maps, fractional anisotropy maps were calculated and compared to known spatial distributions of anisotropic molecular fluxes in the lens. This comparison suggested new hypotheses and experiments to quantitatively assess models of circulation in the avascular lens.

Bacterial adhesion forces to Ag-impregnated contact lens cases and transmission to contact lenses.

Science.gov (United States)

Qu, Wenwen; Busscher, Henk J; van der Mei, Henny C; Hooymans, Johanna M M

2013-03-01

To measure adhesion forces of Pseudomonas aeruginosa, Staphylococcus aureus, and Serratia marcescens to a rigid contact lens (CL), standard polypropylene, and Ag-impregnated lens cases using atomic force microscopy and determine bacterial transmission from lens case to CL. Adhesion forces of bacterial strains to Ag-impregnated and polypropylene lens cases and a rigid CL were measured using atomic force microscopy. Adhesion forces were used to calculate Weibull distributions, from which transmission probabilities from lens case to CL were derived. Transmission probabilities were compared with actual transmission of viable bacteria from a lens case to the CL in 0.9% NaCl and in an antimicrobial lens care solution. Bacterial transmission probabilities from polypropylene lens cases based on force analysis coincided well for all strains with actual transmission in 0.9% NaCl. Bacterial adhesion forces on Ag-impregnated lens cases were much smaller than that on polypropylene and CLs, yielding a high probability of transmission. Comparison with actual bacterial transmission indicated bacterial killing due to Ag ions during colony-forming unit transmission from an Ag-impregnated lens case, especially for P. aeruginosa. Transmission of viable bacteria from Ag-impregnated lens cases could be further decreased by use of an antimicrobial lens care solution instead of 0.9% NaCl. Bacterial transmission probabilities are higher from Ag-impregnated lens cases than from polypropylene lens cases because of small adhesion forces, but this is compensated for by enhanced bacterial killing due to Ag impregnation, especially when in combination with an antimicrobial lens care solution. This calls for a balanced combination of antimicrobial lens care solutions and surface properties of a lens case and CL.

Ac-dc converter firing error detection

International Nuclear Information System (INIS)

Gould, O.L.

1996-01-01

Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

Performance of a Be Refractive Lens

International Nuclear Information System (INIS)

Smither, R.K.; Khounsary, A.M.; Mancini, D.C.; Saleem, K. Abu

2004-01-01

The performance of a beryllium compound refractive lens (CRL) was tested in the energy range of 11.5 to 8.0 keV. The beryllium refractive lens consists of 50 aligned, 1-mm-diameter, hollow spheres in a solid block of beryllium, 30 mm x 20 mm x 55 mm. The minimum web between each hollow sphere was 0.10 mm. The measured focal length of the lens for x-rays close to the axis of the beam was 147.7 cm +/- 2.0 cm at 10 keV and 120.2 +/- 2.0 cm at 9.1 keV. These values agree well with the theoretical values of 146.6 cm and 121.4 cm, respectively. The diameter of the best focus obtained at 10 keV was 35 μm horizontal and 45 μm vertical. For the modified version of the lens used in the 9.1 keV experiment these values were 25 μm horizontal and 35 μm vertical. The x-ray beam cross section for the 10 keV and the 9.1 keV experiments were 0.50 mm x 0.50 mm and 0.30 mm x 0.30 mm, respectively. The enhancement of the flux (photons per sq. mm) was 50:1 at 10 keV and 80:1 in the 9.1 keV experiment

Surgical treatment of hereditary lens subluxations.

Science.gov (United States)

Ozdek, Sengul; Sari, Ayca; Bilgihan, Kamil; Akata, Fikret; Hasanreisoglu, Berati

2002-01-01

To evaluate the effectiveness and results of pars plana vitreolensectomy approach with transscleral fixation of intraocular lens in hereditary lens subluxations. Fifteen eyes of 9 consecutive patients with a mean age of 12.8+/-6.2 years (6-26 years) with hereditary lens subluxation were operated on and the results were evaluated in a prospective study. Surgery was considered if best spectacle corrected visual acuity (BSCVA) was less than 20/70. All eyes underwent a 2-port pars plana vitreolensectomy and transscleral fixation of an intraocular lens (IOL). The mean follow-up period was 12.6+/-7.5 months (6-22 months). There was no major intraoperative complication. Preoperatively, 8 eyes (53.3%) had a BSCVA of counting fingers (CF) and 7 eyes (46.6%) had a BSCVA of 20/200 to 20/70. Postoperatively, 14 eyes (93.3%) had a BSCVA of 20/50 or better. None of the patients had IOL decentration or intraocular pressure (IOP) increase during the follow-up period. There was a macular hole formation in 1 eye postoperatively. The early results of pars plana vitreolensectomy with IOL implantation using scleral fixation technique had shown that it not only promises a rapid visual rehabilitation but it is also a relatively safe method. More serious complications, however, may occur in the long term.

Analysis of a Thin Optical Lens Model

Science.gov (United States)

Ivchenko, Vladimir V.

2011-01-01

In this article a thin optical lens model is considered. It is shown that the limits of its applicability are determined not only by the ratio between the thickness of the lens and the modules of the radii of curvature, but above all its geometric type. We have derived the analytical criteria for the applicability of the model for different types…

Glass molding of 3mm diameter aspheric plano-convex lens

Science.gov (United States)

Sung, Hayeong; Hue, Myung sang; Lee, Giljae; Ryu, Geunman; Kim, Dongguk; Yang, Suncheol

2017-10-01

The many industries and research fields have demands for small scale optical systems. To satisfy the demands, many studies are conducted and the miniaturization technologies have been developed. The optical lens is directly related to the optical systems and a key component for the miniaturization. So the aspheric surface which can replace multispherical lenses is applied to the optical lens. And fabrication methods to reduce the diameter of the lens have been developed. The glass molding pressing (GMP) process is an attractive method to fabricate aspheric lens among the lens manufacturing processes. Because the GMP process has advantages of productivity, repeatability and so on. In this study, a 3 mm diameter aspheric plano-convex lens was fabricated using the GMP process. The GMP process was divided into heating, pressing, annealing and cooling. And the process was conducted using a commercial glass molding machine. Mold tools consist of an upper and a lower mold insert, an inner and an outer guide. The aspheric and the flat surfaces of the mold inserts were coated with ta-C to prevent the sticking of the glass to the mold. The surfaces of molded lens were measured by white interferometry and surface profilometer. The height and the diameter were measured using optical microscopy. As results, the aspheric surface of the lens was 5.1187 nm in Ra and 0.242 um in Pt. And the flat surface was 2.6697 nm in Ra and 0.13 um in Pt. The height and the diameter were 1.935 mm and 3.002 mm respectively.

Contact Lens Risks

Science.gov (United States)

... There is a risk of eye infection from bacteria in swimming pool water, hot tubs, lakes and the ocean Replace your contact lens storage case every 3 months or as directed by your eye care professional. Other Risks of Contact Lenses Other risks of contact lenses include pink eye ( ...

LAUE lens development at UC Berkeley: status and prospects

Science.gov (United States)

Barrière, Nicolas M.; Tomsick, John A.; Ackermann, Marcelo D.; Bastie, Pierre; Boggs, Steven E.; Hanlon, Lorraine; Jentschel, Michael; Lowell, Alexander; Roudil, Gilles; von Ballmoos, Peter; Wade, Colin

2013-09-01

We report on the status of the Laue lens development effort led by UC Berkeley, where a dedicated X-ray beamline and a Laue lens assembly station were built. This allowed the realization of a first lens prototype in June 2012. Based on this achievement, and thanks to a new NASA APRA grant, we are moving forward to enable Laue lenses. Several parallel activities are in progress. Firstly, we are refining the method to glue quickly and accurately crystals on a lens substrate. Secondly, we are conducting a study of high-Z crystals to diffract energies up to 900 keV efficiently. And thirdly, we are exploring new concepts of Si-based lenses that could further improve the focusing capabilities, and thus the sensitivity of Laue lenses.

A 3D printed helical antenna with integrated lens

KAUST Repository

Farooqui, Muhammad Fahad

2015-10-26

A novel antenna configuration comprising a helical antenna with an integrated lens is demonstrated in this work. The antenna is manufactured by a unique combination of 3D printing of plastic material (ABS) and inkjet printing of silver nano-particle based metallic ink. The integration of lens enhances the gain by around 7 dB giving a peak gain of about 16.4 dBi at 9.4 GHz. The helical antenna operates in the end-fire mode and radiates a left-hand circularly polarized (LHCP) pattern. The 3-dB axial ratio (AR) bandwidth of the antenna with lens is 3.2 %. Due to integration of lens and fully printed processing, this antenna configuration offers high gain performance and requires low cost for manufacturing.

Lens thickness assessment: anterior segment optical coherence tomography versus A-scan ultrasonography

Directory of Open Access Journals (Sweden)

Nikoo Hamzeh

2015-12-01

Full Text Available AIM: To assess lens thickness measurements with anterior segment-optical coherence tomography (AS-OCT in comparison with A-scan ultrasonography (A-scan US. METHODS: There were 218 adult subjects (218 eyes aged 59.2±9.2y enrolled in this prospective cross-sectional study. Forty-three eyes had open angles and 175 eyes had narrow angles. Routine ophthalmic exam was performed and nuclear opacity was graded using the Lens Opacities Classification System III (LOCS III. Lens thickness was measured by AS-OCT (Visante OCT, Carl Zeiss Meditec, Dublin, CA, USA. The highest quality image was selected for each eye and lens thickness was calculated using ImageJ software. Lens thickness was also measured by A-scan US. RESULTS: Interclass correlations showed a value of 99.7% for intra-visit measurements and 95.3% for inter-visit measurements. The mean lens thickness measured by AS-OCT was not significantly different from that of A-scan US (4.861±0.404 vs 4.866±0.351 mm, P=0.74. Lens thickness values obtained from the two instruments were highly correlated overall (Pearson correlation coefficient=0.81, P<0.001, and in all LOCS III specific subgroups except in grade 5 of nuclear opacity. Bland-Altman analysis revealed a 95% limit of agreement from -0.45 to 0.46 mm. Lens thickness difference between the two instruments became smaller as the lens thickness increased and AS-OCT yielded smaller values than A-scan US in thicker lens (β=-0.29, P<0.001 CONCLUSION: AS-OCT-derived lens thickness measurement is valid and comparable to the results obtained by A-scan US. It can be used as a reliable noncontact method for measuring lens thickness in adults with or without significant cataract.

The Sloan Digital Sky Survey-II Supernova Survey: Technical Summary

Energy Technology Data Exchange (ETDEWEB)

Frieman, Joshua A.; /Fermilab /KICP, Chicago /Chicago U., Astron. Astrophys. Ctr.; Bassett, Bruce; /Cape Town U. /South African Astron. Observ.; Becker, Andrew; /Washington; Choi, Changsu; /Seoul Natl. U.; Cinabro, David; /Wayne State U.; DeJongh, Don Frederic; /Fermilab; Depoy, Darren L.; /Ohio State U.; Doi, Mamoru; /Tokyo U.; Garnavich, Peter M.; /Notre Dame U.; Hogan, Craig J.; /Washington U., Seattle, Astron. Dept.; Holtzman, Jon; /New Mexico State U.; Im, Myungshin; /Seoul Natl. U.; Jha, Saurabh; /Stanford U., Phys. Dept.; Konishi, Kohki; /Tokyo U.; Lampeitl, Hubert; /Baltimore, Space Telescope Sci.; Marriner, John; /Fermilab; Marshall, Jennifer L.; /Ohio State U.; McGinnis,; /Fermilab; Miknaitis, Gajus; /Fermilab; Nichol, Robert C.; /Portsmouth U.; Prieto, Jose Luis; /Ohio State U. /Rochester Inst. Tech. /Stanford U., Phys. Dept. /Pennsylvania U.

2007-09-14

The Sloan Digital Sky Survey-II (SDSS-II) has embarked on a multi-year project to identify and measure light curves for intermediate-redshift (0.05 < z < 0.35) Type Ia supernovae (SNe Ia) using repeated five-band (ugriz) imaging over an area of 300 sq. deg. The survey region is a stripe 2.5 degrees wide centered on the celestial equator in the Southern Galactic Cap that has been imaged numerous times in earlier years, enabling construction of a deep reference image for discovery of new objects. Supernova imaging observations are being acquired between 1 September and 30 November of 2005-7. During the first two seasons, each region was imaged on average every five nights. Spectroscopic follow-up observations to determine supernova type and redshift are carried out on a large number of telescopes. In its first two three-month seasons, the survey has discovered and measured light curves for 327 spectroscopically confirmed SNe Ia, 30 probable SNe Ia, 14 confirmed SNe Ib/c, 32 confirmed SNe II, plus a large number of photometrically identified SNe Ia, 94 of which have host-galaxy spectra taken so far. This paper provides an overview of the project and briefly describes the observations completed during the first two seasons of operation.

Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

Directory of Open Access Journals (Sweden)

Amir V. Tavakoli

2017-09-01

Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

Engineering constraints and computer-aided optimization of electrostatic lens systems

International Nuclear Information System (INIS)

Steen, H.W.G. van der; Barth, J.E.; Adriaanse, J.P.

1990-01-01

An optimization tool for the design of electrostatic lens systems with axial symmetry is presented. This tool is based on the second-order electrode method combined with a multivariable numerical optimization procedure. The second-order electrode method makes a cubic spline approximation to the axial potential for a given electrode shape. With the help of this approximation, a numerical optimization can be done. To demonstrate this optimization tool, a lens system for Auger analyses is optimized. It is shown that variations in the practical constraints imposed on the design, like maximum electrode potential or maximum lens diameter, have strong effects on the obtainable lens quality. It is concluded that a numerical optimization does not take over the lens designer's job, but allows him to thoroughly examine the optical consequences of engineering choices by finding the optimum design for each set of constraints. (orig.)

The ocular response to extended wear of a high Dk silicone hydrogel contact lens.

Science.gov (United States)

Fonn, Desmond; MacDonald, Karen E; Richter, Doris; Pritchard, Nicola

2002-05-01

A four-month extended wear clinical trial was conducted to compare the ocular effects of a high Dk Balafilcon A silicone hydrogel lens and a low Dk HEMA 38.6 per cent H20 soft lens. Twenty-four subjects who were adapted to daily wear of soft lenses wore a high Dk lens in one eye and a low Dk HEMA lens in the other eye for four months on an extended wear basis after one week of daily wear. Thirteen progress evaluations were conducted using standard clinical procedures. Eighteen subjects (75 per cent) completed the study. The high Dk lens induced significantly less bulbar and limbal injection and corneal vascularisation than the low Dk HEMA lens (p Dk lens. A significant increase in myopia was found in the eyes wearing the low Dk HEMA lens (mean = 0.50 D, p Dk lens. Three subjects developed small infiltrates in the high Dk lens wearing eyes and significantly more post-lens debris was observed under the high Dk lens. Six subjects developed papillary conjunctivitis in the eye wearing silicone hydrogel lenses but only two of those were discontinued from the study. No hypoxia-related effects were observed with extended wear of the high Dk Balafilcon A silicone hydrogel lens.

3D Inkjet Printed Helical Antenna with Integrated Lens

KAUST Repository

Farooqui, Muhammad Fahad

2016-08-30

The gain of an antenna can be enhanced through the integration of a lens, although this technique has traditionally been restricted to planar antennas due to fabrication limitations of standard manufacturing processes. Here, through a unique combination of 3D and 2D inkjet printing of dielectric and metallic inks respectively, we demonstrate a lens that has been monolithically integrated to a non-planar antenna (helix) for the first time. Antenna measurements show that the integration of a Fresnel lens enhances the gain of a 2-turn helix by around 4.6 dB, which provides a peak gain of about 12.9 dBi at 8.8 GHz. The 3-dB axial ratio (AR) bandwidth of the antenna with the lens is 5.5%. This work also reports the complete characterization of this new process in terms of minimum features sizes and achievable conductivities. Due to monolithic integration of the lens through a fully printed process, this antenna configuration offers high gain performance by using a low cost and rapid fabrication technique. © 2016 IEEE.

Radiation dose to physicians’ eye lens during interventional radiology

International Nuclear Information System (INIS)

Bahruddin, N A; Hashim, S; Karim, M K A; Ang, W C; Salehhon, N; Sabarudin, A; Bakar, K A

2016-01-01

The demand of interventional radiology has increased, leading to significant risk of radiation where eye lens dose assessment becomes a major concern. In this study, we investigate physicians' eye lens doses during interventional procedures. Measurement were made using TLD-100 (LiF: Mg, Ti) dosimeters and was recorded in equivalent dose at a depth of 0.07 mm, Hp(0.07). Annual Hp(0.07) and annual effective dose were estimated using workload estimation for a year and Von Boetticher algorithm. Our results showed the mean Hp(0.07) dose of 0.33 mSv and 0.20 mSv for left and right eye lens respectively. The highest estimated annual eye lens dose was 29.33 mSv per year, recorded on left eye lens during fistulogram procedure. Five physicians had exceeded 20 mSv dose limit as recommended by international commission of radiological protection (ICRP). It is suggested that frequent training and education on occupational radiation exposure are necessary to increase knowledge and awareness of the physicians’ thus reducing dose during the interventional procedure. (paper)

Addendum report of the JHPS expert committee on radiation protection of the lens of the eye (1). Eye lens dosimetry R and D, and radiation management and estimated eye-lens exposure for workers in Japanese nuclear power plants

International Nuclear Information System (INIS)

Akahane, Keiichi; Tatsuzaki, Hideo; Iimoto, Takeshi; Ichiji, Takeshi; Hamada, Nobuyuki; Iwai, Satoshi; Ohguchi, Hiroyuki; Ohno, Kazuko; Katoh, Masahiro; Kurosawa, Tadahiro; Kawaura, Chiyo; Tsujimura, Norio; Hayashida, Toshiyuki; Hotta, Yutaka; Yamasaki, Tadashi; Yokoyama, Sumi

2015-01-01

The Expert Committee on Radiation Protection of the Lens of the Eye was established under the Japan Health Physics Society in April, 2013 (completed, March, 2015). The Committee looked at new/revised documents and standards related to the eye lens published by international organizations such as the International Commission on Radiological Protection (ICRP) and the International Commission on Radiation Units and Measurements (ICRU). The Committee also examined recent and previous studies related to eye-lens radiation exposure and dosimetry in Japan. These findings were published in this journal as the Interim Report of the Committee. Since then, the Committee expanded its activity to give an overview the current progress of eye-lens dosimetry R and D at the National Institute of Advanced Industrial Science and Technology, along with research related to radiation management and estimated eye-lens exposure of Japanese nuclear-power-plant workers (including those at Fukushima Daiichi Nuclear Power Plant) for publishing an addendum Committee report. These additional findings are reported here. (author)

Contrast sensitivity after refractive lens exchange with a multifocal diffractive aspheric intraocular lens

Directory of Open Access Journals (Sweden)

Teresa Ferrer-Blasco

2013-04-01

Full Text Available PURPOSE: To evaluate distance and near contrast sensitivity (CS under photopic and mesopic conditions before and after refractive lens exchange (RLE and implantation of the aspheric AcrySof®ReSTOR® (SN6AD3 model intraocular lens (IOL. METHODS:Seventy-four eyes of 37 patients after RLE underwent bilateral implantation with the aspheric AcrySof ReSTOR IOL. The patient sample was divided into myopic and hyperopic groups. Monocular uncorrected visual acuity at distance and near (UCVA and UCNVA, respectively and monocular best corrected visual acuity at distance and near (BCVA and BCNVA, respectively were measured before and 6 months postoperatively. Monocular CS function was measured at three different luminance levels (85, 5 and 2.5 cd/m² before and after RLE. Post-implantation results at 6 months were compared with those found before surgery. RESULTS: Our results revealed that patients in both groups obtained good UCVA and BCVA after RLE at distance and near vision in relation to pre-surgery values. No statistically significant differences were found between the values of CS pre and post-RLE at distance and near, at any lighting condition and spatial frequency (p>0.002. CONCLUSIONS: Refractive lens exchange with aspheric AcrySof ReSTOR IOL in myopic and hyperopic population provided good visual function and yield good distance and near CS under photopic and mesopic conditions.

Crystalline lens thickness determines the perceived chromatic difference in magnification.

Science.gov (United States)

Chen, Yun; Schaeffel, Frank

2014-03-01

Since the origin of the high interindividual variability of the chromatic difference in retinal image magnification (CDM) in the human eye is not well understood, optical parameters that might determine its magnitude were studied in 21 healthy subjects with ages ranging from 21 to 58 years. Two psychophysical procedures were used to quantify CDM. They produced highly correlated results. First, a red and a blue square, presented on a black screen, had to be matched in size by the subjects with their right eyes. Second, a filled red and blue square, flickering on top of each other at 2 Hz, had to be adjusted in perceived brightness and then in size to minimize the impression of flicker. CDM varied widely among subjects from 0.0% to 3.6%. Biometric ocular parameters were measured with low coherence interferometry and crystalline lens tilt and decentration with a custom-built Purkinjemeter. Correlations were studied between CDM and corneal power, anterior chamber depth, lens thickness, lens tilt and lens decentration, and vitreous chamber depths. Lens thickness was found significantly correlated with CDM and accounted for 64% of its variance. Vertical lens tilt and decentration were also significantly correlated. It was also found that CDM increased by 3.5% per year, and part of this change can be attributed to the age-related increase in lens thickness.

[Magnetic resonance imaging study of effects of accommodation on human lens morphological characters].

Science.gov (United States)

Zheng, Sui-lian; Zhang, Ai; Shi, Jian-jing; Zhou, Yun-xin

2013-11-05

To evaluate the effects of accommodation on lens morphological characters. From January 2011 to June 2011, magnetic resonance images of eyes were acquired from 30 subjects aged 20 to 24 years during accommodation and at rest. The optimal images were analyzed by Autocad 2010 to obtain the total lens cross-sectional area (CSA) and CSA of anterior and posterior portions of lens, anterior chamber depth, lens thickness, lens diameter, vitreous chamber depth and axial length during accommodation and at rest. Paired-t test was performed. The anterior curvature radius (mm), posterior curvature radius (mm), CSA of anterior portion (mm(2)), CSA of posterior portion (mm(2)), total lens CSA (mm(2)) was (8.7 ± 0.8), (6.2 ± 0.5), (7.5 ± 2.1), (12.0 ± 2.6), (20 ± 4) during relaxed accommodation; anterior curvature radius (mm), posterior curvature radius (mm), CSA of anterior portion (mm(2)), CSA of posterior portion (mm(2)), total lens CSA (mm(2)) was (7.1 ± 1.3), (5.6 ± 0.5), (14.7 ± 2.9), (12.2 ± 2.1) and (27 ± 4) during accommodation. The total lens CSA (t = -11.556, P 0.05) under a statistically independent accommodative state. There was significant difference in the anterior chamber depth (t = 4.366, P 0.05) and axial length (t = 0.418, P > 0.05) under accommodative states. During accommodation, the anterior chamber depth decreases, lens thickness increases and diameter of lens decreases while anterior portions and total lens CSA increase. There are insignificant changes in posterior portions of lens CSA, vitreous chamber depth and axial length. The accommodative changes in CSA indicate that the anterior portion of lens may be related with the properties of anterior capsule and lens material, the position of zonular attachments and the location of fetal nucleus. Helmholtz theory is supported.

Lens subluxation grading system: predictive value for ectopia lentis surgical outcomes

OpenAIRE

Mauro Waiswol; Niro Kasahara

2009-01-01

Objective: To present a classification system to grade ectopia lentis and to assess its usefulness as a predictor for surgical outcomes. Methods: Fifty-one eyes of 28 patients with either simple (19 patients) or Marfan syndrome-associated ectopia lentis (nine patients) with variable degrees of subluxation were operated on. Lens subluxation intensity was graded according to the lens subluxation grading system (LSGS) from grade 1 (lens on the whole pupillary area) up to grade 4 (lens absent fro...

Magnifying lens for 800 MeV proton radiography

International Nuclear Information System (INIS)

Merrill, F. E.; Campos, E.; Espinoza, C.; Hogan, G.; Hollander, B.; Lopez, J.; Mariam, F. G.; Morley, D.; Morris, C. L.; Murray, M.; Saunders, A.; Schwartz, C.; Thompson, T. N.

2011-01-01

This article describes the design and performance of a magnifying magnetic-lens system designed, built, and commissioned at the Los Alamos National Laboratory (LANL) for 800 MeV flash proton radiography. The technique of flash proton radiography has been developed at LANL to study material properties under dynamic loading conditions through the analysis of time sequences of proton radiographs. The requirements of this growing experimental program have resulted in the need for improvements in spatial radiographic resolution. To meet these needs, a new magnetic lens system, consisting of four permanent magnet quadrupoles, has been developed. This new lens system was designed to reduce the second order chromatic aberrations, the dominant source of image blur in 800 MeV proton radiography, as well as magnifying the image to reduce the blur contribution from the detector and camera systems. The recently commissioned lens system performed as designed, providing nearly a factor of three improvement in radiographic resolution.

Pseudomonas aeruginosa Survival at Posterior Contact Lens Surfaces after Daily Wear

Science.gov (United States)

Wu, Yvonne T.; Zhu, Lucia S.; Tam, K. P. Connie; Evans, David J.; Fleiszig, Suzanne M. J.

2015-01-01

Purpose Pseudomonas aeruginosa keratitis is a sight-threatening complication of contact lens wear, yet mechanisms by which lenses predispose to infection remain unclear. Here, we tested the hypothesis that tear fluid at the posterior contact lens surface can lose antimicrobial activity over time during lens wear. Methods Daily disposable lenses were worn for 1, 2, 4, 6 or 8 h immediately after removal from their packaging, or after presoaking in sterile saline for 2 days to remove packaging solution. Unworn lenses were also tested, some coated in tears “aged” in vitro for 1 or 8 h. Lenses were placed anterior surface down into tryptic soy agar cradles containing gentamicin (100µg/ml) to kill bacteria already on the lens, and posterior surfaces inoculated with gentamicin-resistant P. aeruginosa for 3 h. Surviving bacteria were enumerated by viable counts of lens homogenates. Results Posterior surfaces of lenses worn by patients for 8 h supported more P. aeruginosa growth than lenses worn for only 1 h, if lenses were presoaked prior to wear (~ 2.4-fold, p = 0.01). This increase was offset if lenses were not presoaked to remove packaging solution (p = 0.04 at 2 h and 4 h). Irrespective of presoaking, lenses worn for 8 h showed more growth on their posterior surface than unworn lenses coated with tear fluid that was “aged” for 8 h vitro (~8.6-fold, presoaked, p = 0.003: ~ 5.4-fold from packaging solution, p = 0.004). Indeed, in vitro incubation did not impact tear antimicrobial activity. Conclusions This study shows that post lens tear fluid can lose antimicrobial activity over time during contact lens wear, supporting the idea that efficient tear exchange under a lens is critical for homeostasis. Additional studies are needed to determine applicability to other lens types, wearing modalities, and relevance to contact lens-related infections. PMID:25955639

Contact Lens-Induced Discomfort and Protein Changes in Tears.

Science.gov (United States)

Masoudi, Simin; Stapleton, Fiona Jane; Willcox, Mark Duncan Perry

2016-08-01

Ocular discomfort is among the main causes of contact lens wear discontinuation. This study investigated the association between subjective ocular comfort ratings and diurnal changes in tear protein concentrations with and without contact lens wear. The study was a prospective, open-label, single-group two-staged investigation. Basal tears were collected from 30 experienced contact lens wearers twice a day (morning and evening) using a noninvasive method without lens wear (stage 1) and during wear of Etafilcon A contact lenses (stage 2) for 7 to 10 days. Subjects rated their ocular comfort on a scale of 1 to 100 (with 100 as extremely comfortable) at each time of tear collection. Tears were analyzed using liquid quadrupole mass spectrometry in conjunction with selected reaction monitoring (SRM) method. End-of-day comfort was reduced when wearing lenses (87.8 ± 14.3 AM vs. 79.2 ± 16.6 PM) compared to no lens wear (88.3 ± 12.6 AM vs. 84.7 ± 13.3 PM) (AM vs. PM, p tears (p < 0.05, r = -0.29). Only the absolute concentration of prolactin-induced protein correlated with subjective comfort ratings. Taking into consideration that prolactin-induced protein can be associated with disruption in water transport in lacrimal glands, our findings may indicate that changes to aqueous secretion are associated with contact lens discomfort.

Radiation dose to the eye lens

DEFF Research Database (Denmark)

Baun, Christina; Falch Braas, Kirsten; D. Nielsen, Kamilla

2015-01-01

Radiation Dose to the Eye Lens: Does Positioning Really Matter? C. Baun1, K. Falch1, K.D. Nielsen2, S. Shanmuganathan1, O. Gerke1, P.F. Høilund-Carlsen1 1Department of Nuclear Medicine, Odense University Hospital, Odense C, Denmark. 2University College Lillebaelt, Odense, Denmark. Aim: The scan...... field in oncology patients undergoing eyes-to-thighs PET/CT must always include the base of the scull according to department guidelines. The eye lens is sensitive to radiation exposure and if possible it should be avoided to scan the eye. If the patient’s head is kipped backwards during the scan one...... might avoid including the eye in the CT scan without losing sufficient visualization of the scull base. The aim of this study was to evaluate the possibility of decreasing the radiation dose to the eye lens, simply by changing the head position, when doing the PET/CT scan from the base of the scull...

Non-invasive pre-lens tear film assessment with high-speed videokeratoscopy.

Science.gov (United States)

Llorens-Quintana, Clara; Mousavi, Maryam; Szczesna-Iskander, Dorota; Iskander, D Robert

2018-02-01

To evaluate the effect of two types of daily contact lenses (delefilcon A and omafilcon A) on the tear film and establish whether it is dependent on pre-corneal tear film characteristics using a new method to analyse high-speed videokeratoscopy recordings, as well as to determine the sensitivity of the method in differentiating between contact lens materials on eye. High-speed videokeratoscopy recordings were analysed using a custom made automated algorithm based on a fractal dimension approach that provides a set of parameters directly related to tear film stability. Fifty-four subjects participated in the study. Baseline measurements, in suppressed and natural blinking conditions, were taken before subjects were fitted with two different daily contact lenses and after four hours of contact lens wear. The method for analysing the stability of the tear film provides alternative parameters to the non-invasive break up time to assess the quality of the pre-corneal and pre-lens tear film. Both contact lenses significantly decreased the quality of the tear film in suppressed and natural blinking conditions (pfilm characteristics were not correlated with the decrease in pre-lens tear film quality. High-speed videokeratoscopy equipped with an automated method to analyse the dynamics of the tear film is able to distinguish between contact lens materials in vivo. Incorporating the assessment of pre-lens tear film to the clinical practice could aid improving contact lens fitting and understand contact lens comfort. Copyright © 2017 British Contact Lens Association. Published by Elsevier Ltd. All rights reserved.

A planar lens based on the electrowetting of two immiscible liquids

International Nuclear Information System (INIS)

Liu Chaoxuan; Park, Jihwan; Choi, Jin-Woo

2008-01-01

This paper reports the development and characterization of a planar liquid lens based on electrowetting. The working concept of electrowetting two immiscible liquids is demonstrated with measurement and characterization of contact angles with regard to externally applied electric voltages. Consequently, a planar liquid lens is designed and implemented based on this competitive electrowetting. A droplet of silicone oil confined in an aqueous solution (1% KCl) works as a liquid lens. Electrowetting then controls the shape of the confined silicone oil and the focal length of the liquid lens varies depending upon an applied dc voltage. A unique feature of this lens design is the double-ring planar electrodes beneath the hydrophobic substrate. While an outer ring electrode provides an initial boundary for the silicone oil droplet, an inner ring works as the actuation electrode for the lens. Further, the planar electrodes, instead of vertical or out-of-plane wall electrodes, facilitate the integration of liquid lenses into microfluidic systems. With the voltage applied in the range of 50–250 V, the confined silicone oil droplet changed its shape and the optical magnification of a 3 mm-diameter liquid lens was clearly demonstrated. Moreover, focal lengths of liquid lenses with diameters of 2 mm, 3 mm and 4 mm were characterized, respectively. The obtained results suggest that a larger lens diameter yields a longer focal length and a wider range of focal length change in response to voltage. The demonstrated liquid lens has a simple structure and is easy to fabricate

Citation parameters of contact lens-related articles published in the ophthalmic literature.

Science.gov (United States)

Cardona, Genís; Sanz, Joan P

2014-09-01

This study aimed at exploring the citation parameters of contact lenses articles published in the Ophthalmology thematic category of the Journal Citation Reports (JCR). The Thompson Reuters Web of Science database was accessed to record bibliometric information and citation parameters of all journals listed under the Ophthalmology area of the 2011 JCR edition, including the journals with main publication interests in the contact lens field. In addition, the same database was used to unveil all contact lens-related articles published in 2011 in the same thematic area, whereupon differences in citation parameters between those articles published in contact lens and non-contact lens-related journals were explored. Significant differences in some bibliometric indicators such as half-life and overall citation count were found between contact lens-related journals (shorter half-life and fewer citations) and the median values for the Ophthalmology thematic area of the JCR. Visual examination of all Ophthalmology journals uncovered a total of 156 contact lens-related articles, published in 28 different journals, with 27 articles each for Contact Lens & Anterior Eye, Eye & Contact Lens, and Optometry and Vision Science. Significant differences in citation parameters were encountered between those articles published in contact lens and non-contact lens source journals. These findings, which disclosed contact lenses to be a fertile area of research, may be of interest to researchers and institutions. Differences in bibliometric indicators are of relevance to avoid unwanted bias when conducting between- and within-discipline comparisons of articles, journals, and researchers.

Pigment dispersion and chronic intraocular pressure elevation after sulcus placement of 3-piece acrylic intraocular lens.

Science.gov (United States)

Almond, M Camille; Wu, Michael C; Chen, Philip P

2009-12-01

A 55-year-old man had phacoemulsification and implantation of a 3-piece acrylic intraocular lens (IOL) (AcrySof MA60AC) in the right eye. One month postoperatively, the intraocular pressure (IOP) was 48 mm Hg and peripheral transillumination defects were noted in the iris circumferentially, with the IOL optic edge visible as a silhouette. Gonioscopy showed dense pigmentation of the trabecular meshwork in the right eye, but in the left eye, only mild trabecular meshwork pigment was seen, along with a concave peripheral iris insertion. At 21 months, the right eye required 3 medications for IOP control. While pigment dispersion has been widely reported after placement of 1-piece acrylic IOLs in the ciliary sulcus, we conclude that in susceptible individuals with a concave peripheral iris insertion, pigment dispersion can occur with sulcus placement of a 3-piece acrylic model despite its thinner optic and angulated haptics.

Optimization of electrostatic lens systems for low-energy scanning microcolumn applications

International Nuclear Information System (INIS)

Oh, Tae-Sik; Kim, Dae-Wook; Ahn, Seungjoon; Kim, Young Chul; Kim, Ho-Seob; Ahn, Seong Joon

2008-01-01

The optimization of a low-energy scanning microcolumn is proposed by adopting a modified Einzel lens sandwiched between an aligner and a deflector. The modified Einzel lens is composed of four electrodes, and the two center electrodes are specially designed quadrupole lenses having keyhole type rather than circular apertures. The outer electrodes of the Einzel lens having circular apertures are grounded, and the quadrupole lens is operated by applying the quadrupole voltages. The effects of the separated deflector system and the static quadrupole lens were investigated by analyzing the scanning electron beam spot at the target, and the results show that the proposed system can improve the performance of the scanning microcolumn

Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

DEFF Research Database (Denmark)

Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

2009-01-01

This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

[Bioinorganic chemical composition of the lens and methods of its investigation].

Science.gov (United States)

Avetisov, S E; Novikov, I A; Pakhomova, N A; Motalov, V G

2018-01-01

Bioinorganic chemical composition of the lens of human and experimental animals (cows, dogs, rats, rabbits) have been analyzed in various studies. In most cases, the studies employed different methods to determine the gross (total) composition of chemical elements and their concentrations in the examined samples. Less frequently, they included an assessment of the distribution of chemical elements in the lens and correlation of their concentration with its morphological changes. Chemical elements from all groups (series) of the periodic classification system were discovered in the lens substance. Despite similar investigation methods, different authors obtained contradicting results on the chemical composition of the lens. This article presents data suggesting possible correlation between inorganic chemical elements in the lens substance with the development and formation of lenticular opacities. All currently employed methods are known to only analyze limited number of select chemical elements in the tissues and do not consider the whole range of elements that can be analyzed with existing technology; furthermore, the majority of studies are conducted on the animal model lens. Therefore, it is feasible to continue the development of the chemical microanalysis method by increasing the sensitivity of Scanning Electron Microscopy with Energy Dispersive Spectroscopy (SEM/EDS) with the purpose of assessing the gross chemical composition and distribution of the elements in the lens substance, as well as revealing possible correlation between element concentration and morphological changes in the lens.

Lens Design Using Group Indices of Refraction

Science.gov (United States)

Vaughan, A. H.

1995-01-01

An approach to lens design is described in which the ratio of the group velocity to the speed of light (the group index) in glass is used, in conjunction with the more familiar phase index of refraction, to control certain chromatic properties of a system of thin lenses in contact. The first-order design of thin-lens systems is illustrated by examples incorporating the methods described.

Vortexlike Power Flow at the Interfaces of Metamaterial Lens

Directory of Open Access Journals (Sweden)

K. Fang

2012-10-01

Full Text Available The metamaterial lens with DPS/DNS/DPS structure has been realized by using the two-dimensional (2D isotropic transmission line approach. We studied the vortexlike power flow at the interfaces of metamaterial lens and validated by the finite-difference time-domain (FDTD simulator. The computational results showing its different conditions near DPS/DNS and other kinds of interfaces are obtained by CST STUDIO SUITE at different frequencies, and demonstrate the intuitionistic power location at the metamaterial lens interfaces.

Characterisation of AC1: a naturally decaffeinated coffee

Directory of Open Access Journals (Sweden)

Luciana Benjamim Benatti

2012-01-01

Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

Photonic crystal based polarization insensitive flat lens

International Nuclear Information System (INIS)

Turduev, M; Bor, E; Kurt, H

2017-01-01

The paper proposes a new design of an inhomogeneous artificially created photonic crystal lens structure consisting of annular dielectric rods to efficiently focus both transverse electric and transverse magnetic polarizations of light into the same focal point. The locations of each individual cell that contains the annular dielectric rods are determined according to a nonlinear distribution function. The inner and outer radii of the annular photonic dielectric rods are optimized with respect to the polarization insensitive frequency response of the transmission spectrum of the lens structure. The physical background of the polarization insensitive focusing mechanism is investigated in both spatial and frequency domains. Moreover, polarization independent wavefront transformation/focusing has been explored in detail by investigating the dispersion relation of the structure. Corresponding phase index distribution of the lens is attained for polarization insensitive normalized frequency range of a / λ   =  0.280 and a / λ   =  0.300, where a denotes the lattice constant of the designed structure and λ denotes the wavelength of the incident light. We show the wave transformation performance and focal point movement dynamics for both polarizations of the lens structure by specially adjusting the length of the structure. The 3D finite-difference time domain numerical analysis is also performed to verifiy that the proposed design is able to focus the wave regardless of polarization into approximately the same focal point (difference between focal distances of both polarizations stays below 0.25 λ ) with an operating bandwidth of 4.30% between 1476 nm and 1541 nm at telecom wavelengths. The main superiorities of the proposed lens structure are being all dielectric and compact, and having flat front and back surfaces, rendering the proposed lens design more practical in the photonic integration process in various applications such as optical switch

A multi-channel AC power supply controller

International Nuclear Information System (INIS)

Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei

2003-01-01

A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system

A role for smoothened during murine lens and cornea development.

Directory of Open Access Journals (Sweden)

Janet J Y Choi

Full Text Available Various studies suggest that Hedgehog (Hh signalling plays roles in human and zebrafish ocular development. Recent studies (Kerr et al., Invest Ophthalmol Vis Sci. 2012; 53, 3316-30 showed that conditionally activating Hh signals promotes murine lens epithelial cell proliferation and disrupts fibre differentiation. In this study we examined the expression of the Hh pathway and the requirement for the Smoothened gene in murine lens development. Expression of Hh pathway components in developing lens was examined by RT-PCR, immunofluorescence and in situ hybridisation. The requirement of Smo in lens development was determined by conditional loss-of-function mutations, using LeCre and MLR10 Cre transgenic mice. The phenotype of mutant mice was examined by immunofluorescence for various markers of cell cycle, lens and cornea differentiation. Hh pathway components (Ptch1, Smo, Gli2, Gli3 were detected in lens epithelium from E12.5. Gli2 was particularly localised to mitotic nuclei and, at E13.5, Gli3 exhibited a shift from cytosol to nucleus, suggesting distinct roles for these transcription factors. Conditional deletion of Smo, from ∼E12.5 (MLR10 Cre did not affect ocular development, whereas deletion from ∼E9.5 (LeCre resulted in lens and corneal defects from E14.5. Mutant lenses were smaller and showed normal expression of p57Kip2, c-Maf, E-cadherin and Pax6, reduced expression of FoxE3 and Ptch1 and decreased nuclear Hes1. There was normal G1-S phase but decreased G2-M phase transition at E16.5 and epithelial cell death from E14.5-E16.5. Mutant corneas were thicker due to aberrant migration of Nrp2+ cells from the extraocular mesenchyme, resulting in delayed corneal endothelial but normal epithelial differentiation. These results indicate the Hh pathway is required during a discrete period (E9.5-E12.5 in lens development to regulate lens epithelial cell proliferation, survival and FoxE3 expression. Defective corneal development occurs

An extended magnetic quadrupole lens for a high-resolution nuclear microprobe

Energy Technology Data Exchange (ETDEWEB)

Breese, M.B.H. E-mail: m.breese@surrey.ac.uk; Grime, G.W.; Linford, W.; Harold, M

1999-09-02

This paper describes the design requirements and initial performance of a new style of magnetic quadrupole lens for use in a high-resolution nuclear microprobe, which is presently being constructed in Oxford. Such a microprobe necessitates the use of a small image distance from the exit face of the final quadrupole lens to the image plane in order to produce a large demagnification. This means that the final lens should be as close to the sample chamber as possible. However, with conventional magnetic quadrupoles the current-carrying coils protrude by a typical distance of 10-20 mm beyond the pole face, thereby significantly limiting the minimum image distance. The approach taken here is to recess the coils into the body of the lens, so that they are almost flush with the pole pieces and lens yoke, enabling an image distance of 55 mm. Three-dimensional magnetic field calculations within this lens structure predict that the field in the extended pole piece 'nose' region is only slightly less than that in the main lens body. Experimental field profiles, measured using a Hall probe, are used to confirm these calculations.

An extended magnetic quadrupole lens for a high-resolution nuclear microprobe

International Nuclear Information System (INIS)

Breese, M.B.H.; Grime, G.W.; Linford, W.; Harold, M.

1999-01-01

This paper describes the design requirements and initial performance of a new style of magnetic quadrupole lens for use in a high-resolution nuclear microprobe, which is presently being constructed in Oxford. Such a microprobe necessitates the use of a small image distance from the exit face of the final quadrupole lens to the image plane in order to produce a large demagnification. This means that the final lens should be as close to the sample chamber as possible. However, with conventional magnetic quadrupoles the current-carrying coils protrude by a typical distance of 10-20 mm beyond the pole face, thereby significantly limiting the minimum image distance. The approach taken here is to recess the coils into the body of the lens, so that they are almost flush with the pole pieces and lens yoke, enabling an image distance of 55 mm. Three-dimensional magnetic field calculations within this lens structure predict that the field in the extended pole piece 'nose' region is only slightly less than that in the main lens body. Experimental field profiles, measured using a Hall probe, are used to confirm these calculations

Bioinformatics and Astrophysics Cluster (BinAc)

Science.gov (United States)

Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

2017-09-01

BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

Aero-acoustics noise assessment for Wind-Lens turbine

International Nuclear Information System (INIS)

Hashem, I.; Mohamed, M.H.; Hafiz, A.A.

2017-01-01

This paper introduces an aero-acoustic computational study that investigates the noise caused by one of the most promising wind energy conversion concepts, namely the 'Wind-Lens' technology. The hybrid method - where the flow field and acoustic field are solved separately, was deemed to be an appropriate tool to compute this study. The need to investigate this phenomenon increased gradually, since the feasibility of utilizing Wind-Lens turbine within densely populated cities and urban areas depends largely on their noise generation. Ffowcs Williams-Hawkings (FW-H) equation and its integral solution are used to predict the noise radiating to the farfield. CFD Simulations of transient three-dimensional flow field using (URANS) unsteady Reynolds-averaged Navier-Stokes equations are computed to acquire the acoustic sources location and sound intensity. Then, the noise propagates from the before-mentioned sources to pre-defined virtual microphones positioned in different locations. ANSYS-FLUENT is used to calculate the flow field on and around such turbines which is required for the FW-H code. Some effective parameters are investigated such as Wind-Lens shape, brim height and tip speed ratio. Comparison of the noise emitted from the bare wind turbine and different types of Wind-Lens turbine reveals that, the Wind-Lens generates higher noise intensity. - Highlights: • Aero-acoustic noise generated by wind turbines are one of the major challenges. • Noise from wind turbine equipped with a brimmed diffuser is investigated. • A computational aero-acoustic study using the hybrid method is introduced. • Effective parameters are studied such Wind-Lens shape, brim height and speed ratio. • The optimal shape has a moderate power coefficient and the less noise generation.

Eye lens dosimetry for interventional procedures – Relation between the absorbed dose to the lens and dose at measurement positions

International Nuclear Information System (INIS)

Geber, Therese; Gunnarsson, Mikael; Mattsson, Sören

2011-01-01

This study investigated the relationship between the absorbed dose to the lens of the eye and the absorbed dose at different measurement positions near the eye of interventional radiologists. It also visualised the dose distribution inside the head, both when protective eyewear were used and without such protection. The best position for an eye lens dosimeter was found to be at the side of the head nearest to the radiation source, close to the eye. Positioning the dosimeter at the eyebrow could lead to an underestimation of the lens dose of as much as 45%. The measured dose distribution showed that the absorbed dose to the eye lenses was high compared to the other parts of the head, which stresses the importance of wearing protective eyewear. However, many models of eyewear were found to be deficient as the radiation could slip through at several places, e.g. at the cheek. The relationship between the absorbed dose to the lens and the kerma-area-product (P KA ) delivered to the patient was also studied.

Liquid lens: advances in adaptive optics

Science.gov (United States)

Casey, Shawn Patrick

2010-12-01

'Liquid lens' technologies promise significant advancements in machine vision and optical communications systems. Adaptations for machine vision, human vision correction, and optical communications are used to exemplify the versatile nature of this technology. Utilization of liquid lens elements allows the cost effective implementation of optical velocity measurement. The project consists of a custom image processor, camera, and interface. The images are passed into customized pattern recognition and optical character recognition algorithms. A single camera would be used for both speed detection and object recognition.

Manufacturing PDMS micro lens array using spin coating under a multiphase system

International Nuclear Information System (INIS)

Sun, Rongrong; Yang, Hanry; Rock, D Mitchell; Danaei, Roozbeh; Panat, Rahul; Kessler, Michael R; Li, Lei

2017-01-01

The development of micro lens arrays has garnered much interest due to increased demand of miniaturized systems. Traditional methods for manufacturing micro lens arrays have several shortcomings. For example, they require expensive facilities and long lead time, and traditional lens materials (i.e. glass) are typically heavy, costly and difficult to manufacture. In this paper, we explore a method for manufacturing a polydimethylsiloxane (PDMS) micro lens array using a simple spin coating technique. The micro lens array, formed under an interfacial tension dominated system, and the influence of material properties and process parameters on the fabricated lens shape are examined. The lenses fabricated using this method show comparable optical properties—including surface finish and image quality—with a reduced cost and manufacturing lead time. (paper)

Status of eye lens radiation dose monitoring in European hospitals

International Nuclear Information System (INIS)

Carinou, Eleftheria; Ginjaume, Merce; O’Connor, Una; Kopec, Renata; Sans Merce, Marta

2014-01-01

A questionnaire was developed by the members of WG12 of EURADOS in order to establish an overview of the current status of eye lens radiation dose monitoring in hospitals. The questionnaire was sent to medical physicists and radiation protection officers in hospitals across Europe. Specific topics were addressed in the questionnaire such as: knowledge of the proposed eye lens dose limit; monitoring and dosimetry issues; training and radiation protection measures. The results of the survey highlighted that the new eye lens dose limit can be exceeded in interventional radiology procedures and that eye lens protection is crucial. Personnel should be properly trained in how to use protective equipment in order to keep eye lens doses as low as reasonably achievable. Finally, the results also highlighted the need to improve the design of eye dosemeters in order to ensure satisfactory use by workers. (paper)

Número de anteras por flor, grãos de pólen por antera e capacidade germinativa do pólen de diferentes cultivares de macieiras

Directory of Open Access Journals (Sweden)

Celso Lopes de Albuquerque Junior

2010-12-01

Full Text Available O objetivo deste trabalho foi avaliar o número de anteras por flor, grãos de pólen por antera e capacidade germinativa do pólen de diferentes cultivares de macieiras. O trabalho foi executado no Laboratório de Fisiologia do Desenvolvimento e Genética Vegetal da Universidade Federal de Santa Catarina, e as coletas a campo foram realizadas na Epagri/Estação Experimental de Caçador-SC, em outubro de 2005. Foram utilizadas as seguintes cultivares comerciais de macieira desenvolvidas no Brasil: Primícia, Princesa, Fred Hough, Catarina, Baronesa, Lisgala, Suprema, Condessa, Daiane, Duquesa, Imperatriz e Joaquina. As cultivares de macieira Condessa, Princesa, Eva, Duquesa, Imperatriz, Gala, Fred Hough, Daiane, Baronesa e Suprema produzem pólen em quantidade suficiente e com boa capacidade germinativa. A cv. Condessa, embora apresente alta capacidade germinativa de pólen, produz menos anteras e grãos de pólen por antera que as demais. A cv. Princesa é a que apresenta o melhor perfil como polinizadora, por conjugar número de anteras/flor, número de grãos de pólen/antera e capacidade germinativa do pólen mais satisfatórios.

Terahertz lens made out of natural stone.

Science.gov (United States)

Han, Daehoon; Lee, Kanghee; Lim, Jongseok; Hong, Sei Sun; Kim, Young Kie; Ahn, Jaewook

2013-12-20

Terahertz (THz) time-domain spectroscopy probes the optical properties of naturally occurring solid aggregates of minerals, or stones, in the THz frequency range. Refractive index and extinction coefficient measurement reveals that most natural stones, including mudstone, sandstone, granite, tuff, gneiss, diorite, slate, marble, and dolomite, are fairly transparent for THz frequency waves. Dolomite in particular exhibits a nearly uniform refractive index of 2.7 over the broad frequency range from 0.1 to 1 THz. The high index of refraction allows flexibility in lens designing with a shorter accessible focal length or a thinner lens with a given focal length. Good agreement between the experiment and calculation for the THz beam profile confirms that dolomite has high homogeneity as a lens material, suggesting the possibility of using natural stones for THz optical elements.

Invited review article: the electrostatic plasma lens.

Science.gov (United States)

Goncharov, Alexey

2013-02-01

The fundamental principles, experimental results, and potential applications of the electrostatic plasma lens for focusing and manipulating high-current, energetic, heavy ion beams are reviewed. First described almost 50 years ago, this optical beam device provides space charge neutralization of the ion beam within the lens volume, and thus provides an effective and unique tool for focusing high current beams where a high degree of neutralization is essential to prevent beam blow-up. Short and long lenses have been explored, and a lens in which the magnetic field is provided by rare-earth permanent magnets has been demonstrated. Applications include the use of this kind of optical tool for laboratory ion beam manipulation, high dose ion implantation, heavy ion accelerator injection, in heavy ion fusion, and other high technology.

Flat dielectric metasurface lens array for three dimensional integral imaging

Science.gov (United States)

Zhang, Jianlei; Wang, Xiaorui; Yang, Yi; Yuan, Ying; Wu, Xiongxiong

2018-05-01

In conventional integral imaging, the singlet refractive lens array limits the imaging performance due to its prominent aberrations. Different from the refractive lens array relying on phase modulation via phase change accumulated along the optical paths, metasurfaces composed of nano-scatters can produce phase abrupt over the scale of wavelength. In this letter, we propose a novel lens array consisting of two neighboring flat dielectric metasurfaces for integral imaging system. The aspherical phase profiles of the metasurfaces are optimized to improve imaging performance. The simulation results show that our designed 5 × 5 metasurface-based lens array exhibits high image quality at designed wavelength 865 nm.

Lens protection from ionizing radiaton damage with gammaphos

International Nuclear Information System (INIS)

Rozsival, P.; Obenberger, J.; Zaydlar, K.

1986-01-01

Intramuscular administration of gammaphos prior to irradiation with 60 Co in rabbits significantly reduced the weight increase in the lens after irradiation and delayed it by 8 weeks. No marked opacity of lens was observed even after 24 weeks. The decline in the dry matter content in the irradiated lenses was retarded by 8 weeks and the difference between the protected and unprotected animals was statistically significant. The rise in water content in the lenses after irradiation was also delayed by 8 weeks by the administration of gammaphos prior to irradiation. Gammaphos delays the development of changes in the lens after irradiation. (author) 4 figs., 11 refs

Assessment of eye lens doses for workers during interventional radiology procedures

International Nuclear Information System (INIS)

Urboniene, A.; Sadzeviciene, E.; Ziliukas, J.

2015-01-01

The assessment of eye lens doses for workers during interventional radiology (IR) procedures was performed using a new eye lens dosemeter. In parallel, the results of routine individual monitoring were analysed and compared with the results obtained from measurements with a new eye lens dosemeter. The eye lens doses were assessed using H p (3) measured at the level of the eyes and were compared with H p (10) measured with the whole-body dosemeter above the lead collar. The information about use of protective measures, the number of performed interventional procedures per month and their fluoroscopy time was also collected. The assessment of doses to the lens of the eye was done for 50 IR workers at 9 Lithuanian hospitals for the period of 2012-2013. If the use of lead glasses is not taken into account, the estimated maximum annual dose equivalent to the lens of the eye was 82 mSv. (authors)

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

Temporal properties of the lens eyes of the box jellyfish Tripedalia cystophora

DEFF Research Database (Denmark)

O'Connor, Megan; Nilsson, Dan-E; Garm, Anders Lydik

2010-01-01

Box jellyWsh (Cubomedusae) are visually orientating animals which posses a total of 24 eyes of 4 morphological types; 2 pigment cup eyes (pit eye and slit eye) and 2 lens eyes [upper lens-eye (ule) and lower lens-eye (lle)]. In this study, we use electroretinograms (ERGs) to explore temporal...... properties of the two lens eyes. We Wnd that the ERG of both lens eyes are complex and using sinusoidal Xicker stimuli we Wnd that both lens eyes have slow temporal resolution. The average Xicker fusion frequency (FFF) was found to be approximately 10 Hz for the ule and 8 Hz for the lle. Di......Verences in the FFF and response patterns between the two lens eyes suggest that the ule and lle Wlter information diVerently in the temporal domain and thus are tuned to perform diVerent visual tasks. The data collected in this study support the idea that the visual system of box jellyWsh is a collection of special...

Diffusion of nanoparticles into the capsule and cortex of a crystalline lens

International Nuclear Information System (INIS)

Schachar, Ronald A; Chen Wei; Woo, Boon K; Pierscionek, Barbara K; Zhang, Xing; Ma, Lun

2008-01-01

The purpose of this study is to determine the ability of fluorescent nanoparticles to diffuse into a crystalline lens. Intact porcine lenses from five-month-old pigs, intact human lenses obtained from three donors aged 41, 42 and 45 years, and sections of human lens cortex obtained from four donors aged 11, 19, 32, and 34 years were incubated for 72 h at 7 deg. C in aqueous solutions of green (566 nm) and red (652 nm) fluorescent water soluble cadmium tellurium (CdTe) nanoparticles. As demonstrated by fluorescent and confocal microscopy, the CdTe nanoparticles diffused into the porcine and human lens capsule and into human cortical lens fibres; however, the nanoparticles did not pass through the intact lens capsule. Nanoparticles can be used as a method for studying intracellular structure and biochemical pathways within the lens capsule and cortical lens fibres to further understand cataractogenesis and may serve as a carrier for chemotherapeutic agents for the potential treatment of primary and secondary cataracts

Optical aberrations in a spinning pipe gas lens

CSIR Research Space (South Africa)

Mafusire, C

2008-06-01

Full Text Available If a heated pipe is rotated about its axis, a density gradient is formed which results in the pipe acting as a graded index lens. In this study the authors revisit the concept of a spinning pipe gas lens and for the first time analyse both the wave...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... One Use Facts About Colored Contacts and Halloween Safety Colored Contact Lens Facts Over-the-Counter Costume ... Costume Contact Lenses Can Ruin Vision Eye Makeup Safety In fact, it is illegal to sell colored ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... had not been properly fitted by an eye care professional, the lenses stuck to my eye like ... lenses do not require the same level of care or consideration as a standard contact lens because ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... sell contacts without a prescription are breaking the law, and may be fined $11,000 per violation. " ... wear any kind of contact lens. In Butler's case, the lenses caused an infection and left her ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... glow-in-the-dark lizard lenses, costume contacts can certainly add a spooky, eye-popping touch. But ... consideration as a standard contact lens because they can be purchased over-the-counter or on the ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... With Proper Contact Lens Care Apr 23, 2018 Solar Eclipse Inflicts Damage in the Shape of the ... edging closer, thanks to a wave of new technologies aiming to fix failing eye parts with human- ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... not require the same level of care or consideration as a standard contact lens because they can ... sell contacts without a prescription are breaking the law, and may be fined $11,000 per violation. " ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... contacto de color Sep. 26, 2013 It started as an impulsive buy from a souvenir shop, but ... require the same level of care or consideration as a standard contact lens because they can be ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... be purchased over-the-counter or on the Internet," says Thomas Steinemann, MD, professor of ophthalmology at ... ask for a prescription. There is no such thing as a "one size fits all" contact lens. ...

Colored Contact Lens Dangers

Medline Plus

Full Text Available ... not require the same level of care or consideration as a standard contact lens because they can ... Us About the Academy Jobs at the Academy Financial Relationships with Industry Medical Disclaimer Privacy Policy Terms ...

Electro-optically actuated liquid-lens zoom

Science.gov (United States)

Pütsch, O.; Loosen, P.

2012-06-01

Progressive miniaturization and mass market orientation denote a challenge to the design of dynamic optical systems such as zoom-lenses. Two working principles can be identified: mechanical actuation and application of active optical components. Mechanical actuation changes the focal length of a zoom-lens system by varying the axial positions of optical elements. These systems are limited in speed and often require complex coupled movements. However, well established optical design approaches can be applied. In contrast, active optical components change their optical properties by varying their physical structure by means of applying external electric signals. An example are liquidlenses which vary their curvatures to change the refractive power. Zoom-lenses benefit from active optical components in two ways: first, no moveable structures are required and second, fast response characteristics can be realized. The precommercial development of zoom-lenses demands simplified and cost-effective system designs. However the number of efficient optical designs for electro-optically actuated zoom-lenses is limited. In this paper, the systematic development of an electro-optically actuated zoom-lens will be discussed. The application of aberration polynomials enables a better comprehension of the primary monochromatic aberrations at the lens elements during a change in magnification. This enables an enhanced synthesis of the system behavior and leads to a simplified zoom-lens design with no moving elements. The change of focal length is achieved only by varying curvatures of targeted integrated electro-optically actuated lenses.

Amphibians and Reptiles of the state of Nuevo Le?n, Mexico

OpenAIRE

Lemos-Espinal, Julio A.; Smith, Geoffrey R.; Cruz, Alexander

2016-01-01

Abstract We compiled a check list of the herpetofauna of Nuevo Le?n. We documented 132 species (23 amphibians, 109 reptiles), representing 30 families (11 amphibians, 19 reptiles) and 73 genera (17 amphibians, 56 reptiles). Only two species are endemic to Nuevo Le?n. Nuevo Le?n contains a relatively high richness of lizards in the genus Sceloporus . Overlap in the herpetofauna of Nuevo Le?n and states it borders is fairly extensive. Of 130 native species, 102 are considered species of Least C...

LC-lens array with light field algorithm for 3D biomedical applications

Science.gov (United States)

Huang, Yi-Pai; Hsieh, Po-Yuan; Hassanfiroozi, Amir; Martinez, Manuel; Javidi, Bahram; Chu, Chao-Yu; Hsuan, Yun; Chu, Wen-Chun

2016-03-01

In this paper, liquid crystal lens (LC-lens) array was utilized in 3D bio-medical applications including 3D endoscope and light field microscope. Comparing with conventional plastic lens array, which was usually placed in 3D endoscope or light field microscope system to record image disparity, our LC-lens array has higher flexibility of electrically changing its focal length. By using LC-lens array, the working distance and image quality of 3D endoscope and microscope could be enhanced. Furthermore, the 2D/3D switching ability could be achieved if we turn off/on the electrical power on LClens array. In 3D endoscope case, a hexagonal micro LC-lens array with 350um diameter was placed at the front end of a 1mm diameter endoscope. With applying electric field on LC-lens array, the 3D specimen would be recorded as from seven micro-cameras with different disparity. We could calculate 3D construction of specimen with those micro images. In the other hand, if we turn off the electric field on LC-lens array, the conventional high resolution 2D endoscope image would be recorded. In light field microscope case, the LC-lens array was placed in front of the CMOS sensor. The main purpose of LC-lens array is to extend the refocusing distance of light field microscope, which is usually very narrow in focused light field microscope system, by montaging many light field images sequentially focusing on different depth. With adjusting focal length of LC-lens array from 2.4mm to 2.9mm, the refocusing distance was extended from 1mm to 11.3mm. Moreover, we could use a LC wedge to electrically shift the optics axis and increase the resolution of light field.