Symbiotic Properties of Sinorhizobium Fredii, J-TGS50 an Indonesian Soybean Nodule Forming Bacteria
International Nuclear Information System (INIS)
Setiyo Hadi Waluyo
2004-01-01
Green House experiments were conducted to study symbiotic properties of Sinorhizobium Fredii, J-TGS50. Sinorhizobium Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217 and Bradyrhizobium japonicum USDA 110 were used as references. Yeast extract mannitol broth culture of the bacteria were made and used as inoculation for several local and imported soybean varieties used in this study. Plants were harvested at 20 days after inoculation. Number of nodules were counted, fresh weight of nodules and shoot were determined. S. Fredii J-TGS50 and S. Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217 were found different in their symbiotic properties. S. Fredii J-TGS50 formed nodules on same imported soybean. While there were no nodules obtained from the plant inoculated with S. Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217. S. Fredii J-TGS50 and recommended B. Japonicum USDA 110 formed nodule on several local soybean varieties. There was no differences between those two bacteria either in nodulation efficiency or in the effectiveness of the formed nodules. Results of this study can be concluded that S. Fredii, J-TGS50 is a native to Indonesian soil and it is a promising soybean nodule forming bacteria in Indonesia. Using indigenous bacteria is valuable. Since they are mostly more tolerant and adaptable than the introduced ones. An important aspect for the success of Biological Nitrogen Fixation (BNF) is insight in the structure of indigenous soybean rhizobia populations. Study on the biodiversity of soybean rhizobia was important conducted. (author)
Bacterial Molecular Signals in the Sinorhizobium fredii-Soybean Symbiosis
Directory of Open Access Journals (Sweden)
Francisco J. López-Baena
2016-05-01
Full Text Available Sinorhizobium (Ensifer fredii (S. fredii is a rhizobial species exhibiting a remarkably broad nodulation host-range. Thus, S. fredii is able to effectively nodulate dozens of different legumes, including plants forming determinate nodules, such as the important crops soybean and cowpea, and plants forming indeterminate nodules, such as Glycyrrhiza uralensis and pigeon-pea. This capacity of adaptation to different symbioses makes the study of the molecular signals produced by S. fredii strains of increasing interest since it allows the analysis of their symbiotic role in different types of nodule. In this review, we analyze in depth different S. fredii molecules that act as signals in symbiosis, including nodulation factors, different surface polysaccharides (exopolysaccharides, lipopolysaccharides, cyclic glucans, and K-antigen capsular polysaccharides, and effectors delivered to the interior of the host cells through a symbiotic type 3 secretion system.
Directory of Open Access Journals (Sweden)
Francisco Pérez-Montaño
Full Text Available Bacterial surface components, especially exopolysaccharides, in combination with bacterial Quorum Sensing signals are crucial for the formation of biofilms in most species studied so far. Biofilm formation allows soil bacteria to colonize their surrounding habitat and survive common environmental stresses such as desiccation and nutrient limitation. This mode of life is often essential for survival in bacteria of the genera Mesorhizobium, Sinorhizobium, Bradyrhizobium, and Rhizobium. The role of biofilm formation in symbiosis has been investigated in detail for Sinorhizobium meliloti and Bradyrhizobium japonicum. However, for S. fredii this process has not been studied. In this work we have demonstrated that biofilm formation is crucial for an optimal root colonization and symbiosis between S. fredii SMH12 and Glycine max cv Osumi. In this bacterium, nod-gene inducing flavonoids and the NodD1 protein are required for the transition of the biofilm structure from monolayer to microcolony. Quorum Sensing systems are also required for the full development of both types of biofilms. In fact, both the nodD1 mutant and the lactonase strain (the lactonase enzyme prevents AHL accumulation are defective in soybean root colonization. The impairment of the lactonase strain in its colonization ability leads to a decrease in the symbiotic parameters. Interestingly, NodD1 together with flavonoids activates certain quorum sensing systems implicit in the development of the symbiotic biofilm. Thus, S. fredii SMH12 by means of a unique key molecule, the flavonoid, efficiently forms biofilm, colonizes the legume roots and activates the synthesis of Nod factors, required for successfully symbiosis.
Guo, Hui Juan; Wang, En Tao; Zhang, Xing Xing; Li, Qin Qin; Zhang, Yan Ming; Tian, Chang Fu; Chen, Wen Xin
2014-02-01
In order to investigate the genetic differentiation of Sinorhizobium strains nodulating Glycine max and related microevolutionary mechanisms, three housekeeping genes (SMc00019, truA, and thrA) and 16 symbiosis-related genes on the chromosome (7 genes), pSymA (6 genes), and pSymB (3 genes) were analyzed. Five distinct species were identified among the test strains by calculating the average nucleotide identity (ANI) of SMc00019-truA-thrA: Sinorhizobium fredii, Sinorhizobium sojae, Sinorhizobium sp. I, Sinorhizobium sp. II, and Sinorhizobium sp. III. These species assignments were also supported by population genetics and phylogenetic analyses of housekeeping genes and symbiosis-related genes on the chromosome and pSymB. Different levels of genetic differentiation were observed among these species or different replicons. S. sojae was the most divergent from the other test species and was characterized by its low intraspecies diversity and limited geographic distribution. Intergenic recombination dominated the evolution of 19 genes from different replicons. Intraspecies recombination happened frequently in housekeeping genes and symbiosis-related genes on the chromosome and pSymB, whereas pSymA genes showed a clear pattern of lateral-transfer events between different species. Moreover, pSymA genes were characterized by a lower level of polymorphism and recombination than those on the chromosome and pSymB. Taken together, genes from different replicons of rhizobia might be involved in the establishment of symbiosis with legumes, but these symbiosis-related genes might have evolved differently according to their corresponding replicons.
Liu, Li Xue; Li, Qin Qin; Zhang, Yun Zeng; Hu, Yue; Jiao, Jian; Guo, Hui Juan; Zhang, Xing Xing; Zhang, Biliang; Chen, Wen Xin; Tian, Chang Fu
2017-12-01
Receiving nodulation and nitrogen fixation genes does not guarantee rhizobia an effective symbiosis with legumes. Here, variations in gene content were determined for three Sinorhizobium species showing contrasting symbiotic efficiency on soybeans. A nitrate-reduction gene cluster absent in S. sojae was found to be essential for symbiotic adaptations of S. fredii and S. sp. III. In S. fredii, the deletion mutation of the nap (nitrate reductase), instead of nir (nitrite reductase) and nor (nitric oxide reductase), led to defects in nitrogen-fixation (Fix - ). By contrast, none of these core nitrate-reduction genes were required for the symbiosis of S. sp. III. However, within the same gene cluster, the deletion of hemN1 (encoding oxygen-independent coproporphyrinogen III oxidase) in both S. fredii and S. sp. III led to the formation of nitrogen-fixing (Fix + ) but ineffective (Eff - ) nodules. These Fix + /Eff - nodules were characterized by significantly lower enzyme activity of glutamine synthetase indicating rhizobial modulation of nitrogen-assimilation by plants. A distant homologue of HemN1 from S. sojae can complement this defect in S. fredii and S. sp. III, but exhibited a more pleotropic role in symbiosis establishment. These findings highlighted the lineage-dependent optimization of symbiotic functions in different rhizobial species associated with the same host. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.
Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter
2009-01-01
The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote. PMID:19218416
Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter
2009-04-01
The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote.
Nick, G; de Lajudie, P; Eardly, B D; Suomalainen, S; Paulin, L; Zhang, X; Gillis, M; Lindström, K
1999-10-01
SDS-PAGE of total bacterial proteins was applied to the classification of 25 Sudanese and five Kenyan strains isolated from the root nodules of Acacia senegal and Prosopis chilensis. Twenty strains were also studied by multilocus enzyme electrophoresis (MLEE) and the whole 16S rRNA gene was sequenced from two strains representing the two major clusters. These results, together with the previously reported numerical taxonomy analysis, pulsed-field gel electrophoresis studies, DNA-DNA dot-blot hybridization, genomic fingerprinting using repetitive sequence-based PCR, DNA base composition analysis, DNA-DNA reassociation analysis, partial sequencing of the 16S rRNA gene and RFLP analysis of the amplified 16S rRNA gene, showed that all 30 strains belong to the genus Sinorhizobium. Two of the strains grouped with Sinorhizobium saheli and seven with Sinorhizobium terangae, while the rest did not cluster with any of the established species. The majority of the strains formed two phenotypically and genotypically distinct groups and we therefore propose that these strains should be classified as two new species, Sinorhizobium arboris sp. nov. and Sinorhizobium kostiense sp. nov.
Evaluation of nitrogen fixation rates of soybean and species of rhizobia
International Nuclear Information System (INIS)
Ping Shuzhen; You Chongbiao
1993-01-01
Using 1 '5N dilution technique the nitrogen fixing rates were estimated from symbiosis between 20 varieties of soybean and 2 species of rhizobia: Bradyrhizobium japonicum and Sinorhizobium fredii. The nodulation status such as size and number of nodules differed among the varieties and species of bacteria. The Ndfa% of these varieties ranged from 40% ∼ 59% for S. fredii, 38% ∼ 62% for B. japonicum and 32% ∼ 56% for inoculant of the mixture of the species, respectively. Among 3 inoculants the B. japonicum is the best one. The variety of soybean, however, plays a significant role in the symbiosis. Therefore, improving the soybean and selecting a good partner for raising the yield and nitrogen fixation are important
Informe científico de investigador: Balatti, Pedro Alberto (2012)
Balatti, Pedro Alberto
2012-01-01
Se analizó la diversidad genética existente en los rizobios de crecimiento rápido que nodulan la soja. Por medio de la reacción en cadena de la polimerasa y con diversos primers se generaron marcadores ERIC, REP y RAPD. Además, se amplificó el RNA de 16S el que restringión con endonucleasas. Por medio de estos marcadores se estableció, entre los representantes de Sinorhizobium fredii aislados de la China y Vietnam y Rhizobium sp. NGR234, la diversidad genética existente entre ellos. Además se...
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Gambling. 25.7 Section 25.7 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.7 Gambling. Participating in games for money or other personal property or operating gambling...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Definition. 257.3 Section 257.3 National Defense... SERVICE OF PROCESS § 257.3 Definition. Service of Process. When applied to the filing of a court action... delivery of a subpoena for any other reason whether or not the matter involves the United States. ...
[Symbiotic matching between soybean cultivar Luhuang No. 1 and different rhizobia].
Ji, Zhao-jun; Wang, Fei-meng; Wang, Su-ge; Yang, Sheng-hui; Guo, Rui; Tang, Ru-you; Chen, Wen-xin; Chen, Wen-feng
2014-12-01
Soybean plants could establish symbiosis and fix nitrogen with different rhizobial species in the genera of Sinorhizobium and Bradyrhizobium. Studies on the symbiotic matching between soybean cultivars and different rhizobial species are theoretically and practically important for selecting effective strains used to inoculate the plants and improve the soybean production and quality. A total of 27 strains were isolated and purified from a soil sample of Huanghuaihai area by using the soybean cultivar Luhang No. 1, a protein-rich cultivar grown in that area, as the trapping plants. These strains were identified as members of Sinorhizobium (18 strains) and Bradyrhizobium (9 strains) based on the sequence analysis of housekeeping gene recA. Two representative strains (Sinorhizobium fredii S6 and Bradyrhizobium sp. S10) were used to inoculate the seeds of Luhang No. 1 alone or mixed, in pots filled with vermiculite or soil, and in the field trial to investigate their effects on soybean growth, nodulation, nitrogen fixation activity, yield, contents of protein and oil in seeds. The results demonstrated that strain S6 showed better effects on growth-promotion, yield of seeds and seed quality than strain S10. Thus strain S6 was finally regarded as the effective rhizobium matching to soybean Luhuang No. 1, which could be the candidate as a good inoculant for planting the soybean Luhuang No. 1 at a large scale in the Huanghuaihai area.
Directory of Open Access Journals (Sweden)
Mehrdad Hashemi Beidokhti
2016-03-01
Full Text Available Introduction: Polyhydroxyalkanoates (PHAs are natural polyesters and biodegradable plastics that are stored as intracellular inclusion bodies by a great variety of bacteria. The aim of this study was to extract polyhydroxyalkanoate from native Sinorhizobium meliloti in Iran. Materials and methods: Sinorhizobium meliloti isolates were collected from roots of alfalfa plants and were identified by Gram staining, biochemical experiments and amplification of 1500 bp fragment of 16Sr DNA gene. PHA granules were detected by microscopic examination. PHA production was evaluated in nutrient deficient medium and its amount was determined by conversion of PHA into crotonic acid by sulphuric acid treatment. The effect of various temperatures, agitation rate and carbon source (sucrose, mannitol, and maltose were evaluated on dry cell weight and polyhydroxybutyrate (PHB production. Results: The maximum amount of polymer production (43.10% was seen in basal mineral medium at 29°C, pH~7 and 215 revolutions per minute (rpm. The results of this research showed that the S5 isolate was capable to produce maximum poly3- hydroxybutyrate. The produced polymer was analyzed for its purity by GC- mass (gas chromatography- mass spectroscopy and confirmed to be PHB compared with the standard polymer. Discussion and conclusion: Native strains of Sinorhizobium can be used in the production of biodegradable plastics and the results of present study showed that S. meliloti S5 was capable to produce maximum PHB at 29°C, agitation rate of 215 rpm, and pH~7.
6 CFR 25.7 - Litigation management.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Litigation management. 25.7 Section 25.7 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.7 Litigation management. (a) Liability for all claims...
Sorroche, Fernando G.; Giordano, Walter
2012-01-01
Exopolysaccharide (EPS) production by the rhizobacterium "Sinorhizobium meliloti" is essential for root nodule formation on its legume host (alfalfa), and for establishment of a nitrogen-fixing symbiosis between the two partners. Production of EPS II (galactoglucan) by certain "S. meliloti" strains results in a mucoid colony…
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 257.3-8 Section 257.3-8... and Practices § 257.3-8 Safety. (a) Explosive gases. The concentration of explosive gases generated by... shall not pose a hazard to the safety of persons or property from fires. This may be accomplished...
40 CFR 257.3-4 - Ground water.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Ground water. 257.3-4 Section 257.3-4... and Practices § 257.3-4 Ground water. (a) A facility or practice shall not contaminate an underground drinking water source beyond the solid waste boundary or beyond an alternative boundary specified in...
40 CFR 257.3-3 - Surface water.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Surface water. 257.3-3 Section 257.3-3... and Practices § 257.3-3 Surface water. (a) For purposes of section 4004(a) of the Act, a facility... Water Act, as amended. (b) For purposes of section 4004(a) of the Act, a facility shall not cause a...
27 CFR 40.257 - Processed tobacco.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Processed tobacco. 40.257 Section 40.257 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES, AND...
29 CFR 25.7 - Fees; cost; expenses; decisions.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Fees; cost; expenses; decisions. 25.7 Section 25.7 Labor... ORDER 10988 § 25.7 Fees; cost; expenses; decisions. (a) Arbitrator's fees, per diem and travel expenses... entirely by the agency. (b) The standard fee for the services of an arbitrator should be $100 per day...
40 CFR 264.257 - Special requirements for incompatible wastes.
2010-07-01
... DISPOSAL FACILITIES Waste Piles § 264.257 Special requirements for incompatible wastes. (a) Incompatible... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 264.257 Section 264.257 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
40 CFR 265.257 - Special requirements for incompatible wastes.
2010-07-01
..., STORAGE, AND DISPOSAL FACILITIES Waste Piles § 265.257 Special requirements for incompatible wastes. (a... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for incompatible wastes. 265.257 Section 265.257 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
43 CFR 2.57 - Accounting for disclosures.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Accounting for disclosures. 2.57 Section 2... INFORMATION ACT Privacy Act § 2.57 Accounting for disclosures. (a) Maintenance of an accounting. (1) Where a... the person or agency to whom the disclosure was made. (3) Accountings prepared under this section...
40 CFR 257.3-2 - Endangered species.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Endangered species. 257.3-2 Section... Disposal Facilities and Practices § 257.3-2 Endangered species. (a) Facilities or practices shall not cause or contribute to the taking of any endangered or threatened species of plants, fish, or wildlife. (b...
7 CFR 996.21 - USDA laboratory.
2010-01-01
... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... laboratory. USDA laboratory means laboratories of the Science and Technology Programs, Agricultural Marketing Service, USDA, which chemically analyze peanuts for aflatoxin content. ...
Genomic resources for identification of the minimal N2 -fixing symbiotic genome.
diCenzo, George C; Zamani, Maryam; Milunovic, Branislava; Finan, Turlough M
2016-09-01
The lack of an appropriate genomic platform has precluded the use of gain-of-function approaches to study the rhizobium-legume symbiosis, preventing the establishment of the genes necessary and sufficient for symbiotic nitrogen fixation (SNF) and potentially hindering synthetic biology approaches aimed at engineering this process. Here, we describe the development of an appropriate system by reverse engineering Sinorhizobium meliloti. Using a novel in vivo cloning procedure, the engA-tRNA-rmlC (ETR) region, essential for cell viability and symbiosis, was transferred from Sinorhizobium fredii to the ancestral location on the S. meliloti chromosome, rendering the ETR region on pSymB redundant. A derivative of this strain lacking both the large symbiotic replicons (pSymA and pSymB) was constructed. Transfer of pSymA and pSymB back into this strain restored symbiotic capabilities with alfalfa. To delineate the location of the single-copy genes essential for SNF on these replicons, we screened a S. meliloti deletion library, representing > 95% of the 2900 genes of the symbiotic replicons, for their phenotypes with alfalfa. Only four loci, accounting for < 12% of pSymA and pSymB, were essential for SNF. These regions will serve as our preliminary target of the minimal set of horizontally acquired genes necessary and sufficient for SNF. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.
Energy Technology Data Exchange (ETDEWEB)
Hou, Wenjie; Ma, Zhanqiang; Sun, Liangliang; Han, Mengsha; Lu, Jianjun; Li, Zhenxiu; Mohamad, Osama Abdalla; Wei, Gehong, E-mail: weigehong@nwsuaf.edu.cn
2013-10-15
Highlights: • EPS produced by Sinorhizobium meliloti CCNWSX0020 restricts uptake of Cu{sup 2+}. • We focused on the EPS, which is divided into three main parts. • LB-EPS played a more important role than S-EPS and TB-EPS in Cu{sup 2+} immobilization. • Proteins and carbohydrates were the main extracellular compounds which had functional groups such as carboxyl (-COOH), hydroxyl (-OH), and amide (N-H), primarily involved in metal ion binding. -- Abstract: The copper tolerance gene of wild-type heavy metal-tolerance Sinorhizobium meliloti CCNWSX0020 was mutated by transposon Tn5-a. The mutant was sensitive up to 1.4 mM Cu{sup 2+}. Production, components, surface morphology, and functional groups of extracellular polymeric substances (EPS) of the wild-type strains were compared with sensitive mutant in immobilization of Cu{sup 2+}. EPS produced by S. meliloti CCNWSX0020 restricts uptake of Cu{sup 2+}. The cell wall EPS were categorized based on the compactness and fastness: soluble EPS (S-EPS), loosely bound EPS (LB-EPS), and tightly bound EPS (TB-EPS). LB-EPS played a more important role than S-EPS and TB-EPS in Cu{sup 2+} immobilization. Scanning electron microscopy (SEM) analysis LB-EPS had rough surface and many honeycomb pores, making them conducive to copper entry; therefore, they may play a role as a microbial protective barrier. Fourier transform-infrared (FT-IR) analysis further confirm that proteins and carbohydrates were the main extracellular compounds which had functional groups such as carboxyl (-COOH), hydroxyl (-OH), and amide (N-H), primarily involved in metal ion binding.
Common bean and Medicago rhizobia isolated from five locations on the island of Lanzarote, the Canary Islands, by partial analysis of 10 chromosomal genes were shown to exhibit close similarity to Sinorhizobium meliloti. Several bean isolates from Lanzarote, mainland Spain and Tunisia nodulated Leu...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false USDA costs. 1250.509 Section 1250.509 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Regulations General § 1250.509 USDA costs. Pursuant to § 1250.347 of the Order, the Board shall pay those...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false USDA costs. 1207.508 Section 1207.508 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Rules and Regulations General § 1207.508 USDA costs. Pursuant to § 1207.341 of the Plan the Board shall...
Operational Use of Remote Sensing within USDA
Bethel, Glenn R.
2007-01-01
A viewgraph presentation of remote sensing imagery within the USDA is shown. USDA Aerial Photography, Digital Sensors, Hurricane imagery, Remote Sensing Sources, Satellites used by Foreign Agricultural Service, Landsat Acquisitions, and Aerial Acquisitions are also shown.
Directory of Open Access Journals (Sweden)
mahboobe abolhasani zeraatkar
2009-06-01
Full Text Available It is well known that the host plant inoculation by native strains with high efficiency has a positive effect on plant yield and biological nitrogen fixation process. The main aim of this investigation was to based on salinity and drought experiments, four isolates of Sinorhizobium meliloti (S27K and S36K tolerant isolates, S109K semi-sensitive isolate, S56K sensitive isolate were selected for plant inoculation which was under drought stress in greenhouse condition. This experiment was carried out by using a factorial model in completely randomized design. Results showed that inoculation of alfalfa plants with high salinity and drought tolerant of Sinorhizobium meliloti bacteria could increased biological nitrogen fixation process (symbiotic efficiency, percent crude protein and yield of alfalfa under salinity and drought conditions significantly. There were not any significant differences between S27K and S36K isolates and positive control (no nitrogen limitation. Symbiotic efficiency increased 3.4 times higher than alfalfa plants were inoculated by sensitive isolates S56K when alfalfa plants were inoculated by S27K and S36K isolates.
7 CFR 2.57 - Administrator, Food and Nutrition Service.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Food and Nutrition Service. 2.57... for Food, Nutrition, and Consumer Services § 2.57 Administrator, Food and Nutrition Service. (a... delegations of authority are made by the Under Secretary for Food, Nutrition, and Consumer Services to the...
USDA-ARS SHRS is part of the USDA National Germplasm Repository system and houses collections of tropical and subtropical fruit trees such as mango, lychee, and avocado. In addition to maintaining the germplasm collections, our mission is to also identify genetic diversity in the collections, to ev...
7 CFR 996.22 - USDA-approved laboratory.
2010-01-01
..., Agricultural Marketing Service, USDA, that chemically analyze peanuts for aflatoxin content. Quality and... 7 Agriculture 8 2010-01-01 2010-01-01 false USDA-approved laboratory. 996.22 Section 996.22 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing...
42 CFR 447.257 - FFP: Conditions relating to institutional reimbursement.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false FFP: Conditions relating to institutional reimbursement. 447.257 Section 447.257 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF...: Conditions relating to institutional reimbursement. FFP is not available for a State's expenditures for...
Three way interactions between Thymus vulgaris, Medicago truncatula and Sinorhizobium meliloti
DEFF Research Database (Denmark)
Grøndahl, Eva; Ehlers, Bodil Kirstine
2012-01-01
Thymus vulgaris is a dominating component of the Mediterranean garrigue vegetation. It produces aromatic oil, containing monoterpenes, which affects the performance (growth, survival) of other plants, and microorganisms. Annual plant species of the genus Medicago are commonly found in Mediterranean...... shows patterns of adaptation to its thyme neighbor, and 2) if any adaptive response was dependent on the rhizobium, and whether the rhizobium was either "experienced" or "naive" with respect to thyme monoterpenes. Using a G*G*E design, the fitness of 13 genotypes of Medicago truncatula was tested....... Of these genotypes, 7 were ”experienced”, and 6 were ”naive” to thyme. All genotypes were grown on soil either amended with thyme monoterpene or not. In addition, each plant received a rhizobium treatment, which was either: no rhizobium, a mix of thyme experienced Sinorhizobium genotypes, or a mix of thyme naive...
León-Barrios, Milagros; Pérez-Yépez, Juan; Dorta, Paola; Garrido, Ana; Jiménez, Concepción
2017-04-01
Lotus lancerottensis is an endemic species that grows widely throughout Lanzarote Island (Canary Is.). Characterization of 48 strains isolated from root nodules of plants growing in soils from eleven locations on the island showed that 38 isolates (79.1%) belonged to the species Sinorhizobium meliloti, whereas only six belonged to Mesorhizobium sp., the more common microsymbionts for the Lotus. Other genotypes containing only one isolate were classified as Pararhizobium sp., Sinorhizobium sp., Phyllobacterium sp. and Bradyrhizobium-like. Strains of S. meliloti were distributed along the island and, in most of the localities they were exclusive or major microsymbionts of L. lancerottensis. Phylogeny of the nodulation nodC gene placed the S. meliloti strains within symbiovar lancerottense and the mesorhizobial strains with the symbiovar loti. Although strains from both symbiovars produced effective N 2 -fixing nodules, S. meliloti symbiovar lancerottense was clearly the predominant microsymbiont of L. lancerottensis. This fact correlated with the better adaptation of strains of this species to the alkaline soils of Lanzarote, as in vitro characterization showed that while the mesorhizobial strains were inhibited by alkaline pH, S. meliloti strains grew well at pH 9. Copyright © 2017 Elsevier GmbH. All rights reserved.
Important Late-Stage Symbiotic Role of the Sinorhizobium meliloti Exopolysaccharide Succinoglycan.
Arnold, Markus F F; Penterman, Jon; Shabab, Mohammed; Chen, Esther J; Walker, Graham C
2018-07-01
Sinorhizobium meliloti enters into beneficial symbiotic interactions with Medicago species of legumes. Bacterial exopolysaccharides play critical signaling roles in infection thread initiation and growth during the early stages of root nodule formation. After endocytosis of S. meliloti by plant cells in the developing nodule, plant-derived nodule-specific cysteine-rich (NCR) peptides mediate terminal differentiation of the bacteria into nitrogen-fixing bacteroids. Previous transcriptional studies showed that the intensively studied cationic peptide NCR247 induces expression of the exo genes that encode the proteins required for succinoglycan biosynthesis. In addition, genetic studies have shown that some exo mutants exhibit increased sensitivity to the antimicrobial action of NCR247. Therefore, we investigated whether the symbiotically active S. meliloti exopolysaccharide succinoglycan can protect S. meliloti against the antimicrobial activity of NCR247. We discovered that high-molecular-weight forms of succinoglycan have the ability to protect S. meliloti from the antimicrobial action of the NCR247 peptide but low-molecular-weight forms of wild-type succinoglycan do not. The protective function of high-molecular-weight succinoglycan occurs via direct molecular interactions between anionic succinoglycan and the cationic NCR247 peptide, but this interaction is not chiral. Taken together, our observations suggest that S. meliloti exopolysaccharides not only may be critical during early stages of nodule invasion but also are upregulated at a late stage of symbiosis to protect bacteria against the bactericidal action of cationic NCR peptides. Our findings represent an important step forward in fully understanding the complete set of exopolysaccharide functions during legume symbiosis. IMPORTANCE Symbiotic interactions between rhizobia and legumes are economically important for global food production. The legume symbiosis also is a major part of the global nitrogen
USDA soil classification system dictates site surface management
International Nuclear Information System (INIS)
Bowmer, W.J.
1985-01-01
Success or failure of site surface management practices greatly affects long-term site stability. The US Department of Agriculture (USDA) soil classification system best documents those parameters which control the success of installed practices for managing both erosion and surface drainage. The USDA system concentrates on soil characteristics in the upper three meters of the surface that support the associated flora both physically and physiologically. The USDA soil survey first identifies soil series based on detailed characteristics that are related to production potential. Using the production potential, land use capability classes are developed. Capability classes reveal the highest and best agronomic use for the site. Lower number classes are considered arable while higher number classes are best suited for grazing agriculture. Application of ecological principles based on the USDA soil survey reveals the current state of the site relative to its ecological potential. To assure success, site management practices must be chosen that are compatible with both production capability and current state of the site
Cellular Stoichiometry of Methyl-Accepting Chemotaxis Proteins in Sinorhizobium meliloti.
Zatakia, Hardik M; Arapov, Timofey D; Meier, Veronika M; Scharf, Birgit E
2018-03-15
The chemosensory system in Sinorhizobium meliloti has several important deviations from the widely studied enterobacterial paradigm. To better understand the differences between the two systems and how they are optimally tuned, we determined the cellular stoichiometry of the methyl-accepting chemotaxis proteins (MCPs) and the histidine kinase CheA in S. meliloti Quantitative immunoblotting was used to determine the total amount of MCPs and CheA per cell in S. meliloti The MCPs are present in the cell in high abundance (McpV), low abundance (IcpA, McpU, McpX, and McpW), and very low abundance (McpY and McpZ), whereas McpT was below the detection limit. The approximate cellular ratio of these three receptor groups is 300:30:1. The chemoreceptor-to-CheA ratio is 23.5:1, highly similar to that seen in Bacillus subtilis (23:1) and about 10 times higher than that in Escherichia coli (3.4:1). Different from E. coli , the high-abundance receptors in S. meliloti are lacking the carboxy-terminal NWETF pentapeptide that binds the CheR methyltransferase and CheB methylesterase. Using transcriptional lacZ fusions, we showed that chemoreceptors are positively controlled by the master regulators of motility, VisNR and Rem. In addition, FlbT, a class IIA transcriptional regulator of flagellins, also positively regulates the expression of most chemoreceptors except for McpT and McpY, identifying chemoreceptors as class III genes. Taken together, these results demonstrate that the chemosensory complex and the adaptation system in S. meliloti deviates significantly from the established enterobacterial paradigm but shares some similarities with B. subtilis IMPORTANCE The symbiotic soil bacterium Sinorhizobium meliloti is of great agricultural importance because of its nitrogen-fixing properties, which enhances growth of its plant symbiont, alfalfa. Chemotaxis provides a competitive advantage for bacteria to sense their environment and interact with their eukaryotic hosts. For a better
7 CFR 170.4 - Who may participate in the USDA Farmers Market?
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Who may participate in the USDA Farmers Market? 170.4... MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS MARKET § 170.4 Who may participate in the USDA Farmers Market? Members of three groups may participate in the USDA Farmers Markets...
SISAK liquid-liquid extraction experiments with preseparated 257Rf
International Nuclear Information System (INIS)
Omtvedt, Jon Petter; Alstad, J.; Breivik, H.; Dyve, J.E.; Eberhardt, K.; Folden III, C.M.; Ginter, T.; Gregorich, K.E.; Hult, E.A.; Johansson, M.; Kirbach, U.W.; Lee, D.M.; Mendel, M.; Nahler, A.; Ninov, V.; Omtvedt, L.A.; Patin, J.B.; Skarnemark, G.; Stavsetra, L.; Sudowe, R.; Wiehl, N.; Wierczinski, B.; Wilk, P.A.; Zielinski, P.M.; Kratz, J.V.; Trautmann, N.; Nitsche, H.; Hoffman, D.C.
2002-01-01
The SISAK liquid-liquid extraction system was used to extract 4.0-s 257Rf. The 257Rf was produced in the reaction 208Pb(50Ti, 1n)257Rf with 237-MeV beam energy on target, separated in the Berkeley Gas-filled Separator (BGS) and transferred to a gas jet using the Recoil Transfer Chamber (RTC). The activity delivered by the gas jet was dissolved in 6-M HNO3 and Rf was extracted into 0.25-M dibutyl-phosphoric acid in toluene. This was the first time a transactinide, i.e., an element with Z >= 104, was extracted and unequivocally identified by the SISAK system. Thus, this pilot experiment demonstrates that the fast liquid-liquid extraction system SISAK, in combination with liquidscintillation detectors, can be used for investigating the chemical properties of the transactinides. The extraction result is in accordance with the behaviour shown by the Rf group IV homologues Zr and Hf
Toxic effects of arsenic on Sinorhizobium-Medicago sativa symbiotic interaction
Energy Technology Data Exchange (ETDEWEB)
Pajuelo, Eloisa [Department of Microbiology and Parasitology, Faculty of Pharmacy, University of Seville, 41012 Seville (Spain); Rodriguez-Llorente, Ignacio D. [Department of Microbiology and Parasitology, Faculty of Pharmacy, University of Seville, 41012 Seville (Spain)], E-mail: irodri@us.es; Dary, Mohammed; Palomares, Antonio J. [Department of Microbiology and Parasitology, Faculty of Pharmacy, University of Seville, 41012 Seville (Spain)
2008-07-15
Recently, the Rhizobium-legume symbiotic interaction has been proposed as an interesting tool in bioremediation. However, little is known about the effect of most common contaminants on this process. The phytotoxic effects of arsenic on nodulation of Medicago sativa have been examined in vitro using the highly arsenic resistant and symbiotically effective Sinorhizobium sp. strain MA11. The bacteria were able to grow on plates containing As concentrations as high as 10 mM. Nevertheless, as little as 25-35 {mu}M arsenite produced a 75% decrease in the total number of nodules, due to a 90% reduction in the number of rhizobial infections, as could be determined using the strain MA11 carrying a lacZ reporter gene. This effect was associated to root hair damage and a shorter infective root zone. However, once nodulation was established nodule development seemed to continue normally, although earlier senescence could be observed in nodules of arsenic-grown plants. - First steps of nodulation of alfalfa, in particular infection thread formation, are more sensitive to As than nitrogen fixation due to plant effects.
Haukka, K; Lindström, K; Young, J P
1998-02-01
The diversity and phylogeny of nodA and nifH genes were studied by using 52 rhizobial isolates from Acacia senegal, Prosopis chilensis, and related leguminous trees growing in Africa and Latin America. All of the strains had similar host ranges and belonged to the genera Sinorhizobium and Mesorhizobium, as previously determined by 16S rRNA gene sequence analysis. The restriction patterns and a sequence analysis of the nodA and nifH genes divided the strains into the following three distinct groups: sinorhizobia from Africa, sinorhizobia from Latin America, and mesorhizobia from both regions. In a phylogenetic tree also containing previously published sequences, the nodA genes of our rhizobia formed a branch of their own, but within the branch no correlation between symbiotic genes and host trees was apparent. Within the large group of African sinorhizobia, similar symbiotic gene types were found in different chromosomal backgrounds, suggesting that transfer of symbiotic genes has occurred across species boundaries. Most strains had plasmids, and the presence of plasmid-borne nifH was demonstrated by hybridization for some examples. The nodA and nifH genes of Sinorhizobium teranga ORS1009T grouped with the nodA and nifH genes of the other African sinorhizobia, but Sinorhizobium saheli ORS609T had a totally different nodA sequence, although it was closely related based on the 16S rRNA gene and nifH data. This might be because this S. saheli strain was originally isolated from Sesbania sp., which belongs to a different cross-nodulation group than Acacia and Prosopis spp. The factors that appear to have influenced the evolution of rhizobial symbiotic genes vary in importance at different taxonomic levels.
Mutations in sit B and sit D genes affect manganese-growth requirements in Sinorhizobium meliloti.
Platero, Raúl A; Jaureguy, Melina; Battistoni, Federico J; Fabiano, Elena R
2003-01-21
Two transposon-induced mutants of Sinorhizobium meliloti 242 were isolated based on their inability to grow on rich medium supplemented with the metal chelator ethylenediamine di-o-hydroxyphenylacetic acid (EDDHA) and either heme-compounds or siderophores as iron sources. Tagged loci of these mutants were identified as sit B and sit D genes. These genes encode components of an ABC (ATP-binding cassette) metal-type permease in several Gram-negative bacteria. In this work, the phenotypes of these two mutants were compared with those of two siderophore-mediated iron transport mutants. The results strongly implicate a role of the sit genes in manganese acquisition when this metal is limiting in S. meliloti.
50 CFR 216.257 - Letters of Authorization.
2010-10-01
... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.257 Letters of Authorization. (a) A Letter of Authorization, unless suspended or revoked...
Rifkin takes aim at USDA animal research.
Fox, Jeffrey L
1984-10-19
Jeremy Rifkin has filed a lawsuit to block U.S. Department of Agriculture (USDA) experiments involving the transfer of human growth hormone genes into sheep and pigs, which he rejects on environmental, economic, and ethical grounds. His real target is the Department's animal breeding program; his ultimate aim is "to establish the principle that there should be no crossing of species barriers in animals." USDA officials have not yet responded to the lawsuit but they intend to continue the experiments, which they consider crucial to the progress of research, until told to stop.
SISAK liquid-liquid extraction experiments with preseparated {sup 257}Rf
Energy Technology Data Exchange (ETDEWEB)
Omtvedt, Jon Petter; Alstad, J.; Breivik, H. [University of Oslo, Department of Chemistry, Oslo (NO)] (and others)
2002-06-01
The SISAK liquid-liquid extraction system was used to extract 4.0-s {sup 257}Rf. The {sup 257}Rf was produced in the reaction {sup 208}Pb({sup 50}Ti, 1n){sup 257}Rf with 237-MeV beam energy on target, separated in the Berkeley Gas-filled Separator (BGS) and transferred to a gas jet using the Recoil Transfer Chamber (RTC). The activity delivered by the gas jet was dissolved in 6-M HNO{sub 3} and Rf was extracted into 0.25-M dibutyl-phosphoric acid in toluene. This was the first time a transactinide, i.e., an element with Z{>=}104, was extracted and unequivocally identified by the SISAK system. Thus, this pilot experiment demonstrates that the fast liquid-liquid extraction system SISAK, in combination with liquid-scintillation detectors, can be used for investigating the chemical properties of the transactinides. The extraction result is in accordance with the behaviour shown by the Rf group IV homologues Zr and Hf. (author)
USDA snack food and beverage standards: how big of a stretch for the states?
Chriqui, Jamie F; Piekarz, Elizabeth; Chaloupka, Frank J
2014-06-01
The USDA snack food and beverage standards take effect in school year (SY) 2014-2015. Although the USDA standards will provide nationwide requirements, concerns exist about compliance. This study examined whether existing state laws are aligned with the USDA standards to determine whether some states may be better positioned to facilitate compliance. Codified state statutory and regulatory laws effective for SY 2012-2013 for each of the 50 states and the District of Columbia were identified through Boolean keyword searches using the Westlaw and LexisNexis databases. Laws were analyzed for alignment with 18 snack food and beverage provisions contained within the USDA standards. Thirty-eight states had snack food and beverage standards; 33 states' laws exceeded restrictions on foods of minimal nutritional value. Of the 33 states, no states' laws fully met the USDA's standards, 16 states' laws fully met and 10 states' laws partially met at least one USDA provision, and seven states' laws met no USDA provisions. One state's law met 9 of 18 provisions. On average, states met 4 of 18 provisions. States were more likely to meet individual USDA beverage than snack provisions. Implementation and compliance with the USDA standards may be facilitated in states with laws already containing provisions aligned with the USDA standards and may be more difficult in states with fewer or no provisions in alignment, suggesting possible geographic areas for the USDA to target with technical assistance and training efforts and for advocates to work in to facilitate compliance.
USDA-EPA Collaborative Ammonia Research
In 2014, a work group was formed between USDA and EPA to facilitate information exchange on ammonia emissions from agriculture, air quality impacts and emission mitigation options and to identify opportunities for collaboration. This document provides background on the work grou...
USDA-ARS extension activities in medical, veterinary and urban entomology
Within the USDA Agricultural Research Service (USDA-ARS), National Program 104 conducts research on veterinary, medical, and urban entomology. The goal of this program is to develop more effective methods of preventing or suppressing insects, ticks, and mites that affect animal and human well-being....
The Creation and Role of the USDA Biomass Research Centers
William F. Anderson; Jeffery Steiner; Randy Raper; Ken Vogel; Terry Coffelt; Brenton Sharratt; Bob Rummer; Robert L. Deal; Alan Rudie
2011-01-01
The Five USDA Biomass Research Centers were created to facilitate coordinated research to enhance the establishment of a sustainable feedstock production for bio-based renewable energy in the United States. Scientists and staff of the Agricultural Research Service (ARS) and Forest Service (FS) within USDA collaborate with other federal agencies, universities and...
7 CFR 900.26 - Requesting USDA data for use at an amendatory hearing.
2010-01-01
... Marketing Agreements and Marketing Orders § 900.26 Requesting USDA data for use at an amendatory hearing. Requests for preparation of USDA data to be used at a Federal milk marketing agreement or order amendatory... 7 Agriculture 8 2010-01-01 2010-01-01 false Requesting USDA data for use at an amendatory hearing...
7 CFR 170.2 - Is the USDA Farmers Market a producer-only market?
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Is the USDA Farmers Market a producer-only market? 170...) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS MARKET § 170.2 Is the USDA Farmers Market a producer-only market? Yes. A producer-only market is one that does not offer...
USDA-ASCS 1936-1939 Air Photos
Minnesota Department of Natural Resources — This data set is a digital version of aerial photographs taken during the 1936-1939 time frame for the USDA-ASCS. These photos were originally recorded at a scale of...
Sinorhizobium meliloti can protect Medicago truncatula against Phoma medicaginis attack
Directory of Open Access Journals (Sweden)
Moncef MRABET
2011-09-01
Full Text Available The Sinorhizobium meliloti microsymbiont of Medicago spp. was used in an antibiosis test against Phoma medicaginis and in bioprotection assays of Medicago truncatula JA17 from the pathogen. Among 17 S. meliloti strains isolated from root nodules of M. truncatula and Medicago laciniata grown in Tunisian soils, six showed up to 60% growth inhibition of five P. medicaginis strains isolated from infected field-grown M. truncatula. Two S. meliloti strains with differing in vitro effects on P. medicaginis, 10.16/R6 antagonist and 5M6 non antagonist, were used in a bioprotection assay of M. truncatula JA17 from the pathogen. The inoculation of P. medicaginis caused complete root and stem rotting, and the mortality of all treated plantlets. Inoculation of the antagonist S. meliloti strain 10.16/R6 to M. truncatula JA17 infected with P. medicaginis was associated with a significant 65% decrease of vegetative rotting length, an 80% decrease of plant mortality, an increase of root length, and enhancement of root and shoot biomass comparatively to control plantlets treated with P. medicaginis. The inoculation of the non antagonistic S. meliloti strain 5M6 slightly decreased disease and slightly increased plant growth parameters.
7 CFR 900.40 - Written testimony and USDA data request requirements.
2010-01-01
... and Nut Marketing Agreements and Marketing Orders § 900.40 Written testimony and USDA data request... 7 Agriculture 8 2010-01-01 2010-01-01 false Written testimony and USDA data request requirements...) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF...
Energy Technology Data Exchange (ETDEWEB)
1994-07-01
This documents contains the details from the USDA/USDOE meeting on April 11--12, 1994. Topics discussed include: genetic research, environmental research, renewable energy sources, food supply, improved fertilizers, new pesticides, research programs combining the efforts of the two agencies to develop new products for use in the agriculture industry, environmentally safe products, getting more with less money, and various other subjects dealing with how cooperation among these agencies can improve the agriculture industry.
7 CFR 170.3 - What products may be sold at the USDA Farmers Market?
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false What products may be sold at the USDA Farmers Market...) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS MARKET § 170.3 What products may be sold at the USDA Farmers Market? Products that may be sold at the market include, but are...
USDA/FSA Imagery Programs - Public Map Gallery
Farm Service Agency, Department of Agriculture — Imagery programs are an important part of maintaining, creating and updating geospatial data at the USDA Farm Service Agency. Imagery acquisition is provided by the...
A longstanding agreement between the USDA and the Smithsonian Institution created the National Insect Collection, one of the premiere entomological resources on the planet. Since its inception, USDA scientists associated with the National Insect Collection have been at the forefront of documenting i...
Complete Genome Sequence of the Soybean Symbiont Bradyrhizobium japonicum Strain USDA6T
Directory of Open Access Journals (Sweden)
Nobukazu Uchiike
2011-10-01
Full Text Available The complete nucleotide sequence of the genome of the soybean symbiont Bradyrhizobium japonicum strain USDA6T was determined. The genome of USDA6T is a single circular chromosome of 9,207,384 bp. The genome size is similar to that of the genome of another soybean symbiont, B. japonicum USDA110 (9,105,828 bp. Comparison of the whole-genome sequences of USDA6T and USDA110 showed colinearity of major regions in the two genomes, although a large inversion exists between them. A significantly high level of sequence conservation was detected in three regions on each genome. The gene constitution and nucleotide sequence features in these three regions indicate that they may have been derived from a symbiosis island. An ancestral, large symbiosis island, approximately 860 kb in total size, appears to have been split into these three regions by unknown large-scale genome rearrangements. The two integration events responsible for this appear to have taken place independently, but through comparable mechanisms, in both genomes.
Conjugal properties of the Sinorhizobium meliloti plasmid mobilome.
Pistorio, Mariano; Giusti, María A; Del Papa, María F; Draghi, Walter O; Lozano, Mauricio J; Tejerizo, Gonzalo Torres; Lagares, Antonio
2008-09-01
The biology and biochemistry of plasmid transfer in soil bacteria is currently under active investigation because of its central role in prokaryote adaptation and evolution. In this work, we examined the conjugal properties of the cryptic plasmids present in a collection of the N(2)-fixing legume-symbiont Sinorhizobium meliloti. The study was performed on 65 S. meliloti isolates recovered from 25 humic soils of Argentina, which were grouped into 22 plasmid-profile types [i.e. plasmid operational taxonomic units (OTUs)]. The cumulative Shannon index calculated for the observed plasmid profiles showed a clear saturation plateau, thus indicating an adequate representation of the S. meliloti plasmid-profile types in the isolates studied. The results show that isolates of nearly 14% of the plasmid OTUs hosted transmissible plasmids and that isolates of 29% of the plasmid OTUs were able to retransfer the previously characterized mobilizable-cryptic plasmid pSmeLPU88b to a third recipient strain. It is noteworthy that isolates belonging to 14% of the plasmid OTUs proved to be refractory to the entrance of the model plasmid pSmeLPU88b, suggesting either the presence of surface exclusion phenomena or the occurrence of restriction incompatibility with the incoming replicon. Incompatibility for replication between resident plasmids and plasmid pSmeLPU88b was observed in c. 20% of the OTUs. The results reported here reveal a widespread compatibility among the conjugal functions of the cryptic plasmids in S. meliloti, and this fact, together with the observed high proportion of existing donor genotypes, points to the extrachromosomal compartment of the species as being an extremely active plasmid mobilome.
Photoelectron Emission Studies in CsBr at 257 nm
International Nuclear Information System (INIS)
Maldonado, Juan R.; Liu, Zhi; Sun, Yun; Pianetta, Piero A.; Pease, Fabian W.
2006-01-01
CsBr/Cr photocathodes were found [1,2] to meet the requirements of a multi-electron beam lithography system operating with a light energy of 4.8 eV (257nm). The fact that photoemission was observed with a light energy below the reported 7.3 eV band gap for CsBr was not understood. This paper presents experimental results on the presence of intra-band gap absorption sites (IBAS) in CsBr thin film photo electron emitters, and presents a model based on IBAS to explain the observed photoelectron emission behavior at energies below band gap. A fluorescence band centered at 330 nm with a FWHM of about 0.34 eV was observed in CsBr/Cr samples under 257 nm laser illumination which can be attributed to IBAS and agrees well with previously obtained synchrotron photoelectron spectra[1] from the valence band of CsBr films
USDA research and honey bee health
The USDA - Agricultural Research Service Bee Research Laboratory (BRL) is comprised of nine full-time federal employees and a team of 20+ students and collaborators from the U.S., England, Thailand, Spain, and China. The mission of the BRL is to provide innovative tools and insights for building and...
7 CFR 170.5 - Is there a fee to participate in the USDA Farmers Market?
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Is there a fee to participate in the USDA Farmers... (CONTINUED) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS MARKET § 170.5 Is there a fee to participate in the USDA Farmers Market? No, there are no fees charged to...
News Release: USDA Joins Fair Food Network, State and Local Partners to
vitamin C, calcium, and iron. The Food Bank of Eastern Michigan in Flint is distributing those USDA Foods Joins Fair Food Network, State and Local Partners to Promote Nutrition Resources for Lead-Affected Flint Residents News Release: USDA Joins Fair Food Network, State and Local Partners to Promote Nutrition
International Nuclear Information System (INIS)
Leduc, Yvonne A.; Phenix, Christopher P.; Puttick, Jennifer; Nienaber, Kurt; Palmer, David R. J.; Delbaere, Louis T. J.
2005-01-01
MosA from S. meliloti L5-30 has been crystallized in solution with pyruvate and the 2.3 Å resolution structure has been solved by molecular replacement using E. coli dihydrodipicolinate synthase as the model. The structure of MosA, a dihydrodipicolinate synthase and reported methyltransferase from Sinorhizobium meliloti, has been solved using molecular replacement with Escherichia coli dihydrodipicolinate synthase as the model. A crystal grown in the presence of pyruvate diffracted X-rays to 2.3 Å resolution using synchrotron radiation and belonged to the orthorhombic space group C222 1 , with unit-cell parameters a = 69.14, b = 138.87, c = 124.13 Å
Phase II Investigation at the Former CCC/USDA Grain Storage Facility in Savannah, Missouri
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States). Environmental Science Division. Applied Geosciences and Environmental Management Section
2012-05-01
From approximately 1949 until 1970, the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) operated a grain storage facility on federally owned property approximately 0.25 mi northwest of Savannah, Missouri. During this time, commercial grain fumigants containing carbon tetrachloride were commonly used by the CCC/USDA and the private grain storage industry to preserve grain in their facilities. In November 1998, carbon tetrachloride was detected in a private well (Morgan) roughly 50 ft south of the former CCC/USDA facility, as a result of statewide screening of private wells near former CCC/USDA facilities, conducted in Missouri by the U.S. Environmental Protection Agency (EPA 1999). The 1998 and subsequent investigations by the EPA and the Missouri Department of Natural Resources (MDNR) confirmed the presence of carbon tetrachloride in the Morgan well, as well as in a second well on property currently owned by the Missouri Department of Transportation (MoDOT), directly east of the former CCC/USDA facility. The identified concentrations in these two wells were above the EPA maximum contaminant level (MCL) and the Missouri risk-based corrective action default target level (DTL) values of 5.0 μg/L for carbon tetrachloride in water used for domestic purposes (EPA 1999; MDNR 2000a,b, 2006). Because the observed contamination in the Morgan and MoDOT wells might be linked to the past use of carbon tetrachloride-based fumigants at its former grain storage facility, the CCC/USDA is conducting an investigation to (1) characterize the source(s), extent, and factors controlling the subsurface distribution and movement of carbon tetrachloride and (2) evaluate the potential risks to human health, public welfare, and the environment posed by the contamination. This work is being performed in accord with an Intergovernmental Agreement established in 2007 between the Farm Service Agency of the USDA and the MDNR, to address carbon tetrachloride
2010-01-01
...) On a white background with a brown outer circle and with the term, “USDA,” in green overlaying a... (2) On a white or transparent background with black outer circle and black “USDA” on a white or transparent upper half of the circle with a contrasting white or transparent “organic” on the black lower half...
77 FR 17001 - USDA Public Stakeholder Meeting: Match Making in the Biofuels Value Chain
2012-03-23
... DEPARTMENT OF AGRICULTURE USDA Public Stakeholder Meeting: Match Making in the Biofuels Value... and representatives from the participating stakeholders will respond with short formal presentations... through USDA's security clearance. ADDRESSES: Patio, United States Department of Agriculture Whitten...
Hydrogen peroxide-regulated genes in the Medicago truncatula-Sinorhizobium meliloti symbiosis.
Andrio, Emilie; Marino, Daniel; Marmeys, Anthony; de Segonzac, Marion Dunoyer; Damiani, Isabelle; Genre, Andrea; Huguet, Stéphanie; Frendo, Pierre; Puppo, Alain; Pauly, Nicolas
2013-04-01
Reactive oxygen species (ROS), particularly hydrogen peroxide (H(2)O(2)), play an important role in signalling in various cellular processes. The involvement of H(2)O(2) in the Medicago truncatula-Sinorhizobium meliloti symbiotic interaction raises questions about its effect on gene expression. A transcriptome analysis was performed on inoculated roots of M. truncatula in which ROS production was inhibited with diphenylene iodonium (DPI). In total, 301 genes potentially regulated by ROS content were identified 2 d after inoculation. These genes included MtSpk1, which encodes a putative protein kinase and is induced by exogenous H(2)O(2) treatment. MtSpk1 gene expression was also induced by nodulation factor treatment. MtSpk1 transcription was observed in infected root hair cells, nodule primordia and the infection zone of mature nodules. Analysis with a fluorescent protein probe specific for H(2)O(2) showed that MtSpk1 expression and H(2)O(2) were similarly distributed in the nodule infection zone. Finally, the establishment of symbiosis was impaired by MtSpk1 downregulation with an artificial micro-RNA. Several genes regulated by H(2)O(2) during the establishment of rhizobial symbiosis were identified. The involvement of MtSpk1 in the establishment of the symbiosis is proposed. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
An update on USDA swine gene banking
The USDA, Agricultural Research Service, National Animal Germplasm Program (NAGP) collects, preserves, evaluates and utilizes germplasm (semen, eggs, embryos, DNA) from all of the agricultural species in the US in order to create a secure collection. The material can be released for any of a number...
Abernathy, Toni
2015-01-01
USDA makes sure that nutritious USDA Foods are made available to States, Indian Tribal Organizations and Emergency Feeding Organizations to help feed survivors of natural disasters and other emergencies when needed.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2008-11-19
The Commodity Credit Corporation (CCC), an agency of the U.S. Department of Agriculture (USDA), operated a grain storage facility at the northeastern edge of the city of Hanover, Kansas, from 1950 until the early 1970s. During this time, commercial grain fumigants containing carbon tetrachloride were in common use by the grain storage industry to preserve grain in their facilities. In February 1998, trace to low levels of carbon tetrachloride (below the maximum contaminant level [MCL] of 5.0 {micro}g/L) were detected in two private wells near the former grain storage facility at Hanover, as part of a statewide USDA private well sampling program that was implemented by the Kansas Department of Health and Environment (KDHE) near former CCC/USDA facilities. In April 2007, the CCC/USDA collected near-surface soil samples at 1.8-2 ft BGL (below ground level) at 61 locations across the former CCC/USDA facility. All soil samples were analyzed by the rigorous gas chromatograph-mass spectrometer analytical method (purge-and-trap method). No contamination was found in soil samples above the reporting limit of 10 {micro}g/kg. In July 2007, the CCC/USDA sampled indoor air at nine residences on or adjacent to its former facility to address the residents concerns regarding vapor intrusion. Low levels of carbon tetrachloride were detected at four of the nine homes. Because carbon tetrachloride found in private wells and indoor air at the site might be linked to historical use of fumigants containing carbon tetrachloride at its former grain storage facility, the CCC/USDA is proposing to conduct an investigation to determine the source and extent of the carbon tetrachloride contamination associated with the former facility. This investigation will be conducted in accordance with the intergovernmental agreement between the KDHE and the Farm Service Agency (FSA) of the USDA. The investigation at Hanover will be performed, on behalf of the CCC/USDA, by the Environmental Science
International Nuclear Information System (INIS)
Rojas Martinez, Y.; Bustos Rodriguez, H.; Oyola Lozano, D.; Perez Alcazar, G. A.; Paz, J. C.
2007-01-01
The alloys between a transition metal and a rare earth present magnetic and magneto optical properties of exceptional interest for the production of magnetic devices for information storage. In this work we report the magnetic and structural properties, obtained by Moessbauer spectrometry (MS) and X-ray diffraction (XRD), of Tb 0.257-x Nd x Fe 0.743 alloys with x = 0 and 0.257 prepared by mechanical alloying during 12, 24 and 48 h, to study the influence of the milling time in their magnetic and structural properties. The X-rays results show for all the samples that the α and an amorphous phase are always present. The first decreases and the second increases with the increase of the milling time. Moessbauer results show that the amorphous phase in samples with Nd is ferromagnetic and appears as a hyperfine field distribution and a broad doublet, and that as the milling time increases the paramagnetic contribution increases. For samples with Tb the amorphous phase is paramagnetic and appears as a broad doublet which increases with the milling time and for 48 h milling it appears an additional broad singlet.
The social sciences, philosophy, and the cultural turn in the 1930s USDA.
Jewett, Andrew
2013-01-01
One of the more unusual attempts by the American state to mobilize academic expertise unfolded in the late 1930s, when the United States Department of Agriculture (USDA) hired scholars in the "culture and personality" fields and philosophy to aid its efforts to promote economic, social, and cultural change in the countryside. USDA progressives also reached out to disciplinary scholars in other ways as they sought to institute a deliberative mode of planning in local communities and to remake the curricula of the land-grant colleges in support of that project. These USDA initiatives and scholars' responses reveal that scientific knowledge was mobilized in the 1930s not just for the instrumental purpose of regulating economic behavior but also to explain and legitimate federal programs and to inform ambitious projects for cultural change. At the USDA, as at many other sites between the wars, scientific thinkers turned to the social sciences and philosophy in order to understand and then change the public mind. © 2013 Wiley Periodicals, Inc.
7 CFR 1466.11 - Technical services provided by qualified personnel not affiliated with USDA.
2010-01-01
... not affiliated with USDA. 1466.11 Section 1466.11 Agriculture Regulations of the Department of... OPERATIONS ENVIRONMENTAL QUALITY INCENTIVES PROGRAM Contracts and Payments § 1466.11 Technical services provided by qualified personnel not affiliated with USDA. (a) NRCS may use the services of qualified TSPs...
7 CFR 636.18 - Technical services provided by qualified personnel not affiliated with USDA.
2010-01-01
... HABITAT INCENTIVES PROGRAM § 636.18 Technical services provided by qualified personnel not affiliated with... affiliated with USDA. 636.18 Section 636.18 Agriculture Regulations of the Department of Agriculture... provided by qualified personnel not affiliated with USDA may include, but is not limited to: Conservation...
7 CFR 3406.6 - USDA agency cooperator requirement.
2010-01-01
... 3406.6 Agriculture Regulations of the Department of Agriculture (Continued) COOPERATIVE STATE RESEARCH, EDUCATION, AND EXTENSION SERVICE, DEPARTMENT OF AGRICULTURE 1890 INSTITUTION CAPACITY BUILDING GRANTS... other USDA employees serving on the campuses of the 1890 colleges and universities, may assist with...
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2007-02-02
This Work Plan outlines the scope of work to be conducted to investigate the subsurface contaminant conditions at the property formerly leased by the Commodity Credit Corporation (CCC) in Powhattan, Kansas (Figure 1.1). Data obtained during this event will be used to (1) evaluate potential contaminant source areas on the property; (2) determine the vertical and horizontal extent of potential contamination; and (3) provide recommendations for future action, with the ultimate goal of assigning this site No Further Action status. The planned investigation includes groundwater monitoring requested by the Kansas Department of Health and Environment (KDHE), in accordance with Section V of the Intergovernmental Agreement between the KDHE and the Farm Service Agency of the U.S. Department of Agriculture (USDA). The work is being performed on behalf of the CCC/USDA by the Environmental Science Division of Argonne National Laboratory. A nonprofit, multidisciplinary research center operated by the University of Chicago for the U.S. Department of Energy, Argonne provides technical assistance to the CCC/USDA with environmental site characterization and remediation at former CCC/USDA grain storage facilities. Argonne issued a Master Work Plan (Argonne 2002) that has been approved by the KDHE. The Master Work Plan describes the general scope of all investigations at former CCC/USDA facilities in Kansas and provides guidance for these investigations. It should be consulted for the complete details of plans for work associated with the former CCC/USDA facility at Powhattan.
US Department of Agriculture, 2009
2009-01-01
This paper provides an update on all the new products and projects that U.S. Department of Agriculture (USDA) Food and Nutrition Service (FNS) has been working on, in its effort to help schools meet the nutritional needs of the students and to help in the President's challenge to End Childhood Hunger by 2015. This issue includes: (1) Back to…
he USDA rice (Oryza sativa L.) core subset (RCS) was assembled to represent the genetic diversity of the entire USDA-ARS National Small Grains Collection and consists of 1,794 accessions from 114 countries. The USDA rice mini-core (MC) is a subset of 217 accessions from the RCS and was selected to ...
Loci and candidate genes conferring resistance to soybean cyst nematode HG type 2.5.7.
Zhao, Xue; Teng, Weili; Li, Yinghui; Liu, Dongyuan; Cao, Guanglu; Li, Dongmei; Qiu, Lijuan; Zheng, Hongkun; Han, Yingpeng; Li, Wenbin
2017-06-14
Soybean (Glycine max L. Merr.) cyst nematode (SCN, Heterodera glycines I,) is a major pest of soybean worldwide. The most effective strategy to control this pest involves the use of resistant cultivars. The aim of the present study was to investigate the genome-wide genetic architecture of resistance to SCN HG Type 2.5.7 (race 1) in landrace and elite cultivated soybeans. A total of 200 diverse soybean accessions were screened for resistance to SCN HG Type 2.5.7 and genotyped through sequencing using the Specific Locus Amplified Fragment Sequencing (SLAF-seq) approach with a 6.14-fold average sequencing depth. A total of 33,194 SNPs were identified with minor allele frequencies (MAF) over 4%, covering 97% of all the genotypes. Genome-wide association mapping (GWAS) revealed thirteen SNPs associated with resistance to SCN HG Type 2.5.7. These SNPs were distributed on five chromosomes (Chr), including Chr7, 8, 14, 15 and 18. Four SNPs were novel resistance loci and nine SNPs were located near known QTL. A total of 30 genes were identified as candidate genes underlying SCN resistance. A total of sixteen novel soybean accessions were identified with significant resistance to HG Type 2.5.7. The beneficial alleles and candidate genes identified by GWAS might be valuable for improving marker-assisted breeding efficiency and exploring the molecular mechanisms underlying SCN resistance.
24 CFR 983.257 - Owner termination of tenancy and eviction.
2010-04-01
... (iv) do not apply to the PBV program. (In the PBV program, “good cause” does not include a business or... URBAN DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.257 Owner termination of tenancy... good cause as stated in paragraph (a) of this section; (3) Refuse to renew the lease without good cause...
USDA Research in Support of Deployed Military Troops
The US Department of Agriculture has a long history of collaborating with the US military to conduct research in support of war efforts. The predecessor laboratory of the current USDA-ARS Center for Medical, Agricultural and Veterinary Entomology (CMAVE) located in Gainesville, Florida has a history...
2010-07-01
... compliance with §§ 257.7 through 257.30 prior to the receipt of CESQG hazardous waste. (b) Definitions.... Waste management unit boundary means a vertical surface located at the hydraulically downgradient limit.../operators of non-municipal non-hazardous waste disposal units that receive Conditionally Exempt Small...
Directory of Open Access Journals (Sweden)
Udupa Sripada M
2010-01-01
Full Text Available Abstract Background Sinorhizobium meliloti and S. medicae are symbiotic nitrogen fixing bacteria in root nodules of forage legume alfalfa (Medicago sativa L.. In Morocco, alfalfa is usually grown in marginal soils of arid and semi-arid regions frequently affected by drought, extremes of temperature and soil pH, soil salinity and heavy metals, which affect biological nitrogen fixing ability of rhizobia and productivity of the host. This study examines phenotypic diversity for tolerance to the above stresses and genotypic diversity at Repetitive Extragenic Pallindromic DNA regions of Sinorhizobium nodulating alfalfa, sampled from marginal soils of arid and semi-arid regions of Morocco. Results RsaI digestion of PCR amplified 16S rDNA of the 157 sampled isolates, assigned 136 isolates as S. meliloti and the rest as S. medicae. Further phenotyping of these alfalfa rhizobia for tolerance to the environmental stresses revealed a large degree of variation: 55.41%, 82.16%, 57.96% and 3.18% of the total isolates were tolerant to NaCl (>513 mM, water stress (-1.5 MPa, high temperature (40°C and low pH (3.5, respectively. Sixty-seven isolates of S. meliloti and thirteen isolates of S. medicae that were tolerant to salinity were also tolerant to water stress. Most of the isolates of the two species showed tolerance to heavy metals (Cd, Mn and Zn and antibiotics (chloramphenicol, spectinomycin, streptomycin and tetracycline. The phenotypic clusters observed by the cluster analysis clearly showed adaptations of the S. meliloti and S. medicae strains to the multiple stresses. Genotyping with rep-PCR revealed higher genetic diversity within these phenotypic clusters and classified all the 157 isolates into 148 genotypes. No relationship between genotypic profiles and the phenotypes was observed. The Analysis of Molecular Variance revealed that largest proportion of significant (P Conclusion High degree of phenotypic and genotypic diversity is present in S
Romaniuk, Krzysztof; Dziewit, Lukasz; Decewicz, Przemyslaw; Mielnicki, Sebastian; Radlinska, Monika; Drewniak, Lukasz
2017-01-01
Sinorhizobium sp. M14 is an As(III)-oxidizing, psychrotolerant strain, capable of growth in the presence of extremely high concentrations of arsenic and many other heavy metals. Metallotolerant abilities of the M14 strain depend upon the presence of two extrachromosomal replicons: pSinA (∼ 109 kb) and pSinB (∼ 300 kb). The latter was subjected to complex analysis. The performed analysis demonstrated that the plasmid pSinB is a narrow-host-range repABC-type replicon, which is fully stabilized by the phd-vapC-like toxin-antitoxin stabilizing system. In silico analysis showed that among the phenotypic gene clusters of the plasmid pSinB, eight modules are potentially involved in heavy metals resistance (HMR). These modules carry genes encoding efflux pumps, permeases, transporters and copper oxidases, which provide resistance to arsenic, cadmium, cobalt, copper, iron, mercury, nickel, silver and zinc. The functional analysis revealed that the HMR modules are active and have an effect on the minimal inhibitory concentration (MIC) values observed for the heterological host cells. The phenotype was manifested by an increase or decrease of the MICs of heavy metals and it was strain specific. The analysis of distribution of the heavy metal resistance genes, i.e. resistome, in Sinorhizobium spp. plasmids, revealed that the HMR modules are common in these replicons. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
USDA updates nutrient values for fast food pizza
Consumption of quick service pizza has increased as Americans are spending more on food away from home. Pizza is consistently a primary Key Food in the USDA National Food and Nutrient Analysis Program (NFNAP) because it is a contributor of more than 14 nutrients of public health significance to the...
24 CFR 257.401 - Notice of false information from mortgagor-procedure.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of false information from... HOUSING ACT AND OTHER AUTHORITIES HOPE FOR HOMEOWNERS PROGRAM Enforcement Mortgagor False Information § 257.401 Notice of false information from mortgagor-procedure. (a) If FHA finds that the mortgagor has...
The USDA Cranberry Entomology Lab: Highlights from 2011-2017
Biological, chemical, and cultural control methods have been investigated as part of the cranberry crop protection program pursued in the USDA Cranberry Entomology Laboratory. Surveys of native entomopathogenic nematodes in Wisconsin have produced a new bio-insecticide agent (Oscheius onirici subsp....
Trista Patterson; David Nicholls; Jonathan Long
2015-01-01
The Sustainability Science Team (SST) of the U.S. Department of Agriculture (USDA) Forest Service Sustainable Operations Initiative is a 18-member virtual research and development team, located across five regions and four research stations of the USDA Forest Service. The team provides research, publication, systems analysis, and decision support to the Sustainable...
2010-04-01
... mortgage insurance premiums for H4H program mortgages. 257.203 Section 257.203 Housing and Urban... mortgage insurance premiums for H4H program mortgages. (a) Applicable premiums. Any mortgage presented for... LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOPE FOR HOMEOWNERS PROGRAM...
O'Quinn, Travis G; Brooks, J Chance; Miller, Markus F
2015-02-01
A consumer study was conducted to determine palatability ratings of beef tenderloin steaks from USDA Choice, USDA Select, and USDA Select with marbling scores from Slight 50 to 100 (USDA High Select) cooked to various degrees of doneness. Steaks were randomly assigned to 1 of 3 degree of doneness categories: very-rare, medium-rare, or well-done. Consumers (N = 315) were screened for preference of degree of doneness and fed 4 samples of their preferred doneness (a warm-up and one from each USDA quality grade treatment in a random order). Consumers evaluated steaks on an 8-point verbally anchored hedonic scale for tenderness, juiciness, flavor, and overall like as well as rated steaks as acceptable or unacceptable for all palatability traits. Quality grade had no effect (P > 0.05) on consumer ratings for tenderness, juiciness, flavor, and overall like scores, with all traits averaging above a 7 ("like very much") on the 8-point scale. In addition, no differences (P > 0.05) were found in the percentage of samples rated as acceptable for all palatability traits, with more than 94% of samples rated acceptable for each trait in all quality grades evaluated. Steaks cooked to well-done had lower (P Choice and Select quality grades. © 2015 Institute of Food Technologists®
Dixon, L Beth; Subar, Amy F; Peters, Ulrike; Weissfeld, Joel L; Bresalier, Robert S; Risch, Adam; Schatzkin, Arthur; Hayes, Richard B
2007-11-01
The 2005 Dietary Guidelines for Americans include quantitative recommendations for 2 eating patterns, the USDA Food Guide and the Dietary Approaches to Stop Hypertension (DASH) Eating Plan, to promote optimal health and reduce disease risk. A Mediterranean dietary pattern has also been promoted for health benefits. Our objective was to determine whether adherence to the USDA Food Guide recommendations, the DASH Eating Plan, or a Mediterranean dietary pattern is associated with reduced risk of distal colorectal adenoma. In the Prostate, Lung, Colorectal, and Ovarian Cancer Screening Trial, men and women aged 55-74 y were screened for colorectal cancer by sigmoidoscopy at 10 centers in the U.S. After adjusting for potential confounders, men who most complied with the USDA Food Guide recommendations had a 26% reduced risk of colorectal adenoma compared with men who least complied with the recommendations (OR USDA score >or= 5 vs. dietary pattern. Women who most complied with the USDA Food Guide recommendations had an 18% reduced risk for colorectal adenoma, but subgroup analyses revealed protective associations only for current smokers (OR USDA score >or= 5 vs. or= 5 vs. dietary recommendations or a Mediterranean dietary pattern is associated with reduced risk of colorectal adenoma, especially in men.
Erin Seekamp; Lee K. Cerveny; Allie. McCreary
2011-01-01
Federal land management agencies, such as the USDA Forest Service, have expanded the role of recreation partners reflecting constrained growth in appropriations and broader societal trends towards civic environmental governance. Partnerships with individual volunteers, service groups, commercial outfitters, and other government agencies provide the USDA Forest Service...
Pulsed electric field (PEF)research at USDA, ARS, ERRC
This article summarizes the effects of pulsed electric fields on the microbiological safety and quality aspects of various liquid food matrices, obtained at USDA, ARS, Eastern Regional Research Center under CRIS Project No. 1935-41420-013-00D, Processing Intervention Technologies for Enhancing the S...
Novel USDA Mosquito Control Techniques for the US Military
Novel techniques that we developed at the USDA to protect deployed military troops from the threat of vector-borne diseases are described. Some of the methods developed included (1) novel military personal protection methods, (2) barrier treatments of artificial materials and natural vegetation, and...
International Nuclear Information System (INIS)
Martínez-Rodríguez, Sergio; González-Ramírez, Luis Antonio; Clemente-Jiménez, Josefa María; Rodríguez-Vico, Felipe; Las Heras-Vázquez, Francisco Javier; Gavira, Jose A.; García-Ruíz, Juan Manuel
2006-01-01
The dihydropyrimidinase from S. meliloti CECT4114, with activity towards both hydantoin and dihydrouracil substrates, was crystallized, and diffraction data were collected to 1.85 Å resolution. Dihydropyrimidinases are involved in the reductive pathway of pyrimidine degradation, catalysing the hydrolysis of 5,6-dihydrouracil and 5,6-dihydrothymine to the corresponding N-carbamoyl β-amino acids. This enzyme has often been referred to as hydantoinase owing to its industrial application in the production of optically pure amino acids starting from racemic mixtures of 5-monosubstituted hydantoins. Recombinant dihydropyrimidinase from Sinorhizobium meliloti CECT4114 (SmelDhp) has been expressed, purified and crystallized. Crystallization was performed using the counter-diffusion method with capillaries of 0.3 mm inner diameter. Crystals of SmelDhp suitable for data collection and structure determination were grown in the presence of agarose at 0.1%(w/v) in order to ensure mass transport controlled by diffusion. X-ray data were collected to a resolution of 1.85 Å. The crystal belongs to the orthorhombic space group C222 1 , with unit-cell parameters a = 124.89, b = 126.28, c = 196.10 Å and two molecules in the asymmetric unit. A molecular-replacement solution has been determined and refinement is in progress
Technical justification for a request to reclassify the former CCC/USDA facility at Canada, Kansas.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2007-12-21
Contamination in groundwater at Canada, Kansas, was discovered in 1997, during limited private well sampling near former grain storage facilities of the Commodity Credit Corporation, U.S. Department of Agriculture (CCC/USDA). Subsequent investigations by the Kansas Department of Health and Environment (KDHE) confirmed carbon tetrachloride and nitrate concentrations in groundwater above the respective maximum contaminant levels (MCLs) of 5.0 {micro}g/L and 10.0 mg/L. The KDHE investigations identified both the former CCC/USDA grain storage facility and a private grain storage facility as likely sources for the carbon tetrachloride contamination. The CCC/USDA funded extension of a rural water district line to provide a permanent alternate water supply, and the KDHE has conducted long-term monitoring under the State Water Plan. This document presents an analysis of the available information for the Canada site, acquired in previous investigations and the long-term KDHE monitoring. This analysis forms the technical justification for a request to reclassify the former CCC/USDA grain storage facility at Canada as a site requiring no further action under the Intergovernmental Agreement (IGA) between the KDHE and the USDA's Farm Service Agency. The KDHE's long-term water level monitoring results indicate a consistent groundwater flow direction to the east-southeast. Consequently, the wells with the highest overall concentrations of carbon tetrachloride are downgradient from the private grain storage facility but not downgradient from the former CCC/USDA facility. The KDHE criterion for reclassification of a site is that contamination there should not pose an unacceptable risk, on the basis of analytical results for four consecutive, equally timed, sequenced sampling episodes over a period of no less than two years. In seven KDHE sampling events over a period of six years (2001-2007), the concentrations of carbon tetrachloride in the monitoring well on the former
Emerging crops in the USDA arid lands germplasm collection
The USDA National Plant Germplasm System maintains collections of several emerging crops for arid lands at the National Arid Land Plant Genetic Resources Unit in Parlier, CA (NALPGRU). The guayule, jojoba, and prickly pear collections are most active in terms of current research and crop development...
Climate programs update: USDA Southwest Regional Climate Hub update
PROGRAM OVERVIEW: The overarching goal of the USDA SW Climate Hub is to assist farmers, ranchers and foresters in addressing the effects of climate change including prolonged drought, increased insect outbreaks and severe wildfires. In the first year of operations, the SW Climate Hub (est. Februa...
USDA Mosquito Control Product Research for the US Military
New techniques that were developed at the USDA to protect deployed military troops from the threat of vector-borne diseases and are also applicable for use by civilian mosquito control program use are described. Techniques to be illustrated include: (1) novel military personal protection methods, (2...
2012-08-17
...Authentication Service (eAuth), located at http://www.eauth.egov.usda.gov . The USDA eAuth service provides the... Electronic Access Code. OMB Number: 0503-0014. Expiration Date of Approval: August 31, 2013. Type of Request... eAuth as a management and technical process that addresses user authentication and authorization...
Information Security: USDA Needs to Implement Its Departmentwide Information Security Plan
National Research Council Canada - National Science Library
2000-01-01
USDA has taken positive steps to begin improving its information security by developing its August 1999 Action Plan with recommendations to strengthen department-wide information security and hiring...
Final Corrective Action Study for the Former CCC/USDA Facility in Hanover, Kansas
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States)
2013-11-01
Low concentrations of carbon tetrachloride in groundwater and vapor intrusion into a limited number of residences (attributable to the contaminant concentrations in groundwater) have been identified in Hanover, Kansas, at and near a grain storage facility formerly leased and operated by the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA). At the request of the Kansas Department of Health and Environment (KDHE 2009h), the CCC/USDA has prepared this Corrective Action Study (CAS) for the facility. The CAS examines corrective actions to address the contamination in groundwater and soil vapor.
Energy Technology Data Exchange (ETDEWEB)
Rojas Martinez, Y., E-mail: yarojas@ut.edu.co; Bustos Rodriguez, H.; Oyola Lozano, D. [University of Tolima, Department of Physics (Colombia); Perez Alcazar, G. A.; Paz, J. C. [University of Valle, Department of Physics (Colombia)
2007-02-15
The alloys between a transition metal and a rare earth present magnetic and magneto optical properties of exceptional interest for the production of magnetic devices for information storage. In this work we report the magnetic and structural properties, obtained by Moessbauer spectrometry (MS) and X-ray diffraction (XRD), of Tb{sub 0.257-x}Nd{sub x}Fe{sub 0.743} alloys with x = 0 and 0.257 prepared by mechanical alloying during 12, 24 and 48 h, to study the influence of the milling time in their magnetic and structural properties. The X-rays results show for all the samples that the {alpha} and an amorphous phase are always present. The first decreases and the second increases with the increase of the milling time. Moessbauer results show that the amorphous phase in samples with Nd is ferromagnetic and appears as a hyperfine field distribution and a broad doublet, and that as the milling time increases the paramagnetic contribution increases. For samples with Tb the amorphous phase is paramagnetic and appears as a broad doublet which increases with the milling time and for 48 h milling it appears an additional broad singlet.
USDA Northeast climate hub greenhouse gas mitigation workshop technical report
In April 2015, USDA Secretary Vilsack announced the Greenhouse Gas Building Blocks for Climate Smart Agriculture and Forestry in an effort to reduce greenhouse gas emissions, increase carbon sequestration, and expand renewable energy production in the agricultural and forestry sectors. This initiati...
Tran, Tam T; Charles, Trevor C
2016-02-01
Economically competitive commercial production of biodegradable bioplastics with desirable properties is an important goal. In this study, we demonstrate the use of chromosome engineering of an alternative bacterial host, Sinorhizobium meliloti, for production of the copolymer, poly(lactate-co-3-hydroxybutyrate). Codon-optimized genes for 2 previously engineered enzymes, Clostridium propionicum propionate CoA transferase (Pct532Cp) and Pseudomonas sp. strain MBEL 6-19 polyhydroxyalkanoate (PHA) synthase 1 (PhaC1400Ps6-19), were introduced into S. meliloti Rm1021 by chromosome integration, replacing the native phbC gene. On the basis of phenotypic analysis and detection of polymer product by gas chromatography analysis, synthesis and accumulation of the copolymer was confirmed. The chromosome integrant strain, with the introduced genes under the control of the native phbC promoter, is able to produce over 15% cell dry mass of poly(lactate-co-3-hydroxybutyrate), containing 30 mol% lactate, from growth on mannitol. We were also able to purify the polymer from the culture and confirm the structure by NMR and GC-MS. To our knowledge, this is the first demonstration of production of this copolymer in the Alphaproteobacteria. Further optimization of this system may eventually yield strains that are able to produce economically viable commercial product.
A Partnership for Public Health: USDA Branded Food Products Database
The importance of comprehensive food composition databases is more critical than ever in helping to address global food security. The USDA National Nutrient Database for Standard Reference is the “gold standard” for food composition databases. The presentation will include new developments in stren...
Powdery mildew reaction of hop cultivars and USDA germplasm, 2015
This research was conducted to identify possible sources of resistance to the disease powdery mildew in publicly-available hop germplasm and cultivars. Germplasm with the highest levels of downy mildew resistance in the USDA collection and various cultivars of interest were screened for their reac...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special requirements for operations in the band 29.1-29.25 GHz between NGSO MSS and LMDS. 25.257 Section 25.257 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25...
A content analysis of USDA Forest Service recreation partnerships
Steve Selin
1995-01-01
The USDA Forest Service has been implementing a partnership initiative for 6 years as part of the National Recreation Strategy. Several internal efforts have been undertaken to evaluate the progress made in this initiative as well as to make adjustments in the initiative for the future. These evaluation efforts are extended to present a content analysis of recreation...
2-(5,7-Dimethyl-3-methylsulfanyl-1-benzofuran-2-ylacetic acid
Directory of Open Access Journals (Sweden)
Hong Dae Choi
2008-08-01
Full Text Available The title compound, C13H14O3S, was prepared by alkaline hydrolysis of ethyl 2-(5,7-dimethyl-3-methylsulfanyl-1-benzofuran-2-ylacetate. In the crystal structure, the carboxyl groups are involved in intermolecular O—H...O hydrogen bonds, which link the molecules into centrosymmetric dimers. These dimers are further packed into stacks along the a axis by weak C—H...π interactions.
Regional climate services: A regional partnership between NOAA and USDA
Climate services in the Midwest and Northern Plains regions have been enhanced by a recent addition of the USDA Climate Hubs to NOAA’s existing network of partners. This new partnership stems from the intrinsic variability of intra and inter-annual climatic conditions, which makes decision-making fo...
Structure of the conserved hypothetical protein MAL13P1.257 from Plasmodium falciparum
International Nuclear Information System (INIS)
Holmes, Margaret A.; Buckner, Frederick S.; Van Voorhis, Wesley C.; Mehlin, Christopher; Boni, Erica; Earnest, Thomas N.; DeTitta, George; Luft, Joseph; Lauricella, Angela; Anderson, Lori; Kalyuzhniy, Oleksandr; Zucker, Frank; Schoenfeld, Lori W.; Hol, Wim G. J.; Merritt, Ethan A.
2006-01-01
The crystal structure of a conserved hypothetical protein, MAL13P1.257 from P. falciparum, has been determined at 2.17 Å resolution. The structure represents a new protein fold and is the first structural representative for Pfam sequence family PF05907. The structure of a conserved hypothetical protein, PlasmoDB sequence MAL13P1.257 from Plasmodium falciparum, Pfam sequence family PF05907, has been determined as part of the structural genomics effort of the Structural Genomics of Pathogenic Protozoa consortium. The structure was determined by multiple-wavelength anomalous dispersion at 2.17 Å resolution. The structure is almost entirely β-sheet; it consists of 15 β-strands and one short 3 10 -helix and represents a new protein fold. The packing of the two monomers in the asymmetric unit indicates that the biological unit may be a dimer.
The parasitoid Psytallia cf. concolor (Szépligeti) was reared on sterile Mediterranean fruit fly larvae at the USDA-APHIS-PPQ, Petapa Quarantine Laboratory in Guatemala and shipped to the USDA-ARS, Parlier, for wide-spread release and biological control of olive fruit fly in California. As many as 3...
International Nuclear Information System (INIS)
Martínez-Rodríguez, Sergio; González-Ramírez, Luis Antonio; Clemente-Jiménez, Josefa María; Rodríguez-Vico, Felipe; Las Heras-Vázquez, Francisco Javier; Gavira, Jose Antonio; García-Ruiz, Juan Ma.
2007-01-01
Crystals of an active-site mutated hydantoin racemase from S. meliloti have been obtained in the presence and absence of d,l-5-isopropyl-hydantoin and characterized by X-ray diffraction. A recombinant active-site mutant of hydantoin racemase (C76A) from Sinorhizobium meliloti CECT 4114 (SmeHyuA) has been crystallized in the presence and absence of the substrate d,l-5-isopropyl hydantoin. Crystals of the SmeHyuA mutant suitable for data collection and structure determination were grown using the counter-diffusion method. X-ray data were collected to resolutions of 2.17 and 1.85 Å for the free and bound enzymes, respectively. Both crystals belong to space group R3 and contain two molecules of SmeHyuA per asymmetric unit. The crystals of the free and complexed SmeHyuA have unit-cell parameters a = b = 85.43, c = 152.37 Å and a = b = 85.69, c = 154.38 Å, crystal volumes per protein weight (V M ) of 1.94 and 1.98 Å 3 Da −1 and solvent contents of 36.7 and 37.9%, respectively
Examining USDA Forest Service recreation partnerships: institutional and relational interactions
Erin Seekamp; Lee K. Cerveny
2010-01-01
Since the 1980s, the USDA Forest Service budget has experienced limited growth. Downsizing and outsourcing characterize the agency's response to constrained appropriations. The agency increasingly works with partners to meet targets that otherwise could not be achieved. Partnerships may take many structural forms (e.g., memorandums of understanding, joint venture...
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2007-10-12
From approximately 1949 until 1970, the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) operated a grain storage facility on federally owned property approximately 0.25 mi northwest of Savannah, Missouri. During this time, commercial grain fumigants containing carbon tetrachloride were commonly used by the CCC/USDA and the private grain storage industry to preserve grain in their facilities. In November 1998, carbon tetrachloride was detected in a private well (Morgan) roughly 50 ft south of the former CCC/USDA facility, as a result of state-wide screening of private wells near former CCC/USDA facilities, conducted in Missouri by the U.S. Environmental Protection Agency (EPA 1999). The 1998 and subsequent investigations by the EPA and the Missouri Department of Natural Resources (MoDNR) confirmed the presence of carbon tetrachloride in the Morgan well, as well as in a second well (on property currently occupied by the Missouri Department of Transportation [MoDOT]), approximately 400 ft east of the former CCC/USDA facility. Carbon tetrachloride concentrations in the Morgan well have ranged from the initial value of 29 {micro}g/L in 1998, up to a maximum of 61 {micro}g/L in 1999, and back down to 22 {micro}g/L in 2005. The carbon tetrachloride concentration in the MoDOT well in 2000 (the only time it was sampled) was 321 {micro}g/L. The concentrations for the two wells are above the EPA maximum contaminant level (MCL) of 5 {micro}g/L for carbon tetrachloride (EPA 1999; MoDNR 2000a,b). Because the observed contamination in the Morgan and MoDOT wells might be linked to the past use of carbon tetrachloride-based grain fumigants at its former grain storage facility, the CCC/USDA will conduct investigations to (1) characterize the source(s), extent, and factors controlling the subsurface distribution and movement of carbon tetrachloride at Savannah and (2) evaluate the health and environmental threats potentially posed by the contamination
Human dimensions in ecosystem management: a USDA Forest Service perspective
Deborah S. Carr
1995-01-01
For many decades, the natural resource profession has approached the management of public lands as exclusively a natural science endeavor requiring purely technical solutions. With the adoption of an ecosystem management philosophy, the USDA Forest Service has acknowledged the centrality of people in land management policy and decision-making. This paper explores the...
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M [Argonne National Lab. (ANL), Argonne, IL (United States)
2012-05-01
From September 1949 until September 1966, the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) leased property at the southeastern end of Montgomery City, Missouri, for the operation of a grain storage facility. During this time, commercial grain fumigants containing carbon tetrachloride were commonly used by the CCC/USDA and the private grain storage industry to preserve grain in their facilities.
Assessing human health risk in the USDA forest service
Energy Technology Data Exchange (ETDEWEB)
Hamel, D.R. [Department of Agriculture-Forest Service, Washington, DC (United States)
1990-12-31
This paper identifies the kinds of risk assessments being done by or for the US Department of Agriculture (USDA) Forest Service. Summaries of data sources currently in use and the pesticide risk assessments completed by the agency or its contractors are discussed. An overview is provided of the agency`s standard operating procedures for the conduct of toxicological, ecological, environmental fate, and human health risk assessments.
Energy Technology Data Exchange (ETDEWEB)
Bandyopadhyay, Susmita [Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Avenue, El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), The University of Texas at El Paso (United States); Peralta-Videa, Jose R. [Department of Chemistry, The University of Texas at El Paso, 500 West University Avenue, El Paso, TX 79968 (United States); Plascencia-Villa, German; Jose-Yacaman, Miguel [Department of Physics and Astronomy, The University of Texas at San Antonio, One UTSA Circle, San Antonio, TX 78249 (United States); Gardea-Torresdey, Jorge L., E-mail: jgardea@utep.edu [Environmental Science and Engineering PhD Program, The University of Texas at El Paso, 500 West University Avenue, El Paso, TX 79968 (United States); Department of Chemistry, The University of Texas at El Paso, 500 West University Avenue, El Paso, TX 79968 (United States); University of California Center for Environmental Implications of Nanotechnology (UC CEIN), The University of Texas at El Paso (United States)
2012-11-30
Highlights: Black-Right-Pointing-Pointer First cytotoxicity study of CeO{sub 2} and ZnO nanoparticles to Sinorhizobium meliloti. Black-Right-Pointing-Pointer First report upon the mechanisms of CeO{sub 2} and ZnO NPs toxicity to S. meliloti. Black-Right-Pointing-Pointer ZnO NPs were found to be bactericidal in lower concentration. Black-Right-Pointing-Pointer CeO{sub 2} NPs had bacteriostatic effect on S. meliloti. - Abstract: Cerium oxide (CeO{sub 2}) and zinc oxide (ZnO) nanoparticles (NPs) are extensively used in a variety of instruments and consumer goods. These NPs are of great concern because of potential toxicity towards human health and the environment. The present work aimed to assess the toxic effects of 10 nm CeO{sub 2} and ZnO NPs towards the nitrogen fixing bacterium Sinorhizobium meliloti. Toxicological parameters evaluated included UV/Vis measurement of minimum inhibitory concentration, disk diffusion tests, and dynamic growth. Ultra high-resolution scanning transmission electron microscopy (STEM) and infrared spectroscopy (FTIR) were utilized to determine the spatial distribution of NPs and macromolecule changes in bacterial cells, respectively. Results indicate that ZnO NPs were more toxic than CeO{sub 2} NPs in terms of inhibition of dynamic growth and viable cells counts. STEM images revealed that CeO{sub 2} and ZnO NPs were found on bacterial cell surfaces and ZnO NPs were internalized into the periplasmic space of the cells. FTIR spectra showed changes in protein and polysaccharide structures of extra cellular polymeric substances present in bacterial cell walls treated with both NPs. The growth data showed that CeO{sub 2} NPs have a bacteriostatic effect, whereas ZnO NPs is bactericidal to S. meliloti. Overall, ZnO NPs were found to be more toxic than CeO{sub 2} NPs.
Walker, Graham C.; Finan, Turlough M.; Mengoni, Alessio; Griffitts, Joel S.
2018-01-01
Bacterial genome evolution is characterized by gains, losses, and rearrangements of functional genetic segments. The extent to which large-scale genomic alterations influence genotype-phenotype relationships has not been investigated in a high-throughput manner. In the symbiotic soil bacterium Sinorhizobium meliloti, the genome is composed of a chromosome and two large extrachromosomal replicons (pSymA and pSymB, which together constitute 45% of the genome). Massively parallel transposon insertion sequencing (Tn-seq) was employed to evaluate the contributions of chromosomal genes to growth fitness in both the presence and absence of these extrachromosomal replicons. Ten percent of chromosomal genes from diverse functional categories are shown to genetically interact with pSymA and pSymB. These results demonstrate the pervasive robustness provided by the extrachromosomal replicons, which is further supported by constraint-based metabolic modeling. A comprehensive picture of core S. meliloti metabolism was generated through a Tn-seq-guided in silico metabolic network reconstruction, producing a core network encompassing 726 genes. This integrated approach facilitated functional assignments for previously uncharacterized genes, while also revealing that Tn-seq alone missed over a quarter of wild-type metabolism. This work highlights the many functional dependencies and epistatic relationships that may arise between bacterial replicons and across a genome, while also demonstrating how Tn-seq and metabolic modeling can be used together to yield insights not obtainable by either method alone. PMID:29672509
Fox, Raymond G; Magness, Scott; Kujoth, Gregory C; Prolla, Tomas A; Maeda, Nobuyo
2012-05-01
Changes in intestinal absorption of nutrients are important aspects of the aging process. To address this issue, we investigated the impact of accelerated mitochondrial DNA mutations on the stem/progenitor cells in the crypts of Lieberkühn in mice homozygous for a mitochondrial DNA polymerase gamma mutation, Polg(D257A), that exhibit accelerated aging phenotype. As early as 3-7 mo of age, the small intestine was significantly enlarged in the PolgD257A mice. The crypts of the PolgD257A mice contained 20% more cells than those of their wild-type littermates and exhibited a 10-fold increase in cellular apoptosis primarily in the stem/progenitor cell zones. Actively dividing cells were proportionally increased, yet a significantly smaller proportion of cells was in the S phase of the cell cycle. Stem cell-derived organoids from PolgD257A mice failed to develop fully in culture and exhibited fewer crypt units, indicating an impact of the mutation on the intestinal epithelial stem/progenitor cell maintenance. In addition, epithelial cell migration along the crypt-villus axis was slowed and less organized, and the ATP content in the villi was significantly reduced. On a high-fat, high-carbohydrate diet, PolgD257A mice showed significantly restricted absorption of excess lipids accompanied by an increase in fecal steatocrits. We conclude that the PolgD257A mutation causes cell cycle dysregulation in the crypts leading to the age-associated changes in the morphology of the small intestine and contributes to the restricted absorption of dietary lipids.
Evaluating citrus germplasm for huanglongbing (HLB) resistance: USDA-ARS Inoculation Program
The Asian citrus psyllid (ACP), Diaphorina citri, is an important pest because it vectors bacteria responsible for a serious disease of citrus known as huanglongbing (citrus greening disease). USDA-ARS researchers recently established a program for screening citrus germplasm for resistance to the di...
History and Accomplishments of USDA-ARS Avian Disease and Oncology Laboratory
The USDA-Agricultural Research Service Avian Disease and Oncology Laboratory (ADOL) in East Lansing, Michigan, formerly known as Regional Poultry Research Laboratory, was dedicated on August 8, 1939. Its establishment was the result of joint efforts by the Agricultural Experiment Stations of the Nor...
U.S. Environmental Protection Agency — This EnviroAtlas dataset shows the acres of land enrolled in the US Department of Agriculture (USDA)'s Conservation Reserve Program (CRP). The CRP is administered by...
Final corrective action study for the former CCC/USDA facility in Ramona, Kansas.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M. (Environmental Science Division)
2011-04-20
Past operations at a grain storage facility formerly leased and operated by the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) in Ramona, Kansas, resulted in low concentrations of carbon tetrachloride in groundwater that slightly exceed the regulatory standard in only one location. As requested by the Kansas Department of Health and Environment, the CCC/USDA has prepared a Corrective Action Study (CAS) for the facility. The CAS examines corrective actions to address groundwater impacted by the former CCC/USDA facility but not releases caused by other potential groundwater contamination sources in Ramona. Four remedial alternatives were considered in the CAS. The recommended remedial alternative in the CAS consists of Environmental Use Control to prevent the inadvertent use of groundwater as a water supply source, coupled with groundwater monitoring to verify the continued natural improvement in groundwater quality. The Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) has directed Argonne National Laboratory to prepare a Corrective Action Study (CAS), consistent with guidance from the Kansas Department of Health and Environment (KDHE 2001a), for the CCC/USDA grain storage facility formerly located in Ramona, Kansas. This effort is pursuant to a KDHE (2007a) request. Although carbon tetrachloride levels at the Ramona site are low, they remain above the Kansas Tier 2 risk-based screening level (RBSL) and the U.S. Environmental Protection Agency (EPA) maximum contaminant level (MCL) of 5 {micro}g/L (Kansas 2003, 2004). In its request for the CAS, the KDHE (2007a) stated that, because of these levels, risk is associated with potential future exposure to contaminated groundwater. The KDHE therefore determined that additional measures are warranted to limit future use of the property and/or exposure to contaminated media as part of site closure. The KDHE further requested comparison of at least two corrective
Ahuja, Jaspreet K C; Moshfegh, Alanna J; Holden, Joanne M; Harris, Ellen
2013-02-01
The USDA food and nutrient databases provide the basic infrastructure for food and nutrition research, nutrition monitoring, policy, and dietary practice. They have had a long history that goes back to 1892 and are unique, as they are the only databases available in the public domain that perform these functions. There are 4 major food and nutrient databases released by the Beltsville Human Nutrition Research Center (BHNRC), part of the USDA's Agricultural Research Service. These include the USDA National Nutrient Database for Standard Reference, the Dietary Supplement Ingredient Database, the Food and Nutrient Database for Dietary Studies, and the USDA Food Patterns Equivalents Database. The users of the databases are diverse and include federal agencies, the food industry, health professionals, restaurants, software application developers, academia and research organizations, international organizations, and foreign governments, among others. Many of these users have partnered with BHNRC to leverage funds and/or scientific expertise to work toward common goals. The use of the databases has increased tremendously in the past few years, especially the breadth of uses. These new uses of the data are bound to increase with the increased availability of technology and public health emphasis on diet-related measures such as sodium and energy reduction. Hence, continued improvement of the databases is important, so that they can better address these challenges and provide reliable and accurate data.
Associating mapping of stigma characteristics using the USDA rice core collection
A mini-core from the USDA rice core collection was phenotyped for nine traits of stigma and spikelet and genotyped with 109 DNA markers. Marker-trait association mapping was used to identify the regions associated with the nine traits. Resulting associations were adjusted using false discovery rate ...
USDA forest service southern region – It’s all about GRITS
Barbara S. Crane; Kevin M. Potter
2017-01-01
Genetic resource management programs across the U.S. Department of Agriculture Forest Service (USDA FS) play a key role in supporting successful land management activities. The programs are responsible for developing and providing plant material for revegetation, seed management guidelines, emergency fire recovery assistance, genetic conservation strategies, climate...
Directory of Open Access Journals (Sweden)
P. Fareleira
2007-07-01
Full Text Available O trabalho teve como principal objectivo a obtenção de estirpes de rizóbio adequadas à nodulação de luzernas anuais e adaptadas a sobreviver nas condições ambientais susceptíveis de ocorrer em solos degradados. Dado que as populações de rizóbio apresentam variabilidade considerável no que respeita à tolerância a factores ambientais, os estudos focaram-se na pesquisa e na selecção de estirpes resistentes a condições adversas. Efectuaram-se colheitas de solos em diversas zonas no sul do País, seleccionando-se locais afectados por secura, temperaturas elevadas e, pontualmente, salinidade. A partir destes solos, isolaram-se estirpes de rizóbio, usando como planta hospedeira a luzerna anual Medicago polymorpha. Estudaram-se os efeitos de condições de stresse ambiental, como a salinidade e as altas temperaturas, no crescimento das estirpes isoladas. Dos 41 isolamentos analisados, 11 apresentaram crescimento em meio con-tendo 1,4 M de cloreto de sódio e suplementado com 10% de extracto de terra, e 22 cresceram quando incubadas a 45 ºC em meio sem aditivos. Três estirpes mostraram ter capacidade para crescer sob os efeitos conjuntos da salinidade e da alta temperatura. A análise de extractos etanólicos de estirpes tolerantes à salinidade revelou, na maior parte dos casos, a acumulação, induzida pelo sal, dos solutos compatíveis de Sinorhizobium: o dipéptido N - acetilglutaminilglutamina amida, vários tipos de betaínas, trealose, glutamato e prolina. A observação, por NMR de 31P in vivo, de uma estirpe tolerante ao sal, proveniente de um solo xistoso de baixo teor em fósforo, mostrou a presença de níveis elevados de reservas intracelulares de fosfato inorgânico (polifosfato, sugerindo um bom potencial para utilização em solos onde os riscos de salinização se conjuguem com deficiências em fósforo assimilável.The main objective of this work was to obtain rhizobial strains able to nodulate annual medics and
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2008-12-15
The Commodity Credit Corporation (CCC), an agency of the U.S. Department of Agriculture (USDA), operated a grain storage facility at the northeastern edge of the city of Hanover, Kansas, from 1950 until the early 1970s. During this time, commercial grain fumigants containing carbon tetrachloride were in common use by the grain storage industry to preserve grain in their facilities. In February 1998, trace to low levels of carbon tetrachloride (below the maximum contaminant level [MCL] of 5.0 {micro}g/L) were detected in two private wells near the former grain storage facility at Hanover, as part of a statewide USDA private well sampling program that was implemented by the Kansas Department of Health and Environment (KDHE) near former CCC/USDA facilities. In 2007, the CCC/USDA conducted near-surface soil sampling at 61 locations and also sampled indoor air at nine residences on or adjacent to its former Hanover facility to address the residents concerns regarding vapor intrusion. Low levels of carbon tetrachloride were detected at four of the nine homes. The results were submitted to the KDHE in October 2007 (Argonne 2007). On the basis of the results, the KDHE requested sub-slab sampling and/or indoor air sampling (KDHE 2007). This Work Plan describes, in detail, the proposed additional scope of work requested by the KDHE and has been developed as a supplement to the comprehensive site investigation work plan that is pending (Argonne 2008). Indoor air samples collected previously from four homes at Hanover were shown to contain the carbon tetrachloride at low concentrations (Table 2.1). It cannot be concluded from these previous data that the source of the detected carbon tetrachloride is vapor intrusion attributable to former grain storage operations of the CCC/USDA at Hanover. The technical objective of the vapor intrusion investigation described here is to assess the risk to human health due to the potential for upward migration of carbon tetrachloride and
USDA Forest Service goals and programs for monitoring neotropical migratory birds
Patricia Manley
1993-01-01
The USDA Forest Service (USFS) developed goals, objectives, and guidelines for monitoring neotropical migratory birds (NTMB) on National Forest System lands in response to the Neotropical Migratory Bird Conservation Program Partners in Flight. A USFS task group developed a hierarchical monitoring framework designed to define priorities for type of monitoring data....
Resistance to organic hydroperoxides requires ohr and ohrR genes in Sinorhizobium meliloti
Directory of Open Access Journals (Sweden)
Dufour Virginie
2011-05-01
Full Text Available Abstract Background Sinorhizobium meliloti is a symbiotic nitrogen-fixing bacterium that elicits nodules on roots of host plants Medicago sativa. During nodule formation bacteria have to withstand oxygen radicals produced by the plant. Resistance to H2O2 and superoxides has been extensively studied in S. meliloti. In contrast resistance to organic peroxides has not been investigated while S. meliloti genome encodes putative organic peroxidases. Organic peroxides are produced by plants and are highly toxic. The resistance to these oxygen radicals has been studied in various bacteria but never in plant nodulating bacteria. Results In this study we report the characterisation of organic hydroperoxide resistance gene ohr and its regulator ohrR in S. meliloti. The inactivation of ohr affects resistance to cumene and ter-butyl hydroperoxides but not to hydrogen peroxide or menadione in vitro. The expression of ohr and ohrR genes is specifically induced by organic peroxides. OhrR binds to the intergenic region between the divergent genes ohr and ohrR. Two binding sites were characterised. Binding to the operator is prevented by OhrR oxidation that promotes OhrR dimerisation. The inactivation of ohr did not affect symbiosis and nitrogen fixation, suggesting that redundant enzymatic activity exists in this strain. Both ohr and ohrR are expressed in nodules suggesting that they play a role during nitrogen fixation. Conclusions This report demonstrates the significant role Ohr and OhrR proteins play in bacterial stress resistance against organic peroxides in S. meliloti. The ohr and ohrR genes are expressed in nodule-inhabiting bacteroids suggesting a role during nodulation.
Succinoglycan Production Contributes to Acidic pH Tolerance in Sinorhizobium meliloti Rm1021.
Hawkins, Justin P; Geddes, Barney A; Oresnik, Ivan J
2017-12-01
In this work, the hypothesis that exopolysaccharide plays a role in the survival of Sinorhizobium meliloti at low pH levels is addressed. When S. meliloti was grown at pH 5.75, synthesis of succinoglycan increased, whereas synthesis of galactoglucan decreased. Succinoglycan that was isolated from cultures grown at low pH had a lower degree of polymerization relative to that which was isolated from cultures grown at neutral pH, suggesting that low-molecular weight (LMW) succinoglycan might play a role in adaptation to low pH. Mutants unable to produce succinoglycan or only able to produce high-molecular weight polysaccharide were found to be sensitive to low pH. However, strains unable to produce LMW polysaccharide were 10-fold more sensitive. In response to low pH, transcription of genes encoding proteins for succinoglycan, glycogen, and cyclic β(1-2) glucans biosynthesis increased, while those encoding proteins necessary for the biosynthesis of galactoglucan decreased. While changes in pH did not affect the production of glycogen or cyclic β(1-2) glucan, it was found that the inability to produce cyclic β(1-2) glucan did contribute to pH tolerance in the absence of succinoglycan. Finally, in addition to being sensitive to low pH, a strain carrying mutations in exoK and exsH, which encode the glycanases responsible for the cleavage of succinoglycan to LMW succinoglycan, exhibited a delay in nodulation and was uncompetitive for nodule occupancy. Taken together, the data suggest that the role for LMW succinoglycan in nodule development may be to enhance survival in the colonized curled root hair.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2010-08-16
From September 1949 until September 1966, the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) leased property at the southeastern end of Montgomery City, Missouri, for the operation of a grain storage facility. During this time, commercial grain fumigants containing carbon tetrachloride were commonly used by the CCC/USDA and the private grain storage industry to preserve grain in their facilities. In January 2000, carbon tetrachloride was detected in a soil sample (220 {micro}g/kg) and two soil gas samples (58 {micro}g/m{sup 3} and 550 {micro}g/m{sup 3}) collected at the former CCC/USDA facility, as a result of a pre-CERCLIS site screening investigation (SSI) performed by TN & Associates, Inc., on behalf of the U.S. Environmental Protection Agency (EPA), Region VII (MoDNR 2001). In June 2001, the Missouri Department of Natural Resources (MoDNR) conducted further sampling of the soils and groundwater at the former CCC/USDA facility as part of a preliminary assessment/site inspection (PA/SI). The MoDNR confirmed the presence of carbon tetrachloride (at a maximum identified concentration of 2,810 {micro}g/kg) and chloroform (maximum 82 {micro}g/kg) in the soils and also detected carbon tetrachloride and chloroform (42.2 {micro}g/L and 58.4 {micro}g/L, respectively) in a groundwater sample collected at the former facility (MoDNR 2001). The carbon tetrachloride levels identified in the soils and groundwater are above the default target level (DTL) values established by the MoDNR for this contaminant in soils of all types (79.6 {micro}g/kg) and in groundwater (5.0 {micro}g/L), as outlined in Missouri Risk-Based Corrective Action (MRBCA): Departmental Technical Guidance (MoDNR 2006a). The corresponding MRBCA DTL values for chloroform are 76.6 {micro}g/kg in soils of all types and 80 {micro}g/L in groundwater. Because the observed contamination at Montgomery City might be linked to the past use of carbon tetrachloride-based fumigants at its
Program review of the USDA Center for Medical, Agricultural and Veterinary Entomology
The USDA-ARS Center for Medical, Agricultural and Veterinary Entomology (CMAVE) has a history that starts in 1932 in Orlando to develop methods to control mosquitoes, including malaria vectors under conditions simulating those of the south Pacific jungles, and other insects affecting man and animals...
In response to recent interest in vitamin D composition of foods, USDA-NDL is updating and expanding data in the National Nutrient Database for Standard Reference. In 2007, the USDA sampled vitamin D3 fortified yogurt and milk from 12 and 24 supermarkets, respectively, selected from a nationwide sta...
The parasitoid Psytallia humilis = P. cf. concolor (Szépligeti) was reared on sterile Mediterranean fruit fly, Ceratitis capitata (Wiedemann), larvae at the USDA, APHIS, PPQ, Moscamed biological control laboratory in San Miguel Petapa, Guatemala and shipped to the USDA, ARS, Parlier, for biological ...
Dietary intake of children participating in the USDA Summer Food Service Program
The USDA summer food service program (SFSP) provides free lunches during the summer. This study examined the foods selected and consumed by participating children. Three hundred and two children were observed in 14 schools during a 4-week period in June, 2011; 50% were male; 75% were in elementary s...
Assessing the effects of USDA conservation programs on ecosystem services provided by wetlands
The Conservation Effects Assessment Project (CEAP) is led by the U.S. Department of Agriculture (USDA) in an effort to quantify the environmental effects of conservation programs and practices on privately owned agricultural landscapes across the United States. CEAP’s approach includes application ...
History of cotton fiber bioscience research at USDA-ARS Southern Regional Research Center
Improving fiber quality has been an important breeding goal for cotton breeders. Better understanding of fiber development helps cotton scientists to devise a strategy for crop improvement either through marker-assisted selection or via manipulation of fiber genes. USDA-ARS Southern Regional Researc...
diCenzo, George C; Wellappili, Deelaka; Golding, G Brian; Finan, Turlough M
2018-05-04
Integration of newly acquired genes into existing regulatory networks is necessary for successful horizontal gene transfer (HGT). Ten percent of bacterial species contain at least two DNA replicons over 300 kilobases in size, with the secondary replicons derived predominately through HGT. The Sinorhizobium meliloti genome is split between a 3.7 Mb chromosome, a 1.7 Mb chromid consisting largely of genes acquired through ancient HGT, and a 1.4 Mb megaplasmid consisting primarily of recently acquired genes. Here, RNA-sequencing is used to examine the transcriptional consequences of massive, synthetic genome reduction produced through the removal of the megaplasmid and/or the chromid. Removal of the pSymA megaplasmid influenced the transcription of only six genes. In contrast, removal of the chromid influenced expression of ∼8% of chromosomal genes and ∼4% of megaplasmid genes. This was mediated in part by the loss of the ETR DNA region whose presence on pSymB is due to a translocation from the chromosome. No obvious functional bias among the up-regulated genes was detected, although genes with putative homologs on the chromid were enriched. Down-regulated genes were enriched in motility and sensory transduction pathways. Four transcripts were examined further, and in each case the transcriptional change could be traced to loss of specific pSymB regions. In particularly, a chromosomal transporter was induced due to deletion of bdhA likely mediated through 3-hydroxybutyrate accumulation. These data provide new insights into the evolution of the multipartite bacterial genome, and more generally into the integration of horizontally acquired genes into the transcriptome. Copyright © 2018 diCenzo, et al.
Directory of Open Access Journals (Sweden)
George C. diCenzo
2018-05-01
Full Text Available Integration of newly acquired genes into existing regulatory networks is necessary for successful horizontal gene transfer (HGT. Ten percent of bacterial species contain at least two DNA replicons over 300 kilobases in size, with the secondary replicons derived predominately through HGT. The Sinorhizobium meliloti genome is split between a 3.7 Mb chromosome, a 1.7 Mb chromid consisting largely of genes acquired through ancient HGT, and a 1.4 Mb megaplasmid consisting primarily of recently acquired genes. Here, RNA-sequencing is used to examine the transcriptional consequences of massive, synthetic genome reduction produced through the removal of the megaplasmid and/or the chromid. Removal of the pSymA megaplasmid influenced the transcription of only six genes. In contrast, removal of the chromid influenced expression of ∼8% of chromosomal genes and ∼4% of megaplasmid genes. This was mediated in part by the loss of the ETR DNA region whose presence on pSymB is due to a translocation from the chromosome. No obvious functional bias among the up-regulated genes was detected, although genes with putative homologs on the chromid were enriched. Down-regulated genes were enriched in motility and sensory transduction pathways. Four transcripts were examined further, and in each case the transcriptional change could be traced to loss of specific pSymB regions. In particularly, a chromosomal transporter was induced due to deletion of bdhA likely mediated through 3-hydroxybutyrate accumulation. These data provide new insights into the evolution of the multipartite bacterial genome, and more generally into the integration of horizontally acquired genes into the transcriptome.
A novel symbiovar (aegeanense) of the genus Ensifer nodulates Vigna unguiculata.
Tampakaki, Anastasia P; Fotiadis, Christos T; Ntatsi, Georgia; Savvas, Dimitrios
2017-10-01
Cowpea (Vigna unguiculata) forms nitrogen-fixing root nodules with diverse symbiotic bacteria, mainly slow-growing rhizobial species belonging to the genus Bradyrhizobium, although a few studies have reported the isolation of fast-growing rhizobia under laboratory and field conditions. Although much research has been done on cowpea-nodulating bacteria in various countries around the world, very limited information is available on cowpea rhizobia in European soils. The aim of this study was to study the genetic and phenotypic diversity of indigenous cowpea-nodulating rhizobia in Greece. The genetic diversity of indigenous rhizobia associated with cowpea was investigated through a polyphasic approach. ERIC-PCR based fingerprinting analysis grouped the isolates into three groups. Based on the analysis of the 16S rRNA genes, IGS and on the concatenation of six housekeeping genes (recA, glnII, gyrB, truA, thrA and SMc00019), rhizobial isolates were classified within the species Ensifer fredii. However, symbiotic gene phylogenies, based on nodC, nifH and rhcRST genes, showed that the Ensifer isolates are markedly diverged from type and reference strains of E. fredii and formed one clearly separate cluster. The E. fredii strains were able to nodulate and fix nitrogen in cowpea but not in soybean and common bean. The present study showed that cowpea is nodulated under field conditions by fast-growing rhizobia belonging to the species E. fredii. Based on the phylogenies, similarity levels of symbiotic genes and the host range, the Ensifer isolates may constitute a new symbiovar for which the name 'aegeanense' is proposed. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Döhlemann, Johannes; Brennecke, Meike; Becker, Anke
2016-09-10
The soil-dwelling α-proteobacterium Sinorhizobium meliloti serves as model for studies of symbiotic nitrogen fixation, a highly important process in sustainable agriculture. Here, we report advancements of the genetic toolbox accelerating genome editing in S. meliloti. The hsdMSR operon encodes a type-I restriction-modification (R-M) system. Transformation of S. meliloti is counteracted by the restriction endonuclease HsdR degrading DNA which lacks the appropriate methylation pattern. We provide a stable S. meliloti hsdR deletion mutant showing enhanced transformation with Escherichia coli-derived plasmid DNA and demonstrate that using an E. coli plasmid donor, expressing S. meliloti methyl transferase genes, is an alternative strategy of increasing the transformation efficiency of S. meliloti. Furthermore, we devise a novel cloning-free genome editing (CFGE) method for S. meliloti, Agrobacterium tumefaciens and Xanthomonas campestris, and demonstrate the applicability of this method for intricate applications of the Cre/lox recombination system in S. meliloti. An enhanced Cre/lox system, allowing for serial deletions of large genomic regions, was established. An assay of lox spacer mutants identified a set of lox sites mediating specific recombination. The availability of several non-promiscuous Cre recognition sites enables simultaneous specific Cre/lox recombination events. CFGE combined with Cre/lox recombination is put forward as powerful approach for targeted genome editing, involving serial steps of manipulation to expedite the genetic accessibility of S. meliloti as chassis. Copyright © 2016 Elsevier B.V. All rights reserved.
Effect of neem cake/fertilizers on symbiotic and non-symbiotic N2 fixing bacteria
International Nuclear Information System (INIS)
Akhtar, S.; Solangi, A.H.; Gilani, G.; Pirzada, M.H.
2002-01-01
Neem cake amendment in soil at 1.3% no adverse effect on the population of four symbiotic Rhizobium species viz., japonicum, R. leguminosarum, R. Phaseoli and R. Fredii and three non-symbiotic free living nitrogen fixers bacteria viz., Pseudomonas diazotrophicus, Klebsiella planticola and Enterobacter cloacae. Neem cake extracted with n-hexane stimulated the growth of Rhizobium species in vitro, whereas Neem cake expeller extracted neither inhibited nor stimulated the growth of Rhizobium species except for R. Fredii, whose was slightly retarded. The fertilizers (urea, NPK and DAP) had no adverse effect on these bacteria even at the dosage ten times higher the recommended dose. (author)
Building America Case Study: Rehabilitation of USDA Multifamily Homes, Georgia (Climate Zones 2-4)
Energy Technology Data Exchange (ETDEWEB)
2016-04-01
Rea Ventures Group, LLC, (Rea Ventures) partnered with Southface Energy Institute (Southface) on the rehabilitation of 418 low-income rental multifamily apartments located at 14 different properties in Georgia (Climate Zones 2-4). These 22-year old, individually-metered units were arranged in rowhouse or townhouse style units. Rehabilitation plans were developed using a process prescribed by the US Department of Agriculture (USDA) Rural Development program, who partially funded the building upgrades. The USDA is responsible for building, upgrading, and subsidizing housing in rural areas nationwide. In 2012, over $100 million was allocated in grants and loans. Due to the unique financing mechanism as well as long-term ownership requirements, property owners are especially motivated to invest in upgrades that will increase durability and tenant retention. These buildings represent a large stock of rural affordable housing that have the potential for significant energy and cost savings for property owners and tenants. Southface analyzed the energy upgrade potential of one stereotypical property in the Rea Ventures portfolio. This study will provide insight into the most cost-effective, implementable energy efficiency and durability upgrades for this age multifamily housing, having an enormous impact not only on the portfolio of Rea Ventures but on the vast USDA and larger Federal portfolio. Additionally, Southface will identify gaps in the current capital needs assessment process, examine available audit and simulation tools and protocols, and evaluate additional auditor training or certification needs.
7 CFR 170.13 - What are the operating guidelines for the USDA Farmers Market?
2010-01-01
... farmers or vendors. (g) Farm/Business Visits. Market management may visit farm/business locations to...) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS...
Fox, Raymond; Kim, Hyung-Suk; Reddick, Robert L; Kujoth, Gregory C; Prolla, Tomas A; Tsutsumi, Shuichi; Wada, Youichiro; Smithies, Oliver; Maeda, Nobuyo
2011-05-24
Diabetes and the development of its complications have been associated with mitochondrial DNA (mtDNA) dysfunction, but causal relationships remain undetermined. With the objective of testing whether increased mtDNA mutations exacerbate the diabetic phenotype, we have compared mice heterozygous for the Akita diabetogenic mutation (Akita) with mice homozygous for the D257A mutation in mitochondrial DNA polymerase gamma (Polg) or with mice having both mutations (Polg-Akita). The Polg-D257A protein is defective in proofreading and increases mtDNA mutations. At 3 mo of age, the Polg-Akita and Akita male mice were equally hyperglycemic. Unexpectedly, as the Polg-Akita males aged to 9 mo, their diabetic symptoms decreased. Thus, their hyperglycemia, hyperphagia and urine output declined significantly. The decrease in their food intake was accompanied by increased plasma leptin and decreased plasma ghrelin, while hypothalamic expression of the orexic gene, neuropeptide Y, was lower and expression of the anorexic gene, proopiomelanocortin, was higher. Testis function progressively worsened with age in the double mutants, and plasma testosterone levels in 9-mo-old Polg-Akita males were significantly reduced compared with Akita males. The hyperglycemia and hyperphagia returned in aged Polg-Akita males after testosterone administration. Hyperglycemia-associated distal tubular damage in the kidney also returned, and Polg-D257A-associated proximal tubular damage was enhanced. The mild diabetes of female Akita mice was not affected by the Polg-D257A mutation. We conclude that reduced diabetic symptoms of aging Polg-Akita males results from appetite suppression triggered by decreased testosterone associated with damage to the Leydig cells of the testis.
Efficient Solutions for Existing Homes Case Study: Rehabilitations of USDA Multifamily Homes
Energy Technology Data Exchange (ETDEWEB)
None
2016-04-01
Rea Ventures Group, LLC, partnered with Southface Energy Institute (Southface), a member of the U.S. Department of Energy's Partnership for Home Innovation Building America research team, to develop a prescriptive approach for rehabilitating a portfolio of rural multifamily rental properties in Georgia, which was funded by the U.S. Department of Agriculture (USDA).
7 CFR 170.14 - What circumstances will prevent participation in the USDA Farmers Market?
2010-01-01
... (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA...) Efforts will be made to accommodate all who apply to participate in the market. However, market management...
Fission of 255,256Es, 255-257Fm, and 258Md at moderate excitation energies
Britt, H.C.; Hoffman, D.C.; Plicht, J. van der; Wilhelmy, J.; Cheifetz, E.; Dupzyk, R.J.; Lougheed, R.W.
1984-01-01
The fission of 255,256Es, 255-257Fm, and 258Md has been studied in the excitation energy range from threshold to 25 MeV. A target of 254Es was used in the direct reaction studies; (d,pf), (t,pf), (3He,df), (3He,pf), and in the compound induced fission reactions formed with p, d, t, and α particle
The DivJ, CbrA and PleC system controls DivK phosphorylation and symbiosis in Sinorhizobium meliloti
Pini, Francesco; Frage, Benjamin; Ferri, Lorenzo; De Nisco, Nicole J.; Mohapatra, Saswat S.; Taddei, Lucilla; Fioravanti, Antonella; Dewitte, Frederique; Galardini, Marco; Brilli, Matteo; Villeret, Vincent; Bazzicalupo, Marco; Mengoni, Alessio; Walker, Graham C.; Becker, Anke; Biondi, Emanuele G.
2013-01-01
SUMMARY Sinorhizobium meliloti is a soil bacterium that invades the root nodules it induces on Medicago sativa, whereupon it undergoes an alteration of its cell cycle and differentiates into nitrogen-fixing, elongated and polyploid bacteroid with higher membrane permeability. In Caulobacter crescentus, a related alphaproteobacterium, the principal cell cycle regulator, CtrA, is inhibited by the phosphorylated response regulator DivK. The phosphorylation of DivK depends on the histidine kinase DivJ, while PleC is the principal phosphatase for DivK. Despite the importance of the DivJ in C. crescentus, the mechanistic role of this kinase has never been elucidated in other Alphaproteobacteria. We show here that the histidine kinases DivJ together with CbrA and PleC participate in a complex phosphorylation system of the essential response regulator DivK in S. meliloti. In particular, DivJ and CbrA are involved in DivK phosphorylation and in turn CtrA inactivation, thereby controlling correct cell cycle progression and the integrity of the cell envelope. In contrast, the essential PleC presumably acts as a phosphatase of DivK. Interestingly, we found that a DivJ mutant is able to elicit nodules and enter plant cells, but fails to establish an effective symbiosis suggesting that proper envelope and/or low CtrA levels are required for symbiosis. PMID:23909720
Johnson, R.; Steele, R.
2016-12-01
The USDA Climate Hubs were established in 2014 to develop and deliver science-based, region-specific information and technologies, with USDA agencies and partners, to agricultural and natural resource managers to enable climate-informed decision-making. In the two and half years of existence, our regional leads have gained insights into communicating with the agricultural and forestry communities throughout the different regions of the country. Perspectives differ somewhat among regions and sectors. This talk will share those various insights.
Directory of Open Access Journals (Sweden)
Alexandre Bourdès
Full Text Available Förster resonance energy transfer (FRET biosensors are powerful tools to detect biologically important ligands in real time. Currently FRET bisosensors are available for twenty-two compounds distributed in eight classes of chemicals (two pentoses, two hexoses, two disaccharides, four amino acids, one nucleobase, two nucleotides, six ions and three phytoestrogens. To expand the number of available FRET biosensors we used the induction profile of the Sinorhizobium meliloti transportome to systematically screen for new FRET biosensors.Two new vectors were developed for cloning genes for solute-binding proteins (SBPs between those encoding FRET partner fluorescent proteins. In addition to a vector with the widely used cyan and yellow fluorescent protein FRET partners, we developed a vector using orange (mOrange2 and red fluorescent protein (mKate2 FRET partners. From the sixty-nine SBPs tested, seven gave a detectable FRET signal change on binding substrate, resulting in biosensors for D-quinic acid, myo-inositol, L-rhamnose, L-fucose, β-diglucosides (cellobiose and gentiobiose, D-galactose and C4-dicarboxylates (malate, succinate, oxaloacetate and fumarate. To our knowledge, we describe the first two FRET biosensor constructs based on SBPs from Tripartite ATP-independent periplasmic (TRAP transport systems.FRET based on orange (mOrange2 and red fluorescent protein (mKate2 partners allows the use of longer wavelength light, enabling deeper penetration of samples at lower energy and increased resolution with reduced back-ground auto-fluorescence. The FRET biosensors described in this paper for four new classes of compounds; (i cyclic polyols, (ii L-deoxy sugars, (iii β-linked disaccharides and (iv C4-dicarboxylates could be developed to study metabolism in vivo.
An Overview of Hydrologic Studies at Center for Forested Wetlands Research, USDA Forest Service
Devendra M. Amatya; Carl C. Trettin; R. Wayne Skaggs; Timothy J. Callahan; Ge Sun; Masato Miwa; John E. Parsons
2004-01-01
Managing forested wetland landscapes for water quality improvement and productivity requires a detailed understanding of functional linkages between ecohydrological processes and management practices. Studies are being conducted at Center for Forested Wetlands Research (CFWR), USDA Forest Service to understand the fundamental hydrologic and biogeochemical processes...
López-Gómez, Miguel; Hidalgo-Castellanos, Javier; Muñoz-Sánchez, J Rubén; Marín-Peña, Agustín J; Lluch, Carmen; Herrera-Cervera, José A
2017-07-01
Polyamines (PAs) such as spermidine (Spd) and spermine (Spm) are small ubiquitous polycationic compounds that contribute to plant adaptation to salt stress. The positive effect of PAs has been associated to a cross-talk with other anti-stress hormones such as brassinosteroids (BRs). In this work we have studied the effects of exogenous Spd and Spm pre-treatments in the response to salt stress of the symbiotic interaction between Medicago truncatula and Sinorhizobium meliloti by analyzing parameters related to nitrogen fixation, oxidative damage and cross-talk with BRs in the response to salinity. Exogenous PAs treatments incremented the foliar and nodular Spd and Spm content which correlated with an increment of the nodule biomass and nitrogenase activity. Exogenous Spm treatment partially prevented proline accumulation which suggests that this polyamine could replace the role of this amino acid in the salt stress response. Additionally, Spd and Spm pre-treatments reduced the levels of H 2 O 2 and lipid peroxidation under salt stress. PAs induced the expression of genes involved in BRs biosynthesis which support a cross-talk between PAs and BRs in the salt stress response of M. truncatula-S. meliloti symbiosis. In conclusion, exogenous PAs improved the response to salinity of the M. truncatula-S. meliloti symbiosis by reducing the oxidative damage induced under salt stress conditions. In addition, in this work we provide evidences of the cross-talk between PAs and BRs in the adaptive responses to salinity. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
7 CFR 170.6 - How are potential market participants identified for the USDA Farmers Market?
2010-01-01
... (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA...? Potential market participants are recruited by AMS market management through local farm organizations in the...
Shirey, Carolyn; Badieyan, Somayesadat; Sobrado, Pablo
2013-11-08
SidA (siderophore A) is a flavin-dependent N-hydroxylating monooxygenase that is essential for virulence in Aspergillus fumigatus. SidA catalyzes the NADPH- and oxygen-dependent formation of N(5)-hydroxyornithine. In this reaction, NADPH reduces the flavin, and the resulting NADP(+) is the last product to be released. The presence of NADP(+) is essential for activity, as it is required for stabilization of the C4a-hydroperoxyflavin, which is the hydroxylating species. As part of our efforts to determine the molecular details of the role of NADP(H) in catalysis, we targeted Ser-257 for site-directed mutagenesis and performed extensive characterization of the S257A enzyme. Using a combination of steady-state and stopped-flow kinetic experiments, substrate analogs, and primary kinetic isotope effects, we show that the interaction between Ser-257 and NADP(H) is essential for stabilization of the C4a-hydroperoxyflavin. Molecular dynamics simulation results suggest that Ser-257 functions as a pivot point, allowing the nicotinamide of NADP(+) to slide into position for stabilization of the C4a-hydroperoxyflavin.
Seekamp, Erin; Cerveny, Lee K.; McCreary, Allie
2011-09-01
Federal land management agencies, such as the USDA Forest Service, have expanded the role of recreation partners reflecting constrained growth in appropriations and broader societal trends towards civic environmental governance. Partnerships with individual volunteers, service groups, commercial outfitters, and other government agencies provide the USDA Forest Service with the resources necessary to complete projects and meet goals under fiscal constraints. Existing partnership typologies typically focus on collaborative or strategic alliances and highlight organizational dimensions (e.g., structure and process) defined by researchers. This paper presents a partner typology constructed from USDA Forest Service partnership practitioners' conceptualizations of 35 common partner types. Multidimensional scaling of data from unconstrained pile sorts identified 3 distinct cultural dimensions of recreation partners—specifically, partnership character, partner impact, and partner motivations—that represent institutional, individual, and socio-cultural cognitive domains. A hierarchical agglomerative cluster analysis provides further insight into the various domains of agency personnel's conceptualizations. While three dimensions with high reliability (RSQ = 0.83) and corresponding hierarchical clusters illustrate commonality between agency personnel's partnership suppositions, this study also reveals variance in personnel's familiarity and affinity for specific partnership types. This real-world perspective on partner types highlights that agency practitioners not only make strategic choices when selecting and cultivating partnerships to accomplish critical task, but also elect to work with partners for the primary purpose of providing public service and fostering land stewardship.
Development of a new USDA plant hardiness zone map for the United States
C. Daly; M.P. Widrlechner; M.D. Halbleib; J.I. Smith; W.P. Gibson
2012-01-01
In many regions of the world, the extremes of winter cold are a major determinant of the geographic distribution of perennial plant species and of their successful cultivation. In the United States, the U.S. Department of Agriculture (USDA) Plant Hardiness Zone Map (PHZM) is the primary reference for defining geospatial patterns of extreme winter cold for the...
The current USDA ARS Tropical Agriculture Research Station’s (TARS) cacao (Theobroma cacao L.) collection in Mayaguez, Puerto Rico, consists of 262 clonally propagated accessions. Each accession is represented by six individual trees grafted onto a common ‘Amelonado’ seedling rootstock and planted ...
Cai, Yingying; Xia, Miaomiao; Dong, Huina; Qian, Yuan; Zhang, Tongcun; Zhu, Beiwei; Wu, Jinchuan; Zhang, Dawei
2018-05-11
As a very important coenzyme in the cell metabolism, Vitamin B 12 (cobalamin, VB 12 ) has been widely used in food and medicine fields. The complete biosynthesis of VB 12 requires approximately 30 genes, but overexpression of these genes did not result in expected increase of VB 12 production. High-yield VB 12 -producing strains are usually obtained by mutagenesis treatments, thus developing an efficient screening approach is urgently needed. By the help of engineered strains with varied capacities of VB 12 production, a riboswitch library was constructed and screened, and the btuB element from Salmonella typhimurium was identified as the best regulatory device. A flow cytometry high-throughput screening system was developed based on the btuB riboswitch with high efficiency to identify positive mutants. Mutation of Sinorhizobium meliloti (S. meliloti) was optimized using the novel mutation technique of atmospheric and room temperature plasma (ARTP). Finally, the mutant S. meliloti MC5-2 was obtained and considered as a candidate for industrial applications. After 7 d's cultivation on a rotary shaker at 30 °C, the VB 12 titer of S. meliloti MC5-2 reached 156 ± 4.2 mg/L, which was 21.9% higher than that of the wild type strain S. meliloti 320 (128 ± 3.2 mg/L). The genome of S. meliloti MC5-2 was sequenced, and gene mutations were identified and analyzed. To our knowledge, it is the first time that a riboswitch element was used in S. meliloti. The flow cytometry high-throughput screening system was successfully developed and a high-yield VB 12 producing strain was obtained. The identified and analyzed gene mutations gave useful information for developing high-yield strains by metabolic engineering. Overall, this work provides a useful high-throughput screening method for developing high VB 12 -yield strains.
7 CFR 1945.18 - United States Department of Agriculture (USDA) Food and Agriculture Council (FAC).
2010-01-01
... 7 Agriculture 13 2010-01-01 2009-01-01 true United States Department of Agriculture (USDA) Food and Agriculture Council (FAC). 1945.18 Section 1945.18 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE...
Yon, Bethany A.; Amin, Sarah A.; Taylor, Jennifer C.; Johnson, Rachel K.
2016-01-01
Purpose/Objectives: The U.S. Department of Agriculture's (USDA) new school meals regulations went into effect in July 2012. The purpose of this research was to explore school nutrition director's (SNDs) perspectives and attitudes about the new regulations and to identify strategies used to prepare for and subsequently implement the regulations.…
Directory of Open Access Journals (Sweden)
Markus F. F. Arnold
2017-08-01
Full Text Available The model legume species Medicago truncatula expresses more than 700 nodule-specific cysteine-rich (NCR signaling peptides that mediate the differentiation of Sinorhizobium meliloti bacteria into nitrogen-fixing bacteroids. NCR peptides are essential for a successful symbiosis in legume plants of the inverted-repeat-lacking clade (IRLC and show similarity to mammalian defensins. In addition to signaling functions, many NCR peptides exhibit antimicrobial activity in vitro and in vivo. Bacterial resistance to these antimicrobial activities is likely to be important for symbiosis. However, the mechanisms used by S. meliloti to resist antimicrobial activity of plant peptides are poorly understood. To address this, we applied a global genetic approach using transposon mutagenesis followed by high-throughput sequencing (Tn-seq to identify S. meliloti genes and pathways that increase or decrease bacterial competitiveness during exposure to the well-studied cationic NCR247 peptide and also to the unrelated model antimicrobial peptide polymyxin B. We identified 78 genes and several diverse pathways whose interruption alters S. meliloti resistance to NCR247. These genes encode the following: (i cell envelope polysaccharide biosynthesis and modification proteins, (ii inner and outer membrane proteins, (iii peptidoglycan (PG effector proteins, and (iv non-membrane-associated factors such as transcriptional regulators and ribosome-associated factors. We describe a previously uncharacterized yet highly conserved peptidase, which protects S. meliloti from NCR247 and increases competitiveness during symbiosis. Additionally, we highlight a considerable number of uncharacterized genes that provide the basis for future studies to investigate the molecular basis of symbiotic development as well as chronic pathogenic interactions.
7 CFR Appendix to Subpart A of... - List of Federal Financial Assistance From USDA
2010-01-01
... Food Security Act of 1985 (7 U.S.C. 1281 et seq.). 7. Human Nutrition 7 CFR 3015.205(b); Department of... 7 Agriculture 1 2010-01-01 2010-01-01 false List of Federal Financial Assistance From USDA Appendix to Subpart A of Part 15 Agriculture Office of the Secretary of Agriculture NONDISCRIMINATION...
Directory of Open Access Journals (Sweden)
E. V. Karaushu
2015-01-01
Full Text Available Seed inoculation with bacterial consortium was found to increase legume yield, providing a higher growth than the standard nitrogen treatment methods. Alfalfa plants were inoculated by mono- and binary compositions of nitrogen-fixing microorganisms. Their physiological and biochemical properties were estimated. Inoculation by microbial consortium of Sinorhizobium meliloti T17 together with a new cyanobacterial isolate Nostoc PTV was more efficient than the single-rhizobium strain inoculation. This treatment provides an intensification of the processes of biological nitrogen fixation by rhizobia bacteria in the root nodules and an intensification of plant photosynthesis. Inoculation by bacterial consortium stimulates growth of plant mass and rhizogenesis and leads to increased productivity of alfalfa and to improving the amino acid composition of plant leaves. The full nucleotide sequence of the rRNA gene cluster and partial sequence of the dinitrogenase reductase (nifH gene of Nostoc PTV were deposited to GenBank (JQ259185.1, JQ259186.1. Comparison of these gene sequences of Nostoc PTV with all sequences present at the GenBank shows that this cyanobacterial strain does not have 100% identity with any organisms investigated previously. Phylogenetic analysis showed that this cyanobacterium clustered with high credibility values with Nostoc muscorum.
Irradiation of ready-to-eat foods at USDA'S Eastern Regional Reasearch Center-2003 update
Sommers, Christopher; Fan, Xuetong; Niemira, Brendan; Rajkowski, Kathleen
2004-09-01
Ionizing radiation is a safe and effective method for eliminating bacterial pathogens from food products and disinfestation of fruits and vegetables. Since 1980 research has been conducted at USDA's Eastern Regional Research Center pertaining to the elimination of food-borne pathogens from meat, poultry, fruit and vegetable products. Recent work has focused on elimination of pathogens such as Escherichia coli O157:H7, Salmonella spp., and Listeria monocytogenes from ready-to-eat (RTE) food products including hot dogs, bologna, lettuce, cilantro, sprouts and seeds, and frozen vegetables. The ionizing radiation dose required to eliminate those pathogens from RTE foods has been found to be commodity, formulation and temperature dependent. The need to eliminate bacterial pathogens from RTE food products must always be balanced with the maintenance of product quality. In addition to determining the effective ionizing radiation doses required for pathogen elimination the effects of irradiation on product chemistry, nutritional value and organoleptic quality have also been determined. A review of the studies conducted at USDA's Eastern Regional Research Center in 2002 and 2003 is presented in this article.
Irradiation of ready-to-eat foods at USDA'S Eastern Regional Reasearch Center - 2003 update
International Nuclear Information System (INIS)
Sommers, Christopher; Fan Xuetong; Niemira, Brendan; Rajkowski, Kathleen
2004-01-01
Ionizing radiation is a safe and effective method for eliminating bacterial pathogens from food products and disinfestation of fruits and vegetables. Since 1980 research has been conducted at USDA's Eastern Regional Research Center pertaining to the elimination of food-borne pathogens from meat, poultry, fruit and vegetable products. Recent work has focused on elimination of pathogens such as Escherichia coli O157:H7, Salmonella spp., and Listeria monocytogenes from ready-to-eat (RTE) food products including hot dogs, bologna, lettuce, cilantro, sprouts and seeds, and frozen vegetables. The ionizing radiation dose required to eliminate those pathogens from RTE foods has been found to be commodity, formulation and temperature dependent. The need to eliminate bacterial pathogens from RTE food products must always be balanced with the maintenance of product quality. In addition to determining the effective ionizing radiation doses required for pathogen elimination the effects of irradiation on product chemistry, nutritional value and organoleptic quality have also been determined. A review of the studies conducted at USDA's Eastern Regional Research Center in 2002 and 2003 is presented in this article
Half-lives of long-lived isotopes of transactinium elements from 228Th to 257Fm
International Nuclear Information System (INIS)
Surin, V.M.; Fomushkin, Eh.F.
1983-09-01
The experimental measurements and critical evaluation results of the long-lived isotope half-decay periods of transactinium elements (from 228 Th to 257 Fm) are given on July 1981 to be published in open literature and related to the natural radioactive decay. From the massif of the known half-decay periods the most reliable data were selected, received or evaluated and recommended for practical use; the calculations of isotope specific activities were performed on this data. (author)
Rushing, Keith; Johnson, J. T.
2015-01-01
Purpose/Objectives: The purpose of this study was to explore the frequency of usage of the United States Department of Agriculture (USDA) Recipes for Schools and investigate factors influencing their usage. The relationship between these variables and school district size (student enrollment) was also investigated. Methods: An expert panel…
The objective is to gain knowledge regarding variation in sugar and flavor content among a sample of dry bean and green pod-type accessions from the USDA Phaseolus Germplasm Core Collection, Pullman, WA. The results could be used to market product quality and offer unique opportunities to expand ma...
Recently, the USDA-NRCS National Cooperative Soil Survey Soil Characterization Database (NSCD) was reported to provide evidence that total nitrogen (TN) stocks of agricultural soils have increased across the Mississippi basin since 1985. Unfortunately, due to omission of metadata from the NSCD, hist...
Ghnaya, Tahar; Mnassri, Majda; Ghabriche, Rim; Wali, Mariem; Poschenrieder, Charlotte; Lutts, Stanley; Abdelly, Chedly
2015-01-01
Besides their role in nitrogen supply to the host plants as a result of symbiotic N fixation, the association between legumes and Rhizobium could be useful for the rehabilitation of metal-contaminated soils by phytoextraction. A major limitation presents the metal-sensitivity of the bacterial strains. The aim of this work was to explore the usefulness of Sinorhizobium meliloti originated from a mining site for Cd phytoextraction by Medicago sativa. Inoculated and non-inoculated plants were cultivated for 60 d on soils containing 50 and/or 100 mg Cd kg(-1) soil. The inoculation hindered the occurrence of Cd- induced toxicity symptoms that appeared in the shoots of non-inoculated plants. This positive effect of S. meliloti colonization was accompanied by an increase in biomass production and improved nutrient acquisition comparatively to non-inoculated plants. Nodulation enhanced Cd absorption by the roots and Cd translocation to the shoots. The increase of plant biomass concomitantly with the increase of Cd shoot concentration in inoculated plants led to higher potential of Cd-phytoextraction in these plants. In the presence of 50 mg Cd kg(-1) in the soil, the amounts of Cd extracted in the shoots were 58 and 178 μg plant(-1) in non-inoculated and inoculated plants, respectively. This study demonstrates that this association M. sativa-S. meliloti may be an efficient biological system to extract Cd from contaminated soils.
76 FR 61074 - USDA Increases the Fiscal Year 2011 Tariff-Rate Quota for Refined Sugar
2011-10-03
... Quota for Refined Sugar AGENCY: Office of the Secretary, USDA. ACTION: Notice. SUMMARY: The Secretary of Agriculture today announced an increase in the fiscal year (FY) 2011 refined sugar tariff-rate quota (TRQ) of... INFORMATION: A quantity of 22,000 MTRV for sugars, syrups, and molasses (collectively referred to as refined...
The ARS is the USDA's in-house scientific research agency, whose mission is to conduct research to "develop and transfer solutions to agricultural problems of high national priority..." This includes enhancing the natural resource base and the environment, a dimension of particular relevance to the ...
Babić, Katarina Huić; Schauss, Kristina; Hai, Brigitte; Sikora, Sanja; Redzepović, Sulejman; Radl, Viviane; Schloter, Michael
2008-11-01
Inoculation of leguminous seeds with selected rhizobial strains is practised in agriculture to ameliorate the plant yield by enhanced root nodulation and nitrogen uptake of the plant. However, effective symbiosis between legumes and rhizobia does not only depend on the capacity of nitrogen fixation but also on the entire nitrogen turnover in the rhizosphere. We investigated the influence of seed inoculation with two indigenous Sinorhizobium meliloti strains exhibiting different efficiency concerning plant growth promotion on nitrogen turnover processes in the rhizosphere during the growth of alfalfa. Quantification of six target genes (bacterial amoA, nirK, nirS, nosZ, nifH and archaeal amoA) within the nitrogen cycle was performed in rhizosphere samples before nodule formation, at bud development and at the late flowering stage. The results clearly demonstrated that effectiveness of rhizobial inocula is related to abundance of nifH genes in the late flowering phase of alfalfa. Moreover, other genes involved in nitrogen turnover had been affected by the inocula, e.g. higher numbers of amoA copies were observed during flowering when the more effective strain had been inoculated. However, the respective gene abundances differed overall to a greater extent between the three plant development stages than between the inoculation variants.
Lagares, Antonio; Sanjuán, Juan; Pistorio, Mariano
2014-10-01
Rhizobia are Gram-negative Alpha- and Betaproteobacteria living in the underground which have the ability to associate with legumes for the establishment of nitrogen-fixing symbioses. Sinorhizobium meliloti in particular-the symbiont of Medicago, Melilotus, and Trigonella spp.-has for the past decades served as a model organism for investigating, at the molecular level, the biology, biochemistry, and genetics of a free-living and symbiotic soil bacterium of agricultural relevance. To date, the genomes of seven different S. meliloti strains have been fully sequenced and annotated, and several other draft genomic sequences are also available. The vast amount of plasmid DNA that S. meliloti frequently bears (up to 45% of its total genome), the conjugative ability of some of those plasmids, and the extent of the plasmid diversity has provided researchers with an extraordinary system to investigate functional and structural plasmid molecular biology within the evolutionary context surrounding a plant-associated model bacterium. Current evidence indicates that the plasmid mobilome in S. meliloti is composed of replicons varying greatly in size and having diverse conjugative systems and properties along with different evolutionary stabilities and biological roles. While plasmids carrying symbiotic functions (pSyms) are known to have high structural stability (approaching that of chromosomes), the remaining plasmid mobilome (referred to as the non-pSym, functionally cryptic, or accessory compartment) has been shown to possess remarkable diversity and to be highly active in conjugation. In light of the modern genomic and current biochemical data on the plasmids of S. meliloti, the current article revises their main structural components, their transfer and regulatory mechanisms, and their potential as vehicles in shaping the evolution of the rhizobial genome.
International Nuclear Information System (INIS)
Al-Barakah, F. N.; Mridha, M. A. U.
2016-01-01
The nodulation status in alfalfa (Medicago sativa L.) plants by Sinorhizobium meliloti under Saudi field condition was assessed in some selected farms in four seasons for two years. In the present study, we also monitored the introduced S. meliloti strains activity under Saudi soil conditions. The samples were collected at regular seasonal intervals from the selected farms. The total number of nodules, morphology of the nodules and the effectiveness of N/sub 2/-fixation was assessed. In general, it was revealed that soils in the selected areas in Saudi Arabia have sufficient bacteria of the proper types to nodulate the alfalfa plants. These nodules are high in number, small in size and white in color. The nodules obtained from most of the selected farms are ineffective for nitrogen fixation. Inoculation of alfalfa seeds with imported S. meliloti strains failed to fix the atmospheric nitrogen sufficiently and also the growth improvement of alfalfa plants. There was a wide variation in the occurrence of number of nodules among the four seasons in two years. It was also observed that summer season severely affected the nodulation making it nearly zero. This low number of nodules exerts a very slow recovery of nodule formation in the next year. The introduced strains were always over competing with the native strains but they did not survive because of hot and dry summer. Nitrogenase activity of the nodules collected from both the inoculated and non-inoculated farms were always very low in all the collected samples, which indicates that the ability of fixing nitrogen by S. meliloti strains in alfalfa under Saudi soils conditions is very low. (author)
2012-04-19
... marketing allocations between beet processors, and a reassignment of surplus cane sugar marketing allotment...-0876; or by email to [email protected] . SUPPLEMENTARY INFORMATION: USDA today announced an... split in accordance with the Sugar Marketing Allotment program, 54.35/45.65 percent between the beet and...
Directory of Open Access Journals (Sweden)
F Ahmadi Dana
2017-12-01
Full Text Available Introduction Agriculture depends heavily on nitrogen which is biologically fixed through the symbiotic association between rhizobia and legume plants in nodules located on plant roots. Alfalfa is a legume that should fix most of its own N requirement if it is sufficiently nodulated by viable Rhizobium meliloti inoculums. The process of nitrogen fixation is done by the help of an enzyme called nitrogenase and molybdenum which is an important element in the formation of this compound. Molybdenum is required by plants for protein synthesis and is especially important for legumes as it is needed for nitrogen fixation by rhizobia. Therefore the following research was done aimed on studying the effect of different amount of molybdenum and S. rhizobium bacteria on alfalfa’s yield. Material and Methods Alfalfa (Medicago sativa were grown in a field. The experiment was conducted at Karaj in 2013 in split plot arrangement based on completely randomized block design (RCBD, including 2 caring S. rhizobium inoculated seed and non-inoculated as the main plot factorand 3 levels of Molybdenum (0,5,10 kg ha-1 from ammonium molybdate (as the sub plot factor in three replications. Sinorhizobium meliloti bacteria were cultured on plates. Then half of the seeds were inoculated by Sinorhizobium meliloti. Nitrogen fertilizer was added only in one stage before planting up to 50 kg per hectare. Plants were grown until flowering. The data were analyzed by the SAS (9.1 software and mean comparisons were done by Duncan's MRT at the 1% and 5% probability level. Results and Discussion The results showed the effect of different levels of molybdenum and S. Rhizobium bacteria on dry matter yield, molybdenum concentrations in shoots and roots and the number of root nodules was significant. This treatment was significant in comparison to the control treatment with the14.27 ton per hectare. Increasing of molybdenum application, led to increasing of root nodules and showed a
Sensitivity analysis of tracer transport in variably saturated soils at USDA-ARS OPE3 field site
The objective of this study was to assess the effects of uncertainties in hydrologic and geochemical parameters on the results of simulations of the tracer transport in variably saturated soils at the USDA-ARS OPE3 field site. A tracer experiment with a pulse of KCL solution applied to an irrigatio...
Osińska-Jaroszuk, Monika; Jaszek, Magdalena; Starosielec, Magdalena; Sulej, Justyna; Matuszewska, Anna; Janczarek, Monika; Bancerz, Renata; Wydrych, Jerzy; Wiater, Adrian; Jarosz-Wilkołazka, Anna
2018-03-26
Four bacterial EPSs extracted from Rhizobium leguminosarum bv. trifolii Rt24.2, Sinorhizobium meliloti Rm1021, Bradyrhizobium japonicum USDA110, and Bradyrhizobium elkanii USDA76 were determined towards their metal ion adsorption properties and possible modification of Cerrena unicolor laccase properties. The highest magnesium and iron ion-sorption capacity (~ 42 and ~ 14.5%, respectively) was observed for EPS isolated from B. japonicum USDA110. An evident influence of EPSs on the stability of laccase compared to the control values (without EPSs) was shown after 30-day incubation at 25 °C. The residual activity of laccases was obtained in the presence of Rh76EPS and Rh1021EPS, i.e., 49.5 and 41.5% of the initial catalytic activity, respectively. This result was confirmed by native PAGE electrophoresis. The EPS effect on laccase stability at different pH (from 3.8 to 7.0) was also estimated. The most significant changes at the optimum pH value (pH 5.8) was observed in samples of laccase stabilized by Rh76EPS and Rh1021EPS. Cyclic voltamperometry was used for analysis of electrochemical parameters of laccase stabilized by bacterial EPS and immobilized on single-walled carbon nanotubes (SWCNTs) with aryl residues. Laccases with Rh76EPS and Rh1021EPS had an evident shift of the value of the redox potential compared to the control without EPS addition. In conclusion, the results obtained in this work present a new potential use of bacterial EPSs as a metal-binding component and a modulator of laccase properties especially stability of enzyme activity, which can be a very effective tool in biotechnology and industrial applications.
Evolution of soil, ecosystem, and critical zone research at the USDA FS Calhoun Experimental Forest
Daniel deB. Richter; Allan R. Bacon; Sharon A. Billings; Dan Binkley; Marilyn Buford; Mac Callaham; Amy E. Curry; Ryan L. Fimmen; A. Stuart Grandy; Paul R. Heine; Michael Hofmockel; Jason A. Jackson; Elisabeth LeMaster; Jianwei Li; Daniel Markewitz; Megan L. Mobley; Mary W. Morrison; Michael S. Strickland; Thomas Waldrop; Carol G. Wells
2015-01-01
The US Department of Agriculture (USDA) Forest Service Calhoun Experimental Forest was organized in 1947 on the southern Piedmont to engage in research that today is called restoration ecology, to improve soils, forests, and watersheds in a region that had been severely degraded by nearly 150 years farming. Today, this 2,050-ha research forest is managed by the Sumter...
NSGIC State | GIS Inventory — The following is excerpted from the metadata provided by NASS (USDA) for the source data set CDL_AWIFS_R_IN_2006.tif: "The USDA-NASS 2006 Indiana Cropland Data Layer...
Haytowitz, David B; Pehrsson, Pamela R
2018-01-01
For nearly 20years, the National Food and Nutrient Analysis Program (NFNAP) has expanded and improved the quantity and quality of data in US Department of Agriculture's (USDA) food composition databases (FCDB) through the collection and analysis of nationally representative food samples. NFNAP employs statistically valid sampling plans, the Key Foods approach to identify and prioritize foods and nutrients, comprehensive quality control protocols, and analytical oversight to generate new and updated analytical data for food components. NFNAP has allowed the Nutrient Data Laboratory to keep up with the dynamic US food supply and emerging scientific research. Recently generated results for nationally representative food samples show marked changes compared to previous database values for selected nutrients. Monitoring changes in the composition of foods is critical in keeping FCDB up-to-date, so that they remain a vital tool in assessing the nutrient intake of national populations, as well as for providing dietary advice. Published by Elsevier Ltd.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States). Environmental Science Division. Applied Geoscience and Environmental Restoration Program
2012-11-01
This report presents the technical findings of Phase I of Argonne’s studies. The Phase I field investigation was initiated on October 18, 2010. The work was conducted in accord with (1) the final site-specific Phase I Work Plan for Montgomery City (Argonne 2010; approved by the MDNR [2010]); (2) applicable Missouri regulations; and (3) the standard operating procedures, quality assurance/quality control (QA/QC) measures, and general health and safety policies outlined in the Master Work Plan (Argonne 2002) for operations in Kansas, which was reviewed by the MDNR and accepted for current use. A draft master plan specific to work in Missouri and a set of draft standard operating procedures are in review with the MDNR. The site-specific Work Plan for Montgomery City (Argonne 2010) (1) summarizes the pre-existing knowledge base for the Montgomery City investigation site compiled by Argonne and (2) describes the site-specific technical objectives and the intended scope of work developed for the first phase of the investigation. Three primary technical objectives were identified for the Phase I studies, as follows: 1. Update the presently identified inventory and status of private and public drinking water wells in the immediate vicinity of the former CCC/USDA grain storage facility, and sample the identified wells for volatile organic compounds (VOCs) and geochemical analyses. In conjunction with this effort, determine the present sources(s) of drinking water for all residents in an approximate 0.5-mi radius of the former CCC/USDA facility. 2. Investigate for possible evidence of a soil source of carbon tetrachloride contamination in the unconsolidated sediments beneath the former CCC/USDA facility that might affect the underlying bedrock aquifer units. 3. Obtain preliminary information on the site-specific lithologic and hydrologic characteristics of the unconsolidated sediments overlying bedrock at the former CCC/USDA grain storage location. Section 2 of this report
The Asian tiger mosquito, Aedes albopictus, became established in the continental US in 1985 and now infests 30 states. In 2007 the USDA Agricultural Research Service funded an “area-wide” project focused on the management of this species. The project was a unique federal, state, local collaborati...
Nowak, Petri; Soupas, Laura; Thomas-Oates, Jane; Lindström, Kristina
2004-04-28
Sinorhizobium arboris and S. kostiense are rhizobia that nodulate the tropical leguminous trees Acacia senegal and Prosopis chilensis. The lipochito-oligosaccharidic signalling molecules (LCOs) of S. arboris HAMBI 2361 and S. kostiense HAMBI 2362 were analyzed by mass spectrometry. The major LCOs produced by the strains were shown to be pentameric, acylated with common fatty acids, N-methylated, O-6-carbamoylated and partially sulfated, as are the LCOs characterized to date for other Acacia-nodulating rhizobia. Besides the major LCOs the two strains produced (i) tetrameric LCOs, (ii) LCOs acylated with fatty acids other than those commonly found, (iii) LCOs with only an acyl substituent and (iv) noncarbamoylated LCOs. Production of LCOs (i) to (iii) are novel among Acacia-nodulating rhizobia. The roles of the different structural characteristics of LCOs in the rhizobium-A. senegal symbiosis are discussed. Specific structural features of the LCOs are proposed to be important in the selection of effective nitrogen-fixing rhizobia by A. senegal.
Teng, William; Shannon, Harlan; Mladenova, Iliana; Fang, Fan
2010-01-01
A primary goal of the U.S. Department of Agriculture (USDA) is to expand markets for U.S. agricultural products and support global economic development. The USDA World Agricultural Outlook Board (WAOB) supports this goal by coordinating monthly World Agricultural Supply and Demand Estimates (WASDE) for the U.S. and major foreign producing countries. Because weather has a significant impact on crop progress, conditions, and production, WAOB prepares frequent agricultural weather assessments, in a GIS-based, Global Agricultural Decision Support Environment (GLADSE). The main goal of this project, thus, is to improve WAOB's estimates by integrating NASA remote sensing soil moisture observations and research results into GLADSE (See diagram below). Soil moisture is currently a primary data gap at WAOB.
Peterson, Cora
2010-01-01
Purpose/Objectives: Schools that participate in the National School Lunch Program (NSLP) receive a portion of their annual federal funding as commodity entitlement foods--now called USDA Foods--rather than cash payments. Due to rising food prices in recent years, it has been recommended that schools compare the costs and benefits of commodity and…
Teng, W. L.; de Jeu, R. A.; Doraiswamy, P. C.; Kempler, S. J.; Shannon, H. D.
2009-12-01
A primary goal of the U.S. Department of Agriculture (USDA) is to expand markets for U.S. agricultural products and support global economic development. The USDA World Agricultural Outlook Board (WAOB) supports this goal by developing monthly World Agricultural Supply and Demand Estimates (WASDE) for the U.S. and major foreign producing countries. Because weather has a significant impact on crop progress, conditions, and production, WAOB prepares frequent agricultural weather assessments, in a GIS-based, Global Agricultural Decision Support Environment (GLADSE). The main objective of this project, thus, is to improve WAOB's estimates by integrating NASA remote sensing soil moisture observations and research results into GLADSE. Soil moisture is a primary data gap at WAOB. Soil moisture data, generated by the Land Parameter Retrieval Model (LPRM, developed by NASA GSFC and Vrije Universiteit Amsterdam) and customized to WAOB's requirements, will be directly integrated into GLADSE, as well as indirectly by first being integrated into USDA Agricultural Research Service (ARS)'s Environmental Policy Integrated Climate (EPIC) crop model. The LPRM-enhanced EPIC will be validated using three major agricultural regions important to WAOB and then integrated into GLADSE. Project benchmarking will be based on retrospective analyses of WAOB's analog year comparisons. The latter are between a given year and historical years with similar weather patterns. WAOB is the focal point for economic intelligence within the USDA. Thus, improving WAOB's agricultural estimates by integrating NASA satellite observations and model outputs will visibly demonstrate the value of NASA resources and maximize the societal benefits of NASA investments.
2012-04-20
...--DON/USDA/DOE/ DOT-FAA Advanced Drop-In Biofuels Initiative AGENCY: Department of the Navy, DoD. ACTION... participants in the biofuels supply chain. The purpose of the roundtable meeting is for the federal government... Biofuels Production Project. Questions related to the Special Notices or the pending Broad Agency...
Irradiation of ready-to-eat foods at USDA'S Eastern Regional Reasearch Center - 2003 update
Energy Technology Data Exchange (ETDEWEB)
Sommers, Christopher; Fan Xuetong; Niemira, Brendan; Rajkowski, Kathleen
2004-10-01
Ionizing radiation is a safe and effective method for eliminating bacterial pathogens from food products and disinfestation of fruits and vegetables. Since 1980 research has been conducted at USDA's Eastern Regional Research Center pertaining to the elimination of food-borne pathogens from meat, poultry, fruit and vegetable products. Recent work has focused on elimination of pathogens such as Escherichia coli O157:H7, Salmonella spp., and Listeria monocytogenes from ready-to-eat (RTE) food products including hot dogs, bologna, lettuce, cilantro, sprouts and seeds, and frozen vegetables. The ionizing radiation dose required to eliminate those pathogens from RTE foods has been found to be commodity, formulation and temperature dependent. The need to eliminate bacterial pathogens from RTE food products must always be balanced with the maintenance of product quality. In addition to determining the effective ionizing radiation doses required for pathogen elimination the effects of irradiation on product chemistry, nutritional value and organoleptic quality have also been determined. A review of the studies conducted at USDA's Eastern Regional Research Center in 2002 and 2003 is presented in this article.
Mirabella, A; Terwagne, M; Zygmunt, M S; Cloeckaert, A; De Bolle, X; Letesson, J J
2013-02-01
Brucella spp. and Sinorhizobium meliloti are alphaproteobacteria that share not only an intracellular lifestyle in their respective hosts, but also a crucial requirement for cell envelope components and their timely regulation for a successful infectious cycle. Here, we report the characterization of Brucella melitensis mucR, which encodes a zinc finger transcriptional regulator that has previously been shown to be involved in cellular and mouse infections at early time points. MucR modulates the surface properties of the bacteria and their resistance to environmental stresses (i.e., oxidative stress, cationic peptide, and detergents). We show that B. melitensis mucR is a functional orthologue of S. meliloti mucR, because it was able to restore the production of succinoglycan in an S. meliloti mucR mutant, as detected by calcofluor staining. Similar to S. meliloti MucR, B. melitensis MucR also represses its own transcription and flagellar gene expression via the flagellar master regulator ftcR. More surprisingly, we demonstrate that MucR regulates a lipid A core modification in B. melitensis. These changes could account for the attenuated virulence of a mucR mutant. These data reinforce the idea that there is a common conserved circuitry between plant symbionts and animal pathogens that regulates the relationship they have with their hosts.
2010-04-27
... USDA Reassigns Domestic Cane Sugar Allotments and Increases the Fiscal Year 2010 Raw Sugar Tariff-Rate... announced a reassignment of surplus sugar under domestic cane sugar allotments of 200,000 short tons raw value (STRV) to imports, and increased the fiscal year (FY) 2010 raw sugar tariff-rate quota (TRQ) by...
2010-07-06
... USDA Reassigns Domestic Cane Sugar Allotments and Increases the Fiscal Year 2010 Raw Sugar Tariff-Rate... announced a reassignment of surplus sugar under domestic cane sugar allotments of 300,000 short tons raw value (STRV) to imports, and increased the fiscal year (FY) 2010 raw sugar tariff-rate quota (TRQ) by...
2011-04-12
... USDA Reassigns Domestic Cane Sugar Allotments and Increases the Fiscal Year 2011 Raw Sugar Tariff-Rate... announced a reassignment of surplus sugar under domestic cane sugar allotments of 325,000 short tons raw value (STRV) to imports, and increased the fiscal year (FY) 2011 raw sugar tariff-rate quota (TRQ) by...
This record contains videos of apple trees acquired from a ground vehicle throughout the growing season at the USDA-ARS, Appalachian Fruit Research Station. Research in precision management methods in orchard crops revolve around locating objects of interest, namely flowers, fruitlets, and fruit, a...
Directory of Open Access Journals (Sweden)
Samira Menbari
2017-12-01
Full Text Available Nowadays, the use of soil-born microorganisms as biological fertilizers is considered to be a natural and most desirable solution to maintain sustainability of agricultural soil system. Potassium releasing bacteria, nitrogen fixing and phosphorus dissolving bacteria make mentioned elements available to plants. In order to evaluate the effects of bio-fertilizers Potabarvar 2, Sinorhizobium meliloti, as well as urea fertilizer on physiological properties and yield of Fenugreek, an experiment as complete randomized block design was conducted with five treatments and three replications. Treatments included biofertilizer Potabarvar 2, S. meliloti, inoculation with a mixture of Sinorhizobium+Potabarvar 2, positive control (based on soil analysis and negative control (no fertilization and inoculation.The results showed that all morphological traits were significant at 1%. Most physiological traits except for carotenoid were significantly affected by S. meliloti, and a mixture of Sinorhizobium+Potabarvar 2. Seed inoculation with biofertilizer Sinorhizobium meliloti and Potabarvar 2 lead to increase in growth and eventually shoot yield. Separate application of these biofertilizers led to better results than the integrated application. Symbiotic relationship of Sinorhizobium with Fenugreek increased physiological indices data, especially the absorption of nitrogen and phosphorus, as well as the amount of phenolic antioxidant have been significantly affected. In general, application of S. meliloti resulted in better and more effective increase in yield, quality and plant growth than fertilizer Potabarvar 2 and a mixture of Sinorhizobium+Potabarvar 2.
NCBI nr-aa BLAST: CBRC-DRER-26-0474 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-26-0474 ref|NP_384172.1| SENSOR HISTIDINE KINASE TRANSMEMBRANE PROTEIN [S...inorhizobium meliloti 1021] emb|CAC41453.1| SENSOR HISTIDINE KINASE TRANSMEMBRANE PROTEIN [Sinorhizobium meliloti] NP_384172.1 1e-159 68% ...
Plant-released flavonoids induce the transcription of symbiotic genes in rhizobia and one of the first bacterial responses is the synthesis of so called Nod factors. They are responsible for the initial root hair curling during onset of root nodule development. This signal exchange is believed to be...
The Impact of Measurement Error on Estimates of the Price Reaction to USDA Crop Reports
Aulerich, Nicole M.; Irwin, Scott H.; Nelson, Carl H.
2007-01-01
This paper investigates the impact of USDA crop production reports in corn and soybean futures markets. The analysis is based on all corn and soybean production reports released over 1970-2006. The empirical analysis compares the typical OLS event study approach to the new Identification by Censoring (ITC) technique. Corn and soybean production reports are analyzed both separately and together for impact in corn and soybean futures prices. ITC proves to be the more useful method because it av...
Peng, Christine Y S; Zhou, Xinsheng; Kaya, Harry K
2002-11-01
The Varroa mite, Varroa destructor, is recognized as the most serious pest of both managed and feral Western honey bee (Apis mellifera) in the world. The mite has developed resistance to fluvalinate, an acaricide used to control it in beehives, and fluvalinate residues have been found in the beeswax, necessitating an urgent need to find alternative control measures to suppress this pest. Accordingly, we investigated the possibility of using the fungus, Hirsutella thompsonii, as a biocontrol agent of the Varroa mite. Among the 9 isolates of H. thompsonii obtained from the University of Florida and the USDA, only the 3 USDA isolates (ARSEF 257, 1947 and 3323) were infectious to the Varroa mite in laboratory tests. The mite became infected when it was allowed to walk on a sporulating H. thompsonii culture for 5 min. Scanning electron micrographs revealed that the membranous arolium of the mite leg sucker is the focus of infection where the fungal conidia adhered and germinated. The infected mites died from mycosis, with the lethal times to kill 50% (LT(50)s) dependent on the fungal isolates. Thus, the LT(50)s were 52.7, 77.2, and 96.7h for isolates 3323, 257, and 1947, respectively. Passage of H. thompsonii through Varroa mite three times significantly reduced the LT(50)s of isolates 257 and 1947 (P<0.05) but not the LT(50) of isolate 3323. The fungus did not infect the honey bee in larval, prepupal, pupal, and adult stages under our laboratory rearing conditions. Our encouraging results suggest that some isolates of H. thompsonii have the potential to be developed as a biocontrol agent for V. destructor. However, fungal infectivity against the mites under beehive conditions needs to be studied before any conclusion can be made.
USDA Snack Policy Implementation: Best Practices From the Front Lines, United States, 2013-2014.
Asada, Yuka; Chriqui, Jamie; Chavez, Noel; Odoms-Young, Angela; Handler, Arden
2016-06-16
The Smart Snacks in Schools interim final rule was promulgated by the US Department of Agriculture (USDA) as authorized by the Healthy, Hunger-Free Kids Act of 2010 (PL 111-296) and implementation commenced beginning July 1, 2014; however, in the years leading up to this deadline, national studies suggested that most schools were far from meeting the USDA standards. Evidence to guide successful implementation of the standards is needed. This study examined snack policy implementation in exemplary high schools to learn best practices for implementation. Guided by a multiple case study approach, school professionals (n = 37) from 9 high schools across 8 states were recruited to be interviewed about perceptions of school snack implementation; schools were selected using criterion sampling on the basis of the HealthierUS Schools Challenge: Smarter Lunchrooms (HUSSC: SL) database. Interview transcripts and internal documents were organized and coded in ATLAS.Ti v7; 2 researchers coded and analyzed data using a constant comparative analysis method to identify best practice themes. Best practices for snack policy implementation included incorporating the HUSSC: SL award's comprehensive wellness approach; leveraging state laws or district policies to reinforce snack reform initiatives; creating strong internal and external partnerships; and crafting positive and strategic communications. Implementation of snack policies requires evidence of successful experiences from those on the front lines. As federal, state, and local technical assistance entities work to ensure implementation of the Smart Snacks standards, these best practices provide strategies to facilitate the process.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M. (Environmental Science Division)
2010-05-24
The Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) operated a grain storage facility at the western edge of Everest, Kansas, from the early 1950s to the early 1970s. Sampling by the Kansas Department of Health and Environment (KDHE) in 1997 resulted in the detection of carbon tetrachloride in one domestic well (the Nigh well) northwest of the former facility. On behalf of the CCC/USDA, Argonne National Laboratory subsequently conducted a series of investigations to characterize the contamination (Argonne 2003, 2006a,b,c). Automatic, continuous monitoring of groundwater levels began in 2002 and is ongoing at six locations. The results have consistently indicated groundwater flow toward the north-northwest from the former CCC/USDA property to the Nigh property, then west-southwest from the Nigh property to the intermittent creek. Sitewide periodic groundwater and surface water sampling with analysis for volatile organic compounds (VOCs) began in 2008. Argonne's combined data indicate no significant downgradient extension of contamination since 2000. At present, the sampling is annual, as approved by the KDHE (2009) in response to a plan developed for the CCC/USDA (Argonne 2009). This document presents a plan for collecting indoor air samples in homes located along and adjacent to the defined extent of the carbon tetrachloride contamination. The plan was requested by the KDHE. Ambient air samples to represent the conditions along this pathway will also be taken. The purpose of the proposed work is to satisfy KDHE requirements and to collect additional data for assessing the risk to human health due to the potential upward migration of carbon tetrachloride and its primary degradation product (chloroform) into homes located in close proximity to the former grain storage facility, as well as along and within 100 ft laterally from the currently defined plume emanating from the former Everest facility. Investigation of the indoor air
Brenton J. Dickinson; Brett J. Butler
2013-01-01
The USDA Forest Service's National Woodland Owner Survey (NWOS) is conducted to better understand the attitudes and behaviors of private forest ownerships, which control more than half of US forestland. Inferences about the populations of interest should be based on theoretically sound estimation procedures. A recent review of the procedures disclosed an error in...
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15964777 >1v4aA 24 435 49 467 e-101 ... emb|CAC45596.1| PUTATIVE GLUTAMATE-AMMONIA...-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti] ref|NP_385130.1| PUTATIVE ... GLUTAMATE-AMMO...NIA-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti 1021] sp|
Ronald E. McRoberts; William A. Bechtold; Paul L. Patterson; Charles T. Scott; Gregory A. Reams
2005-01-01
The Forest Inventory and Analysis (FIA) program of the USDA Forest Service has initiated a transition from regional, periodic inventories to an enhanced national FIA program featuring annual measurement of a proportion of plots in each state, greater national consistency, and integration with the ground sampling component of the Forest Health Monitoring (FHM) program...
Crutchfield, J.
2016-12-01
The presentation will discuss the current status of the International Production Assessment Division of the USDA ForeignAgricultural Service for operational monitoring and forecasting of current crop conditions, and anticipated productionchanges to produce monthly, multi-source consensus reports on global crop conditions including the use of Earthobservations (EO) from satellite and in situ sources.United States Department of Agriculture (USDA) Foreign Agricultural Service (FAS) International Production AssessmentDivision (IPAD) deals exclusively with global crop production forecasting and agricultural analysis in support of the USDAWorld Agricultural Outlook Board (WAOB) lockup process and contributions to the World Agricultural Supply DemandEstimates (WASE) report. Analysts are responsible for discrete regions or countries and conduct in-depth long-termresearch into national agricultural statistics, farming systems, climatic, environmental, and economic factors affectingcrop production. IPAD analysts become highly valued cross-commodity specialists over time, and are routinely soughtout for specialized analyses to support governmental studies. IPAD is responsible for grain, oilseed, and cotton analysison a global basis. IPAD is unique in the tools it uses to analyze crop conditions around the world, including customweather analysis software and databases, satellite imagery and value-added image interpretation products. It alsoincorporates all traditional agricultural intelligence resources into its forecasting program, to make the fullest use ofavailable information in its operational commodity forecasts and analysis. International travel and training play animportant role in learning about foreign agricultural production systems and in developing analyst knowledge andcapabilities.
The Center at Florence is one of the ninety research units of the United States Department of Agriculture - Agricultural Research Service (USDA-ARS). The mission of the Center is to conduct research and transfer solutions that improve agricultural production, protect the environment, and enhance the...
The Mosquito and Fly Research Unit of the USDA-ARS Center for Medical, Agricultural and Veterinary Entomology located in Gainesville Florida is the largest Federal laboratory devoted to specifically solving operational mosquito and fly surveillance and control challenges in the U.S. and internationa...
2010-01-01
... Secretary of Agriculture DEBT MANAGEMENT Administrative Offset § 3.45 USDA payment authorizing agency offset... ownership of, or changed in some other manner the operation of, for the purpose of avoiding payment on the claim or debt, as determined by the creditor agency or the payment authorizing agency. (b) Prior to...
USDA Section 9006 Program: Status and Energy Benefits of Grant Awards in FY 2003-2005
Energy Technology Data Exchange (ETDEWEB)
Walters, T.; Savage, S.; Brown, J.
2006-08-01
At the request of the U. S. Department of Agriculture (USDA) Rural Development, the National Renewable Energy Laboratory reviewed projects awarded in the Section 9006 Program: Renewable Energy Systems and Energy Efficiency Improvements Program. This report quantifies federal and private investment, outlines project status based on recent field updates, and calculates the effects on energy and emissions of energy efficiency and renewable energy projects awarded grants in FY 2003, FY 2004, and FY 2005. An overview of the program challenges and modifications in the first three years of operation is also included.
Directory of Open Access Journals (Sweden)
Bénédicte Bastiat
Full Text Available Rhizobia are soil bacteria able to establish a nitrogen-fixing symbiosis with legume plants. Both in soil and in planta, rhizobia spend non-growing periods resembling the stationary phase of in vitro-cultured bacteria. The primary objective of this work was to better characterize gene regulation in this biologically relevant growth stage in Sinorhizobium meliloti. By a tap-tag/mass spectrometry approach, we identified five sigma factors co-purifying with the RNA polymerase in stationary phase: the general stress response regulator RpoE2, the heat shock sigma factor RpoH2, and three extra-cytoplasmic function sigma factors (RpoE1, RpoE3 and RpoE4 belonging to the poorly characterized ECF26 subgroup. We then showed that RpoE1 and RpoE4 i are activated upon metabolism of sulfite-generating compounds (thiosulfate and taurine, ii display overlapping regulatory activities, iii govern a dedicated sulfite response by controlling expression of the sulfite dehydrogenase SorT, iv are activated in stationary phase, likely as a result of endogenous sulfite generation during bacterial growth. We showed that SorT is required for optimal growth of S. meliloti in the presence of sulfite, suggesting that the response governed by RpoE1 and RpoE4 may be advantageous for bacteria in stationary phase either by providing a sulfite detoxification function or by contributing to energy production through sulfite respiration. This paper therefore reports the first characterization of ECF26 sigma factors, the first description of sigma factors involved in control of sulphur metabolism, and the first indication that endogenous sulfite may act as a signal for regulation of gene expression upon entry of bacteria in stationary phase.
Djordjevic, Michael A; Chen, Han Cai; Natera, Siria; Van Noorden, Giel; Menzel, Christian; Taylor, Scott; Renard, Clotilde; Geiger, Otto; Weiller, Georg F
2003-06-01
A proteomic examination of Sinorhizobium meliloti strain 1021 was undertaken using a combination of 2-D gel electrophoresis, peptide mass fingerprinting, and bioinformatics. Our goal was to identify (i) putative symbiosis- or nutrient-stress-specific proteins, (ii) the biochemical pathways active under different conditions, (iii) potential new genes, and (iv) the extent of posttranslational modifications of S. meliloti proteins. In total, we identified the protein products of 810 genes (13.1% of the genome's coding capacity). The 810 genes generated 1,180 gene products, with chromosomal genes accounting for 78% of the gene products identified (18.8% of the chromosome's coding capacity). The activity of 53 metabolic pathways was inferred from bioinformatic analysis of proteins with assigned Enzyme Commission numbers. Of the remaining proteins that did not encode enzymes, ABC-type transporters composed 12.7% and regulatory proteins 3.4% of the total. Proteins with up to seven transmembrane domains were identified in membrane preparations. A total of 27 putative nodule-specific proteins and 35 nutrient-stress-specific proteins were identified and used as a basis to define genes and describe processes occurring in S. meliloti cells in nodules and under stress. Several nodule proteins from the plant host were present in the nodule bacteria preparations. We also identified seven potentially novel proteins not predicted from the DNA sequence. Post-translational modifications such as N-terminal processing could be inferred from the data. The posttranslational addition of UMP to the key regulator of nitrogen metabolism, PII, was demonstrated. This work demonstrates the utility of combining mass spectrometry with protein arraying or separation techniques to identify candidate genes involved in important biological processes and niche occupations that may be intransigent to other methods of gene expression profiling.
ORF Alignment: NC_003037 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003037 gi|16263035 >1nyoA 11 162 8 158 4e-30 ... ref|NP_435828.1| Nex18 Symbiotica...lly induced conserved protein [Sinorhizobium ... meliloti 1021] gb|AAK65240.1| Nex18 Symbiotically ... ... ... induced conserved protein [Sinorhizobium meliloti 1021] ... pir||F95334 Nex18 Symbiotically
Bradyrhizobium elkanii USDA 76T (INSCD = ARAG00000000), the type strain for Bradyrhizobium elkanii, is an aerobic, motile, Gram-negative, non-spore-forming rod that was isolated from an effective nitrogen-fixing root nodule of Glycine max (L. Merr) grown in the USA. Because of its significance as a ...
DEFF Research Database (Denmark)
Gauer, Sabrina; Wang, Zhijie; Otten, Harm
2014-01-01
A gene in Bradyrhizobium japonicum USDA 110, annotated as a ribitol dehydrogenase (RDH), had 87 % sequence identity (97 % positives) to the N-terminal 31 amino acids of an L-glucitol dehydrogenase from Stenotrophomonas maltophilia DSMZ 14322. The 729-bp long RDH gene coded for a protein consistin...
Andrew Lister; Charles Scott; Susan King; Michael Hoppus; Brett Butler; Douglas Griffith
2005-01-01
The Food Security Act of 1985 prohibits the disclosure of any information collected by the USDA Forest Service's FIA program that would link individual landowners to inventory plot information. To address this, we developed a technique based on a "swapping" procedure in which plots with similar characteristics are exchanged, and on a ...
Biochar is being evaluated by scientists from the United States Department of Agriculture (USDA) Agricultural Research Service (ARS) for its potential to sequester soil C, to improve soil health, and to increase crop yields. ARS scientists from multiple locations (Florence SC, K...
Genetic variability of isoflavones in the USDA red clover core collection
Directory of Open Access Journals (Sweden)
Graziele P. Ramos
2012-11-01
Full Text Available Red clover is one of the most utilized forage in agriculture and contains many of the isoflavones known for their human health benefits. The objectives of this study were: i to quantify, using HPLC analysis, isoflavones in 77 accessions from the USDA core collection and a Brazilian line; ii to verify possible relationships depending on their origin, improvement status or maturity type and; iii to verify the seasonal variation. The isoflavone mean contents were 29.27 µg g-1 of dry material for daidzein, 163.69 µg g-1 for genistein, 11353.29 µg g-1 for formononetin and 6568.8 µg g-1 for biochanin A. Clustering was mainly influenced by the total amount of isoflavones and partially due to maturity type, improvement status and geographic origin. The seasonal evaluation demonstrated an increase of concentration during winter, and decrease during spring. These results highlighted accessions that can be used to develop new varieties with low or high isoflavones concentration.
One of our three program goals for this USDA-ARS-CRIS project is to determine the effects of vineyard and vine microclimate (sunlight, temperature, humidity, etc) upon fruit development, vine productivity, and fruit quality, particularly phenolic compounds. Plant phenolics are important due to their...
Bica, Lori A.; Jamelske, Eric M.
2012-01-01
Purpose/Objectives: The purpose of this study was to investigate the impact of the 2009-2010 USDA Fresh Fruit and Vegetable Program (FFVP) on fruit intake and other behaviors related to fruit and vegetable consumption among Wisconsin fourth- and fifth-grade students. Methods: Participants were fourth- and fifth-grade from one FFVP school (n = 51)…
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States). Environmental Science Division. Applied Geoscience and Environmental Restoration Program
2013-06-01
The Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) is conducting an environmental investigation at the former CCC/USDA grain storage facility on the county fairgrounds in Montgomery City, Missouri, to evaluate contamination associated with the former use of grain fumigants containing carbon tetrachloride at the site. The CCC/USDA studies have identified carbon tetrachloride in the soils (primarily unconsolidated glacial tills) at concentrations that exceed the U.S. Environmental Protection Agency (EPA) regional screening level (RSL) values for this compound in residential soils (610 μg/kg) but are below the corresponding RSL for industrial soils (3,000 μg/kg). Concentrations of carbon tetrachloride greater than the EPA maximum contaminant level (MCL; 5.0 μg/L) for this contaminant in drinking water were also identified in the shallow groundwater (Argonne 2012). On the basis of these findings, remedial actions are considered necessary to mitigate the present and potential future impacts of the contamination. In cooperation with the Missouri Department of Natural Resources (MDNR), the CCC/USDA has initiated a field-scale pilot test to evaluate an in situ technology for treatment of the carbon tetrachloride contamination. In this approach, a chemical amendment consisting primarily of slow-release organic matter and zero-valent iron is employed to induce oxygen-depleted, chemically reducing conditions in the subsurface. These conditions foster the in situ chemical reduction (ISCR) of carbon tetrachloride and its degradation products (chloroform, methylene chloride, and chloromethane) via both inorganic and biologically mediated processes. The chemical amendment being used, EHC™, was developed by the Adventus Group, Freeport, Illinois, and is now manufactured and distributed by FMC Environmental Solutions, Philadelphia, Pennsylvania. With the approval of the MDNR (2012), the ISCR technology is being tested in two target areas
D'Alessio, Maya; Nordeste, Ricardo; Doxey, Andrew C; Charles, Trevor C
2017-01-01
Polyhydroxybutyrate (PHB) and glycogen polymers are produced by bacteria as carbon storage compounds under unbalanced growth conditions. To gain insights into the transcriptional mechanisms controlling carbon storage in Sinorhizobium meliloti , we investigated the global transcriptomic response to the genetic disruption of key genes in PHB synthesis and degradation and in glycogen synthesis. Under both nitrogen-limited and balanced growth conditions, transcriptomic analysis was performed with genetic mutants deficient in PHB synthesis ( phbA , phbB , phbAB , and phbC ), PHB degradation ( bdhA , phaZ , and acsA2 ), and glycogen synthesis ( glgA1 ). Three distinct genomic regions of the pSymA megaplasmid exhibited altered expression in the wild type and the PHB cycle mutants that was not seen in the glycogen synthesis mutant. An Fnr family transcriptional motif was identified in the upstream regions of a cluster of genes showing similar transcriptional patterns across the mutants. This motif was found at the highest density in the genomic regions with the strongest transcriptional effect, and the presence of this motif upstream of genes in these regions was significantly correlated with decreased transcript abundance. Analysis of the genes in the pSymA regions revealed that they contain a genomic overrepresentation of Fnr family transcription factor-encoding genes. We hypothesize that these loci, containing mostly nitrogen utilization, denitrification, and nitrogen fixation genes, are regulated in response to the intracellular carbon/nitrogen balance. These results indicate a transcriptional regulatory association between intracellular carbon levels (mediated through the functionality of the PHB cycle) and the expression of nitrogen metabolism genes. IMPORTANCE The ability of bacteria to store carbon and energy as intracellular polymers uncouples cell growth and replication from nutrient uptake and provides flexibility in the use of resources as they are available to
Directory of Open Access Journals (Sweden)
Chiara Santi
2017-12-01
Full Text Available Plant lipid-transfer proteins (LTPs are small basic secreted proteins, which are characterized by lipid-binding capacity and are putatively involved in lipid trafficking. LTPs play a role in several biological processes, including the root nodule symbiosis. In this regard, the Medicago truncatula nodulin 5 (MtN5 LTP has been proved to positively regulate the nodulation capacity, controlling rhizobial infection and nodule primordia invasion. To better define the lipid transfer protein MtN5 function during the symbiosis, we produced MtN5-downregulated and -overexpressing plants, and we analysed the transcriptomic changes occurring in the roots at an early stage of Sinorhizobium meliloti infection. We also carried out the lipid profile analysis of wild type (WT and MtN5-overexpressing roots after rhizobia infection. The downregulation of MtN5 increased the root hair curling, an early event of rhizobia infection, and concomitantly induced changes in the expression of defence-related genes. On the other hand, MtN5 overexpression favoured the invasion of the nodules by rhizobia and determined in the roots the modulation of genes that are involved in lipid transport and metabolism as well as an increased content of lipids, especially galactolipids that characterize the symbiosome membranes. Our findings suggest the potential participation of LTPs in the synthesis and rearrangement of membranes occurring during the formation of the infection threads and the symbiosome membrane.
Teng, William; Shannon, Harlan
2011-01-01
The USDA World Agricultural Outlook Board (WAOB) is responsible for monitoring weather and climate impacts on domestic and foreign crop development. One of WAOB's primary goals is to determine the net cumulative effect of weather and climate anomalies on final crop yields. To this end, a broad array of information is consulted, including maps, charts, and time series of recent weather, climate, and crop observations; numerical output from weather and crop models; and reports from the press, USDA attach s, and foreign governments. The resulting agricultural weather assessments are published in the Weekly Weather and Crop Bulletin, to keep farmers, policy makers, and commercial agricultural interests informed of weather and climate impacts on agriculture. Because both the amount and timing of precipitation significantly affect crop yields, WAOB often uses precipitation time series to identify growing seasons with similar weather patterns and help estimate crop yields for the current growing season, based on observed yields in analog years. Historically, these analog years are visually identified; however, the qualitative nature of this method sometimes precludes the definitive identification of the best analog year. Thus, one goal of this study is to derive a more rigorous, statistical approach for identifying analog years, based on a modified coefficient of determination, termed the analog index (AI). A second goal is to compare the performance of AI for time series derived from surface-based observations vs. satellite-based measurements (NASA TRMM and other data).
Cannell, R C; Tatum, J D; Belk, K E; Wise, J W; Clayton, R P; Smith, G C
1999-11-01
An improved ability to quantify differences in the fabrication yields of beef carcasses would facilitate the application of value-based marketing. This study was conducted to evaluate the ability of the Dual-Component Australian VIASCAN to 1) predict fabricated beef subprimal yields as a percentage of carcass weight at each of three fat-trim levels and 2) augment USDA yield grading, thereby improving accuracy of grade placement. Steer and heifer carcasses (n = 240) were evaluated using VIASCAN, as well as by USDA expert and online graders, before fabrication of carcasses to each of three fat-trim levels. Expert yield grade (YG), online YG, VIASCAN estimates, and VIASCAN estimated ribeye area used to augment actual and expert grader estimates of the remaining YG factors (adjusted fat thickness, percentage of kidney-pelvic-heart fat, and hot carcass weight), respectively, 1) accounted for 51, 37, 46, and 55% of the variation in fabricated yields of commodity-trimmed subprimals, 2) accounted for 74, 54, 66, and 75% of the variation in fabricated yields of closely trimmed subprimals, and 3) accounted for 74, 54, 71, and 75% of the variation in fabricated yields of very closely trimmed subprimals. The VIASCAN system predicted fabrication yields more accurately than current online yield grading and, when certain VIASCAN-measured traits were combined with some USDA yield grade factors in an augmentation system, the accuracy of cutability prediction was improved, at packing plant line speeds, to a level matching that of expert graders applying grades at a comfortable rate.
Directory of Open Access Journals (Sweden)
Ana Dolores Santiago de Freitas
2007-01-01
Full Text Available Pesquisas sobre a biodiversidade microbiológica de solos salinos envolvem a busca por genótipos tolerantes a esse tipo de estresse ambiental. Dados genotípicos correlacionados às características morfológicas, fisiológicas e bioquímicas de bactérias fornecem informações importantes para sua identificação e agrupamento. Este trabalho objetivou caracterizar rizóbios provenientes de solos salinos, do Agreste e Sertão de Pernambuco, utilizando jacatupé (Pachyrhizus erosus L. Urban como planta-isca. Os testes foram efetuados em meio YMA e as características culturais observadas em 24 isolados foram as seguintes: mudança de pH, tempo de crescimento, transparência, forma, borda, produção de exopolissacarídeo das colônias e resistência à salinidade. Os testes moleculares utilizando análise por PCR (reação em cadeia da polimerase por meio de seqüências repetitivas de DNA amplificadas com o primer BOX envolveram 13 isolados. Os resultados revelaram alta diversidade fenotípica e genotípica entre os isolados nativos. As características culturais e genéticas desses isolados foram comparados com 19 estirpes de referência. Os isolados NFB746 e NFB747 tiveram alta semelhança entre si e também com as estirpes Rhizobium sp. NGR234 (BR2406 e Mesorhizobium ciceri USDA3383 (BR521. O isolado NFB742, possivelmente, era da mesma espécie de M. ciceri (BR521. Com relação ao isolado NFB741, a semelhança com as bactérias Rhizobium tropici IIA CFN299T (BR10016 e Sinorhizobium terangue USDA4894 (BR527 foi de 87%. Os demais isolados, praticamente, formaram grupos independentes quando comparados com as estirpes de referência. Os resultados foram de grande relevância para diagnosticar novas espécies de rizóbios nativos altamente tolerantes a estresses ambientais.Investigation on microbiological biodiversity in the saline soils involves searching for tolerant genotypes to this type of emvironmental stress. Genotypic data associated to
Devon Donahue
2012-01-01
This paper is an analysis of 5 years of accident data for the USDA Forest Service, Rocky Mountain Research Station (RMRS) Inventory and Monitoring (IM) Program that identifies past trends, allows for standardized self-comparison, and increases our understanding of the true costs of injuries and accidents. Measuring safety is a difficult task. While most agree that...
Directory of Open Access Journals (Sweden)
Mauricio Galvis-Patiño
2017-01-01
Full Text Available En el presente trabajo se reporta el estudio de las propiedades estructurales y magnéticas de la composición en forma de polvo de Gd0.257-xTbxFe0.743 con x=0, 0.1285, 0.257,preparados por Aleamiento Mecánico (AM en atmosfera de argón durante 72 horas mediante un molino planetario de alta energía ;la caracterización estructural se realizó por medio de Difractometría de rayos X(DRX, para la caracterización magnética se utilizó la espectroscopía Mössbauer, los ciclos de histéresis se llevaron a cabo a través de PPMS (Physical Property Measurement System, Sistema de Medidas de Propiedades Físicas. La fase de α-Fe se presenta en los tres difractogramas mediante un pico característico cuya intensidad disminuye al reemplazar el Tb por el Gd, presentándose la menor en x= 0 así mismo se observa un aumento de su ancho atribuible a la presencia de átomos de Gd en lugares propios del Fe. Los espectros Mössbauer (EM fueron ajustados con sextetos, dobletes, singletes y distribuciones de campo hiperfino lo que señala que el orden magnético se ve alterado al sustituir el Tb por el Gd en la composición. Las propiedades magnéticas extrínsecas de la composición en estudio, la caracterizan como materiales magnéticamente semiduros.
Kidney transplant graft outcomes in 379 257 recipients on 3 continents.
Merion, Robert M; Goodrich, Nathan P; Johnson, Rachel J; McDonald, Stephen P; Russ, Graeme R; Gillespie, Brenda W; Collett, David
2018-03-24
Kidney transplant outcomes that vary by program or geopolitical unit may result from variability in practice patterns or health care delivery systems. In this collaborative study, we compared kidney graft outcomes among 4 countries (United States, United Kingdom, Australia, and New Zealand) on 3 continents. We analyzed transplant and follow-up registry data from 1988-2014 for 379 257 recipients of first kidney-only transplants using Cox regression. Compared to the United States, 1-year adjusted graft failure risk was significantly higher in the United Kingdom (hazard ratio [HR] 1.22, 95% confidence interval [CI] 1.18-1.26, P < .001) and New Zealand (hazard ratio [HR] 1.29, 95% confidence interval [CI] 1.14-1.46, P < .001), but lower in Australia (HR 0.90, 95% CI 0.84-0.96, P = .001). In contrast, long-term adjusted graft failure risk (conditional on 1-year function) was significantly higher in the United States compared to Australia, New Zealand, and the United Kingdom (HR 0.74, 0.75, and 0.74, respectively; each P < .001). Thus long-term kidney graft outcomes are approximately 25% worse in the United States than in 3 other countries with well-developed kidney transplant systems. Case mix differences and residual confounding from unmeasured factors were found to be unlikely explanations. These findings suggest that identification of potentially modifiable country-specific differences in care delivery and/or practice patterns should be sought. © 2018 The American Society of Transplantation and the American Society of Transplant Surgeons.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2007-11-09
This document presents an Interim Measure Work Plan/Design for the short-term, field-scale pilot testing and subsequent implementation of a non-emergency Interim Measure (IM) at the site of the former grain storage facility operated by the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) in Centralia, Kansas. The IM is recommended to mitigate both (1) localized carbon tetrachloride contamination in the vadose zone soils beneath the former facility and (2) present (and potentially future) carbon tetrachloride contamination identified in the shallow groundwater beneath and in the immediate vicinity of the former CCC/USDA facility. Investigations conducted on behalf of the CCC/USDA by Argonne National Laboratory have demonstrated that groundwater at the Centralia site is contaminated with carbon tetrachloride at levels that exceed the Kansas Tier 2 Risk-Based Screening Level (RBSL) and the U.S. Environmental Protection Agency's maximum contaminant level of 5.0 {micro}g/L for this compound. Groundwater sampling and analyses conducted by Argonne under a monitoring program approved by the Kansas Department of Health and Environment (KDHE) indicated that the carbon tetrachloride levels at several locations in the groundwater plume have increased since twice yearly monitoring of the site began in September 2005. The identified groundwater contamination currently poses no unacceptable health risks, in view of the absence of potential human receptors in the vicinity of the former CCC/USDA facility. Carbon tetrachloride contamination has also been identified at Centralia in subsurface soils at concentrations on the order of the Kansas Tier 2 RBSL of 200 {micro}g/kg in soil for the soil-to-groundwater protection pathway. Soils contaminated at this level might pose some risk as a potential source of carbon tetrachloride contamination to groundwater. To mitigate the existing contaminant levels and decrease the potential future concentrations of
Meng, Shi; Chang, Sam; Gillen, Anne M; Zhang, Yan
2016-12-15
Food-grade soybeans with large seed size, uniformity, clear hilum and a high 11S/7S ratio are favoured by the food industry for making tofu. In order to search for soybean lines with desirable characteristics for making foods, 22 soybean lines were selected from the USDA-Soybean Germplasm Collection, were grown in Stoneville, MS for biochemical analysis and tofu texture and sensory quality tests. Eight lines were identified, from 22 lines harvested in 2014, to be suitable for tofu making, as judged by chemical composition and sensory quality of pressed tofu. In the filled tofu making and texture analysis study, the correlation between A3 subunit content and filled tofu firmness was significant (N=22, r=0.77, Pquality information for the selection of soybean genotypes for improving food quality. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Burton, J. C.; Environmental Research
2003-01-23
The Commodity Credit Corporation (CCC) of the U.S. Department of Agriculture (USDA) has entered into an interagency agreement with the U.S. Department of Energy (DOE) under which Argonne National Laboratory provides technical assistance for hazardous waste site characterization and remediation for the CCC/USDA. Carbon tetrachloride is the contaminant of primary concern at sites in Kansas where former CCC/USDA grain storage facilities were located. Argonne applies its QuickSite(reg sign) Expedited Site Characterization (ESC) approach to these former facilities. The QuickSite environmental site characterization methodology is Argonne's proprietary implementation of the ESC process (ASTM 1998). Argonne has used this approach at several former CCC/USDA facilities in Kansas, including Agenda, Agra, Everest, and Frankfort. The Argonne ESC approach revolves around a multidisciplinary, team-oriented approach to problem solving. The basic features and steps of the QuickSite methodology are as follows: (1) A team of scientists with diverse expertise and strong field experience is required to make the process work. The Argonne team is composed of geologists, geochemists, geophysicists, hydrogeologists, chemists, biologists, engineers, computer scientists, health and safety personnel, and regulatory staff, as well as technical support staff. Most of the staff scientists are at the Ph.D. level; each has on average, more than 15 years of experience. The technical team works together throughout the process. In other words, the team that plans the program also implements the program in the field and writes the reports. More experienced scientists do not remain in the office while individuals with lesser degrees or experience carry out the field work. (2) The technical team reviews, evaluates, and interprets existing data for the site and the contaminants there to determine which data sets are technically valid and can be used in initially designing the field program. A basic
Both the United States and Brazil maintain vast collections of grape genetic resources. We share a common interest in using cryopreservation methods for the secure, long-term back-up of accessions within these field collections of the USDA-ARS National Plant Germplasm System and UDESC-CAV Santa Cata...
Le Quéré, Antoine; Tak, Nisha; Gehlot, Hukam Singh; Lavire, Celine; Meyer, Thibault; Chapulliot, David; Rathi, Sonam; Sakrouhi, Ilham; Rocha, Guadalupe; Rohmer, Marine; Severac, Dany; Filali-Maltouf, Abdelkarim; Munive, Jose-Antonio
2017-01-14
Nitrogen fixing bacteria isolated from hot arid areas in Asia, Africa and America but from diverse leguminous plants have been recently identified as belonging to a possible new species of Ensifer (Sinorhizobium). In this study, 6 strains belonging to this new clade were compared with Ensifer species at the genome-wide level. Their capacities to utilize various carbon sources and to establish a symbiotic interaction with several leguminous plants were examined. Draft genomes of selected strains isolated from Morocco (Merzouga desert), Mexico (Baja California) as well as from India (Thar desert) were produced. Genome based species delineation tools demonstrated that they belong to a new species of Ensifer. Comparison of its core genome with those of E. meliloti, E. medicae and E. fredii enabled the identification of a species conserved gene set. Predicted functions of associated proteins and pathway reconstruction revealed notably the presence of transport systems for octopine/nopaline and inositol phosphates. Phenotypic characterization of this new desert rhizobium species showed that it was capable to utilize malonate, to grow at 48 °C or under high pH while NaCl tolerance levels were comparable to other Ensifer species. Analysis of accessory genomes and plasmid profiling demonstrated the presence of large plasmids that varied in size from strain to strain. As symbiotic functions were found in the accessory genomes, the differences in symbiotic interactions between strains may be well related to the difference in plasmid content that could explain the different legumes with which they can develop the symbiosis. The genomic analysis performed here confirms that the selected rhizobial strains isolated from desert regions in three continents belong to a new species. As until now only recovered from such harsh environment, we propose to name it Ensifer aridi. The presented genomic data offers a good basis to explore adaptations and functionalities that enable them
Deborah J. Shields; Ingrid M. Martin; Wade E. Martin; Michelle A. Haefele
2002-01-01
The USDA Forest Service completed its Strategic Plan (2000 Revision) in October 2000. The goals and objectives included in the Plan were developed with input from the public, some of which was obtained through a telephone survey. We report results of the survey. Members of the American public were asked about their values with respect to public lands, objectives for...
U.S. Environmental Protection Agency — This data depicts calculated and validated LAI estimates generated from the USDA Environmental Policy Impact Climate (EPIC) model (a widely used, field-scale,...
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2009-01-14
In October, 2007, the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) presented the document Interim Measure Conceptual Design (Argonne 2007a) to the Kansas Department of Health and Environment, Bureau of Environmental Remediation (KDHE/BER), for a proposed non-emergency Interim Measure (IM) at the site of the former CCC/USDA grain storage facility in Centralia, Kansas (Figure 1.1). The IM was recommended to mitigate existing levels of carbon tetrachloride contamination identified in the vadose zone soils beneath the former facility and in the groundwater beneath and in the vicinity of the former facility, as well as to moderate or decrease the potential future concentrations of carbon tetrachloride in the groundwater. The Interim Measure Conceptual Design (Argonne 2007a) was developed in accordance with the KDHE/BER Policy No.BERRS-029, Policy and Scope of Work: Interim Measures (KDHE 1996). The hydrogeologic, geochemical, and contaminant distribution characteristics of the Centralia site, as identified by the CCC/USDA, factored into the development of the nonemergency IM proposal. These characteristics were summarized in the Interim Measure Conceptual Design (Argonne 2007a) and were discussed in detail in previous Argonne reports (Argonne 2002a, 2003, 2004, 2005a,b,c, 2006a,b, 2007b). The identified remedial goals of the proposed IM were as follows: (1) To reduce the existing concentrations of carbon tetrachloride in groundwater in three 'hot spot' areas identified at the site (at SB01, SB05, and SB12-MW02; Figure 1.2) to levels acceptable to the KDHE. (2) To reduce carbon tetrachloride concentrations in the soils near the location of former soil boring SB12 and existing monitoring well MW02 (Figure 1.2) to levels below the KDHE Tier 2 Risk-Based Screening Level (RBSL) of 200 {micro}g/kg for this contaminant. To address these goals, the potential application of an in situ chemical reduction (ISCR) treatment technology
Cannell, R C; Belk, K E; Tatum, J D; Wise, J W; Chapman, P L; Scanga, J A; Smith, G C
2002-05-01
Objective quantification of differences in wholesale cut yields of beef carcasses at plant chain speeds is important for the application of value-based marketing. This study was conducted to evaluate the ability of a commercial video image analysis system, the Computer Vision System (CVS) to 1) predict commercially fabricated beef subprimal yield and 2) augment USDA yield grading, in order to improve accuracy of grade assessment. The CVS was evaluated as a fully installed production system, operating on a full-time basis at chain speeds. Steer and heifer carcasses (n = 296) were evaluated using CVS, as well as by USDA expert and online graders, before the fabrication of carcasses into industry-standard subprimal cuts. Expert yield grade (YG), online YG, CVS estimated carcass yield, and CVS measured ribeye area in conjunction with expert grader estimates of the remaining YG factors (adjusted fat thickness, percentage of kidney-pelvic-heart fat, hot carcass weight) accounted for 67, 39, 64, and 65% of the observed variation in fabricated yields of closely trimmed subprimals. The dual component CVS predicted wholesale cut yields more accurately than current online yield grading, and, in an augmentation system, CVS ribeye measurement replaced estimated ribeye area in determination of USDA yield grade, and the accuracy of cutability prediction was improved, under packing plant conditions and speeds, to a level close to that of expert graders applying grades at a comfortable rate of speed offline.
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Sinorhizobium meliloti 1021] ... Length = 101 ... Query: 1 ... MFAVIKTGGKQYRVAANDVITIEKLEGVAGDKIEF...TEILMVGVGADATIGAPFVEGAVVS 60 ... MFAVIKTGGKQYRVAANDVITIEKLEGVAGDKIEFTEILMV...GVGADATIGAPFVEGAVVS Sbjct: 1 ... MFAVIKTGGKQYRVAANDVITIEKLEGVAGDKIEFTEILMVGVGADATIGAPFVEGAVVS 60 ...
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Sinorhizobium meliloti 1021] ... Length = 118 ... Query: 249 ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRT...LPVLDENEKLQGTVGLRELAGKEPG 308 ... ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRTLP...VLDENEKLQGTVGLRELAGKEPG Sbjct: 1 ... ELTCADIMSRDVVTVPGDTTPDHARYLLLKHDIRTLPVLDENEKLQGTVGLRELAGKEPG 60 ...
Shiga toxin-producing E. coli (STEC) O157:H7 and serogroups O26, O45, O103, O111, O121, and O145 are often referred to as the “top 7” STEC, and these have been declared as adulterants in beef by the USDA Food Safety and Inspection Service (FSIS). The aim of this work was to compare the methods des...
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available SE ... PROTEIN [Sinorhizobium meliloti 1021] ... Length = 130 ... Query: 751 AREDEGAAEASRLRMEIDELRSILETATDGVVVLGRDGDIRT...MNRSASALFDYDEADMRG 810 ... AREDEGAAEASRLRMEIDELRSILETATDGVVVLGRDGDIRT...MNRSASALFDYDEADMRG Sbjct: 1 ... AREDEGAAEASRLRMEIDELRSILETATDGVVVLGRDGDIRTMNRSASALFDYDEADMRG
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Sinorhizobium meliloti 1021] ... Length = 138 ... Query: 9 ... SKAPRSVLFMCGMNAIRSPMAEALARVALPKGTYVASAGVRQGERD...PFVDVVLEEVGLTI 68 ... SKAPRSVLFMCGMNAIRSPMAEALARVALPKGTYVASAGVRQGERD...PFVDVVLEEVGLTI Sbjct: 1 ... SKAPRSVLFMCGMNAIRSPMAEALARVALPKGTYVASAGVRQGERDPFVDVVLEEVGLTI 60 ... Query: 12
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available R ... PROTEIN [Sinorhizobium meliloti 1021] ... Length = 106 ... Query: 12 ... ELTVGEVAERSGLAVSTLHFYEAKGLIRSN...RSRGNQRRYPRSVLRRVAVIKVAQRTGIPL 71 ... ELTVGEVAERSGLAVSTLHFYEAKGLIRSN...RSRGNQRRYPRSVLRRVAVIKVAQRTGIPL Sbjct: 1 ... ELTVGEVAERSGLAVSTLHFYEAKGLIRSNRSRGNQRRYPRSVLRRVAVIKVAQRTGIPL 60 ...
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-02-01
The Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) operated a grain storage facility at Agra, Kansas, from the 1950s to the early 1970s. No structures remain on the property, and the land is used for agricultural purposes, specifically wheat production. The property is currently owned by the Kyle Railroad Co. and is leased to Mr. Herb VanEaton. The Pro-Ag Marketing grain storage facility is directly south of the former CCC/USDA facility. Quarterly progress reports for October-December 2008, January-March 2009, and April- June 2009 (Argonne 2009a,b,c) provided detailed information regarding construction and startup of the cleanup. Previous periodic monitoring reports (Argonne 2010a,b,c,d, 2011a,b,c, 2012, 2013a,b,c, 2014a,b) have tracked the subsequent progress of the cleanup effort. Data for evaluation of system performance are collected primarily by sampling SVE effluents, soil gas monitoring points, and groundwater wells for analysis for volatile organic compounds (VOCs). Table 1.1 provides a detailed chronological summary of activities during implementation of the cleanup.
ORF Alignment: NC_003078 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available lator, ArsR family protein [Sinorhizobium meliloti ... 1021] ... Length = 83 ... Query: 8 ... LSALADPTRRAIVARLAAGEATVNELAAPFEM...SLPAVSKHLKVLERAGLISRGRNAQWRP 67 ... LSALADPTRRAIVARLAAGEATVNELAAPFEMSLPAVSKHL...KVLERAGLISRGRNAQWRP Sbjct: 1 ... LSALADPTRRAIVARLAAGEATVNELAAPFEMSLPAVSKHLKVLERAGLISRGRNAQWRP 60 ...
Energy Technology Data Exchange (ETDEWEB)
Regnier, Cindy [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Harding, Ari [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Robinson, Alastair [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-07-01
The University of Hawai’i at M257noa (UHM) partnered with the US Department of Energy (DOE) and the Hawai`i Clean Energy Initiative to develop and implement solutions to retrofit exiting buildings to reduce energy consumption by at least 30% as part of DOE’s Commercial Building Partnerships (CBP) Program1. Kuykendall Hall, located on the UHM campus in Honolulu, was the focus of a CBP analysis and design collaboration among the University of Hawai’i, their consultants, and Lawrence Berkeley National Laboratory (LBNL). Kuykendall Hall consists of two 1960s-era wings – a four-story wing containing classrooms, and a seven-story tower containing offices – with a total floor area of approximately 76,000 square feet (ft²).
ORF Sequence: NC_003078 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp
ORF Sequence: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available MOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMONIA CHAIN ... ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium... meliloti] ... ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE ... LARGE CHAIN (AMMONIA
Identification of Antimony- and Arsenic-Oxidizing Bacteria Associated with Antimony Mine Tailing
Hamamura, Natsuko; Fukushima, Koh; Itai, Takaaki
2013-01-01
Antimony (Sb) is a naturally occurring toxic element commonly associated with arsenic (As) in the environment and both elements have similar chemistry and toxicity. Increasing numbers of studies have focused on microbial As transformations, while microbial Sb interactions are still not well understood. To gain insight into microbial roles in the geochemical cycling of Sb and As, soils from Sb mine tailing were examined for the presence of Sb- and As-oxidizing bacteria. After aerobic enrichment culturing with AsIII (10 mM) or SbIII (100 μM), pure cultures of Pseudomonas- and Stenotrophomonas-related isolates with SbIII oxidation activities and a Sinorhizobium-related isolate capable of AsIII oxidation were obtained. The AsIII-oxidizing Sinorhizobium isolate possessed the aerobic arsenite oxidase gene (aioA), the expression of which was induced in the presence of AsIII or SbIII. However, no SbIII oxidation activity was detected from the Sinorhizobium-related isolate, suggesting the involvement of different mechanisms for Sb and As oxidation. These results demonstrate that indigenous microorganisms associated with Sb mine soils are capable of Sb and As oxidation, and potentially contribute to the speciation and mobility of Sb and As in situ. PMID:23666539
ORF Sequence: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI
Tesco, G; Tanzi, R E
2000-01-01
We have previously shown that the endogenous C-terminal fragment of presenilin 1 co-immunoprecipitates with endogenous beta-catenin. Since PS1 has been suggested to be involved in beta-catenin stabilization, we further investigated whether GSK3 beta, responsible for beta-catenin phosphorylation and degradation, is part of the PS1/beta-catenin complex. In naïve H4 and CHO cells, PS1 co-immunoprecipitated with both endogenous beta-catenin and GSK3 beta. In addition, GSK3 beta endogenously binds to the PS1-CTF/NTF complex and beta-catenin in naïve CHO cells. GSK3 beta also co-immunoprecipitated with PS1 full length in CHO cell lines overexpressing PS1 wild type. Given that it has been recently shown that PS1 mutations of aspartate 257 or 385 result in prevention of PS1 endoproteolysis and inhibition of gamma-secretase activity, we also tested whether PS1 endoproteolysis is required for beta-catenin/GSK3 beta/PS1 binding and whether PS1 FAD-linked mutations affect GSK3 beta recruitment in the PS1/beta-catenin complex. GSK3 beta was detected in PS1 immunoprecipitates from H4 cell lines overexpressing PS1 wild type, delta E10, A286E, L246V and in CHO cell lines overexpressing aspartate or M146L mutations. The latter data show that the absence of PS1 endoproteolysis (D257A/D385A and delta E10) or the presence of PS1-FAD mutations does not interfere with beta-catenin/GSK3 beta/PS1 complex formation.
Aims: To evaluate the performance of the IQ-Check kits and the USDA Microbiology Laboratory Guidebook (MLG) methods for detection of the top 7 Shiga toxin-producing E. coli (STEC) (O157:H7, O26, O45, O103, O111, O121, and O145) in ground beef and both STEC and Salmonella in co-inoculated samples. M...
Host range, symbiotic effectiveness and nodulation competitiveness ...
African Journals Online (AJOL)
SERVER
2008-04-17
Apr 17, 2008 ... ERIC-PCR DNA fingerprinting patterns were used to identify the ... Apart from cowpea where all the isolates were effective, there were significant ..... aminocyclopropane-1-carboxylate deaminase gene in Sinorhizobium.
Detection and isolation of novel rhizopine-catabolizing bacteria from the environment
Gardener; de Bruijn FJ
1998-12-01
Microbial rhizopine-catabolizing (Moc) activity was detected in serial dilutions of soil and rhizosphere washes. The activity observed generally ranged between 10(6) and 10(7) catabolic units per g, and the numbers of nonspecific culture-forming units were found to be approximately 10 times higher. A diverse set of 37 isolates was obtained by enrichment on scyllo-inosamine-containing media. However, none of the bacteria that were isolated were found to contain DNA sequences homologous to the known mocA, mocB, and mocC genes of Sinorhizobium meliloti L5-30. Twenty-one of the isolates could utilize an SI preparation as the sole carbon and nitrogen source for growth. Partial sequencing of 16S ribosomal DNAs (rDNAs) amplified from these strains indicated that five distinct bacterial genera (Arthrobacter, Sinorhizobium, Pseudomonas, Aeromonas, and Alcaligenes) were represented in this set. Only 6 of these 21 isolates could catabolize 3-O-methyl-scyllo-inosamine under standard assay conditions. Two of these, strains D1 and R3, were found to have 16S rDNA sequences very similar to those of Sinorhizobium meliloti. However, these strains are not symbiotically effective on Medicago sativa, and DNA sequences homologous to the nodB and nodC genes were not detected in strains D1 and R3 by Southern hybridization analysis.
A Three-Legged Stool or Race? Governance Models for NOAA RISAs, DOI CSCs, and USDA Climate Hubs
Foster, J. G.
2014-12-01
NOAAs Regional Integrated Sciences and Assessments (RISA) Teams, DOIs Climate Science Centers (CSCs), and USDAs Regional Climate Hubs (RCHs) have common missions of integrating climate and related knowledge across scientific disciplines and regions to create "actionable" information that decision-makes can use to manage climate risks and impacts at state and local scales. However, the sponsoring agency programs, university investigators, and local federal officials govern each differently. The three models of program and center governance are 1) exclusively university (RISAs), 2) a hybrid of Federal government and (host) university (CSCs,), and 3) exclusively Federal (Hubs). Each model has it's advantages and disadvantages in terms of legal definition and authority, scientific mission requirements and strategies, flexibility and legitimacy to conduct research and to collaborate regionally with constituencies, leadership and governance approach and "friction points,", staff capacity and ability to engage stakeholders, necessity to deliver products and services, bureaucratic oversight, performance evaluation, and political support at Congressional, state, and local levels. Using available sources of information and data, this paper will compare and contrast the strengths and weakness of these three regional applied climate science center governance models.
A Three-Legged Stool or Race? Governance Models for NOAA RISAs, DOI CSCs, and USDA Climate Hub
Foster, J. G.
2014-12-01
NOAAs Regional Integrated Sciences and Assessments (RISA) Teams, DOIs Climate Science Centers (CSCs), and USDAs Regional Climate Hubs (RCHs) have common missions of integrating climate and related knowledge across scientific disciplines and regions to create "actionable" information that decision-makes can use to manage climate risks and impacts at state and local scales. However, the sponsoring agency programs, university investigators, and local federal officials govern each differently. The three models of program and center governance are 1) exclusively university (RISAs), 2) a hybrid of Federal government and (host) university (CSCs,), and 3) exclusively Federal (Hubs). Each model has it's advantages and disadvantages in terms of legal definition and authority, scientific mission requirements and strategies, flexibility and legitimacy to conduct research and to collaborate regionally with constituencies, leadership and governance approach and "friction points,", staff capacity and ability to engage stakeholders, necessity to deliver products and services, bureaucratic oversight, performance evaluation, and political support at Congressional, state, and local levels. Using available sources of information and data, this paper will compare and contrast the strengths and weakness of these three regional applied climate science center governance models.
Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Ferroli, R Baldini; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S Chen; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Fava, L; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; He, X Q; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G M; Huang, G S; Huang, J S; Huang, X T; Huang, Y; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kühn, W; Kupsc, A; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, T; Li, W D; Li, W G; Li, X L; Li, X M; Li, X N; Li, X Q; Li, Z B; Liang, H; Liang, J J; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Mitchell, R E; Mo, X H; Mo, Y J; Morales, C Morales; Moriya, K; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, W P; Wang, X F; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, X Y; Zhang, Y; Zhang, Y N; Zhang, Y H; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H
2015-11-27
A neutral structure in the DD[over ¯]^{*} system around the DD[over ¯]^{*} mass threshold is observed with a statistical significance greater than 10σ in the processes e^{+}e^{-}→D^{+}D^{*-}π^{0}+c.c. and e^{+}e^{-}→D^{0}D[over ¯]^{*0}π^{0}+c.c. at sqrt[s]=4.226 and 4.257 GeV in the BESIII experiment. The structure is denoted as Z_{c}(3885)^{0}. Assuming the presence of a resonance, its pole mass and width are determined to be [3885.7_{-5.7}^{+4.3}(stat)±8.4(syst)] MeV/c^{2} and [35_{-12}^{+11}(stat)±15(syst)] MeV, respectively. The Born cross sections are measured to be σ[e^{+}e^{-}→Z_{c}(3885)^{0}π^{0},Z_{c}(3885)^{0}→DD[over ¯]^{*}]=[77±13(stat)±17(syst)] pb at 4.226 GeV and [47±9(stat)±10(syst)] pb at 4.257 GeV. The ratio of decay rates B[Z_{c}(3885)^{0}→D^{+}D^{*-}+c.c.]/B[Z_{c}(3885)^{0}→D^{0}D[over ¯]^{*0}+c.c.] is determined to be 0.96±0.18(stat)±0.12(syst), consistent with no isospin violation in the process, Z_{c}(3885)^{0}→DD[over ¯]^{*}.
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE
Directory of Open Access Journals (Sweden)
Marziyeh Alamatsaz
2018-02-01
Full Text Available Background Rhizomelic chondrodysplasia punctata (RCDP type 1 is among of the rare autosomal recessive peroxisome biogenesis disorders caused by mutations in the PEX7 gene. RCDP patients with the classic form of RCDP1 do not live more than 10- year. Materials and Methods In the present study, a two-year-old girl with skeletal abnormalities and dysmorphic facial appearance is reported to be suffered from RCDP. The patient's parents were second cousins and healthy and there was no similar case in the parents’ family. PEX7 gene was sequenced in the patient and her parents. Results A homozygous mutation, G257A, was identified PEX7 in the genome of patient while the parents were compound heterozygous. Conclusion Taken together, clinical presentation and peroxisome profile of the patient suggested a missense mutation led to formation of a pathogenic PEX7, responsible for incidence of RCDP.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine [Argonne National Lab. (ANL), Argonne, IL (United States)
2014-04-01
In 2008-2009, to address the carbon tetrachloride contamination detected on its former property, the CCC/USDA implemented a source area cleanup in accord with the document Interim Measure Work Plan/Design for Agra, Kansas (IMWP/D; Argonne 2008). The cleanup involves five large-diameter boreholes (LDBs) coupled with soil vapor extraction (SVE) and air sparging (AS). The work plan was approved by the Kansas Department of Health and Environment (KDHE) in November 2008 (KDHE 2008b), and operation began in May 2009.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-09-01
In 2008-2009, to address the carbon tetrachloride contamination detected on its former property, the CCC/USDA implemented a source area cleanup in accord with the document Interim Measure Work Plan/Design for Agra, Kansas (IMWP/D; Argonne 2008). The cleanup involves five large-diameter boreholes (LDBs) coupled with soil vapor extraction (SVE) and air sparge (AS) systems. The work plan was approved by the Kansas Department of Health and Environment (KDHE) in November 2008 (KDHE 2008b), and operation began in May 2009.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States)
2015-09-01
In 2008-2009, to address the carbon tetrachloride contamination detected on its former property, the CCC/USDA implemented a source area cleanup in accord with the document Interim Measure Work Plan/Design for Agra, Kansas (IMWP/D; Argonne 2008). The cleanup involves five large-diameter boreholes (LDBs) coupled with soil vapor extraction (SVE) and air sparge (AS) systems. The work plan was approved by the Kansas Department of Health and Environment (KDHE) in November 2008 (KDHE 2008b), and operation began in May 2009.
Roesch-McNally, G.; Prendeville, H. R.
2017-12-01
A lack of coproduction, the joint production of new technologies or knowledge among technical experts and other groups, is arguably one of the reasons why much scientific information and resulting decision support systems are not very usable. Increasingly, public agencies and academic institutions are emphasizing the importance of coproduction of scientific knowledge and decision support systems in order to facilitate greater engagement between the scientific community and key stakeholder groups. Coproduction has been embraced as a way for the scientific community to develop actionable scientific information that will assist end users in solving real-world problems. Increasing the level of engagement and stakeholder buy-in to the scientific process is increasingly necessary, particularly in the context of growing politicization of science and the scientific process. Coproduction can be an effective way to build trust and can build-on and integrate local and traditional knowledge. Employing coproduction strategies may enable the development of more relevant and useful information and decision support tools that address stakeholder challenges at relevant scales. The USDA Northwest Climate Hub has increasingly sought ways to integrate coproduction in the development of both applied research projects and the development of decision support systems. Integrating coproduction, however, within existing institutions is not always simple, given that coproduction is often more focused on process than products and products are, for better or worse, often the primary focus of applied research and tool development projects. The USDA Northwest Climate Hub sought to integrate coproduction into our FY2017 call for proposal process. As a result we have a set of proposals and fledgling projects that fall along the engagement continuum (see Figure 1- attached). We will share the challenges and opportunities that emerged from this purposeful integration of coproduction into the work
Lu, Mingmei; Jiao, Shuo; Gao, Enting; Song, Xiuyong; Li, Zhefei; Hao, Xiuli; Rensing, Christopher; Wei, Gehong
2017-10-15
The symbiosis of the highly metal-resistant Sinorhizobium meliloti CCNWSX0020 and Medicago lupulina has been considered an efficient tool for bioremediation of heavy metal-polluted soils. However, the metal resistance mechanisms of S. meliloti CCNWSX00200 have not been elucidated in detail. Here we employed a comparative transcriptome approach to analyze the defense mechanisms of S. meliloti CCNWSX00200 against Cu or Zn exposure. Six highly upregulated transcripts involved in Cu and Zn resistance were identified through deletion mutagenesis, including genes encoding a multicopper oxidase (CueO), an outer membrane protein (Omp), sulfite oxidoreductases (YedYZ), and three hypothetical proteins (a CusA-like protein, a FixH-like protein, and an unknown protein), and the corresponding mutant strains showed various degrees of sensitivity to multiple metals. The Cu-sensitive mutant (Δ cueO ) and three mutants that were both Cu and Zn sensitive (Δ yedYZ , Δ cusA -like, and Δ fixH -like) were selected for further study of the effects of these metal resistance determinants on bioremediation. The results showed that inoculation with the Δ cueO mutant severely inhibited infection establishment and nodulation of M. lupulina under Cu stress, while inoculation with the Δ yedYZ and Δ fixH -like mutants decreased just the early infection frequency and nodulation under Cu and Zn stresses. In contrast, inoculation with the Δ cusA -like mutant almost led to loss of the symbiotic capacity of M. lupulina to even grow in uncontaminated soil. Moreover, the antioxidant enzyme activity and metal accumulation in roots of M. lupulina inoculated with all mutants were lower than those with the wild-type strain. These results suggest that heavy metal resistance determinants may promote bioremediation by directly or indirectly influencing formation of the rhizobium-legume symbiosis. IMPORTANCE Rhizobium-legume symbiosis has been promoted as an appropriate tool for bioremediation of heavy
Directory of Open Access Journals (Sweden)
Bénédicte Lafay
2007-03-01
Full Text Available Symbiotic relationships between leguminous plants (family Fabaceae and nodule-forming bacteria in Australia native ecosystems remain poorly characterized despite their importance. Most studies have focused on temperate parts of the country, where the use of molecular approaches have already revealed the presence of Bradyrhizobium, Ensifer (formerly Sinorhizobium, Mesorhizobium and Rhizobium genera of legume root-nodule bacteria. We here provide the first molecular characterization of nodulating bacteria from tropical Australia.45 nodule-forming bacterial strains, isolated from eight native legume hosts at eight locations in Kakadu National Park, Northern Territory, Australia, were examined for their genetic diversity and phylogenetic position. Using SSU rDNA PCR-RFLPs and phylogenetic analyses, our survey identified nine genospecies, two of which, Bradyrhizobium genospp. B and P, had been previously identified in south-eastern Australia and one, Mesorhizobium genospecies AA, in southern France. Three of the five newly characterized Bradyrhizobium genospecies were more closely related to B. japonicum USDA110, whereas the other two belonged to the B. elkanii group. All five were each more closely related to strains sampled in various tropical areas outside Australia than to strains known to occur in Australia. We also characterized an entirely novel nodule-forming lineage, phylogenetically distant from any previously described rhizobial and non-rhizobial legume-nodulating lineage within the Rhizobiales.Overall, the present results support the hypothesis of tropical areas being centres of biodiversity and diversification for legume root-nodule bacteria and confirm the widespread occurrence of Bradyrhizobium genosp. B in continental Australia.
Behrends, J M; Goodson, K J; Koohmaraie, M; Shackelford, S D; Wheeler, T L; Morgan, W W; Reagan, J O; Gwartney, B L; Wise, J W; Savell, J W
2005-03-01
An in-home beef study evaluated consumer ratings of top round steaks (semimembranosus) as influenced by USDA quality grade (top Choice or high Select), city (Chicago or Philadelphia), consumer segment (beef loyalists = heavy consumers of beef; budget rotators = cost-driven and split meat consumption between beef and chicken; and variety rotators = higher incomes and education and split meat consumption among beef, poultry, and other foods), degree of doneness, cooking method, and marination. Consumers evaluated each steak for overall like, tenderness, juiciness, flavor like, and flavor amount using 10-point scales (1 = dislike extremely, not at all tender, not at all juicy, dislike extremely, and none at all to 10 = like extremely, extremely tender, extremely juicy, like extremely, and an extreme amount of flavor, respectively). Quality grade affected several consumer sensory traits, with top Choice receiving higher (P Consumers in Chicago rated steaks cooked "medium and less" higher for overall like, tenderness, juiciness, flavor like, and flavor amount than those in Philadelphia (city x degree of doneness; P customers in Philadelphia received among the highest scores for overall like, tenderness, juiciness, flavor like, and flavor amount compared with any cooking method used by customers in Chicago (cooking method x city; P customers' satisfaction with top round steaks, and was the sensory trait most highly correlated to overall like, followed by tenderness, flavor amount, and juiciness. Preparation of top round steaks was crucial in consumers' likes and dislikes, and by improving flavor, higher consumer satisfaction may be achieved.
African Journals Online (AJOL)
User
IRRIGATED FLUVISOLS ALONG RIVER TATSEWARKI, KANO, NIGERIA ... concentrations of heavy metals in wastewater irrigated Fluvisols and in the ..... Effects of. Wastewater Discharge on Heavy Metals. Pollution in Fadama Soils in Kano ...
Interaction of arbuscular mycorrhizal fungi and rhizobia: Effects on flax yield in spoil-bank clay
Czech Academy of Sciences Publication Activity Database
Rydlová, Jana; Püschel, David; Sudová, Radka; Gryndler, M.; Mikanová, O.; Vosátka, Miroslav
2011-01-01
Roč. 174, č. 1 (2011), s. 128-134 ISSN 1436-8730 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : Linum usitatissimum * Glomus * Sinorhizobium Subject RIV: EF - Botanics Impact factor: 1.596, year: 2011
DEFF Research Database (Denmark)
Ehlers, Bodil K; Grøndahl, Eva; Ronfort, Joëlle
2012-01-01
of both partners. So far these studies have been typically carried out in a single environment. Here, we ask if the genetic correlation between fitness of the host plant Medicago truncatula (Fabaceae) and its bacterial symbiont Sinorhizobium meliloti is affected by the presence/absence of a monoterpene...
DEFF Research Database (Denmark)
Horn, Marcus A.; Drake, Harold L.; Schramm, Andreas
2006-01-01
-derived sequences, or were related to N2O reductases of the genera Bradyrhizobium, Brucella, Dechloromonas, Flavobacterium, Pseudomonas, Ralstonia, and Sinorhizobium. Although the numbers of estimators for genotype richness of sequence data from the gut were higher than those of soil, only one gut-derived nos...
Directory of Open Access Journals (Sweden)
Christine S. M. Lau
2015-01-01
Full Text Available Introduction. Hepatocellular carcinoma (HCC is a rare pediatric cancer accounting for 0.5% of all pediatric malignancies. This study examines a large cohort of HCC patients in an effort to define the factors impacting clinical outcomes in pediatric HCC patients compared to adults. Methods. Demographic and clinical data on 63,771 HCC patients (257 pediatric patients ≤ 19 and 63,514 adult patients age ≥ 20 were abstracted from the SEER database (1973–2011. Results. HCC was more common among males (59.5% pediatric and 75.1% adults and Caucasians (50.4% and 50.5%, p 4 cm in size (79.6% versus 62.0%, p=0.02. Pediatric HCC patients undergoing surgery (13.107 versus 8.324 years, p4 cm in Caucasian males. Children with HCC achieve significantly longer mean overall survival compared to adults with HCC, primarily attributable to the more favorable fibrolamellar histologic variant, and more aggressive surgical intervention, which significantly improves survival.
Yang, Yi; Hu, Xiao-Pan; Ma, Bin-Guang
2017-02-28
Bradyrhizobium diazoefficiens is a rhizobium able to convert atmospheric nitrogen into ammonium by establishing mutualistic symbiosis with soybean. It has been recognized as an important parent strain for microbial agents and is widely applied in agricultural and environmental fields. In order to study the metabolic properties of symbiotic nitrogen fixation and the differences between a free-living cell and a symbiotic bacteroid, a genome-scale metabolic network of B. diazoefficiens USDA110 was constructed and analyzed. The metabolic network, iYY1101, contains 1031 reactions, 661 metabolites, and 1101 genes in total. Metabolic models reflecting free-living and symbiotic states were determined by defining the corresponding objective functions and substrate input sets, and were further constrained by high-throughput transcriptomic and proteomic data. Constraint-based flux analysis was used to compare the metabolic capacities and the effects on the metabolic targets of genes and reactions between the two physiological states. The results showed that a free-living rhizobium possesses a steady state flux distribution for sustaining a complex supply of biomass precursors while a symbiotic bacteroid maintains a relatively condensed one adapted to nitrogen-fixation. Our metabolic models may serve as a promising platform for better understanding the symbiotic nitrogen fixation of this species.
Ito, Ryousuke; Nakada, Chika; Hoshino, Tsutomu
2017-01-18
Correction for 'β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade' by Ryousuke Ito et al., Org. Biomol. Chem., 2017, 15, 177-188.
Effect of exogenous application of rhizopine on lucerne root nodulation
African Journals Online (AJOL)
Rhizopine, 3-0 -methyl scyllo-inosamine was applied to the roots of luceme seedling inoculated with either rhizopine synthesizing Sinorhizobium meliloti strain L530 or the non-rhizopine synthesizing strain Rm 1021 . There was an initial delay in nodule formation. A significant increase in the number of nodules formed in ...
40 CFR Appendix II to Part 257 - Appendix II to Part 257
2010-07-01
... will be a minimum of five turnings of the windrow. Heat drying: Dewatered sludge cake is dried by... are only add-on in nature. Beta ray irradiation: Sludge is irradiated with beta rays from an...
Wan Xi,
2007-01-01
Medicago root nodules are formed as a result of the interaction of the plant with the soil-borne bacterium Sinorhizobium meliloti. Several plant genes are induced during nodule formation and MtENOD40 is one of the earliest genes activated. The precise function as well as the molecule
Wang, Ming Li; Morris, J Bradley; Tonnis, Brandon; Pinnow, David; Davis, Jerry; Raymer, Paul; Pederson, Gary A
2011-09-14
Castor has tremendous potential as a feedstock for biodiesel production. The oil content and fatty acid composition in castor seed are important factors determining the price for production and affecting the key fuel properties of biodiesel. There are 1033 available castor accessions collected or donated from 48 countries worldwide in the USDA germplasm collection. The entire castor collection was screened for oil content and fatty acid composition by nuclear magnetic resonance (NMR) and gas chromatography (GC), respectively. Castor seeds on the average contain 48.2% oil with significant variability ranging from 37.2 to 60.6%. Methyl esters were prepared from castor seed by alkaline transmethylation. GC analysis of methyl esters confirmed that castor oil was composed primarily of eight fatty acids: 1.48% palmitic (C16:0), 1.58% stearic (C18:0), 4.41% oleic (C18:1), 6.42% linoleic (C18:2), 0.68% linolenic (C18:3), 0.45% gadoleic (C20:1), 84.51% ricinoleic (C18:1-1OH), and 0.47% dihydroxystearic (C18:0-2OH) acids. Significant variability in fatty acid composition was detected among castor accessions. Ricinoleic acid (RA) was positively correlated with dihydroxystearic acid (DHSA) but highly negatively correlated with the five other fatty acids except linolenic acid. The results for oil content and fatty acid composition obtained from this study will be useful for end-users to explore castor germplasm for biodiesel production.
Roles of Extracellular Polysaccharides and Biofilm Formation in Heavy Metal Resistance of Rhizobia
Natalia Nocelli; Pablo C. Bogino; Erika Banchio; Walter Giordano
2016-01-01
Bacterial surface components and extracellular compounds, particularly flagella, lipopolysaccharides (LPSs), and exopolysaccharides (EPSs), in combination with environmental signals and quorum-sensing signals, play crucial roles in bacterial autoaggregation, biofilm development, survival, and host colonization. The nitrogen-fixing species Sinorhizobium meliloti (S. meliloti) produces two symbiosis-promoting EPSs: succinoglycan (or EPS I) and galactoglucan (or EPS II). Studies of the S. melilo...
Genetic identification and symbiotic efficiency of Sinorhizobium ...
African Journals Online (AJOL)
STORAGESEVER
2008-08-18
Aug 18, 2008 ... numerical analysis (diversity data base for DNA v2.1.1) of gel data (Figure .... strains nodulating small senegalese legumes by 16S-23S rRNA intergenic gene ... 169-174. Gao J, Terefework Z, Chen W-X, Lindstrom K (2001).
Directory of Open Access Journals (Sweden)
Alexandre Matsuda
2002-03-01
Full Text Available Sessenta estirpes/isolados dos gêneros Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium e Azorhizobium, procedentes de diferentes locais (Mata Atlântica, Amazônia, culturas agrícolas e experimentos com metais pesados e de espécies hospedeiras pertencentes às subfamílias Papilionoideae, Mimosoideae e Caesalpinoideae, foram avaliadas quanto à tolerância a Zn, Cu e Cd em meio YMA modificado pela adição de tampões biológicos (HEPES e MES e suplementados com Cu (0 a 60 mg L-1, Cd (0 a 60 mg L-1 e Zn (0 a 1.000 mg L-1. Mediante padrões de crescimento atribuídos às culturas nas diferentes concentrações dos metais, avaliaram-se as concentrações máximas toleradas e as doses tóxicas destes metais para redução de crescimento em 25% (DT25 e 50% (DT50. Não houve influência da procedência na concentração máxima de metal tolerada. A ordem de sensibilidade aos metais, considerando-se as concentrações máximas toleradas, foi Azorhizobium > Rhizobium = Mesorhizobium = Sinorhizobium > Bradyrhizobium. A DT25 e a DT50 foram úteis para diferenciarem estirpes/isolados de um mesmo gênero, que atingiram a mesma concentração máxima tolerada a Zn, Cu e Cd. A ordem de toxicidade dos metais estudados foi Cu > Cd > Zn.Sixty strains/isolates of the genera Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium and Azorhizobium, isolated from different hosts (legume subfamilies: Papilionoideae, Mimosoideae and Caesalpinoideae and location (Atlantic Forest, Amazon region, crop plantings and heavy metal experiments, were evaluated for Zn, Cu and Cd tolerance in YMA medium modified by the addition of biological buffers (HEPES and MES and supplemented with Cu (0 to 60 mg L-1, Cd (0 to 60 mg L-1, and Zn (0 to 1,000 mg L-1sulphates. Growth standards were applied to evaluate rhizobia cultures growth at different metal concentrations, allowing evaluation of highest tolerated concentrations of Zn, Cu, and Cd and the toxic doses
Saeki, Yuichi; Nakamura, Misato; Mason, Maria Luisa T; Yano, Tsubasa; Shiro, Sokichi; Sameshima-Saito, Reiko; Itakura, Manabu; Minamisawa, Kiwamu; Yamamoto, Akihiro
2017-06-24
We investigated the effects of the water status (flooded or non-flooded) and presence of the nosZ gene in bradyrhizobia on the bradyrhizobial community structure in a factorial experiment that examined three temperature levels (20°C, 25°C, and 30°C) and two soil types (andosol and gray lowland soil) using microcosm incubations. All microcosms were inoculated with Bradyrhizobium japonicum USDA6 T , B. japonicum USDA123, and B. elkanii USDA76 T , which do not possess the nosZ gene, and then half received B. diazoefficiens USDA110 T wt (wt for the wild-type) and the other half received B. diazoefficiens USDA110ΔnosZ. USDA110 T wt possesses the nosZ gene, which encodes N 2 O reductase; 110ΔnosZ, a mutant variant, does not. Changes in the community structure after 30- and 60-d incubations were investigated by denaturing-gradient gel electrophoresis and an image analysis. USDA6 T and 76 T strains slightly increased in non-flooded soil regardless of which USDA110 T strain was present. In flooded microcosms with the USDA110 T wt strain, USDA110 T wt became dominant, whereas in microcosms with the USDA110ΔnosZ, a similar change in the community structure occurred to that in non-flooded microcosms. These results suggest that possession of the nosZ gene confers a competitive advantage to B. diazoefficiens USDA110 T in flooded soil. We herein demonstrated that the dominance of B. diazoefficiens USDA110 T wt within the soil bradyrhizobial population may be enhanced by periods of flooding or waterlogging systems such as paddy-soybean rotations because it appears to have the ability to thrive in moderately anaerobic soil.
2010-07-01
... not locate such units in wetlands, unless the owner or operator can make the following demonstrations... actions (e.g., restoration of existing degraded wetlands or creation of man-made wetlands); and (5) Sufficient information is available to make a reasonable determination with respect to these demonstrations...
2010-04-01
... records (See Item 18). 4. Organization Documents: (a) Title, franchises, and licenses: (1) Certificates of... (prepared for internal administrative or operating purposes) of estimated future income, receipts and...
2010-04-01
....C. 552a. (b) Individual. As used in this subpart, “individual” means a citizen of the United States... the Commission including, but not limited to, education, financial transactions, medical history, and... photograph. (e) System of records. As used in this subpart, “System of records” means a group of any records...
40 CFR 257.21 - Applicability.
2010-07-01
...) Site-specific field collected measurements, sampling, and analysis of physical, chemical, and... there is no potential for migration of hazardous constituents from that unit to the uppermost aquifer...; and (5) Resource value of the underlying aquifer, including: (i) Current and future uses; (ii...
2010-07-01
... grease removed from a grease trap at a restaurant. Facility means all contiguous land and structures... manure spreading operations) for agricultural purposes or for treatment and disposal. Landfill means an... industrial, commercial, mining, and agricultural operations, and from community activities, but does not...
Directory of Open Access Journals (Sweden)
Diego Jarquin
2016-08-01
Full Text Available The identification and mobilization of useful genetic variation from germplasm banks for use in breeding programs is critical for future genetic gain and protection against crop pests. Plummeting costs of next-generation sequencing and genotyping is revolutionizing the way in which researchers and breeders interface with plant germplasm collections. An example of this is the high density genotyping of the entire USDA Soybean Germplasm Collection. We assessed the usefulness of 50K single nucleotide polymorphism data collected on 18,480 domesticated soybean (Glycine max accessions and vast historical phenotypic data for developing genomic prediction models for protein, oil, and yield. Resulting genomic prediction models explained an appreciable amount of the variation in accession performance in independent validation trials, with correlations between predicted and observed reaching up to 0.92 for oil and protein and 0.79 for yield. The optimization of training set design was explored using a series of cross-validation schemes. It was found that the target population and environment need to be well represented in the training set. Second, genomic prediction training sets appear to be robust to the presence of data from diverse geographical locations and genetic clusters. This finding, however, depends on the influence of shattering and lodging, and may be specific to soybean with its presence of maturity groups. The distribution of 7608 nonphenotyped accessions was examined through the application of genomic prediction models. The distribution of predictions of phenotyped accessions was representative of the distribution of predictions for nonphenotyped accessions, with no nonphenotyped accessions being predicted to fall far outside the range of predictions of phenotyped accessions.
The Use of the Delphi and Other Consensus Group Methods in Medical Education Research: A Review.
Humphrey-Murto, Susan; Varpio, Lara; Wood, Timothy J; Gonsalves, Carol; Ufholz, Lee-Anne; Mascioli, Kelly; Wang, Carol; Foth, Thomas
2017-10-01
Consensus group methods, such as the Delphi method and nominal group technique (NGT), are used to synthesize expert opinions when evidence is lacking. Despite their extensive use, these methods are inconsistently applied. Their use in medical education research has not been well studied. The authors set out to describe the use of consensus methods in medical education research and to assess the reporting quality of these methods and results. Using scoping review methods, the authors searched the Medline, Embase, PsycInfo, PubMed, Scopus, and ERIC databases for 2009-2016. Full-text articles that focused on medical education and the keywords Delphi, RAND, NGT, or other consensus group methods were included. A standardized extraction form was used to collect article demographic data and features reflecting methodological rigor. Of the articles reviewed, 257 met the inclusion criteria. The Modified Delphi (105/257; 40.8%), Delphi (91/257; 35.4%), and NGT (23/257; 8.9%) methods were most often used. The most common study purpose was curriculum development or reform (68/257; 26.5%), assessment tool development (55/257; 21.4%), and defining competencies (43/257; 16.7%). The reporting quality varied, with 70.0% (180/257) of articles reporting a literature review, 27.2% (70/257) reporting what background information was provided to participants, 66.1% (170/257) describing the number of participants, 40.1% (103/257) reporting if private decisions were collected, 37.7% (97/257) reporting if formal feedback of group ratings was shared, and 43.2% (111/257) defining consensus a priori. Consensus methods are poorly standardized and inconsistently used in medical education research. Improved criteria for reporting are needed.
Directory of Open Access Journals (Sweden)
Pérez Guianeya
2008-06-01
Full Text Available Se aislaron 19 cepas de rizobio a partir de los nódulos de las leguminosas Canavalia ensiformis, Stylosanthes guianensis, Centrosema molle, Pueraria phaseoloides y Macroptilium atropurpureum, con el objetivo de obtener inoculantes efectivos para dichos cultivos en suelos ácidos. Para la caracterización de los aislados bacterianos se estudiaron sus características micromorfológicas, tintoriales y culturales, así como algunas respuestas fisiológico-bioquímicas, tales como la excreción de ácido o base al medio de cultivo y el ensayo de la cetolactasa. Se hizo un ensayo de nodulación in vitro con cada una de las leguminosas para determinar la efectividad de los aislados. De acuerdo con las características culturales, la tasa de crecimiento en medio LMA y la producción de ácido o base, los aislados obtenidos pudieran pertenecer a los géneros Bradyrhizobium y Rhizobium y/o Sinorhizobium. La prueba de la cetolactasa permitió conocer que ninguno de los aislados en estudio pertenece al género Agrobacterium. El ensayo con plantas inoculadas mostró que todas las cepas aisladas fueron efectivas en la nodulación, ya que nodularon en las leguminosas probadas. Se concluye que de las cepas aisladas 11 pudieran pertenecer al género Bradyrhizobium, mientras que las ocho restantes comparten características similares con los géneros Rhizobium y/o Sinorhizobium; todos los aislados fueron efectivos en la nodulación y pueden considerarse cepas promisorias para la obtención de inoculantes para las leguminosas forrajeras en estudio.Nineteen rhizobium strains were isolated from the nodules of the legumes Canavalia ensiformis, Stylosanthes guianensis, Centrosema molle, Pueraria phaseoloides and Macroptilium atropurpureum, with the objective of obtaining effective inoculants for such crops in acid soils. For the characterization of the bacterial isolates, their micromorphological, staining and cultural characteristics were studied, as well as some
Potato research at the Red River Valley Agricultural Research Center is conducted by the Sugarbeet & Potato Research Unit at two locations: the Northern Crop Science Laboratory in Fargo, ND and the Potato Research Worksite located in East Grand Forks, MN. Research in Fargo is laboratory oriented an...
... Gov Sites FAQ Contact Us En Español Search Nutrition.Gov Search all USDA Advanced Search Browse by ... FAQs USDA Research, Education, and Economics Resources Welcome Nutrition.gov is a USDA-sponsored website that offers ...
75 FR 43140 - The National Advisory Committee on Meat and Poultry Inspection; Re-establishment
2010-07-23
... contacting the person above. USDA Nondiscrimination Statement USDA prohibits discrimination in all its programs and activities on the basis of race, color, national origin, gender, religion, age, disability...). To file a written complaint of discrimination, write USDA, Office of the Assistant Secretary for...
Energy Technology Data Exchange (ETDEWEB)
Melius, C; Robertson, A; Hullinger, P
2006-10-24
The epidemiological and economic modeling of livestock diseases requires knowing the size, location, and operational type of each livestock facility within the US. At the present time, the only national database of livestock facilities that is available to the general public is the USDA's 2002 Agricultural Census data, published by the National Agricultural Statistics Service, herein referred to as the 'NASS data.' The NASS data provides facility data at the county level for various livestock types (i.e., beef cows, milk cows, cattle on feed, other cattle, total hogs and pigs, sheep and lambs, milk goats, and angora goats). However, the number and sizes of facilities for the various livestock types are not independent since some facilities have more than one type of livestock, and some livestock are of more than one type (e.g., 'other cattle' that are being fed for slaughter are also 'cattle on feed'). In addition, any data tabulated by NASS that could identify numbers of animals or other data reported by an individual respondent is suppressed by NASS and coded with a 'D.'. To be useful for epidemiological and economic modeling, the NASS data must be converted into a unique set of facility types (farms having similar operational characteristics). The unique set must not double count facilities or animals. At the same time, it must account for all the animals, including those for which the data has been suppressed. Therefore, several data processing steps are required to work back from the published NASS data to obtain a consistent database for individual livestock operations. This technical report documents data processing steps that were used to convert the NASS data into a national livestock facility database with twenty-eight facility types. The process involves two major steps. The first step defines the rules used to estimate the data that is suppressed within the NASS database. The second step converts the NASS
78 FR 11814 - Submission for OMB Review; Comment Request
2013-02-20
... USDA customer desiring access to online services or applications that require user eAuthentication. The... number. Office of the Chief Information Officer Title: USDA eAuthentication Service Customer Registration... Agency customers, as well as employees who request access to protected USDA Web applications and services...
Publications | Page 257 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
A public talk with Globe and Mail journalist Doug Saunders. A third of humanity is on the move—usually from farms ... This study looks at backward linkages to the manufacturing sector in the oil and gas value chain in Angola as a potential driver of industrial development. The study employs a sub-sectoral approach rather ...
7 CFR 1944.257 - Service coordinator.
2010-01-01
... professional relationships with all agencies and service providers in the community, and develop a directory of...) Maintain necessary case files on each program participant, containing such information and kept in such...) Assist the grant recipient in building informal support networks with neighbors, friends and family; and...
2010-07-01
... septic tank pumpings (Interim Final). A facility or practice involving disposal of sewage sludge or septic tank pumpings shall not exist or occur unless in compliance with paragraphs (b) (1), (2) or (3) of... trenching or burial operation.) (2) Septic tank pumpings that are applied to the land surface or...
Publications | Page 257 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Any -, Central Asia, Europe, Far East Asia, Middle East, North and Central America ... Utilization of trade agreements in Sri Lanka : perceptions of exporters vs. statistical ... in diverse cropping patterns, lifestyles and social and cultural relations. ... Research assessed the level of access to sexual and reproductive health ...
Publications | Page 257 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
TTI reports on its first two years of programming. During its first two years, the Think Tank Initiative has supported 52 institutions in ... the way we acquire, disseminate, and transform knowledge. And, as a result, knowledge production is becoming closer and more directly linked to economic competitiveness. This evolution.
17 CFR 257.1 - General instructions.
2010-04-01
... conflict with other legal retention requirements. Optional destruction of records relevant to pending or... statements including the transactions to which such records relate. (j) Use of technical accounting terms. For purposes of the schedules, traditional accounting terms such as ledgers, journals, registers and...
38 CFR 21.257 - Self-employment.
2010-07-01
.... (Authority: 38 U.S.C. 3104, 3116, 3117) (f) Feasibility analysis of a proposed self-employment business plan. VA will conduct a comprehensive review and analysis of the feasibility of a proposed business plan... amended; (6) The location of the site for the proposed business and the cost of the site, if any; and (7...
40 CFR 25.7 - Advisory groups.
2010-07-01
... agencies involved in activities supported by EPA financial assistance under any of the three Acts. (b) Role... should monitor the progress of the project and become familiar with issues relevant to project...
14 CFR 257.5 - Notice requirement.
2010-01-01
... that the corporate name of the transporting carrier and any other name under which that service is held... communication in the United States with a prospective consumer and in any telephone calls placed from the United... and shall identify the transporting carrier by its corporate name and any other name under which that...
2010-07-01
... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR CLASSIFICATION OF SOLID WASTE DISPOSAL FACILITIES AND PRACTICES Classification of Solid Waste Disposal Facilities... residential, commercial, institutional or industrial solid waste. This requirement does not apply to...
42 CFR 441.257 - Informed consent.
2010-10-01
... otherwise entitled. (ii) A description of available alternative methods of family planning and birth control... section was effectively communicated to any individual who is blind, deaf, or otherwise handicapped; (3...
76 FR 82075 - Highly Erodible Land and Wetland Conservation
2011-12-30
... based on a ``good faith'' determination. The ``good faith'' provisions in the USDA regulations allow... eligibility for USDA program benefits if certain conditions are met. This rule revises the ``good faith'' provisions in two ways, first, by requiring higher level concurrence within USDA with the good faith...
2013-09-16
...). USDA Nondiscrimination Statement The U.S. Department of Agriculture (USDA) prohibits discrimination in all its programs and activities on the basis of race, color, national origin, gender, religion, age...) 720-2600 (voice and TTY). To file a written complaint of discrimination, write USDA Office of the...
Final work plan : environmental site investigation at Sylvan Grove, Kansas.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M. (Environmental Science Division)
2012-07-15
In 1998, carbon tetrachloride was found above the maximum contaminant level (MCL) of 5 {micro}g/L in groundwater from one private livestock well at Sylvan Grove, Kansas, by the Kansas Department of Health and Environment (KDHE). The 1998 KDHE sampling was conducted under the U.S. Department of Agriculture (USDA) private well sampling program. The Commodity Credit Corporation (CCC), a USDA agency, operated a grain storage facility in Sylvan Grove from 1954 to1966. Carbon tetrachloride is the contaminant of primary concern at sites associated with former CCC/USDA grain storage operations. Sylvan Grove is located in western Lincoln County, approximately 60 mi west of Salina (Figure 1.1). To determine whether the former CCC/USDA facility at Sylvan Grove is a potential contaminant source and its possible relationship to the contamination in groundwater, the CCC/USDA has agreed to conduct an investigation, in accordance with the Intergovernmental Agreement between the KDHE and the Farm Service Agency (FSA) of the USDA. This Work Plan presents historical data related to previous investigations, grain storage operations, local private wells and public water supply (PWS) wells, and local geologic and hydrogeologic conditions at Sylvan Grove. The findings from a review of all available documents are discussed in Section 2. On the basis of the analyses of historical data, the following specific technical objectives are proposed for the site investigation at Sylvan Grove: (1) Evaluate the potential source of carbon tetrachloride at the former CCC/USDA facility; (2) Determine the relationship of potential contamination (if present) at the former CCC/USDA facility to contamination identified in 1998 in groundwater samples from one private well to the west; and (3) Delineate the extent of potential contamination associated with the former CCC/USDA facility. The detailed scope of work is outlined in Section 3. The results of the proposed work will provide the basis for determining
Directory of Open Access Journals (Sweden)
Fernando A Pagliai
2014-04-01
Full Text Available The causal agent of Huanglongbing disease, 'Candidatus Liberibacter asiaticus', is a non-culturable, gram negative, phloem-limited α-proteobacterium. Current methods to control the spread of this disease are still limited to the removal and destruction of infected trees. In this study, we identified and characterized a regulon from 'Ca. L. asiaticus' involved in cell wall remodeling, that contains a member of the MarR family of transcriptional regulators (ldtR, and a predicted L,D-transpeptidase (ldtP. In Sinorhizobium meliloti, mutation of ldtR resulted in morphological changes (shortened rod-type phenotype and reduced tolerance to osmotic stress. A biochemical approach was taken to identify small molecules that modulate LdtR activity. The LdtR ligands identified by thermal shift assays were validated using DNA binding methods. The biological impact of LdtR inactivation by the small molecules was then examined in Sinorhizobium meliloti and Liberibacter crescens, where a shortened-rod phenotype was induced by growth in presence of the ligands. A new method was also developed to examine the effects of small molecules on the viability of 'Ca. Liberibacter asiaticus', using shoots from HLB-infected orange trees. Decreased expression of ldtRLas and ldtPLas was observed in samples taken from HLB-infected shoots after 6 h of incubation with the LdtR ligands. These results provide strong proof of concept for the use of small molecules that target LdtR, as a potential treatment option for Huanglongbing disease.
Energy Technology Data Exchange (ETDEWEB)
Melius, C
2007-12-05
The epidemiological and economic modeling of poultry diseases requires knowing the size, location, and operational type of each poultry type operation within the US. At the present time, the only national database of poultry operations that is available to the general public is the USDA's 2002 Agricultural Census data, published by the National Agricultural Statistics Service, herein referred to as the 'NASS data'. The NASS data provides census data at the county level on poultry operations for various operation types (i.e., layers, broilers, turkeys, ducks, geese). However, the number of farms and sizes of farms for the various types are not independent since some facilities have more than one type of operation. Furthermore, some data on the number of birds represents the number sold, which does not represent the number of birds present at any given time. In addition, any data tabulated by NASS that could identify numbers of birds or other data reported by an individual respondent is suppressed by NASS and coded with a 'D'. To be useful for epidemiological and economic modeling, the NASS data must be converted into a unique set of facility types (farms having similar operational characteristics). The unique set must not double count facilities or birds. At the same time, it must account for all the birds, including those for which the data has been suppressed. Therefore, several data processing steps are required to work back from the published NASS data to obtain a consistent database for individual poultry operations. This technical report documents data processing steps that were used to convert the NASS data into a national poultry facility database with twenty-six facility types (7 egg-laying, 6 broiler, 1 backyard, 3 turkey, and 9 others, representing ducks, geese, ostriches, emus, pigeons, pheasants, quail, game fowl breeders and 'other'). The process involves two major steps. The first step defines the rules used to
Seed collection success and failure in fraxinus gene conservation efforts
Joseph D. Zeleznik; Andrew J. David
2017-01-01
National seed collection and gene conservation programs have expanded in recent years, especially in response to pressure from non-native pests such as the emerald ash borer (Agrilus planipennis). Since 2008, we have been working with the U.S. Department of Agriculture Agricultural Research Service (USDA ARS) and USDA Forest Service (USDA FS) leading seed collection...
Chaloupkova, Radka; Prokop, Zbynek; Sato, Yukari; Nagata, Yuji; Damborsky, Jiri
2011-08-01
The effect of pH and temperature on structure, stability, activity and enantioselectivity of haloalkane dehalogenase DbjA from Bradyrhizobium japonicum USDA110 was investigated in this study. Conformational changes have been assessed by circular dichroism spectroscopy, functional changes by kinetic analysis, while quaternary structure was studied by gel filtration chromatography. Our study shows that the DbjA enzyme is highly tolerant to pH changes. Its secondary and tertiary structure was not affected by pH in the ranges 5.3-10.3 and 6.2-10.1, respectively. Oligomerization of DbjA was strongly pH-dependent: monomer, dimer, tetramer and a high molecular weight cluster of the enzyme were distinguished in solution at different pH conditions. Moreover, different oligomeric states of DbjA possessed different thermal stabilities. The highest melting temperature (T(m) = 49.1 ± 0.2 °C) was observed at pH 6.5, at which the enzyme occurs in dimeric form. Maximal activity was detected at 50 °C and in the pH interval 7.7-10.4. While pH did not have any effect on enantiodiscriminination of DbjA, temperature significantly altered DbjA enantioselectivity. A decrease in temperature results in significantly enhanced enantioselectivity. The temperature dependence of DbjA enantioselectivity was analysed with 2-bromobutane, 2-bromopentane, methyl 2-bromopropionate and ethyl 2-bromobutyrate, and differential activation parameters Δ(R-S)ΔH and Δ(R-S)ΔS were determined. The thermodynamic analysis revealed that the resolution of β-bromoalkanes was driven by both enthalpic and entropic terms, while the resolution of α-bromoesters was driven mainly by an enthalpic term. Unique catalytic activity and structural stability of DbjA in a broad pH range, combined with high enantioselectivity with particular substrates, make this enzyme a very versatile biocatalyst. Enzyme EC3.8.1.5 haloalkane dehalogenase. © 2011 The Authors Journal compilation © 2011 FEBS.
Regulation of Long-Chain N-Acyl-Homoserine Lactones in Agrobacterium vitis
Hao, Guixia; Burr, Thomas J.
2006-01-01
Homologs of quorum-sensing luxR and luxI regulatory genes, avsR and avsI, were identified in Agrobacterium vitis strain F2/5. Compared to other LuxI proteins from related species, the deduced AvsI shows the greatest identity to SinI (71%) from Sinorhizobium meliloti Rm1021. AvsR possesses characteristic autoinducer binding and helix-turn-helix DNA binding domains and shares a high level of identity with SinR (38%) from Rm1021. Site-directed mutagenesis of avsR and avsI was performed, and both...
Hongmei Gu; Richard Bergman
2018-01-01
AbstractWith the worldâs increasing focus on sustainability in the construction sector through green building systems, the U.S. Department of Agriculture (USDA) has been ac-tively engaged in green building advocacy in the United States through USDA Tall Wood Building competitions and follow-up research on use of mass timber for nonresi-dential buildings. The USDA...
Directory of Open Access Journals (Sweden)
Yuanyuan Zhou
Full Text Available Soybean cyst nematode (SCN is the most damaging soybean pest worldwide. To improve soybean resistance to SCN, we employed a soybean seed-coating strategy through combination of three rhizobacterial strains, including Bacillus simple, B. megaterium and Sinarhizobium fredii at various ratios. We found seed coating by such rhizobacterial strains at a ratio of 3:1:1 (thereafter called SN101 produced the highest germination rate and the mortality of J2 of nematodes. Then, the role of soybean seed coating by SN101 in nematode control was evaluated under both greenhouse and two field conditions in Northeast China in 2013 and 2014. Our results showed that SN101 treatment greatly reduced SCN reproduction and significantly promoted plant growth and yield production in both greenhouse and field trials, suggesting that SN101 is a promising seed-coating agent that may be used as an alternative bio-nematicide for controlling SCN in soybean fields. Our findings also demonstrate that combination of multiple rhizobacterial strains needs to be considered in the seed coating for better management of plant nematodes.
Kim, Won-Seok; Ho, Heo Jae; Nelson, Randall L; Krishnan, Hari B
2008-12-10
Tofu, a cheese-like food made by curdling soy milk, is a major dietary staple of Asian countries. Consumption of tofu and other soy products is steadily increasing in North America due to its well-known health benefits. Soybean A(5), A(4), and B(3) peptide null lines 'Enrei' and 'Raiden' are commonly utilized in breeding programs to develop high-quality tofu cultivars. To expand the genetic diversity it is desirable to identify and utilize other A(5), A(4), and B(3) null genotypes in the development of improved tofu cultivars that are adapted to North American conditions. In this study were screened diverse soybean accessions from the USDA Soybean Germplasm Collection to identify Gy4 mutants, the locus that controls A(5), A(4), and B(3) peptide production. Analysis of total seed proteins from 485 soybean lines by SDS-PAGE enabled the identification of 38 accessions that lacked the A(5), A(4), and B(3) peptides. These accessions showed marked differences in seed size and seed coat color and represented different maturity groups ranging from 0 to IX. To ascertain the molecular basis for the lack of A(5), A(4), and B(3) peptides in the newly identified Gy4 mutants, the nucleotide sequence of a portion of the Gy4 gene was determined from eight soybean accessions representing different maturity groups. These eight Gy4 mutants revealed a single point mutation that changed the translation initiation codon ATG to ATA, resulting in the A(5), A(4), and B(3) null phenotype. The newly identified Gy4 mutants from this study will enable plant breeders to expand the genetic diversity of North American food-quality soybeans and also aid in the development of hypoallergenic soybeans.
Sene, Godar; Thiao, Mansour; Samba-Mbaye, Ramatoulaye; Khasa, Damase; Kane, Aboubacry; Mbaye, Mame Samba; Beaulieu, Marie-Ève; Manga, Anicet; Sylla, Samba Ndao
2013-01-01
Several fast-growing and multipurpose tree species have been widely used in West Africa to both reverse the tendency of land degradation and restore soil productivity. Although beneficial effects have been reported on soil stabilization, there still remains a lack of information about their impact on soil microorganisms. Our investigation has been carried out in exotic and native tree plantations of 28 years and aimed to survey and compare the abundance and genetic diversity of natural legume-nodulating rhizobia (LNR). The study of LNR is supported by the phylogenetic analysis which clustered the isolates into three genera: Bradyrhizobium, Mesorhizobium, and Sinorhizobium. The results showed close positive correlations between the sizes of LNR populations estimated both in the dry and rainy seasons and the presence of legume tree hosts. There were significant increases in Rhizobium spp. population densities in response to planting with Acacia spp., and high genetic diversities and richness of genotypes were fittest in these tree plantations. This suggests that enrichment of soil Rhizobium spp. populations is host specific. The results indicated also that species of genera Mesorhizobium and Sinorhizobium were lacking in plantations of non-host species. By contrast, there was a widespread distribution of Bradyrhizobium spp. strains across the tree plantations, with no evident specialization in regard to plantation type. Finally, the study provides information about the LNR communities associated with a range of old tree plantations and some aspects of their relationships to soil factors, which may facilitate the management of man-made forest systems that target ecosystem rehabilitation and preservation of soil biota.
262 257 Profitability Analysis of Three Met
African Journals Online (AJOL)
2008-12-02
Dec 2, 2008 ... marketing in Maiduguri Metropolitan Area in Borno State of Nigeria. ... emphasis on “convenience” foods such as Suya. (Igene ... of the businesses of the people of the State. .... are old in the business and, therefore, managed.
27 CFR 24.257 - Labeling wine containers.
2010-04-01
... container of beverage wine prior to removal for consumption or sale. The minimum type size for information... wines under 7 percent alcohol is under the jurisdiction of the Food and Drug Administration. (iv) The..., 5662) (Approved by the Office of Management and Budget under control number 1512-0503) [T.D. ATF-299...
24 CFR 92.257 - Faith-based activities.
2010-04-01
... organization retains its authority over its internal governance, and it may retain religious terms in its..., practice, and expression of its religious beliefs, provided that it does not use direct HOME funds to...
40 CFR 257.27 - Selection of remedy.
2010-07-01
... currently available, but which may offer significant advantages over already available technologies in terms...; (6) Resource value of the aquifer including: (i) Current and future uses; (ii) Proximity and... and those substances are present in concentrations such that cleanup of the release from the unit...
40 CFR 257.1 - Scope and purpose.
2010-07-01
... disposal of solid waste by underground well injection subject to the regulations (40 CFR part 146) for the Underground Injection Control Program (UICP) under the Safe Drinking Water Act, as amended, 42 U.S.C. 3007 et... intended for return to the mine site. (3) The criteria do not apply to the land application of domestic...
Jozefkowicz, Cintia; Brambilla, Silvina; Frare, Romina; Stritzler, Margarita; Piccinetti, Carlos; Puente, Mariana; Berini, Carolina Andrea; Pérez, Pedro Reyes; Soto, Gabriela; Ayub, Nicolás
2017-12-10
We here characterized the stress-tolerant alfalfa microsymbiont Sinorhizobium meliloti B401. B401-treated plants showed high nitrogen fixation rates under humid and semiarid environments. The production of glycine betaine in isolated bacteroids positively correlated with low precipitation levels, suggesting that this compound acts as a critical osmoprotectant under field conditions. Genome analysis revealed that strain B401 contains alternative pathways for the biosynthesis and uptake of glycine betaine and its precursors. Such genomic information will offer substantial insight into the environmental physiology of this biotechnologically valuable nitrogen-fixing bacterium. Copyright © 2017 Elsevier B.V. All rights reserved.
77 FR 20281 - Designation of Product Categories for Federal Procurement
2012-04-04
... derived from imported oil and natural gas. When USDA designates by rulemaking a product category (a...: Vehicular Products--re-refined lubricating oils. USDA is requesting that manufacturers of these qualifying...
7 CFR 3411.8 - Other Federal statutes and regulations that apply.
2010-01-01
... Drug-Free Workplace (Grants); 7 CFR part 3018—USDA implementation of New Restrictions on Lobbying... 7 CFR part 15B (USDA implementation of statute), prohibiting discrimination based upon physical or...
Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.
Directory of Open Access Journals (Sweden)
Jun-Hui Zhang
Full Text Available To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML in the production of human milk fat substitute (HMFS, we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease and tripalmitin (7.55 KJ/mol decrease were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type. The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.
Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.
Zhang, Jun-Hui; Jiang, Yu-Yan; Lin, Ying; Sun, Yu-Fei; Zheng, Sui-Ping; Han, Shuang-Yan
2013-01-01
To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML) in the production of human milk fat substitute (HMFS), we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease) and tripalmitin (7.55 KJ/mol decrease) were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type). The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.
2010-05-27
... flexibility analysis, USDA has not identified any relevant Federal rules that duplicate, overlap, or conflict... continuing to work with USDA to solve the oversupply situation and most recently made a recommendation to add...
Final Report: Results of Environmental Site Investigation at Sylvan Grove, Kansas
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M [Argonne National Lab. (ANL), Argonne, IL (United States)
2014-09-01
Sylvan Grove is located in western Lincoln County, approximately 60 mi west of Salina, Kansas (Figure 1.1). From 1954 to 1966, the Commodity Credit Corporation (CCC), an agency of the U.S. Department of Agriculture (USDA), operated a grain storage facility at the northeastern edge of Sylvan Grove. During this time, commercial grain fumigants containing carbon tetrachloride were in common use to preserve grain in storage. In 1998, the Kansas Department of Health and Environment (KDHE) found carbon tetrachloride above the maximum contaminant level (MCL) of 5 μg/L in groundwater from one private well used for livestock and lawn and garden watering. The 1998 KDHE sampling at Sylvan Grove was conducted under the USDA private well sampling program. To determine whether the former CCC/USDA facility at Sylvan Grove is a potential contaminant source and its possible relationship to the contamination in groundwater, the CCC/USDA proposed to conduct an environmental site investigation, in accordance with the Intergovernmental Agreement between the KDHE and the Farm Service Agency (FSA) of the USDA. Argonne National Laboratory, on behalf of the CCC/USDA, developed a work plan (Argonne 2012) for the site investigation and a supplemental work plan for indoor and ambient air sampling (Appendix A). The proposed work was approved by the KDHE (2012a, 2013). The investigations were performed by the Environmental Science Division of Argonne National Laboratory, on behalf of the CCC/USDA. The main activities for the site investigation were conducted in June 2012, and indoor and ambient air sampling was performed in February 2013. This report presents the findings of the investigations at Sylvan Grove.
Final Phase II report : QuickSite(R) investigation, Everest, Kansas.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M. (Environmental Research)
2003-11-01
The Commodity Credit Corporation (CCC), an agency of the U.S. Department of Agriculture (USDA), operated grain storage facilities at two different locations at Everest, Kansas (Figure 1.1). One facility (referred to in this report as the Everest facility) was at the western edge of the city of Everest. The CCC/USDA operated this facility from 1950 until the early 1970s. The second facility (referred to in this report as Everest East) was about 0.5 mi northeast of the town. The CCC/USDA operated this facility from 1954 until the early 1970s. While these two former CCC/USDA grain storage facilities were in operation, commercial grain fumigants containing carbon tetrachloride were in common use by the CCC/USDA and the private grain storage industry to preserve grain. In 1997, the Kansas Department of Health and Environment (KDHE) sampled several domestic drinking water and nondrinking water wells in the Everest area. The KDHE sampling was part of the CCC/USDA Private Well Sampling Program, which was initiated to determine whether carbon tetrachloride was present in domestic wells near former CCC/USDA grain storage facilities in Kansas. All of the sampled domestic drinking water wells were located outside the Everest city boundaries. As a result of this sampling, carbon tetrachloride contamination was identified at a single domestic drinking water well (the Nigh well; DW06) approximately 3/8 mi northwest of the former Everest CCC/USDA grain storage facility. The CCC/USDA subsequently connected the Nigh residence to the Everest municipal water system. As a result of the detection of carbon tetrachloride in this well, the KDHE conducted preliminary investigations to further evaluate the existence of contamination and its potential effect on public health and the environment. The KDHE concluded that carbon tetrachloride in groundwater at Everest might, in part, be linked to historical use of carbon tetrachloride-based grain fumigants at the former CCC/USDA facilities. For
7 CFR 1415.14 - Misrepresentation and violations.
2010-01-01
... participant's negligence or failure to comply with the easement terms and conditions. (c) USDA may require the... applicable law, USDA may withhold any easement payment, rental payment, or cost-share payments owing to the...
7 CFR 3403.15 - Other Federal statues and regulations that apply.
2010-01-01
... Requirements for Drug-Free Workplace (Grants). 7 CFR part 3018—USDA implementation of Restrictions on Lobbying...) and 7 CFR part 15b (USDA implementation of statute)—prohibiting discrimination based upon physical or...
... Perdue Pledges Support on the Long Road to Recovery 4/5 USDA Continues Disaster Assistance in Puerto Rico USDA is continuing its efforts to address the nutrition needs of Puerto Rican residents affected by Hurricanes ...
7 CFR 3430.4 - Other applicable statutes and regulations.
2010-01-01
... for Drug-Free Workplace (Financial Assistance). 7 CFR Part 3052—USDA implementation of OMB Circular No..., Rehabilitation Act of 1973) and 7 CFR Part 15b (USDA implementation of statute)—prohibiting discrimination based...
FInal Report: Site Investigation Results, 2009-2011, at Inman, Kansas
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States). Environmental Sciences Div.
2015-05-01
The Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) operated a grain storage facility at the southern edge of the city of Inman, Kansas, from 1954 to 1965. During this time, commercial grain fumigants containing carbon tetrachloride were in common use by the grain storage industry to preserve grain in their facilities. In 1997, trace to low levels of carbon tetrachloride (below the maximum contamination level [MCL] of 5.0 μg/L) were detected in three private wells near the former grain storage facility at Inman, as part of a statewide USDA private well sampling program that was implemented by the Kansas Department of Health and Environment (KDHE) near former CCC/USDA facilities. No public water supply wells were identified in 1998 by the KDHE within 1 mi of the town. Carbon tetrachloride is the contaminant of primary concern at sites associated with grain storage operations. To determine whether the former CCC/USDA facility at Inman is a potential contaminant source and its possible relationship to the contamination in groundwater, the CCC/USDA agreed to conduct investigations at Inman. The investigations were performed by the Environmental Science Division of Argonne National Laboratory in accordance with the Intergovernmental Agreement between the KDHE and the Farm Service Agency of the USDA. Argonne, on behalf of the CCC/USDA, developed a Work Plan (Argonne 2007) and subsequently a Summary of Investigation Results and Proposed Work Plan (Appendix A) for a phased site investigation. The proposed work was approved by the KDHE (2007, 2011). The investigations were conducted from November 2009 to September 2011, as proposed in the two work plans. This report presents the findings of the 2009-2011 investigations at Inman.
75 FR 11840 - Biorefinery Assistance Program
2010-03-12
... 0570-0055. Nondiscrimination Statement USDA prohibits discrimination in all its programs and activities..., sex, marital status, familial status, parental status, religion, sexual orientation, genetic... of discrimination, write to USDA, Director, Office of Civil Rights, 1400 Independence Avenue, SW...
Management of wildlife causing damage at Argonne National Laboratory-East, DuPage County, Illinois
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-04-01
The DOE, after an independent review, has adopted an Environmental Assessment (EA) prepared by the US Department of Agriculture (USDA) which evaluates use of an Integrated Wildlife Damage Management approach at Argonne National Laboratory-East (ANL-E) in DuPage County, Illinois (April 1995). In 1994, the USDA issued a programmatic Environmental Impact Statement (EIS) that covers nationwide animal damage control activities. The EA for Management of Wildlife Causing Damage at ANL-E tiers off this programmatic EIS. The USDA wrote the EA as a result of DOE`s request to USDA to prepare and implement a comprehensive Wildlife Management Damage Plan; the USDA has authority for animal damage control under the Animal Damage Control Act of 1931, as amended, and the Rural Development, Agriculture and Related Agencies Appropriations Act of 1988. DOE has determined, based on the analysis in the EA, that the proposed action does not constitute a major Federal action significantly affecting the quality of the human environment within the meaning of the National Environmental Policy Act of 1969 (NEPA). Therefore, the preparation of an EIS is not required. This report contains the Environmental Assessment, as well as the Finding of No Significant Impact (FONSI).
Tripartite symbiosis of Sophora tomentosa, rhizobia and arbuscular mycorhizal fungi.
Toma, Maíra Akemi; Soares de Carvalho, Teotonio; Azarias Guimarães, Amanda; Martins da Costa, Elaine; Savana da Silva, Jacqueline; de Souza Moreira, Fatima Maria
Sophora tomentosa is a pantropical legume species with potential for recovery of areas degraded by salinization, and for stabilization of sand dunes. However, few studies on this species have been carried out, and none regarding its symbiotic relationship with beneficial soil microorganisms. Therefore, this study aimed to evaluate the diversity of nitrogen-fixing bacteria isolated from nodules of Sophora tomentosa, and to analyze the occurrence of colonization of arbuscular mycorrhizal fungi on the roots of this legume in seafront soil. Thus, seeds, root nodules, and soil from the rhizosphere of Sophora tomentosa were collected. From the soil samples, trap cultures with this species were established to extract spores and to evaluate arbuscular mycorhizal fungi colonization in legume roots, as well as to capture rhizobia. Rhizobia strains were isolated from nodules collected in the field or from the trap cultures. Representative isolates of the groups obtained in the similarity dendrogram, based on phenotypic characteristics, had their 16S rRNA genes sequenced. The legume species showed nodules with indeterminate growth, and reddish color, distributed throughout the root. Fifty-one strains of these nodules were isolated, of which 21 were classified in the genus Bacillus, Brevibacillus, Paenibacillus, Rhizobium and especially Sinorhizobium. Strains closely related to Sinorhizobium adhaerens were the predominant bacteria in nodules. The other genera found, with the exception of Rhizobium, are probably endophytic bacteria in the nodules. Arbuscular mycorrhizal fungi was observed colonizing the roots, but arbuscular mycorhizal fungi spores were not found in the trap cultures. Therefore Sophora tomentosa is associated with both arbuscular mycorhizal fungi and nodulating nitrogen-fixing bacteria. Copyright © 2017 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.
... Your Healthy Eating Style Choose a variety of foods and beverages to build your own healthy eating style. Include ... and http: / / www. fns. usda. gov/ wic/ guidance Food and Nutrition Service FNS-458 Revised December 2016 USDA is an ...
75 FR 23226 - Trade Adjustment Assistance for Farmers
2010-05-03
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers AGENCY: Foreign Agricultural Service, USDA. ACTION: Notice. The Administrator, Foreign Agricultural... Web site for the Trade Adjustment Assistance for Farmers program. The URL is http://www.fas.usda.gov...
7 CFR 1.123 - Specific exemptions.
2010-01-01
... Compliance Review Cases, USDA/AMS-11. Agricultural Stabilization and Conservation Service EEO Complaints and... Services Programs—Animal Welfare and Horse Protection Regulatory Actions, USDA/APHIS-4. Farmers Home... Meat and Poultry Inspection Program—Slaughter, Processing and Allied Industries Compliance Records...
2012-02-01
..., Ineligibility and Voluntary Exclusion;'' AD-1049, ``Certification Regarding Drug-Free Workplace Requirements.... Nondiscrimination Statement The U.S. Department of Agriculture (USDA) prohibits discrimination in all its programs... of discrimination, write to USDA, Assistant Secretary for Civil Rights, Office of the Assistant...
77 FR 64099 - Notice of Request for Extension of a Currently Approved Information Collection
2012-10-18
.... Nondiscrimination Statement The U.S. Department of Agriculture (USDA) prohibits discrimination in all its programs..., sex, marital status, familial status, parental status, religion, sexual orientation, genetic... of discrimination write to USDA, Director, Office of Civil Rights, 1400 Independence Avenue SW...
75 FR 18145 - Eastern Arizona Counties Resource Advisory Committee
2010-04-09
... DEPARTMENT OF AGRICULTURE Forest Service Eastern Arizona Counties Resource Advisory Committee AGENCY: Forest Service, USDA. ACTION: Notice of meeting. SUMMARY: The Eastern Arizona Counties Resource... Rivera, Coordinator, Eastern Arizona Counties Resource Advisory Committee, c/o Forest Service, USDA, P.O...
Cheng, Jiujun; Nordeste, Ricardo; Trainer, Maria A; Charles, Trevor C
2017-01-01
Development of different PHAs as alternatives to petrochemically derived plastics can be facilitated by mining metagenomic libraries for diverse PHA cycle genes that might be useful for synthesis of bio-plastics. The specific phenotypes associated with mutations of the PHA synthesis pathway genes in Sinorhizobium meliloti and Pseudomonas putida, allows the use of powerful selection and screening tools to identify complementing novel PHA synthesis genes. Identification of novel genes through their function rather than sequence facilitates the functional proteins that may otherwise have been excluded through sequence-only screening methodology. We present here methods that we have developed for the isolation of clones expressing novel PHA metabolism genes from metagenomic libraries.
Nordeste, Ricardo F; Trainer, Maria A; Charles, Trevor C
2010-01-01
Development of different PHAs as alternatives to petrochemically derived plastics can be facilitated by mining metagenomic libraries for diverse PHA cycle genes that might be useful for synthesis of bioplastics. The specific phenotypes associated with mutations of the PHA synthesis pathway genes in Sinorhizobium meliloti allows for the use of powerful selection and screening tools to identify complementing novel PHA synthesis genes. Identification of novel genes through their function rather than sequence facilitates finding functional proteins that may otherwise have been excluded through sequence-only screening methodology. We present here methods that we have developed for the isolation of clones expressing novel PHA metabolism genes from metagenomic libraries.
Final report for DOE grant FG02-06ER15805
Energy Technology Data Exchange (ETDEWEB)
Gage, Daniel
2012-05-31
DOE funding was used to investigate the role of the phosphotransferase system (PTS) in the symbiotic, nodulating bacterium Sinorhizobium meliloti. This system is well studied in several bacterial species. However, it's organization and function in S. meliloti is substantially different than in the those other, well-studied bacteria. The S. meliloti PTS, through our DOE-funded work, has become a model for how this important signal transduction system works in the a-proteobacteria. We have found that the PTS is relatively simple, used for only signal transduction and not transport, and is involved in regulation of carbon metabolism in response to carbon availability and nitrogen availability.
75 FR 39910 - Prince William Sound Resource Advisory Committee; Meeting
2010-07-13
... DEPARTMENT OF AGRICULTURE Forest Service Prince William Sound Resource Advisory Committee; Meeting AGENCY: Forest Service, USDA. ACTION: Notice of meeting. SUMMARY: The Prince William Sound Resource..., Anchorage, Alaska 99503. Send written comments to Prince William Sound Resource Advisory Committee, c/o USDA...
2010-02-03
... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-FV-09-0072] Notice of Funds...) AGENCY: Agricultural Marketing Service, USDA. ACTION: Notice. SUMMARY: The Agricultural Marketing Service (AMS) announces the availability, of $55,000,000 in grant funds, less USDA administrative costs, to...
77 FR 75606 - Submission for OMB Review; Comment Request
2012-12-21
... information is used only to identify students for the USDA 1994 Tribal Scholarship Award. Description of... Native Educational Opportunities and Strengthening Tribal Colleges and Universities. The USDA/1994 Tribal... through qualified American Indian or Alaska Native students hired utilizing Indian Preference. This...
2013-11-19
... DEPARTMENT OF AGRICULTURE Forest Service Lake Tahoe Basin Management Unit, California, Heavenly Mountain Resort Epic Discovery Project AGENCY: Lake Tahoe Basin Management Unit, Forest Service, USDA...: The Epic Discovery Project is intended to enhance summer activities in response to the USDA Forest...
2013-06-18
...-Discrimination Statement The U.S. Department of Agriculture (USDA) prohibits discrimination against its customers..., gender identity, religion, reprisal, and where applicable, political beliefs, marital status, familial or... activities.) If you wish to file a Civil Rights program complaint of discrimination, complete the USDA...
75 FR 61121 - Trade Adjustment Assistance for Farmers
2010-10-04
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers... Farmers Program Review Committee, comprised of representatives from USDA's Office of the Chief Economist... Certified As Eligible For TAA For Farmers Contact: Your local USDA Farm Service Agency county office. FOR...
75 FR 59683 - Trade Adjustment Assistance for Farmers
2010-09-28
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers... Adjustment Assistance for Farmers Program Review Committee, comprised of representatives from USDA's Office... for Farmers Program Staff, Office of Trade Programs, FAS, USDA; or by phone at (202) 720-0638, or (202...
75 FR 41432 - Trade Adjustment Assistance for Farmers
2010-07-16
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers... Service and reviewed by the TAA for Farmers Review Committee, comprised of representatives from USDA's.... Producers Certified as Eligible for TAA for Farmers' Program Should Contact: USDA, Farm Service Agency (at...
Development of the Wind Erosion Prediction System (WEPS) was officially inaugurated in 1985 by United States Department of Agriculture-Agricultural Research Service (USDA-ARS) scientists in response to customer requests, particularly those coming from the USDA Soil Conservation Service (SCS), for im...
78 FR 65582 - Single Family Housing Direct Loan Program
2013-11-01
.... Department of Agriculture (USDA) prohibits discrimination against its customers, employees, and applicants for employment on the bases of race, color, national origin, age, disability, sex, gender identity....) If you wish to file a Civil Rights program complaint of discrimination, complete the USDA Program...
2011-07-15
... Statement ``The U.S. Department of Agriculture (USDA) prohibits discrimination in all its programs and... status, familial status, parental status, religion, sexual orientation, genetic information, political... contact USDA's TARGET Center at (202) 720-2600 (voice and TDD). To file a complaint of discrimination...
2013-04-23
.... Department of Agriculture (USDA) prohibits discrimination in all its programs and activities on the basis of race, color, national origin, gender, religion, age, disability, political beliefs, sexual orientation... complaint of discrimination, write USDA, Office of the Assistant Secretary for Civil Rights, 1400...
Developing a low cortisol responsive line of channel catfish, Ictalurus punctatus
Nagaraj G. Chatakondi and Brian C. Peterson USDA ARS Warmwater Aquaculture Research Unit, 141 Experiment Station Road, Stoneville, MS 38776. nagaraj.chatakondi@ars.usda.gov Channel catfish, Ictalurus punctatus is the most important farm-raised aquacultured species in the USA. Stressors in aquacultu...
USDA Flax fiber utilization research
The United States is pursuing natural fibers as sustainable, environmentally friendly sources for a variety of industrial applications. Flax (Linum usitatissimum L.) fiber offers many possibilities towards this goal. Research on flax fiber production, processing, and standards development is urgen...
76 FR 77963 - Oglethorpe Power Corporation; Proposed Biomass Power Plant
2011-12-15
... Service Oglethorpe Power Corporation; Proposed Biomass Power Plant AGENCY: Rural Utilities Service, USDA... related to possible financial assistance to Oglethorpe Power Corporation's (Oglethorpe) for the... online at the following Web site: http://www.rurdev.usda.gov/UWP-OglethorpePower.html and at the: Warren...
76 FR 9641 - Delegation of Authority to Under Secretary for Research, Education, and Economics
2011-02-22
... Secretary for Research, Education, and Economics AGENCY: Office of the Secretary, USDA. ACTION: Final rule... Secretary for Research, Education, and Economics for requests for the United States Department of... for Research, Education, and Economics as USDA's authorized signatory for requests for all 2-year...
7 CFR 354.4 - User fees for certain domestic services.
2010-01-01
... Directors, USDA, APHIS, Plant Protection and Quarantine and the States for which they are responsible, may be obtained from the Animal and Plant Health Inspection Service, Plant Protection and Quarantine... their agents, must contact the Regional Director, USDA, APHIS, Plant Protection and Quarantine, 5 for...
2012-11-06
... Stockyards Administration, USDA. ACTION: Notice; correction. SUMMARY: The USDA, Grain Inspection, Packers and Stockyards Administration published a document in the Federal Register on October 31, 2012, concerning... Stockyards Administration. [FR Doc. 2012-27079 Filed 11-5-12; 8:45 am] BILLING CODE 3410-KD-P ...
75 FR 48931 - Trade Adjustment Assistance for Farmers
2010-08-12
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers... assistance and cash benefits. FOR FURTHER INFORMATION CONTACT: Trade Adjustment Assistance for Farmers....usda.gov ; or visit the TAA for Farmers' Web site: www.fas.usda.gov/itp/taa . Dated: July 30, 2010...
75 FR 48642 - Trade Adjustment Assistance for Farmers
2010-08-11
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers... benefits. FOR FURTHER INFORMATION CONTACT: Trade Adjustment Assistance for Farmers Program Staff, FAS, USDA... the TAA for Farmers' Web site: http://www.fas.usda.gov/itp/taa . Dated: July 30, 2010. John D. Brewer...
75 FR 49886 - Trade Adjustment Assistance for Farmers
2010-08-16
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers... INFORMATION CONTACT: Trade Adjustment Assistance for Farmers Program Staff, FAS, USDA by phone: (202) 720-0638... for Farmers' Web site: http://www.fas.usda.gov/itp/taa . Dated: August 3, 2010. Suzanne Hale, Acting...
2013-08-09
... Nondiscrimination Statement The U.S. Department of Agriculture (USDA) prohibits discrimination in all its programs and activities on the basis of race, color, national origin, gender, religion, age, disability... TTY). To file a written complaint of discrimination, write USDA, Office of the Assistant Secretary for...
2011-01-20
..., Ineligibility and Voluntary Exclusion;'' AD-1049, ``Certification Regarding Drug-Free Workplace Requirements... (USDA) prohibits discrimination in all its programs and activities on the basis of race, color, national...) 720-2600 (voice and TDD). To file a complaint of discrimination write to USDA, Director, Office of...
75 FR 8294 - Submission for OMB Review; Comment Request
2010-02-24
... voluntary one-time electronic self-registration to obtain an eAuthentication account for each USDA Agency... information collected through the electronic self-registration process is necessary to enable the electronic... sign-on capability for USDA applications, management of user credentials, and verification of identify...
2010-06-15
... Meeting AGENCIES: U.S. Department of Agriculture (USDA), Food, Nutrition and Consumer Services (FNCS) and... Public Health and Science (OPHS). ACTION: Notice. SUMMARY: The Department of Agriculture (USDA) and the... the Dietary Guidelines Advisory Committee, Center for Nutrition Policy and Promotion, U.S. Department...
78 FR 13014 - Submission for OMB Review; Comment Request
2013-02-26
... a currently valid OMB control number. Animal and Plant Health Inspection Service Title: Submission... Agriculture (USDA) to regulate the humane care and handling of most warm-blooded animals, including marine... private citizens requesting a Federal law to protect such animals. USDA, Animal and Plant Health...
78 FR 34978 - Amendment to Notice of Funding Availability for the Rural Energy for America Program
2013-06-11
.... Nondiscrimination Statement USDA prohibits discrimination in all its programs and activities on the basis of race..., parental status, religion, sexual orientation, genetic information, political beliefs, reprisal, or because... at (202) 720-2600 (voice and TDD). To file a complaint of discrimination, write to: USDA, Assistant...
78 FR 26747 - Amendment to Notice of Funding Availability for the Rural Energy for America Program
2013-05-08
... Statement USDA prohibits discrimination in all its programs and activities on the basis of race, color... status, religion, sexual orientation, genetic information, political beliefs, reprisal, or because all or...) 720-2600 (voice and TDD). To file a complaint of discrimination, write to: USDA, Assistant Secretary...
2013-09-26
... Agriculture (USDA) prohibits discrimination in all its programs and activities on the basis of race, color, national origin, gender, religion, age, disability, political beliefs, sexual orientation, and marital or... discrimination, write USDA, Office of the Assistant Secretary for Civil Rights, 1400 Independence Avenue SW...
78 FR 59338 - Notice of Funds Availability Under the Rural Microentrepreneur Assistance Program
2013-09-26
.... Department of Agriculture (USDA) prohibits discrimination against its customers, employees, and applicants..., sexual orientation, or all or part of an individual's income is derived from any public assistance....) If you wish to file a Civil Rights program complaint of discrimination, complete the USDA Program...
PCDD/Fs, PCBs, and PBDEs in catfish from U.S. Commerce
The U.S. Department of Agriculture (USDA) is responsible for the safety of meat, poultry, egg products, and farm-raised catfish marketed in the United States. As such the USDA conducts statistical surveys to determine chemical residue concentrations in these domestic products. Little background data...
Compendium of fruit fly host information (CoFFHI), edition 3.0
The Compendium of Fruit Fly Host Information (CoFFHI), edition 3.0 (available at: https://coffhi.cphst.org/), developed through collaborative efforts of scientists in USDA-APHIS, USDA-ARS, and the Center for Integrated Pest Management (CIPM) of North Carolina State University (NCSU), provides centra...
Nutrient analysis of the Beef Alternative Merchandising cuts.
Desimone, T L; Acheson, R A; Woerner, D R; Engle, T E; Douglass, L W; Belk, K E
2013-03-01
The objective of this study was to generate raw and cooked nutrient composition data to identify Quality Grade differences in proximate values for eight Beef Alternative Merchandising (BAM) cuts. The data generated will be used to update the nutrient data in the USDA National Nutrient Database for Standard Reference (SR). Beef Rib, Oven-Prepared, Beef Loin, Strip Loin, and Beef Loin, Top Sirloin Butt subprimals were collected from a total of 24 carcasses from four packing plants. The carcasses were a combination of USDA Yield Grades 2 (n=12) and 3 (n=12), USDA Quality Grades upper two-thirds Choice (n=8), low Choice (n=8), and Select (n=8), and two genders, steer (n=16) and heifer (n=8). After aging, subprimals were fabricated into the BAM cuts, dissected, and nutrient analysis was performed. Sample homogenates from each animal were homogenized and composited for analysis of the following: proximate analysis, long chain and trans-fatty acids, conjugated linoleic acid, total cholesterol, vitamin B-12, and selenium. This study identified seven BAM cuts from all three Quality Grades that qualify for USDA Lean; seven Select cuts that qualify for USDA Extra Lean; and three Select cuts that qualify for the American Heart Association's Heart Healthy Check. Copyright © 2012 Elsevier Ltd. All rights reserved.
14 CFR 257.4 - Unfair and deceptive practice.
2010-01-01
... violation of 49 U.S.C. 41712 unless, in conjunction with such holding out or sale, carriers and ticket... Unfair and deceptive practice. The holding out or sale of scheduled passenger air transportation...
40 CFR 180.257 - Chloroneb; tolerances for residues.
2010-07-01
..., sugar, tops 0.2 Cowpea, forage 2.0 Cowpea, hay 2.0 Cattle, fat 0.2 Cattle, meat 0.2 Cattle, meat byproducts 0.2 Cotton, gin byproducts 1.0 Cotton, undelinted seed 0.2 Goat, fat 0.2 Goat, meat 0.2 Goat, meat byproducts 0.2 Hog, fat 0.2 Hog, meat 0.2 Hog, meat byproducts 0.2 Horse, fat 0.2 Horse, meat 0.2 Horse, meat...
Lifescience Database Archive (English)
Full Text Available h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanxcknldw*nyhlgsrrf*qh*kc*sqnpgqrrxxxxspx infrw*tirr...rystrstkinlcw*tirrwsxsf*lqhskgihspfssxik rxyanxcknxhw*nhhlxg*r*x*h*kc*s*nsrqrryptrsxkinfrw*tirxwsyxl* lqhskgihsplgsqikrxxanx
14 CFR 257.6 - Effective and compliance dates.
2010-01-01
... the selling carrier is not the transporting carrier and (ii) Of the transporting carrier's identity... transportation involving a code-share arrangement of the transporting carrier's corporate name and any other name...
24 CFR 203.257 - Creation of the contract.
2010-04-01
... issuance of a Mortgage Insurance Certificate, from the date of the endorsement of the credit instrument, or... SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Endorsement and Contract of Insurance...
Lifescience Database Archive (English)
Full Text Available vp*thvqiqpvv*tlqsmlmiiihvl*mlvpnqqvshipq*m*mittnvqlmhvpkkvv* lilqstlmitmpvqlilvhhqxvfptpqsivmikxpvqlihvqiqlv...v*ilqxxvtiiih vlxilamt*lvvxilqsmlmiixhvpsmpvlnqqvxlipqsmxmiitnvqlixvpkkvv* lilhsilmitm
75 FR 43485 - Trade Adjustment Assistance for Farmers
2010-07-26
... Service Trade Adjustment Assistance for Farmers AGENCY: Foreign Agricultural Service, USDA. ACTION: Notice... cash benefits. FOR FURTHER INFORMATION CONTACT: Trade Adjustment Assistance for Farmers Staff, FAS... visit the TAA for Farmers' Web site: http://www.fas.usda.gov/itp/taa . Dated: July 14, 2010. John D...
77 FR 59888 - General Conference Committee of the National Poultry Improvement Plan
2012-10-01
... Improvement Plan AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Notice of intent to renew... the General Conference Committee of the National Poultry Improvement Plan (Committee) for a 2year... Improvement Plan, VS, APHIS, USDA, 1506 Klondike Road, Suite 300, Conyers, GA 30094; (770) 922-3496...
75 FR 43142 - United States Standards for Grades of Refried Beans
2010-07-23
...] United States Standards for Grades of Refried Beans AGENCY: Agricultural Marketing Service, USDA. ACTION... comments on the possible establishment of voluntary United States Standards for Grades of Refried Beans... industry requested that USDA develop grade standards for canned refried beans to be used by the industry...
77 FR 26735 - Information Collection Activity; Comment Request
2012-05-07
... collected through the USDA Data Collection System. The data collected via the Broadband Operating Report is... collected via the operating reports provides financial information to ensure loan security [[Page 26736... Operating Reports with the Agency using the USDA Data Collection System. RUS Form 674, accompanied by a...
76 FR 81910 - Abolishment of Privacy Act System of Records
2011-12-29
... Program Manager, USDA, Forest Service, Office of Safety and Occupational and Health, 1400 Independence... Management Handbook (FSH) 6209.11. This system is abolished and removed from the inventory of the USDA System... DEPARTMENT OF AGRICULTURE Office of the Secretary Abolishment of Privacy Act System of Records...
2012-07-24
... Agriculture (USDA), and the Agricultural Marketing Service (AMS), are sponsoring a public meeting on August 30... Session of the CCFFV Contact: Dorian Lafond, Agricultural Marketing Service, Fruits and Vegetables... (Braille, large print, or audiotape.) should contact USDA's Target Center at 202-720-2600 (voice and TTY...
78 FR 7266 - Alpha-Cypermethrin; Pesticide Tolerances
2013-02-01
... exposure, EPA used food consumption information from the U.S. Department of Agriculture (USDA) 1994-1996... data from the U.S. Department of Agriculture/National Agricultural Statistics Service (USDA/NASS... > 6 years. For exposures from birth to Based on an evaluation of over 70 guideline toxicity studies...
Abell, Caitlyn E; Stalder, Kenneth J; Hendricks, Haven B; Fitzgerald, Robert F
2012-07-01
The objectives of this study were to develop a prediction equation for carcass knife-separable lean within and across USDA cull sow market weight classes (MWC) and to determine carcass and individual primal cut knife separable lean content from cull sows. There were significant percent lean and fat differences in the primal cuts across USDA MWC. The two lighter USDA MWC had a greater percent carcass lean and lower percent fat compared to the two heavier MWC. In general, hot carcass weight explained the majority of carcass lean variation. Additionally, backfat was a significant variation source when predicting cull sow carcass lean. The findings support using a single lean prediction equation across MWC to assist processors when making cull sow purchasing decisions and determine the mix of animals from various USDA MWC that will meet their needs when making pork products with defined lean:fat content. Copyright © 2012 Elsevier Ltd. All rights reserved.
Age and growth of Labeo gonius (Cyprinidae) in Kali river, Uttar Pradesh, India
Digital Repository Service at National Institute of Oceanography (India)
Chatterji, A.
stream_size 4 stream_content_type text/plain stream_name Asian_Fish_Sci_5_257.pdf.txt stream_source_info Asian_Fish_Sci_5_257.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
75 FR 45092 - Trade Adjustment Assistance for Farmers
2010-08-02
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers... Farmers Program Staff, FAS, USDA by phone: (202) 720-0638 or (202) 690- 0633; or by e-mail at: [email protected] ; or visit the TAA for Farmers' Web site: http://www.fas.usda.gov/itp/taa . Dated...
75 FR 43140 - Trade Adjustment Assistance for Farmers
2010-07-23
... DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers... Assistance for Farmers Staff, FAS, USDA, by phone: (202) 720-0638, or (202) 690-0633; or by e-mail: [email protected] ; or visit the TAA for Farmers' Web site: http://www.fas.usda.gov/itp/taa . Dated...
Using a phosphorus loss model to evaluate the Kentucky phosphorus index
U.S. Department of Agriculture’s Natural Resource Conservation Service (USDA-NRCS) has recently revised its 590 Nutrient Management Conservation Standard. As part of this revision, USDA-NRCS is requiring states to test the accuracy of their phosphorus (P) index using either measured P loss data or s...
75 FR 17682 - Notice of Request for an Extension of a Currently Approved Information Collection
2010-04-07
... have proven to be a quick and inexpensive way for AMS to get customer opinions and feedback about USDA... use of the customer opinion postcards to get voluntary customer feedback on various products each year... currently approved information collection in support of customer-focused improvement initiatives for USDA...
Introduction to HACCP Deana R. Jones, Ph.D. Egg Safety and Quality Research Unit USDA-Agricultural Research Service Russell Research Center Athens, GA Deana.Jones@ars.usda.gov HACCP is an acronym for Hazard Analysis and Critical Control Point and was initially developed by the Pillsbury Company a...
2011-04-01
...), and the Fruit and Vegetable Programs of the USDA Agricultural Marketing Service (AMS), are sponsoring... USDA's Target Center at (202) 720-2600 (voice and TTY). To file a written complaint of discrimination... able to provide information to a much broader, more diverse audience. In addition, FSIS offers an e...
2011-10-07
... break-even basis? The activities to be undertaken subject to this notice include: [squ] Conducting a... Analyst, Office of Research and Analysis, Food and Nutrition Service, USDA, 3101 Park Center Drive, Room... Analysis, Food and Nutrition Service/USDA, 3101 Park Center Drive, Room 1004, Alexandria, VA 22302; Fax...
2011-10-12
... Statement USDA prohibits discrimination in all its programs and activities on the basis of race, color... discrimination, write USDA, Office of the Assistant Secretary for Civil Rights, 1400 Independence Avenue, SW..., women, and persons with disabilities, are aware of this notice, FSIS will announce it on-line through...
75 FR 32158 - Information Collection; SRS Publications Evaluation Card
2010-06-07
... facilitate entry into the building. Additionally, the public may inspect comments received on the World Wide Web, at http://www.srs.fs.usda.gov/pubeval . FOR FURTHER INFORMATION CONTACT: Louise Wilde, Science... should be addressed to Forest Service, USDA, Southern Research Station, Science Delivery Group, 200 W.T...
Dioxin, furan, PCB, and PBDE levels in U.S. foods: Survey trends and consumer exposure
The U.S. Department of Agriculture, Agricultural Research Service (USDA-ARS) and Food Safety and Inspection Service (USDA-FSIS) have conducted statistical surveys for dioxins (PCDDs, PCDFs, and PCBs) and polybrominated diphenyl ethers every 5 years since the mid-1990s (mid-1990s, 2002-3, 2007-8). I...
75 FR 22736 - Notice of Request for Applications for the Veterinary Medicine Loan Repayment Program
2010-04-30
... (RFA) at http://www.nifa.usda.gov/vmlrp . DATES: The FY 2010 Veterinary Medicine Loan Repayment Program (VMLRP) application package has been made available at http://www.nifa.usda.gov/vmlrp and applications... http://www.nslds.ed.gov . Individuals who consolidated their DVM loans with non-educational loans or...
2013-11-08
... States Department of Agriculture (USDA) granted any explicit prior sanction or approval for any use of... Agriculture (USDA) National Nutrition Database for Standard Reference, Release 23, 2010 (Internet address.... Vrijkotte, et al., ``Maternal n-3, n-6, and Trans Fatty Acid Profile Early in Pregnancy and Term Birth...
African Journals Online (AJOL)
Items 251 - 257 of 257 ... ... technology in accessing maternal and child health information in Nigeria, Abstract. Oluwaseun I. Obasola, Iyabo M. Mabawonku. Vol 17, No 1 (2007), Workplace, Biographical and Motivation Factors Affecting Organisational Commitment of Records Officers in Nigerian Federal Universities, Abstract.
Hively, W. Dean; Devereux, Olivia H.; Claggett, Peter
2013-01-01
In response to the Executive Order for Chesapeake Bay Protection and Restoration (E.O. #13508, May 12, 2009), the U.S. Geological Survey (USGS) took on the task of acquiring and assessing agricultural conservation practice data records for U.S. Department of Agriculture (USDA) programs, and transferred those datasets in aggregated format to State jurisdictional agencies for use in reporting conservation progress to the Chesapeake Bay Program Partnership (CBP Partnership). Under the guidelines and regulations that have been developed to protect and restore water-quality in the Chesapeake Bay, the six State jurisdictions that fall within the Chesapeake Bay watershed are required to report their progress in promoting agricultural conservation practices to the CBP Partnership on an annual basis. The installation and adoption of agricultural best management practices is supported by technical and financial assistance from both Federal and State conservation programs. The farm enrollment data for USDA conservation programs are confidential, but agencies can obtain access to the privacy-protected data if they are established as USDA Conservation Cooperators. The datasets can also be released to the public if they are first aggregated to protect farmer privacy. In 2012, the USGS used its Conservation Cooperator status to obtain implementation data for conservation programs sponsored by the USDA Natural Resources Conservation Service (NRCS) and the USDA Farm Service Agency (FSA) for farms within the Chesapeake Bay watershed. Three jurisdictions (Delaware, Pennsylvania, and West Virginia) used the USGS-provided aggregated dataset to report conservation progress in 2012, whereas the remaining three jurisdictions (Maryland, New York, and Virginia) used jurisdictional Conservation Cooperator Agreements to obtain privacy-protected data directly from the USDA. This report reviews the status of conservation data sharing between the USDA and the various jurisdictions, discusses the
Directory of Open Access Journals (Sweden)
Patrícia Baston Barretti
2009-01-01
Full Text Available Quarenta isolados bacterianos endofíticos de plantas sadias de tomateiro foram avaliados quanto à sua potencialidade como agentes de biocontrole de doenças do tomateiro. Foi realizada, em casa de vegetação, uma seleção massal utilizando-se Pseudomonas syringae pv. tomato e Alternaria solani, como patógenos desafiantes. Com base na média do número de lesões por planta, quatro isolados foram selecionados como potenciais agentes de biocontrole dessas enfermidades fúngica e bacteriana do tomateiro. Esses isolados foram identificados, por meio do sequenciamento do gene 16S do DNA ribossômico, como Acinetobacter johnsonii (UFV-E05, Serratia marcescens (UFV-E13, Sinorhizobium sp. (UFV-E25 e Bacillus megaterium (UFV-E26. Os mesmos isolados selecionados para o biocontrole também foram avaliados quanto à sua capacidade de promover o crescimento em plantas e somente S. marcescens (UFV-E13 proporcionou aumento na altura das plantas.Forty isolates of endophytic bacteria obtained from healthy tomato plants were tested for their potential as biocontrol agents of tomato diseases. A massal screening was performed at greenhouse using Pseudomonas syringae pv. tomato and Alternaria solani as challenging pathogens. Based on the average number of lesions per plant, four isolates were selected as potential agents of biocontrol of these tomato diseases caused by fungi and bacteria. These isolates were identified by 16S ribosomal DNA sequence analysis as Acinetobacter johnsonii (UFV-E05, Serratia marcescens (UFV-E13, Sinorhizobium sp. (UFV-E25 and Bacillus megaterium (UFV-E26. The four endophytes selected for biocontrol were also evaluated for their ability of promoting plant growth and only S. marcescens (UFV-E13 presented increase in the height of the plants.
Agricultural land use change in the Northeast
The USDA Census of Agriculture (http://www.agcensus.usda.gov/) provides county-level estimates of farm numbers, land use area and livestock and crop production every five years. In 2007, only eight of the 299 counties that make up the twelve Northeastern states had no agricultural land use. About 20...
2013-08-27
... Chief Economist, USDA. ACTION: Notice of availability for public comment. SUMMARY: The U.S. Department... Change Program Office (CCPO) operates within the Office of the Chief Economist at USDA and functions as...). Dated: August 20, 2013. Joseph Glauber, Chief Economist. [FR Doc. 2013-20701 Filed 8-26-13; 8:45 am...
75 FR 56502 - National Advisory Committee on Meat and Poultry Inspection
2010-09-16
... Advisory Committee on Meat and Poultry Inspection AGENCY: Food Safety and Inspection Service, USDA. ACTION... and Poultry Inspection (NACMPI) will hold a public meeting on September 29-30, 2010, to review and... disks or CD-ROMs: Send to National Advisory Committee on Meat and Poultry Inspection, USDA, FSIS, 14th...
Breaking the salmonella/chicken connection
International Nuclear Information System (INIS)
Kinzel, B.
1990-01-01
The use of gamma radiation of poultry to reduce the risk of foodborne salmonellosis is discussed with reference to surveys carried out by USDA's Food Safety and Inspection Service and research carried out at the USDA-ARS Food Safety Research Unit at the Eastern Region Research Center, Philadelphia, PA, USA
The Hazard Analysis and Critical Control Point (HACCP) food safety inspection program is utilized by both USDA Food Safety Inspection Service (FSIS) and FDA for many of the products they regulate. This science-based program was implemented by the USDA FSIS to enhance the food safety of meat and pou...
2010-08-06
..., 601 Business Loop 70 West, Parkade Center, Suite 235, Columbia, MO 65203. (573) 876-9321. [email protected]mo.usda.gov . Montana John Guthmiller, USDA Rural Development, 900 Technology Blvd., Unit 1, Suite B... received under the other two REAP notices. Conversely, the Agency may, at its discretion, move money for...
Physical, Chemicals and Flavors of Some Varieties of Arabica Coffee
Directory of Open Access Journals (Sweden)
Yusianto .
2014-08-01
Full Text Available Export of Arabica coffee was 28,100 tons/year or 8.28% total export of Indonesian coffee, most of them are specialty coffee. Beside their origin, variety and determine the of physical, chemical and flavors characters. The promising clones or varieties i.e. BP 416A, BP 418A, BP 430A, BP 431A, BP 432A, BP 507A, BP 508A, BP 509A, BP 511A, BP 513A, BP 516A, BP 517A and BP 518A still not be determined their quality This research was conducted to analyze their physicals, chemicals and flavors during 2 periods of harvesting (2004 and 2005, using AS 1, S 795 and USDA 762 as the control. Mature coffee berry was harvested, sorted manually, and depulped, cleaned manually and then fermented in plastic sacks during 36 hours. The fermented parchment was washed, and then sun dried, dehulled to get green coffee. Observations wre conducted on green coffee yield, husk content, color of green coffee, distribution of size, bulk density of green and roasted coffee, roasting characters, color of roasted beans, and pH, acidity and flavors. The results showed (a The lowest content of husk was BP 432A and the highest was USDA 762. The control varieties of AS 1, S 795 and USDA 762, showed husk content >15%, while those potential varieties were < 15% except BP 416A. (b Beans size >6,5 mm and more than 80% were BP 416A, BP 430A, BP 432A, BP 509A, P 88 and S 795. Green coffee of BP 430A, BP 432A and BP 509A were uniform, but S 795 was not uniform. AS 1 and BP 416A and P 88 was one group; S 795 was one group with BP 542A; BP 509 was a group with BP 432A; but BP4 30A and USDA 762 were the other groups. (c Green coffee of USDA 762 was the palest color, but BP 542A was the darkest color. AS 1 and S 795 were a group with all potential varieties, except BP 542A. (d Roasted coffee of USDA 762 was the palest color and AS 1 was the darkest. In this case, AS 1 was a group with BP 430A, BP 509A and P 88, while S 795 was a group with BP 416A and BP 432A, but USDA 762 and BP 542A were
Search Results | Page 26 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2015-04-07
Results 251 - 257 of 257 ... Putting open data into policy : lessons from leaders around the world. Open data as a policy area is not more than five years old. Published date. April 7, 2015. Journal articles. DEVELOPMENT AID CULTURAL CHANGE SOCIAL MOVEMENTS DEVELOPMENT STRATEGY ORGANIZATIONAL ...
7 CFR 1415.11 - Restoration agreements.
2010-01-01
... functions and values of the grassland to meet both USDA and the participant's objective and the purposes of... restoration agreement at that time to improve the functions and values with USDA approval and when funds are... grassland resources are adequate to meet the participant's objectives and the purposes of the program, or if...
75 FR 9573 - Minnkota Power Cooperative, Inc: Bemidji-Grand Rapids 230kV Transmission Project
2010-03-03
... Rapids 230kV Transmission Project AGENCY: Rural Utilities Service, USDA. ACTION: Notice of Availability... copy of the Draft EIS may be viewed online at the following Web sites: http://www.usda.gov/rus/water..., Longville, MN 56655; Walker Public Library, 207 4th St., Walker, MN 56484; Bovey Public Library--Village...
Evaluating the Effectiveness Of Postfire Rehabilitation Treatments
Peter R. Robichaud; Jan L. Beyers; Daniel G. Neary
2000-01-01
Spending on postfire emergency watershed rehabilitation has increased during the past decade. A west-wide evaluation of USDA Forest Service burned area emergency rehabilitation (BAER) treatment effectiveness was undertaken as a joint project by USDA Forest Service Research and National Forest System staffs. This evaluation covers 470 fires and 321 BAER projects, from...
The Eating Disorders Inventory among Asian American College Women.
Tsai, Grace; Gray, James
2000-01-01
Assesses the prevalence rate of bulimic disorders among 257 female Asian Americans from 18 to 30 years old. Finds that only two of the 257 women met the classification for bulimia nervosa. Contends that the findings illustrate the need for future research among culturally different populations. (CMK)
Virgilio, Alex; Raposo, Jorge L; Cardoso, Arnaldo A; Nóbrega, Joaquim A; Gomes Neto, José A
2011-03-23
The usefulness of molecular absorption was investigated for the determination of total sulfur (S) in agricultural samples by high-resolution continuum source flame molecular absorption spectrometry. The lines for CS at 257.595, 257.958, and 258.056 nm and for SH at 323.658, 324.064, and 327.990 nm were evaluated. Figures of merit, such as linear dynamic range, sensitivity, linear correlation, characteristic concentration, limit of detection, and precision, were established. For selected CS lines, wavelength-integrated absorbance equivalent to 3 pixels, analytical curves in the 100-2500 mg L(-1) (257.595 nm), 250-2000 mg L(-1) (257.958 nm), and 250-5000 mg L(-1) (258.056 nm) ranges with a linear correlation coefficient better than 0.9980 were obtained. Results were in agreement at a 95% confidence level (paired t test) with those obtained by gravimetry. Recoveries of S in fungicide and fertilizer samples were within the 84-109% range, and the relative standard deviation (n=12) was typically <5%.
Nuclear structure investigations of neutron deficient nuclei in the region Z=103 to 105
International Nuclear Information System (INIS)
Hessberger, F. P.; Hofmann, S.; Armbruster, P.; Muenzenberg, G.; Stodel, Ch.; Ackermann, D.; Lavrentev, A. Yu.; Popeko, A. G.; Yeremin, A. V.; Saro, S.; Leino, M.
1999-01-01
The isotopes 257,255 Rf, 257,256 Db, 253,252 Lr have been produced in bombardments of 207,208 Pb and 209 Bi target nuclei with 50 Ti and identified by their α-decay. New or improved decay data could be obtained. Analysis of the fine structure of the α-decay pattern of 257 Rf allowed the construction of a first tentative level scheme for the daughter nucleus 253 No and also the identification of a low lying high spin isomeric state, while from α-γ- coincidence measurements for 255 Rf a first tentative level scheme of the daughter nucleus 251 No was derived. For 257 Db we found that two nuclear levels decay by α-emission and populate also different levels in the daughter nucleus 253 Lr. The levels are produced by the reaction process. In bombardments of 209 Bi with 50 Ti at E CN *=26.4 MeV and 30.8 MeV the previously unknown isotopes 256 Db and 252 Lr were identified
Narożna, Dorota; Pudełko, Krzysztof; Króliczak, Joanna; Golińska, Barbara; Sugawara, Masayuki; Mądrzak, Cezary J; Sadowsky, Michael J
2015-08-15
It was previously demonstrated that there are no indigenous strains of Bradyrhizobium japonicum forming nitrogen-fixing root nodule symbioses with soybean plants in arable field soils in Poland. However, bacteria currently classified within this species are present (together with Bradyrhizobium canariense) as indigenous populations of strains specific for nodulation of legumes in the Genisteae tribe. These rhizobia, infecting legumes such as lupins, are well established in Polish soils. The studies described here were based on soybean nodulation field experiments, established at the Poznań University of Life Sciences Experiment Station in Gorzyń, Poland, and initiated in the spring of 1994. Long-term research was then conducted in order to study the relation between B. japonicum USDA 110 and USDA 123, introduced together into the same location, where no soybean rhizobia were earlier detected, and nodulation and competitive success were followed over time. Here we report the extra-long-term saprophytic survival of B. japonicum strains nodulating soybeans that were introduced as inoculants 20 years earlier and where soybeans were not grown for the next 17 years. The strains remained viable and symbiotically competent, and molecular and immunochemical methods showed that the strains were undistinguishable from the original inoculum strains USDA 110 and USDA 123. We also show that the strains had balanced numbers and their mobility in soil was low. To our knowledge, this is the first report showing the extra-long-term persistence of soybean-nodulating strains introduced into Polish soils and the first analyzing the long-term competitive relations of USDA 110 and USDA 123 after the two strains, neither of which was native, were introduced into the environment almost 2 decades ago. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
7 CFR 170.1 - To which farmers markets does this rule apply?
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false To which farmers markets does this rule apply? 170.1... MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS MARKET § 170.1 To which farmers markets does this rule apply? This rule applies only to the USDA Farmers Market at headquarters on...
Rehabilitation of Understocked Loblolly-Shortleaf Pine Stands - I. Recently Cutover Natural Stands
James B. Baker; Michael G. Shelton
1998-01-01
A 1988 USDA Forest Service report indicated that 22% (40 million ac) of the commercial timberland in the South was understocked (less than 60% stocking) with desirable tree species for timber production (USDA Forest Service 1988). The understocked stands are usually the result of past har-vesting practices, natural catastrophes, or regeneration fail-ures. Understocked...
2012-05-07
... its mind or cannot pay the cost (go to www.Regulations.gov to see entire comment). Two revisions have... OMB control number 0505-0023. E. Executive Order 12630 This rule has been reviewed in accordance with... property under the control of a USDA agency that is no longer required for that agency's or another USDA...
Gordon A. Enk; Stuart L. Hart
2003-01-01
A process was designed to evaluate the sustainability and potential marketability of USDA Forest Service patented technologies. The process was designed and tested jointly by the University of North Carolina, the University of Michigan, Partners for Strategic Change, and the USDA Forest Service. Two technologies were evaluated: a fiber-based product and a wood fiber/...
Matthew F. Winn; Philip A. Araman
2012-01-01
The USDA Forest Service Forest Inventory and Analysis (FIA) program collects crown foliage transparency estimates for individual trees on Phase 3 (P3) inventory plots. The FIA crown foliage estimate is obtained from a pair of perpendicular side views of the tree. Researchers with the USDA Forest Service Southern Research Station have developed a computer program that...
Wood bioenergy and soil productivity research
D. Andrew Scott; Deborah S. Page-Dumroese
2016-01-01
Timber harvesting can cause both short- and long-term changes in forest ecosystem functions, and scientists from USDA Forest Service (USDA FS) have been studying these processes for many years. Biomass and bioenergy markets alter the amount, type, and frequency at which material is harvested, which in turn has similar yet specific impacts on sustainable productivity....
Hydrological processes of reference watersheds in Experimental Forests, USA
Devendra Amatya; John Campbell; Pete Wohlgemuth; Kelly Elder; Stephen Sebestyen; Sherri Johnson; Elizabeth Keppeler; Mary Beth Adams; Peter Caldwell; D. Misra
2016-01-01
Long-term research at small, gauged, forested watersheds within the USDA Forest Service, Experimental Forest and Range network (USDA-EFR) has contributed substantially to our current understanding of relationships between forests and streamflow (Vose et al., 2014). Many of these watershed studies were established in the early to mid-20th century and have been used to...
Native plant development and restoration program for the Great Basin, USA
N. L. Shaw; M. Pellant; P. Olweli; S. L. Jensen; E. D. McArthur
2008-01-01
The Great Basin Native Plant Selection and Increase Project, organized by the USDA Bureau of Land Management, Great Basin Restoration Initiative and the USDA Forest Service, Rocky Mountain Research Station in 2000 as a multi-agency collaborative program (http://www.fs.fed.us/rm/boise/research/shrub/greatbasin.shtml), has the objective of improving the availability of...
B. Loth; R.P. Karrfalt
2017-01-01
The U.S. Department of Agriculture Forest Service (USDA FS) National Seed Laboratory (NSL) began long term seed storage for genetic conservation, in 2005, for USDA FS units and cooperators. This program requires secure storage of both seeds and the data documenting the identification of the seeds. The Agricultural Research Service (ARS) has provided both of these...
Czech Academy of Sciences Publication Activity Database
Rivers, D. B.; Žďárek, Jan; Denlinger, D. L.
2004-01-01
Roč. 57, - (2004), s. 78-91 ISSN 0739-4462 R&D Projects: GA ČR GA522/01/0501 Grant - others:USDA-NRI(US) 98-35302-6659; USDA-NRICGP(US) 2001-1005 Institutional research plan: CEZ:AV0Z4055905 Keywords : ectoparasitoid * ecdysone * fly development Subject RIV: CC - Organic Chemistry Impact factor: 1.173, year: 2004
Chapter 9. Data Management, Storage, and Reporting
Linda A. Spencer; Mary M. Manning; Bryce. Rickel
2013-01-01
Data collected for a habitat monitoring program must be managed and stored to be accessible for current and future use inside and outside the Forest Service. Information maintenance and dissemination are important to the Forest Service; they are part of the U.S. Department of Agriculture (USDA) guidelines for information quality (USDA 2002) under the Data Quality Act...
Assessing the Sustainability of Agricultural and Urban Forests in the United States
Guy Robertson; Andy. Mason
2016-01-01
The Forest Service, an agency of the U.S. Department of Agriculture (USDA), published the National Report on Sustainable Forests-2010 (USDA Forest Service 2011) (hereafter, National Report) several years ago and will be releasing a subsequent version of the report in 2017. Based on the Montreal Process Criteria and Indicators for Forest Sustainability, the National...
Radionuclides for nuclear medicine: a nuclear physicists' view
Czech Academy of Sciences Publication Activity Database
Cantone, M.; Haddad, F.; Harissopoulos, S.; Jensen, M.; Jokinen, A.; Koster, U.; Lebeda, Ondřej; Ponsard, B.; Ratzinger, U.; Stora, T.; Tarkanyi, F.; Van Duppen, P.
2013-01-01
Roč. 40, 2 Supplement (2013), S257-S257 ISSN 1619-7070. [Annual Congress of the European Association of Nuclear Medicine (EANM). 19.10.2013-23.10.2013, Lyon] Institutional support: RVO:61389005 Keywords : nuclear physics for medicine * EANM * medical radionuclides Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders
Ren, Y.; Yang, P.; Li, B.; Gao, Y.; Zhou, H.; Huang, X.; Zhu, L.; Kijlstra, A.
2006-01-01
To examine antigen (Ag)-specific CTL response during anterior chamber associated immune deviation (ACAID). Methods OVA or OVA257-264 peptide was injected into the anterior chamber (AC) of C57BL/6 mice. There were 16 mice in each ACAID group induced with OVA or OVA257-264 peptide. The mice were
2015-01-01
Science and Letters, Gazi Univer- sity, 06500 Ankara, Turkey. 5 USDA-ARS, Center for Medical, Agricultural and Veterinary Ento- mology, Gainesville, FL... Microbiology Department, College of Science, King Saud University, 11451 Riyadh, Saudi Arabia. 8 Department of Pharmacognosy, School of Pharmacy, University of...Agricultural and Veterinary Entomology, U.S. Department of Agriculture–Agricultural Research Service (USDA- ARS), Gainesville, FL. For biting deterrence
Rehabilitating Afghanistan's natural resources
George Hernandez
2011-01-01
The Soviet Union invaded Afghanistan in late 1979. During the next 23 years, the war between the Mujahideen Resistance and the Soviet forces, the ensuing civil war, and eventual take over by the Taliban caused enormous harm to the natural resources of Afghanistan. In 2003, the USDA Forest Service (USFS) was asked by the USDA Foreign Agricultural Service to provide...
2012-11-14
..., entire; Stormer 2009, entire; U.S. Department of Agriculture (USDA) 2010, entire; Stormer 2010a, entire; Stormer 2010b, entire). The amount of total acreage of the proposed site varies from 5 to 187 acres (2 to... information (Secor 2006a, p. 1; PADEP 2009, p. 1; Service 2009, p. 1; Stormer 2009, p. 1; USDA 2010, pp. 1, 4...
Mike H. Freeman; Douglas Crawford; Patricia Lebow; James A. Brient
2005-01-01
Wood preservatives extend the useful service life of all wooden commodities used above ground and in ground contact, Over SO years ago, the USDA-Forest Products Lab established tests in a high decay and high termite hazard zone in southern Mississippi. During the last five decades, periodic reports have been issued by researchers located at the USDA-FPL, in Madison, WI...
DEFF Research Database (Denmark)
Lundquist, Rasmus; Nielsen, Leif Kofoed; Jafarshad, Ali
2006-01-01
against MSP-3 residues 194 to 257 (MSP-3(194-257)) on the molecular level. mRNA from peripheral blood leukocytes from clinically immune individuals was used as a source of Fab (fragment antibody) genes. A Fab-phage display library was made, and three distinct antibodies designated RAM1, RAM2, and RAM3...
USDA-FSA-APFO Dugutak Ortho Mosaic
Federal Emergency Management Agency, Department of Homeland Security — This data set contains imagery from the National Agricultural Imagery Program (NAIP). NAIP acquires digital ortho imagery during the agricultural growing seasons in...
USDA-FSA-APFO Digital Ortho Mosaic
Federal Emergency Management Agency, Department of Homeland Security — Digital orthographic imagery datasets contain georeferenced images of the Earth's surface, collected by a sensor in which object displacement has been removed for...
USDA-FSA-APFO Digital Ortho Mosaic
Federal Emergency Management Agency, Department of Homeland Security — This data set contains imagery from the National Agricultural Imagery Program (NAIP). NAIP acquires digital ortho imagery during the agricultural growing seasons in...
3-(2-Fluorophenylsulfinyl-2,5,7-trimethyl-1-benzofuran
Directory of Open Access Journals (Sweden)
Hong Dae Choi
2013-06-01
Full Text Available In the title compound, C17H15FO2S, the benzofuran ring system, being essentially planar, with an r.m.s. deviation from the least-squares plane of 0.009 (2 Å, makes a dihedral angle of 79.02 (5° with the plane of the 2-fluorophenyl group. In the crystal, molecules are linked by pairs of weak C—H...O hydrogen bonds into centrosymmetric dimers.
All projects related to | Page 257 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Research on the links between tobacco farming and health problems among men, women, and children in Bangladesh will examine the health and ... was a London-based news agency that bought news features from developing world correspondents and distributed them to news media organizations around the world.
2014-03-21
extracted from the USDA Production, Supply, and Distribution Online (PSD) electronic database (http://www.fas.usda.gov/psdonline/) for the focal regions...Precipitation Climatology Project [31] (Table 1). Various publicly-available databases were surveyed to develop maps of outbreak locations of dengue, Rift...rates of leaf photosynthesis and severely reduced the development of floral buds thus reducing yields [33]. Direct losses from the drought approached $10
2015-01-30
USDA: United States Department of Agriculture, http://www.usda.gov USLE : Universal Soil Loss Equation, http://topsoil.nserl.purdue.edu/ usle / ix...Modified Soil Adjusted Vegetation Index (Qi et al., 1994) NCDC: National Climatic Data Center NDVI: Normalized Difference Vegetation Index NEXRAD-MPE...www.rapideye.net/ RENDVI: Red Edge Normalized Difference Vegetation Index RS: Remote sensing RSI: Rainfall Seasonality Index SAVI: Soil Adjusted Vegetation
Cunha, B C N; Belk, K E; Scanga, J A; LeValley, S B; Tatum, J D; Smith, G C
2004-07-01
This study was performed to validate previous equations and to develop and evaluate new regression equations for predicting lamb carcass fabrication yields using outputs from a lamb vision system-hot carcass component (LVS-HCC) and the lamb vision system-chilled carcass LM imaging component (LVS-CCC). Lamb carcasses (n = 149) were selected after slaughter, imaged hot using the LVS-HCC, and chilled for 24 to 48 h at -3 to 1 degrees C. Chilled carcasses yield grades (YG) were assigned on-line by USDA graders and by expert USDA grading supervisors with unlimited time and access to the carcasses. Before fabrication, carcasses were ribbed between the 12th and 13th ribs and imaged using the LVS-CCC. Carcasses were fabricated into bone-in subprimal/primal cuts. Yields calculated included 1) saleable meat yield (SMY); 2) subprimal yield (SPY); and 3) fat yield (FY). On-line (whole-number) USDA YG accounted for 59, 58, and 64%; expert (whole-number) USDA YG explained 59, 59, and 65%; and expert (nearest-tenth) USDA YG accounted for 60, 60, and 67% of the observed variation in SMY, SPY, and FY, respectively. The best prediction equation developed in this trial using LVS-HCC output and hot carcass weight as independent variables explained 68, 62, and 74% of the variation in SMY, SPY, and FY, respectively. Addition of output from LVS-CCC improved predictive accuracy of the equations; the combined output equations explained 72 and 66% of the variability in SMY and SPY, respectively. Accuracy and repeatability of measurement of LM area made with the LVS-CCC also was assessed, and results suggested that use of LVS-CCC provided reasonably accurate (R2 = 0.59) and highly repeatable (repeatability = 0.98) measurements of LM area. Compared with USDA YG, use of the dual-component lamb vision system to predict cut yields of lamb carcasses improved accuracy and precision, suggesting that this system could have an application as an objective means for pricing carcasses in a value
Nash, J.T.
1999-01-01
Field observations, sampling of mine dumps and mine drainage waters, and laboratory studies of dump materials have been made at mining areas deemed to be on public lands administered by the USDA Forest Service in the Mineral Creek watershed. Results of chemical analyses of dump materials, leachates of those materials, and of surface waters draining mines or dumps provide indications of where acid is generated or consumed, and what metals are mobilized below mines or dumps. Information on 25 sites is reviewed and reclamation priorities are ranked into four classes (high, medium, low priority, or no work required). The western side of the upper Animas watershed (the Mineral Creek watershed) has a history of mining and prospecting for about 130 years. The intensity of miningrelated disturbance is higher than in most parts of the San Juan Mountains region, but actually is much less than the eastern half of the watershed (US BLM lands) and none of the mines moved millions of tons of rock and ore as in some of the eastern mines. The majority of the roughly one thousand mining sites on the USFS lands are very small (less than 100 tons or 70 cubic yards of dump material), are more than 2 miles from a major stream, or are so inaccessible as to prohibit reclamation. Twenty five sites have been considered by others to have significant size and potential for significant environmental degradation. These most significant mining areas were evaluated by multiple criteria, including tendency to generate acid or liberate toxic metals, observed acidic pH or dead vegetation (?kill zones?) below dumps or adits, potential mobility of metals, and likelihood of transport into streams of the watershed. In the author?s opinion, no single measurable parameter, such as metal concentration, is reliable for ranking significance or feasibility of reclamation. Rather, subjective estimates are required to evaluate combinations of, or interactions among, several parameters. The most subjective
Osmond, Deanna; Bolster, Carl; Sharpley, Andrew; Cabrera, Miguel; Feagley, Sam; Forsberg, Adam; Mitchell, Charles; Mylavarapu, Rao; Oldham, J Larry; Radcliffe, David E; Ramirez-Avila, John J; Storm, Dan E; Walker, Forbes; Zhang, Hailin
2017-11-01
Phosphorus (P) Indices in the southern United States frequently produce different recommendations for similar conditions. We compared risk ratings from 12 southern states (Alabama, Arkansas, Florida, Georgia, Kentucky, Louisiana, Mississippi, North Carolina, Oklahoma, South Carolina, Tennessee, and Texas) using data collected from benchmark sites in the South (Arkansas, Georgia, Mississippi, North Carolina, Oklahoma, and Texas). Phosphorus Index ratings were developed using both measured erosion losses from each benchmark site and Revised Universal Soil Loss Equation 2 predictions; mostly, there was no difference in P Index outcome. The derived loss ratings were then compared with measured P loads at the benchmark sites by using equivalent USDA-NRCS P Index ratings and three water quality models (Annual P Loss Estimator [APLE], Agricultural Policy Environmental eXtender [APEX], and Texas Best Management Practice Evaluation Tool [TBET]). Phosphorus indices were finally compared against each other using USDA-NRCS loss ratings model estimate correspondence with USDA-NRCS loss ratings. Correspondence was 61% for APEX, 48% for APLE, and 52% for TBET, with overall P index correspondence at 55%. Additive P Indices (Alabama and Texas) had the lowest USDA-NRCS loss rating correspondence (31%), while the multiplicative (Arkansas, Florida, Louisiana, Mississippi, South Carolina, and Tennessee) and component (Georgia, Kentucky, and North Carolina) indices had similar USDA-NRCS loss rating correspondence-60 and 64%, respectively. Analysis using Kendall's modified Tau suggested that correlations between measured and calculated P-loss ratings were similar or better for most P Indices than the models. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.
Gallant, Alisa L.; Sadinski, Walt; Roth, Mark F.; Rewa, Charles A.
2011-01-01
Conservationists and agriculturists face unprecedented challenges trying to minimize tradeoffs between increasing demands for food, fiber, feed, and biofuels and the resulting loss or reduced values of other ecosystem services, such as those derived from wetlands and biodiversity (Millenium Ecosystem Assessment 2005a, 2005c; Maresch et al. 2008). The Food, Conservation, and Energy Act of 2008 (Pub. L. 110-234, Stat. 923, HR 2419, also known as the 2008 Farm Bill) reauthorized the USDA to provide financial incentives for agricultural producers to reduce environmental impacts via multiple conservation programs. Two prominent programs, the Wetlands Reserve Program (WRP) and the Conservation Reserve Program (CRP), provide incentives for producers to retire environmentally sensitive croplands, minimize erosion, improve water quality, restore wetlands, and provide wildlife habitat (USDA FSA 2008a, 2008b; USDA NRCS 2002). Other conservation programs (e.g., Environmental Quality Incentives Program, Conservation Stewardship Program) provide incentives to implement structural and cultural conservation practices to improve the environmental performance of working agricultural lands. Through its Conservation Effects Assessment Project, USDA is supporting evaluation of the environmental benefits obtained from the public investment in conservation programs and practices to inform decisions on where further investments are warranted (Duriancik et al. 2008; Zinn 1997).
Sitewide Monitoring at Agra, Kansas, in 2015
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-05-01
The CCC/USDA is currently implementing a KDHE-approved interim measure (IM) to address the contamination identified on its former property. This source control IM consists of large-diameter boreholes coupled with soil vapor extraction (SVE) and air sparging (AS). The CCC/USDA completed installation of the IM in May 2009. Assessment of the performance and effectiveness of the IM is being reported separately. Pro-Ag is conducting its own site investigation (KDHE 2011c).
Ramona, Kansas, Corrective Action Monitoring Report for 2015
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-04-01
This report describes groundwater monitoring in 2015 for the property at Ramona, Kansas, on which a grain storage facility was formerly operated by the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA). The monitoring was implemented on behalf of the CCC/USDA by Argonne National Laboratory and was conducted as specified in the Long-Term Groundwater Monitoring Plan (Argonne 2012) approved by the Kansas Department of Health and Environment (KDHE 2012).
Muradov, Khakim G; Granovsky, Alexey E; Artemyev, Nikolai O
2003-03-25
Photoreceptor cGMP phosphodiesterase (PDE6) is the effector enzyme in the vertebrate visual transduction cascade. The activity of rod PDE6 catalytic alpha- and beta-subunits is blocked in the dark by two inhibitory Pgamma-subunits. The inhibition is released upon light-stimulation of photoreceptor cells. Mutation H258N in PDE6beta has been linked to congenital stationary night blindness (CSNB) in a large Danish family (Rambusch pedigree) (Gal, A., Orth, U., Baehr, W., Schwinger, E., and Rosenberg, T. (1994) Nat. Genet. 7, 64-67.) We have analyzed the consequences of this mutation for PDE6 function using a Pgamma-sensitive PDE6alpha'/PDE5 chimera, Chi16. Biochemical analysis of the H257N mutant, an equivalent of PDE6betaH258N, demonstrates that this substitution does not alter the ability of chimeric PDE to dimerize or the enzyme's catalytic properties. The sensitivity of H257N to a competitive inhibitor zaprinast was also unaffected. However, the mutant displayed a significant impairment in the inhibitory interaction with Pgamma, which was apparent from a approximately 20-fold increase in the K(i) value (46 nM) and incomplete maximal inhibition. The inhibitory defect of H257N is not due to perturbation of noncatalytic cGMP binding to the PDE6alpha' GAF domains. The noncatalytic cGMP-binding characteristics of the H257N mutant were similar to those of the parent PDE6alpha'/PDE5 chimera. Since rod PDE6 in the Rambusch CSNB is a catalytic heterodimer of the wild-type PDE6alpha and mutant PDE6beta, Chi16 and H257N were coexpressed, and a heterodimeric PDE, Chi16/H257N, was isolated. It displayed two Pgamma inhibitory sites with the K(i) values of 5 and 57 nM. Our results support the hypothesis that mutation H258N in PDE6beta causes CSNB through incomplete inhibition of PDE6 activity by Pgamma, which leads to desensitization of rod photoreceptors.
Energy Technology Data Exchange (ETDEWEB)
Wibmer, Constantinos Kurt; Gorman, Jason; Anthony, Colin S.; Mkhize, Nonhlanhla N.; Druz, Aliaksandr; York, Talita; Schmidt, Stephen D.; Labuschagne, Phillip; Louder, Mark K.; Bailer, Robert T.; Karim, Salim S. Abdool; Mascola, John R.; Williamson, Carolyn; Moore, Penny L.; Kwong, Peter D.; Morris, Lynn (NHLS-South Africa); (NIH); (Witwatersrand); (KwaZulu-Natal)
2016-08-31
All HIV-1-infected individuals develop strain-specific neutralizing antibodies to their infecting virus, which in some cases mature into broadly neutralizing antibodies. Defining the epitopes of strain-specific antibodies that overlap conserved sites of vulnerability might provide mechanistic insights into how broadly neutralizing antibodies arise. We previously described an HIV-1 clade C-infected donor, CAP257, who developed broadly neutralizing plasma antibodies targeting an N276 glycan-dependent epitope in the CD4 binding site. The initial CD4 binding site response potently neutralized the heterologous tier 2 clade B viral strain RHPA, which was used to design resurfaced gp120 antigens for single-B-cell sorting. Here we report the isolation and structural characterization of CAP257-RH1, an N276 glycan-dependent CD4 binding site antibody representative of the early CD4 binding site plasma response in donor CAP257. The cocrystal structure of CAP257-RH1 bound to RHPA gp120 revealed critical interactions with the N276 glycan, loop D, and V5, but not with aspartic acid 368, similarly to HJ16 and 179NC75. The CAP257-RH1 monoclonal antibody was derived from the immunoglobulin-variable IGHV3-33 and IGLV3-10 genes and neutralized RHPA but not the transmitted/founder virus from donor CAP257. Its narrow neutralization breadth was attributed to a binding angle that was incompatible with glycosylated V5 loops present in almost all HIV-1 strains, including the CAP257 transmitted/founder virus. Deep sequencing of autologous CAP257 viruses, however, revealed minority variants early in infection that lacked V5 glycans. These glycan-free V5 loops are unusual holes in the glycan shield that may have been necessary for initiating this N276 glycan-dependent CD4 binding site B-cell lineage.
Molecular and phenotypic characterization of endophytic bacteria isolated from sulla nodules.
Beghalem, Hamida; Aliliche, Khadidja; Chriki, Ali; Landoulsi, Ahmed
2017-10-01
In the current study, bacterial diversity was investigated in root nodules of Sulla pallida and Sulla capitata. The isolates were analyzed on the basis of their phenotypic and molecular characteristics. The phylogenetic analysis based on 16S rRNA and housekeeping genes (recA and atpD) showed that the isolated bacteria related to Sinorhizobium, Neorhizobium, Phyllobacterium, Arthrobacter, Variovorax and Pseudomonas genera. This is the first report of Neorhizobium genus associated with Hedysarum genus. Phenotypically, all strains tolerate the elevated temperature of 40 °C, and salt stress at a concentration of 2%. In addition, the isolates failed to induce nodulation on their original host; and the symbiotic genes could not be amplified, suggesting that these strains are endophytic bacteria. Copyright © 2017 Elsevier Ltd. All rights reserved.
Root and Nodulation Phenotypes of the Ethylene-Insensitive Sickle Mutant of Medicago truncatula
Directory of Open Access Journals (Sweden)
JOKO PRAYITNO
2010-09-01
Full Text Available The sickle (skl mutant of the model legume Medicago truncatula is an ethylene-sensitive mutant that have a ten-fold increase in nodule numbers. The nodulation and root phenotypes of the skl mutant were investigated and further characterised. The skl mutant had longer roots than the wild type, but when inoculated with Sinorhizobium, its root length was reduced to the level of wild type. Furthermore, lateral root numbers in uninoculated skl were similar to those in uninoculated wild type. However, when the root tips were decapitated, fewer lateral roots formed in skl than in wild type. Nodule numbers of the skl mutant were significantly reduced by low nitrate concentration (2.5 mM. These results suggest that skl mutant has alterations in both root and nodule development.
A Regional Assessment of the Effects of Conservation Practices on In-stream Water Quality
Garcia, A. M.; Alexander, R. B.; Arnold, J.; Norfleet, L.; Robertson, D. M.; White, M.
2011-12-01
The Conservation Effects Assessment Program (CEAP), initiated by USDA Natural Resources Conservation Service (NRCS), has the goal of quantifying the environmental benefits of agricultural conservation practices. As part of this effort, detailed farmer surveys were compiled to document the adoption of conservation practices. Survey data showed that up to 38 percent of cropland in the Upper Mississippi River basin is managed to reduce sediment, nutrient and pesticide loads from agricultural activities. The broader effects of these practices on downstream water quality are challenging to quantify. The USDA-NRCS recently reported results of a study that combined farmer surveys with process-based models to deduce the effect of conservation practices on sediment and chemical loads in farm runoff and downstream waters. As a follow-up collaboration, USGS and USDA scientists conducted a semi-empirical assessment of the same suite of practices using the USGS SPARROW (SPAtially Referenced Regression On Watershed attributes) modeling framework. SPARROW is a hybrid statistical and mechanistic stream water quality model of annual conditions that has been used extensively in studies of nutrient sources and delivery. In this assessment, the USDA simulations of the effects of conservation practices on loads in farm runoff were used as an explanatory variable (i.e., change in farm loads per unit area) in a component of an existing a SPARROW model of the Upper Midwest. The model was then re-calibrated and tested to determine whether the USDA estimate of conservation adoption intensity explained a statistically significant proportion of the spatial variability in stream nutrient loads in the Upper Mississippi River basin. The results showed that the suite of conservation practices that NRCS has catalogued as complete nutrient and sediment management are a statistically significant feature in the Midwestern landscape associated with phosphorous runoff and delivery to downstream waters
Eating a Healthy Diet: Is Cost a Major Factor?
Carlson, Andrea; Lino, Mark; Fungwe, Thomas V.; Guenther, Patricia M.
2009-01-01
We examine the association between food expenditure and overall diet quality using a model where we assumed dietary quality is a function of health conditions, life style choices, total food expenditures, and socio-economic status. We use cross-sectional data from the National Health and Nutrition Examination Survey (NHANES) 2001-02 and the U.S. Department of Agriculture (USDA)’s Center for Nutrition Policy and Promotion Food Prices Database. Diet quality is measured using the USDA Healthy Ea...
Annual Report of Monitoring at Barnes, Kansas, in 2016
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, Lorraine M. [Argonne National Lab. (ANL), Argonne, IL (United States)
2017-05-01
In 2006, the CCC/USDA assumed responsibility for the site investigation relating to potential carbon tetrachloride contamination. Initially, the CCC/USDA developed and implemented a work plan for targeted groundwater sampling and monitoring well installation (KDHE 2009). The investigation and subsequent monitoring (Argonne 2008a-d, 2009a,b, 2010, 2011, 2012, 2013, 2015a,b, 2016) were performed by the Environmental Science Division of Argonne National Laboratory. The reports of environmental investigations at Barnes are summarized.
Yoshida, Ken-ichi; Takemoto, Yuki; Sotsuka, Takayuki; Tanaka, Kosei; Takenaka, Shinji
2013-01-01
Background Bradyrhizobium japonicum USDA110, a soybean symbiont, is capable of accumulating a large amount of poly-β-hydroxybutyrate (PHB) as an intracellular carbon storage polymer during free-living growth. Within the genome of USDA110, there are a number of genes annotated as paralogs of proteins involved in PHB metabolism, including its biosynthesis, degradation, and stabilization of its granules. They include two phbA paralogs encoding 3-ketoacyl-CoA thiolase, two phbB paralogs encoding ...
Okubo, Takashi; Tsukui, Takahiro; Maita, Hiroko; Okamoto, Shinobu; Oshima, Kenshiro; Fujisawa, Takatomo; Saito, Akihiro; Futamata, Hiroyuki; Hattori, Reiko; Shimomura, Yumi; Haruta, Shin; Morimoto, Sho; Wang, Yong; Sakai, Yoriko; Hattori, Masahira; Aizawa, Shin-ichi; Nagashima, Kenji V. P.; Masuda, Sachiko; Hattori, Tsutomu; Yamashita, Akifumi; Bao, Zhihua; Hayatsu, Masahito; Kajiya-Kanegae, Hiromi; Yoshinaga, Ikuo; Sakamoto, Kazunori; Toyota, Koki; Nakao, Mitsuteru; Kohara, Mitsuyo; Anda, Mizue; Niwa, Rieko; Jung-Hwan, Park; Sameshima-Saito, Reiko; Tokuda, Shin-ichi; Yamamoto, Sumiko; Yamamoto, Syuji; Yokoyama, Tadashi; Akutsu, Tomoko; Nakamura, Yasukazu; Nakahira-Yanaka, Yuka; Hoshino, Yuko Takada; Hirakawa, Hideki; Mitsui, Hisayuki; Terasawa, Kimihiro; Itakura, Manabu; Sato, Shusei; Ikeda-Ohtsubo, Wakako; Sakakura, Natsuko; Kaminuma, Eli; Minamisawa, Kiwamu
2012-01-01
Bradyrhizobium sp. S23321 is an oligotrophic bacterium isolated from paddy field soil. Although S23321 is phylogenetically close to Bradyrhizobium japonicum USDA110, a legume symbiont, it is unable to induce root nodules in siratro, a legume often used for testing Nod factor-dependent nodulation. The genome of S23321 is a single circular chromosome, 7,231,841 bp in length, with an average GC content of 64.3%. The genome contains 6,898 potential protein-encoding genes, one set of rRNA genes, and 45 tRNA genes. Comparison of the genome structure between S23321 and USDA110 showed strong colinearity; however, the symbiosis islands present in USDA110 were absent in S23321, whose genome lacked a chaperonin gene cluster (groELS3) for symbiosis regulation found in USDA110. A comparison of sequences around the tRNA-Val gene strongly suggested that S23321 contains an ancestral-type genome that precedes the acquisition of a symbiosis island by horizontal gene transfer. Although S23321 contains a nif (nitrogen fixation) gene cluster, the organization, homology, and phylogeny of the genes in this cluster were more similar to those of photosynthetic bradyrhizobia ORS278 and BTAi1 than to those on the symbiosis island of USDA110. In addition, we found genes encoding a complete photosynthetic system, many ABC transporters for amino acids and oligopeptides, two types (polar and lateral) of flagella, multiple respiratory chains, and a system for lignin monomer catabolism in the S23321 genome. These features suggest that S23321 is able to adapt to a wide range of environments, probably including low-nutrient conditions, with multiple survival strategies in soil and rhizosphere. PMID:22452844
Flavonoid intake and all-cause mortality.
Ivey, Kerry L; Hodgson, Jonathan M; Croft, Kevin D; Lewis, Joshua R; Prince, Richard L
2015-05-01
Flavonoids are bioactive compounds found in foods such as tea, chocolate, red wine, fruit, and vegetables. Higher intakes of specific flavonoids and flavonoid-rich foods have been linked to reduced mortality from specific vascular diseases and cancers. However, the importance of flavonoids in preventing all-cause mortality remains uncertain. The objective was to explore the association between flavonoid intake and risk of 5-y mortality from all causes by using 2 comprehensive food composition databases to assess flavonoid intake. The study population included 1063 randomly selected women aged >75 y. All-cause, cancer, and cardiovascular mortalities were assessed over 5 y of follow-up through the Western Australia Data Linkage System. Two estimates of flavonoid intake (total flavonoidUSDA and total flavonoidPE) were determined by using food composition data from the USDA and the Phenol-Explorer (PE) databases, respectively. During the 5-y follow-up period, 129 (12%) deaths were documented. Participants with high total flavonoid intake were at lower risk [multivariate-adjusted HR (95% CI)] of 5-y all-cause mortality than those with low total flavonoid consumption [total flavonoidUSDA: 0.37 (0.22, 0.58); total flavonoidPE: 0.36 (0.22, 0.60)]. Similar beneficial relations were observed for both cardiovascular disease mortality [total flavonoidUSDA: 0.34 (0.17, 0.69); flavonoidPE: 0.32 (0.16, 0.61)] and cancer mortality [total flavonoidUSDA: 0.25 (0.10, 0.62); flavonoidPE: 0.26 (0.11, 0.62)]. Using the most comprehensive flavonoid databases, we provide evidence that high consumption of flavonoids is associated with reduced risk of mortality in older women. The benefits of flavonoids may extend to the etiology of cancer and cardiovascular disease. © 2015 American Society for Nutrition.
Barrière, Quentin; Guefrachi, Ibtissem; Gully, Djamel; Lamouche, Florian; Pierre, Olivier; Fardoux, Joël; Chaintreuil, Clémence; Alunni, Benoît; Timchenko, Tatiana; Giraud, Eric; Mergaert, Peter
2017-08-22
Legumes harbor in their symbiotic nodule organs nitrogen fixing rhizobium bacteria called bacteroids. Some legumes produce Nodule-specific Cysteine-Rich (NCR) peptides in the nodule cells to control the intracellular bacterial population. NCR peptides have antimicrobial activity and drive bacteroids toward terminal differentiation. Other legumes do not produce NCR peptides and their bacteroids are not differentiated. Bradyrhizobia, infecting NCR-producing Aeschynomene plants, require the peptide uptake transporter BclA to cope with the NCR peptides as well as a specific peptidoglycan-modifying DD-carboxypeptidase, DD-CPase1. We show that Bradyrhizobium diazoefficiens strain USDA110 forms undifferentiated bacteroids in NCR-lacking soybean nodules. Unexpectedly, in Aeschynomene afraspera nodules the nitrogen fixing USDA110 bacteroids are hardly differentiated despite the fact that this host produces NCR peptides, suggesting that USDA110 is insensitive to the host peptide effectors and that nitrogen fixation can be uncoupled from differentiation. In agreement with the absence of bacteroid differentiation, USDA110 does not require its bclA gene for nitrogen fixing symbiosis with these two host plants. Furthermore, we show that the BclA and DD-CPase1 act independently in the NCR-induced morphological differentiation of bacteroids. Our results suggest that BclA is required to protect the rhizobia against the NCR stress but not to induce the terminal differentiation pathway.
Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016
U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...
24 CFR 257.120 - Appreciation sharing or up-front payment
2010-04-01
... the Act, the amount of the appreciation in value of a property securing an H4H program mortgage that... appreciation may be established to the satisfaction of FHA: (1) In the case of— (i) A sale of the property to...'s interest in appreciation. Upon sale or disposition of a property securing an H4H program mortgage...
Nigeria: Power and Democracy in Africa. Headline Series No. 257.
Herskovits, Jean
This booklet traces the emergence of a democratic government in Nigeria through military dictatorship to the writing of a constitution fashioned on the American model. Chapters include: (1) "Prologue"; (2) "Nigeria Defined"; (3) "Tragedy and Recovery: The First Republic and the Federal Military Government"; (4)…
40 CFR 257.23 - Ground-water sampling and analysis requirements.
2010-07-01
...: (1) Sample collection; (2) Sample preservation and shipment; (3) Analytical procedures; (4) Chain of... theory test, then the data should be transformed or a distribution-free theory test should be used. If... chart and its associated parameter values shall be protective of human health and the environment. The...
40 CFR 257.28 - Implementation of the corrective action program.
2010-07-01
... constituents as a result of an accident or failure of a container or handling system; and (vii) Other situations that may pose threats to human health and the environment. (b) An owner or operator may determine... alternative measures prior to implementing the alternative measures has been placed in the operating record...
Zribi, Kais; Nouairi, Issam; Slama, Ines; Talbi-Zribi, Ons; Mhadhbi, Haythem
2015-01-01
In this study we investigated effects of Zn supply on germination, growth, inorganic solutes (Zn, Ca, Fe, and Mg) partitioning and nodulation of Medicago sativa This plant was cultivated with and without Zn (2 mM). Treatments were plants without (control) and with Zn tolerant strain (S532), Zn intolerant strain (S112) and 2 mM urea nitrogen fertilisation. Results showed that M. sativa germinates at rates of 50% at 2 mM Zn. For plants given nitrogen fertilisation, Zn increased plant biomass production. When grown with symbionts, Zn supply had no effect on nodulation. Moreover, plants with S112 showed a decrease of shoot and roots biomasses. However, in symbiosis with S532, an increase of roots biomass was observed. Plants in symbiosis with S. meliloti accumulated more Zn in their roots than nitrogen fertilised plants. Zn supply results in an increase of Ca concentration in roots of fertilised nitrogen plants. However, under Zn supply, Fe concentration decreased in roots and increased in nodules of plants with S112. Zn supply showed contrasting effects on Mg concentrations for plants with nitrogen fertilisation (increase) and plants with S112 (decrease). The capacity of M. sativa to accumulate Zn in their nodulated roots encouraged its use in phytostabilisation processes.
Final report : Hanover environmental site investigation, 2009-2010.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M. (Environmental Science Division)
2011-06-07
The Commodity Credit Corporation (CCC), an agency of the U.S. Department of Agriculture (USDA), operated a grain storage facility at the northeastern edge of the city of Hanover, Kansas, from 1950 until the early 1970s. During this time, commercial grain fumigants containing carbon tetrachloride were in common use by the grain storage industry to preserve grain in their facilities. In February 1998, trace to low levels of carbon tetrachloride were detected in two private lawn and garden wells near the former grain storage facility at Hanover, as part of a statewide USDA private well sampling program that was implemented by the Kansas Department of Health and Environment (KDHE) near former CCC/USDA facilities. In July 2007, the CCC/USDA sampled indoor air at nine residences on or adjacent to its former facility to address the residents concerns. Low levels of carbon tetrachloride were detected at four of the nine homes. Consequently, the CCC/USDA has conducted investigations, under the direction of the KDHE, to determine the source and extent of the carbon tetrachloride contamination that might be associated with the former facility. In July 2007, the CCC/USDA sampled indoor air at nine residences on or adjacent to its former facility to address the residents concerns regarding vapor intrusion (VI). Low levels of carbon tetrachloride were detected at four of the nine homes. Because carbon tetrachloride found in private wells and indoor air at Hanover might be linked to historical use of fumigants containing carbon tetrachloride at its former grain storage facility, the CCC/USDA has conducted investigations to determine the source and extent of the carbon tetrachloride contamination that may be associated with the former facility. The results of the comprehensive investigation at Hanover indicate that no unacceptable risk to human health currently exists from exposure to surface and subsurface soils by either ingestion, inhalation or dermal contact. No risk is
Energy Technology Data Exchange (ETDEWEB)
Hollinger, David [USDA Forest Service, Washington, DC (United States); Davidson, E. [Woods Hole Research Center, Falmouth, MA (United States); Dail, D. B. [Univ. of Maine, Orono, ME (United States); Richardson, A. [Harvard Univ., Cambridge, MA (United States)
2016-01-11
This report provides and overview of the work carried out and lists the products produced under the terms of agreement SC0005578 with the USDA Forest Service. This relates to scientific investigation of the carbon cycle at the Howland Forest AmeriFlux site located in central Maine, USDA. The overall goal of this work was to understand the various (and interacting) impacts of a changing climate on carbon cycling at the Howland AmeriFlux site, representative of an important component of the North American boreal forest.
Czech Academy of Sciences Publication Activity Database
Vávra, Jiří; Hyliš, M.; Vossbrinck, C. R.; Pilarska, D. K.; Linde, A.; Weiser, Jaroslav; McManus, M. L.; Hoch, G.; Solter, L. F.
2006-01-01
Roč. 53, č. 4 (2006), s. 292-304 ISSN 1066-5234 Grant - others:Karlova Univerzita v Praze a USDA US Forest Service(CZ) 161/79-982111; USDA FS Cooperative Agreement(US) AG 01CA-11242343-107; Grant US Agricultural Experimental Station(US) ILLU-65-0344; Deutsche ForschungsGemeinschaft(BG) 436 BUL 17/8/04 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50070508 Keywords : microsporidia * parasitology * biological control Subject RIV: EH - Ecology, Behaviour Impact factor: 2.288, year: 2006
1992-12-01
Allison P.O. Box 946 USDA Tifton , GA 31794 Box 946 Phone: 912-386-3899 Tifton , GA 31794 FAX: 912-386-7215 Phone: 912-386-7075 FAX: 912-386-7215 Paul...FAX: 603-889-3984 FAX: 071-724-1433 Ricky Fletcher S. V. Cosvay USDA-ARS-SEWRL Sensors and Software, Inc. Rt. 4, Box 1390 5566 Tomken Road Tifton , GA ... Tifton , GA 31793 Phone: 305-634-4507 Phone: 912-386-7174 FAX: 305-635-4901 FAX: 912-386-7215 8 GOVERNMENT USERS WORKSHOP ON GROUND PENETRATING RADAR
The impact of mechanism on the management and outcome of penetrating colonic trauma.
Oosthuizen, G V; Kong, V Y; Estherhuizen, T; Bruce, J L; Laing, G L; Odendaal, J J; Clarke, D L
2018-02-01
Introduction In light of continuing controversy surrounding the management of penetrating colonic injuries, we set out to compare the outcome of penetrating colonic trauma according to whether the mechanism of injury was a stab wound or a gunshot wound. Methods Our trauma registry was interrogated for the 5-year period from January 2012 to December 2016. All patients over the age of 18 years with penetrating trauma (stab or gunshot) and with intraoperatively proven colonic injury were reviewed. Details of the colonic and concurrent abdominal injuries were recorded, together with the operative management strategy. In-hospital morbidities were divided into colon-related and non-colon related morbidities. The length of hospital stay and mortality were recorded. Direct comparison was made between patients with stab wounds and gunshot wounds to the colon. Results During the 5-year study period, 257 patients sustained a colonic injury secondary to penetrating trauma; 95% (244/257) were male and the mean age was 30 years. A total of 113 (44%) sustained a gunshot wound and the remaining 56% (144/257) sustained a stab wound. Some 88% (226/257) of all patients sustained a single colonic injury, while 12% (31/257) sustained more than one colonic injury. A total of 294 colonic injuries were found at laparotomy. Multiple colonic injuries were less commonly encountered in stab wounds (6%, 9/144 vs. 19%, 22/113, P colonic stab wounds and colonic gunshot wounds are different in terms of severity of the injury and in terms of outcome. While primary repair is almost always applicable to the management of colonic stab wounds, the same cannot be said for colonic gunshot wounds. The management of colonic gunshot wounds should be examined separately from that of stab wounds.
Ampomah, Osei Yaw; Jensen, John Beck
2014-03-01
Competitiveness for nodulation is a desirable trait in rhizobia strains used as inoculant. In Sinorhizobium meliloti 1021 mutation in either of the trehalose utilization genes thuA or thuB influences its competitiveness for root colonization and nodule occupancy depending on the interacting host. We have therefore investigated whether mutation in the thuA ortholog in Mesorhizobium loti MAFF303099 also leads to a similar competitive phenotype on its hosts. The results show that M. loti thuA mutant Ml7023 was symbiotically effective and was as competitive as the wild type in colonization and nodule occupancy on Lotus corniculatus and Lotus japonicus. The thuA gene in M. loti was not induced during root colonization or in the infection threads unlike in S. meliloti, despite its induction by trehalose and high osmolarity in in vitro assays.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M.; Environmental Science Division
2007-05-31
This document summarizes the performance of the groundwater and surface water restoration systems installed by the Commodity Credit Corporation of the U.S. Department of Agriculture (CCC/USDA) at the former CCC/USDA grain storage facility in Murdock, Nebraska, during the initial period of systems operation, from June 2005 through December 2006. In the Murdock project, several innovative technologies are being used to remove carbon tetrachloride contamination from a shallow aquifer underlying the town, as well as from water naturally discharged to the surface at the headwaters of a small creek (a tributary to Pawnee Creek) north of the town (Figure 1.1). The restoration activities at Murdock are being conducted by the CCC/USDA as a non-time-critical removal action under the regulatory authority and supervision of the U.S. Environmental Protection Agency (EPA), Region VII. Argonne National Laboratory assisted the CCC/USDA by providing technical oversight for the restoration effort and facilities during this review period. Included in this report are the results of all sampling and monitoring activities performed in accord with the EPA-approved Monitoring Plan for this site (Argonne 2006), as well as additional investigative activities conducted during the review period. This document presents overviews of the treatment facilities (Section 2) and site operations and activities (Section 3), then describes the groundwater, surface water, vegetation, and atmospheric monitoring results (Section 4) and modifications and costs during the review period (Section 5). Section 6 summarizes the initial period of operation.
Pomeranz, Jennifer L; Chriqui, Jamie F
2015-09-01
Under the current version of the Supplemental Nutrition Assistance Program (SNAP), participants can purchase virtually any food or beverage (collectively, food). Research indicates that SNAP recipients may have worse dietary quality than income-eligible nonparticipants. Policymakers have urged the U.S. Department of Agriculture (USDA) to pilot SNAP purchasing restrictions intended to support a healthier diet, and state legislators have proposed similar bills. The USDA rejected these invitations, stating that it would be administratively and logistically difficult to differentiate among products, amid other concerns. However, the USDA's Dietary Guidelines for Americans and the Supplemental Nutrition Program for Women, Infants, and Children (WIC) do just that. Further, state governments define and differentiate among foods and beverages for tax purposes. This paper reviews several factors intended to inform future policy decisions: the science indicating that SNAP recipients have poorer diet quality than income-eligible nonparticipants; the public's support for revising the SNAP program; federal, state, and city legislators' formal proposals to amend SNAP based on nutrition criteria and the USDA's public position in opposition to these proposals; state bills to amend eligible foods purchasable with SNAP benefits; state retail food tax laws; and the retail administration and program requirements for both WIC and SNAP. The paper finds that the government has a clear ability to align SNAP benefits with nutrition science and operationalize this into law. Copyright © 2015 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.
Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser
DEFF Research Database (Denmark)
Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm
2003-01-01
Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm.......Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....
Statistical Inference on Memory Structure of Processes and Its Applications to Information Theory
2016-05-12
8217x’!will!correspond!with!the!stringoid! matrices! ! E4=C4*log(P4)! Ea4=matrix(E4[1:256])! Es4=matrix(E4[257:496])! ! EL4 =matrix(cbind(A4,E4),length...E4))! ELa4=matrix( EL4 [1:256,1:5],length(Ea4))! ELs4=matrix( EL4 [257:496,1:5],length(Es4))! ! Ea4a=matrix(rep(0,60))! for(i!in!1:256)! for(j!in!1:60
Exporting Rambutan to United States: One Reality?
International Nuclear Information System (INIS)
Ahmad Zainuri Mohd Dzomir; Zainon Othman; Mohd Sidek Othman
2011-01-01
Rambutan is a one of commodity that are passed by United States of America authority to be market in that states. The main condition for the approval is the exporter must use irradiation technology as quarantine treatment to monitor the insects in there. United States of America's Agriculture Department (USDA-APHIS) has make early survey to the facilities involved in exporting process chain to overview Malaysia preparedness for this purpose. This paper work will discussed the possibility of this exporting implemented based on conditions rule by the USDA. (author)
Woodward-Lopez, Gail; Kao, Janice; Kiesel, Kristin; Lewis Miller, Markell; Boyle, Maria; Drago-Ferguson, Soledad; Braff-Guajardo, Ellen; Crawford, Patricia
2014-09-01
Despite the resurgence of interest in scratch-cooking as a way to increase the quality and appeal of school meals, many school districts are concerned about the cost implications of switching to scratch-cooking. US Department of Agriculture (USDA) Foods are the single largest source of ingredients for school meals, and about half of USDA Foods are diverted for processing before being sent to the school district. We aimed to determine whether school lunch entrées made in a district from basic or raw USDA Foods ingredients can be healthier and less expensive to prepare than those sent to external processors. This cross-sectional study examined the relationship between the extent of scratch-cooking and the nutritional content and cost to prepare entrées. Information was gathered by interview with school foodservice personnel and from school foodservice records from a convenience sample of 10 school districts in California that employed varying degrees of scratch-cooking and is diverse in terms of geographic location and the sociodemographics of the student body. The sample included all elementary school lunch entrées that contain USDA Foods offered during October 2010 for a total sample of 146 entrées. Ordinary least squares regressions were used to test for statistically significant differences in cost and nutrient content of entrées according to the level of scratch-cooking. There was no significant relationship between total costs and level of scratch-cooking. Entrées with the highest scratch-cooking scores had significantly lower food costs, higher labor costs, and not significantly different total costs compared with entrées with no scratch-cooking. Nutrient content was not consistently associated with scratch-cooking, but scratch-cooked entrées did include a larger variety of non-fast-food-type entrées. The findings suggest that scratch-cooking can be a cost-effective way to expand the variety of healthy school lunches prepared with USDA Foods