Effects of the ssb-1 and ssb-113 mutations on survival and DNA repair in UV-irradiated delta uvrB strains of Escherichia coli K-12.

OpenAIRE

Wang, T C; Smith, K C

1982-01-01

The molecular defect in DNA repair caused by ssb mutations (single-strand binding protein) was studied by analyzing DNA synthesis and DNA double-strand break production in UV-irradiated Escherichia coli delta uvrB strains. The presence of the ssb-113 mutation produced a large inhibition of DNA synthesis and led to the formation of double-strand breaks, whereas the ssb-1 mutation produced much less inhibition of DNA synthesis and fewer double-strand breaks. We suggest that the single-strand bi...

Temperature-Dependent Mollow Triplet Spectra from a Single Quantum Dot: Rabi Frequency Renormalization and Sideband Linewidth Insensitivity

DEFF Research Database (Denmark)

Wei, Yu-Jia; He, Yu; He, Yu-Ming

2014-01-01

We investigate temperature-dependent resonance fluorescence spectra obtained from a single self- assembled quantum dot. A decrease of the Mollow triplet sideband splitting is observed with increasing temperature, an effect we attribute to a phonon-induced renormalization of the driven dot Rabi fr...

Sideband ratio in double sideband receivers with a Michelson interferometer

NARCIS (Netherlands)

Romanini, M.; Baryshev, A. M.; Hesper, R.; Mena, F. P.; Wild, W.

2007-01-01

Terahertz heterodyne receivers typically use double sideband (DSB) mixers. The precise knowledge of the receiver sideband ratio (SBR) is a fundamental requirement for the calibration of the data taken with this type of receivers. At the moment the spectroscopic techniques developed for submillimeter

Reversely modulated optical single sideband scheme and its application in a 60-GHz full duplex ROF system

NARCIS (Netherlands)

Cao, Z.; Yu, J.J.; Chen, L.; Shu, Q.L.

2012-01-01

The reversely modulated optical single sideband scheme (IM-OSSB) based on a parallel Mach-Zehnder modulator (P-MZM) is proposed. In this P-MZM, one sub-MZM is employed for data modulation and the other is used for optical millimeter wave (mm-wave) generation. Due to the individual modulation, this

A core hSSB1–INTS complex participates in the DNA damage response

OpenAIRE

Zhang, Feng; Ma, Teng; Yu, Xiaochun

2013-01-01

Human single-stranded DNA-binding protein 1 (hSSB1) plays an important role in the DNA damage response and the maintenance of genomic stability. It has been shown that the core hSSB1 complex contains hSSB1, INTS3 and C9orf80. Using protein affinity purification, we have identified integrator complex subunit 6 (INTS6) as a major subunit of the core hSSB1 complex. INTS6 forms a stable complex with INTS3 and hSSB1 both in vitro and in vivo. In this complex, INTS6 directly interacts with INTS3. I...

Dicty_cDB: SSB721 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB721 (Link to dictyBase) ssb721 G20804 DDB0230090 Contig-U04...594-1 SSB721E (Link to Original site) - - - - - - SSB721E 549 Show SSB721 Library SS (Link to library) Clone ID SSB721 (Link to dict...yBase) Atlas ID ssb721 NBRP ID G20804 dictyBase ID DDB0230090 Link to Contig Contig-...U04594-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSB7-A/SSB72...quence update 1997.11.25 Translated Amino Acid sequence NDINSIVCKANSQCPTSHICTSSNKCIIKYSSKVGEKCTDSPLQCRVFNGEI

Roles of Bacillus subtilis DprA and SsbA in RecA-mediated genetic recombination.

Science.gov (United States)

Yadav, Tribhuwan; Carrasco, Begoña; Serrano, Ester; Alonso, Juan C

2014-10-03

Bacillus subtilis competence-induced RecA, SsbA, SsbB, and DprA are required to internalize and to recombine single-stranded (ss) DNA with homologous resident duplex. RecA, in the ATP · Mg(2+)-bound form (RecA · ATP), can nucleate and form filament onto ssDNA but is inactive to catalyze DNA recombination. We report that SsbA or SsbB bound to ssDNA blocks the RecA filament formation and fails to activate recombination. DprA facilitates RecA filamentation; however, the filaments cannot engage in DNA recombination. When ssDNA was preincubated with SsbA, but not SsbB, DprA was able to activate DNA strand exchange dependent on RecA · ATP. This work demonstrates that RecA · ATP, in concert with SsbA and DprA, catalyzes DNA strand exchange, and SsbB is an accessory factor in the reaction. In contrast, RecA · dATP efficiently catalyzes strand exchange even in the absence of single-stranded binding proteins or DprA, and addition of the accessory factors marginally improved it. We proposed that the RecA-bound nucleotide (ATP and to a lesser extent dATP) might dictate the requirement for accessory factors. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

Saccharomyces cerevisiae SSB1 protein and its relationship to nucleolar RNA-binding proteins.

Science.gov (United States)

Jong, A Y; Clark, M W; Gilbert, M; Oehm, A; Campbell, J L

1987-08-01

To better define the function of Saccharomyces cerevisiae SSB1, an abundant single-stranded nucleic acid-binding protein, we determined the nucleotide sequence of the SSB1 gene and compared it with those of other proteins of known function. The amino acid sequence contains 293 amino acid residues and has an Mr of 32,853. There are several stretches of sequence characteristic of other eucaryotic single-stranded nucleic acid-binding proteins. At the amino terminus, residues 39 to 54 are highly homologous to a peptide in calf thymus UP1 and UP2 and a human heterogeneous nuclear ribonucleoprotein. Residues 125 to 162 constitute a fivefold tandem repeat of the sequence RGGFRG, the composition of which suggests a nucleic acid-binding site. Near the C terminus, residues 233 to 245 are homologous to several RNA-binding proteins. Of 18 C-terminal residues, 10 are acidic, a characteristic of the procaryotic single-stranded DNA-binding proteins and eucaryotic DNA- and RNA-binding proteins. In addition, examination of the subcellular distribution of SSB1 by immunofluorescence microscopy indicated that SSB1 is a nuclear protein, predominantly located in the nucleolus. Sequence homologies and the nucleolar localization make it likely that SSB1 functions in RNA metabolism in vivo, although an additional role in DNA metabolism cannot be excluded.

Simultaneous transmission of wired and wireless signals based on double sideband carrier suppression

Science.gov (United States)

Bitew, Mekuanint Agegnehu; Shiu, Run-Kai; Peng, Peng-Chun; Wang, Cheng-Hao; Chen, Yan-Ming

2017-11-01

In this paper, we proposed and experimentally demonstrated simultaneous transmission of wired and wireless signals based on double sideband optical carrier suppression. By properly adjusting the bias point of the dual-output mach-zehnder modulator (MZM), a central carrier in one output port and a pair of first-order sidebands in another output port are generated. The pair of first-order sidebands are fed into a second MZM to generate second-order order sidebands. A wired signal is embedded on the central carrier while a wireless signal is embedded on the second-order sidebands. Unlike other schemes, we did not use optical filter to separate the carrier from the optical sidebands. The measured bit error rate (BER) and eye-diagrams after a 25 km single-mode-fiber (SMF) transmission proved that the proposed scheme is successful for both wired and wireless signals transmission. Moreover, the power penalty at the BER of 10-9 is 0.3 and 0.7 dB for wired and wireless signals, respectively.

Application of the SSB biosensor to study in vitro transcription.

Science.gov (United States)

Cook, Alexander; Hari-Gupta, Yukti; Toseland, Christopher P

2018-02-12

Gene expression, catalysed by RNA polymerases (RNAP), is one of the most fundamental processes in living cells. The majority of methods to quantify mRNA are based upon purification of the nucleic acid which leads to experimental inaccuracies and loss of product, or use of high cost dyes and sensitive spectrophotometers. Here, we describe the use of a fluorescent biosensor based upon the single stranded binding (SSB) protein. In this study, the SSB biosensor showed similar binding properties to mRNA, to that of its native substrate, single-stranded DNA (ssDNA). We found the biosensor to be reproducible with no associated loss of product through purification, or the requirement for expensive dyes. Therefore, we propose that the SSB biosensor is a useful tool for comparative measurement of mRNA yield following in vitro transcription. Copyright © 2018 The Authors. Published by Elsevier Inc. All rights reserved.

Side-band mutual interactions in the magnetosphere

Science.gov (United States)

Chang, D. C. D.; Helliwell, R. A.; Bell, T. F.

1980-01-01

Sideband mutual interactions between VLF waves in the magnetosphere are investigated. Results of an experimental program involving the generation of sidebands by means of frequency shift keying are presented which indicate that the energetic electrons in the magnetosphere can interact only with sidebands generated by signals with short modulation periods. Using the value of the memory time during which electrons interact with the waves implied by the above result, it is estimated that the length of the electron interaction region in the magnetosphere is between 4000 and 2000 km. Sideband interactions are found to be similar to those between constant-frequency signals, exhibiting suppression and energy coupling. Results from a second sideband transmitting program show that for most cases the coherence bandwidth of sidebands is about 50 Hz. Sideband mutual interactions are then explained by the overlap of the ranges of the parallel velocity of the electrons which the sidebands organize, and the wave intensity in the interaction region is estimated to be 2.5-10 milli-gamma, in agreement with satellite measurements.

Receiver sensitivity improvement in spectrally-efficient guard-band twin-SSB-OFDM using an optical IQ modulator

Science.gov (United States)

Chen, Ming; Peng, Miao; Zhou, Hui; Zheng, Zhiwei; Tang, Xionggui; Maivan, Lap

2017-12-01

To further improve receiver sensitivity of spectrally-efficient guard-band direct-detection optical orthogonal frequency-division multiplexing (OFDM) with twin single-side-band (SSB) modulation technique, an optical IQ modulator (IQM) is employed to optimize optical carrier-to-signal power ratio (CSPR). The CSPRs for the guard-band twin-SSB-OFDM signal generated by using dual-drive Mach-Zehnder modulator (DD-MZM) and optical IQM are theoretically analyzed and supported by simulations. The optimal CSPR for the two types of guard-band twin-SSB-OFDM are identified. The simulations exhibit that the error vector magnitude (EVM) performance of the IQM-enabled guard-band twin-SSB-OFDM is improved by more than 4-dB compared to that of the twin-SSB-OFDM enabled by DD-MZM after 80-km single-mode fiber (SMF) transmission. In addition, more than 3-dB and 10 dB receiver sensitivity improvements in terms of received optical power (ROP) and optical signal-to-noise ratio (OSNR) are also achieved, respectively.

The essential role of the Deinococcus radiodurans ssb gene in cell survival and radiation tolerance.

Directory of Open Access Journals (Sweden)

J Scott Lockhart

Full Text Available Recent evidence has implicated single-stranded DNA-binding protein (SSB expression level as an important factor in microbial radiation resistance. The genome of the extremely radiation resistant bacterium Deinococcus radiodurans contains genes for two SSB homologs: the homodimeric, canonical Ssb, encoded by the gene ssb, and a novel pentameric protein encoded by the gene ddrB. ddrB is highly induced upon exposure to radiation, and deletions result in decreased radiation-resistance, suggesting an integral role of the protein in the extreme resistance exhibited by this organism. Although expression of ssb is also induced after irradiation, Ssb is thought to be involved primarily in replication. In this study, we demonstrate that Ssb in D. radiodurans is essential for cell survival. The lethality of an ssb deletion cannot be complemented by providing ddrB in trans. In addition, the radiation-sensitive phenotype conferred by a ddrB deletion is not alleviated by providing ssb in trans. By altering expression of the ssb gene, we also show that lower levels of transcription are required for optimal growth than are necessary for high radiation resistance. When expression is reduced to that of E. coli, ionizing radiation resistance is similarly reduced. UV resistance is also decreased under low ssb transcript levels where growth is unimpaired. These results indicate that the expression of ssb is a key component of both normal cellular metabolism as well as pathways responsible for the high radiation tolerance of D. radiodurans.

Saccharomyces cerevisiae SSB1 protein and its relationship to nucleolar RNA-binding proteins.

OpenAIRE

Jong, A Y; Clark, M W; Gilbert, M; Oehm, A; Campbell, J L

1987-01-01

To better define the function of Saccharomyces cerevisiae SSB1, an abundant single-stranded nucleic acid-binding protein, we determined the nucleotide sequence of the SSB1 gene and compared it with those of other proteins of known function. The amino acid sequence contains 293 amino acid residues and has an Mr of 32,853. There are several stretches of sequence characteristic of other eucaryotic single-stranded nucleic acid-binding proteins. At the amino terminus, residues 39 to 54 are highly ...

Advanced High Frequency Communication and Optoelectronic Radar Systems

National Research Council Canada - National Science Library

2001-01-01

We have demonstrated photonic time-stretching (PTS) of radio frequency (RF) signals using our novel polymer modulators and two techniques to reduce the power penalty from the effects of fiber chromatic dispersion. A Single-sideband (SSB...

A 6-9 GHz 5-band CMOS synthesizer for MB-OFDM UWB

International Nuclear Information System (INIS)

Chen Pufeng; Li Zhiqiang; Wang Xiaosong; Zhang Haiying; Ye Tianchun

2010-01-01

An ultra-wideband frequency synthesizer is designed to generate carrier frequencies for 5 bands distributed from 6 to 9 GHz with less than 3 ns switching time. It incorporates two phase-locked loops and one single-sideband (SSB) mixer. A 2-to-1 multiplexer with high linearity is proposed. A modified wideband SSB mixer, quadrature VCO, and layout techniques are also employed. The synthesizer is fabricated in a 0.18 μm CMOS process and operates at 1.5-1.8 V while consuming 40 mA current. The measured phase noise is -128 dBc/Hz at 10 MHz offset, and the sideband rejection is -22 dBc at 7.656 GHz.

A 6-9 GHz 5-band CMOS synthesizer for MB-OFDM UWB

Energy Technology Data Exchange (ETDEWEB)

Chen Pufeng; Li Zhiqiang; Wang Xiaosong; Zhang Haiying; Ye Tianchun, E-mail: chenpufeng@ime.ac.c [Institute of Microelectronics, Chinese Academy of Sciences, Beijing 100029 (China)

2010-07-15

An ultra-wideband frequency synthesizer is designed to generate carrier frequencies for 5 bands distributed from 6 to 9 GHz with less than 3 ns switching time. It incorporates two phase-locked loops and one single-sideband (SSB) mixer. A 2-to-1 multiplexer with high linearity is proposed. A modified wideband SSB mixer, quadrature VCO, and layout techniques are also employed. The synthesizer is fabricated in a 0.18 {mu}m CMOS process and operates at 1.5-1.8 V while consuming 40 mA current. The measured phase noise is -128 dBc/Hz at 10 MHz offset, and the sideband rejection is -22 dBc at 7.656 GHz.

Dicty_cDB: SSB171 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h

Development and Evaluation of the Sugar-Sweetened Beverages Media Literacy (SSB-ML) Scale and Its Relationship With SSB Consumption

Science.gov (United States)

Chen, Yvonnes; Porter, Kathleen J.; Estabrooks, Paul A.; Zoellner, Jamie

2017-01-01

Understanding how adults’ media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) scale and its subdomains, (b) examine how the scale varies across demographic variables, and (c) explain the scale’s concurrent validity to predict SSB consumption. Results from 293 adults in rural southwestern Virginia (81.6% female, 94.0% White, 54.1% receiving SNAP and/or WIC benefits, average 410 SSB kcal daily) show that overall SSB-ML scale and its subdomains have strong internal consistencies (Cronbach’s alphas ranging from 0.65 to 0.83). The Representation & Reality domain significantly predicted SSB kilocalories, after controlling for demographic variables. This study has implications for the assessment and inclusion of context-specific media literacy skills in behavioral interventions. PMID:27690635

Development and Evaluation of the Sugar-Sweetened Beverages Media Literacy (SSB-ML) Scale and Its Relationship With SSB Consumption.

Science.gov (United States)

Chen, Yvonnes; Porter, Kathleen J; Estabrooks, Paul A; Zoellner, Jamie

2017-10-01

Understanding how adults' media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) scale and its subdomains, (b) examine how the scale varies across demographic variables, and (c) explain the scale's concurrent validity to predict SSB consumption. Results from 293 adults in rural southwestern Virginia (81.6% female, 94.0% White, 54.1% receiving SNAP and/or WIC benefits, average 410 SSB kcal daily) show that overall SSB-ML scale and its subdomains have strong internal consistencies (Cronbach's alphas ranging from 0.65 to 0.83). The Representation & Reality domain significantly predicted SSB kilocalories, after controlling for demographic variables. This study has implications for the assessment and inclusion of context-specific media literacy skills in behavioral interventions.

Dicty_cDB: SSB322 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E

Fiber-FSO/wireless convergent systems based on dual-polarization and one optical sideband transmission schemes

Science.gov (United States)

Huang, Xu-Hong; Lu, Hai-Han; Li, Chung-Yi; Wang, Yun-Chieh; Chang, Jen-Chieh; Jheng, Yu-Bo; Tsai, Wen-Shing

2018-06-01

A bidirectional fiber-free-space optical (FSO)/wireless convergent system that uses dual-polarization and one optical sideband transmission schemes for hybrid vestigial sideband (VSB)–four-level pulse amplitude modulation (PAM4)/millimeter-wave signal transmission is proposed and demonstrated. Using a dual-polarization scheme, one optical sideband that is modulated by a 56 Gb s‑1 VSB–PAM4 signal (x-polarization) and another optical sideband that is modulated by a 10 Gbps data stream (y-polarization) are separated and polarized orthogonally. One optical sideband modulated by a 10 Gbps data stream (y-polarization) is delivered to efficaciously suppress the dispersion-induced limitation due to a span of 40 km single-mode fiber (SMF) and the distortion due to the beating among multiple sidebands. The proposed bidirectional fiber-FSO/wireless convergent system is a prominent one for providing broadband integrated services, such as the Internet, telecommunication, and 5G mobile networks.

Multi-tap complex-coefficient incoherent microwave photonic filters based on optical single-sideband modulation and narrow band optical filtering.

Science.gov (United States)

Sagues, Mikel; García Olcina, Raimundo; Loayssa, Alayn; Sales, Salvador; Capmany, José

2008-01-07

We propose a novel scheme to implement tunable multi-tap complex coefficient filters based on optical single sideband modulation and narrow band optical filtering. A four tap filter is experimentally demonstrated to highlight the enhanced tuning performance provided by complex coefficients. Optical processing is performed by the use of a cascade of four phase-shifted fiber Bragg gratings specifically fabricated for this purpose.

Conversion from non-orthogonally to orthogonally polarized optical single-sideband modulation using optically injected semiconductor lasers.

Science.gov (United States)

Hung, Yu-Han; Tseng, Chin-Hao; Hwang, Sheng-Kwang

2018-06-01

This Letter investigates an optically injected semiconductor laser for conversion from non-orthogonally to orthogonally polarized optical single-sideband modulation. The underlying mechanism relies solely on nonlinear laser characteristics and, thus, only a typical semiconductor laser is required as the key conversion unit. This conversion can be achieved for a broadly tunable frequency range up to at least 65 GHz. After conversion, the microwave phase quality, including linewidth and phase noise, is mostly preserved, and simultaneous microwave amplification up to 23 dB is feasible.

A Sideband-Separating Mixer Upgrade for ALMA Band 9

NARCIS (Netherlands)

Hesper, R.; Gerlofsma, G.; Mena, P.; Spaans, M.; Baryshev, A.

2009-01-01

The ALMA band 9 (600-720 GHz) receiver cartridge, as currently being produced, features two single-ended (dual sideband) SIS mixers in orthogonal polarisations. In the case of spectral line observations in the presence of atmospheric backgound, the integration time to reach a certain desired signal

Development and Evaluation of the Sugar-Sweetened Beverages Media Literacy (SSB-ML) Scale and Its Relationship With SSB Consumption

OpenAIRE

Chen, Yvonnes; Porter, Kathleen J.; Estabrooks, Paul A.; Zoellner, Jamie

2016-01-01

Understanding how adults’ media literacy skill sets impact their sugar-sweetened beverage (SSB) intake provides insight into designing effective interventions to enhance their critical analysis of marketing messages and thus improve their healthy beverage choices. However, a media literacy scale focusing on SSBs is lacking. This cross-sectional study uses baseline data from a large randomized controlled trial to (a) describe the psychometric properties of an SSB Media Literacy Scale (SSB-ML) ...

Smart sustainable bottle (SSB) system for E. coli based recombinant protein production.

Science.gov (United States)

Li, Zhaopeng; Carstensen, Bettina; Rinas, Ursula

2014-11-05

Recombinant proteins are usually required in laboratories interested in the protein but not in the production process itself. Thus, technical equipment which is easy to handle and straight forward protein production procedures are of great benefit to those laboratories. Companies selling single use cultivation bags and bioreactors are trying to satisfy at least part of these needs. However, single-use systems can contribute to major costs which might be acceptable when "good manufacturing practices" are required but not acceptable for most laboratories facing tight funding. The assembly and application of a simple self-made "smart sustainable bottle" (SSB) system for E. coli based protein production is presented. The core of the SSB system is a 2-L glass bottle which is operated at constant temperature, air flow, and stirrer speed without measurement and control of pH and dissolved oxygen. Oxygen transfer capacities are in the range as in conventional bioreactors operated at intermediate aeration rates and by far exceed those found in conventional shaking flasks and disposable bioreactors. The SSB system was applied for the production of various recombinant proteins using T7-based expression systems and a defined autoinduction medium. The production performance regarding amount and solubility of proteins with robust and delicate properties was as good as in state-of-the-art stirred tank commercial bioreactors. The SSB system represents a low cost protein production device applicable for easy, effective, and reproducible recombinant protein production.

Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

Directory of Open Access Journals (Sweden)

Ivett María Ramírez-Pérez

2017-01-01

Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

Analysis of second order harmonic distortion due to transmitter non-linearity and chromatic and modal dispersion of optical OFDM SSB modulated signals in SMF-MMF fiber links

Science.gov (United States)

Patel, Dhananjay; Singh, Vinay Kumar; Dalal, U. D.

2017-01-01

Single mode fibers (SMF) are typically used in Wide Area Networks (WAN), Metropolitan Area Networks (MAN) and also find applications in Radio over Fiber (RoF) architectures supporting data transmission in Fiber to the Home (FTTH), Remote Antenna Units (RAUs), in-building networks etc. Multi-mode fibers (MMFs) with low cost, ease of installation and low maintenance are predominantly (85-90%) deployed in-building networks providing data access in local area networks (LANs). The transmission of millimeter wave signals through the SMF in WAN and MAN, along with the reuse of MMF in-building networks will not levy fiber reinstallation cost. The transmission of the millimeter waves experiences signal impairments due to the transmitter non-linearity and modal dispersion of the MMF. The MMF exhibiting large modal dispersion limits the bandwidth-length product of the fiber. The second and higher-order harmonics present in the optical signal fall within the system bandwidth. This causes degradation in the received signal and an unwanted radiation of power at the RAU. The power of these harmonics is proportional to the non-linearity of the transmitter and the modal dispersion of the MMF and should be maintained below the standard values as per the international norms. In this paper, a mathematical model is developed for Second-order Harmonic Distortion (HD2) generated due to non-linearity of the transmitter and chromatic-modal dispersion of the SMF-MMF optic link. This is also verified using a software simulation. The model consists of a Mach Zehnder Modulator (MZM) that generates two m-QAM OFDM Single Sideband (SSB) signals based on phase shift of the hybrid coupler (90° and 120°). Our results show that the SSB signal with 120° hybrid coupler has suppresses the higher-order harmonics and makes the system more robust against the HD2 in the SMF-MMF optic link.

Resolved sidebands in a strain-coupled hybrid spin-oscillator system

OpenAIRE

Teissier, Jean; Barfuss, Arne; Appel, Patrick; Neu, Elke; Maletinsky, P.

2014-01-01

We report on single electronic spins coupled to the motion of mechanical resonators by a novel mechanism based on crystal strain. Our device consists of single-crystalline diamond cantilevers with embedded Nitrogen-Vacancy center spins. Using optically detected electron spin resonance, we determine the unknown spin-strain coupling constants and demonstrate that our system resides well within the resolved sideband regime. We realize coupling strengths exceeding ten MHz under mechanical driving...

Suppression of the Escherichia coli ssb-1 mutation by an allele of groEL.

OpenAIRE

Ruben, S M; VanDenBrink-Webb, S E; Rein, D C; Meyer, R R

1988-01-01

A series of spontaneous suppressors to the temperature-sensitive phenotype of the single-stranded DNA-binding protein mutation ssb-1 were isolated. A genomic library of EcoRI fragments from one of these suppressor strains was prepared by using pBR325 as the cloning vector. A 10.0-kilobase class of inserts was identified as carrying the ssb-1 gene itself. A second class of 8.3-kilobase inserts was shown to contain the groE region by (i) restriction analysis, (ii) Southern hybridization of the ...

Modulation of intracellular protein degradation by SSB1-SIS1 chaperon system in yeast S. cerevisiae.

Science.gov (United States)

Ohba, M

1997-06-09

In prokaryotes, DnaK-DnaJ chaperon is involved in the protein degradation catalyzed by proteases La and ClpA/B complex as shown in E. coli. To extend this into eukaryotic cells, we examined the effects of hsp70 genes, SSA1 and SSB1, and DnaJ genes, SIS1 and YDJ1, on the growth of proteasome subunit mutants of the yeast S. cerevisiae. The results identified SSB1 and SIS1 as a pair of chaperon genes specifically involved in efficient protein turnover in the yeast, whose overexpression suppressed the growth defects caused by the proteasome mutations. Moreover, a single amino acid substitution in the putative peptide-binding site of SSB1 protein profoundly enhanced the suppression activity, indicating that the activity is mediated by the peptide-binding activity of this chaperon. Thus SSB1, with its partner DnaJ, SIS1, modulates the efficiency of protein turnover through its chaperon activity.

Radiation pressure induced difference-sideband generation beyond linearized description

Energy Technology Data Exchange (ETDEWEB)

Xiong, Hao, E-mail: haoxiong1217@gmail.com; Fan, Yu-Wan; Yang, Xiaoxue; Wu, Ying, E-mail: yingwu2@126.com [School of Physics, Huazhong University of Science and Technology, Wuhan 430074 (China)

2016-08-08

We investigate radiation-pressure induced generation of the frequency components at the difference-sideband in an optomechanical system, which beyond the conventional linearized description of optomechanical interactions between cavity fields and the mechanical oscillation. We analytically calculate amplitudes of these signals, and identify a simple square-root law for both the upper and lower difference-sideband generation which can describe the dependence of the intensities of these signals on the pump power. Further calculation shows that difference-sideband generation can be greatly enhanced via achieving the matching conditions. The effect of difference-sideband generation, which may have potential application for manipulation of light, is especially suited for on-chip optomechanical devices, where nonlinear optomechanical interaction in the weak coupling regime is within current experimental reach.

Tunable microwave photonic filter free from baseband and carrier suppression effect not requiring single sideband modulation using a Mach-Zenhder configuration.

Science.gov (United States)

Mora, José; Ortigosa-Blanch, Arturo; Pastor, Daniel; Capmany, José

2006-08-21

We present a full theoretical and experimental analysis of a novel all-optical microwave photonic filter combining a mode-locked fiber laser and a Mach-Zenhder structure in cascade to a 2x1 electro-optic modulator. The filter is free from the carrier suppression effect and thus it does not require single sideband modulation. Positive and negative coefficients are obtained inherently in the system and the tunability is achieved by controlling the optical path difference of the Mach-Zenhder structure.

Fixed-Tuned Waveguide 0.6 THz SIS Mixer with Wide Band IF

NARCIS (Netherlands)

Baryshev, A.; Lauria, E.; Hesper, R.; Zijistra, T.; Wild, W.

2002-01-01

The Atacama Large Millimeter Array (ALMA) requires low noise SIS receivers for frequencies from about 80 GHz to 950 GHz with a very large IF bandwidth (8 GHz SSB upper or lower sideband, 8 GHz DSB or 4 GHz dual sideband, upper and lower sideband). Since there will be a large number of antennas in

Multichannel heterodyne radiometers with fast-scanning backward-wave oscillators for ECE measurement on HT-7 tokamak

International Nuclear Information System (INIS)

Zhang, S.Y.; Poznyak, V.I.; Ploskirev, G.; Kalupin, D.; Wan, Y.X.; Xie, J.K.; Luo, J.R.; Li, J.G.; Gao, X.; Wan, B.N.; Zhang, X.D.; Wang, K.J.; Kuang, G.L.

2001-01-01

Two sets of fast-scanning heterodyne radiometer receiver systems employing backward-wave oscillators (BWOs) in 78-118 and 118-178 GHz were developed and installed for electron cyclotron emission (ECE) measurements on HT-7 superconducting tokamak. The double sideband (DSB) radiometer in 78-118 GHz measures 16 ECE frequency points with a scanning time period of 0.65 ms. The other radiometer in 118-178 GHz consists of one independent channel of DSB heterodyne receiver with intermediate frequency (IF) of 100-500 MHz and two channels of single sideband (SSB) heterodyne receiver that are sensitive to upper sideband and lower sideband individually; the IF frequency of the SSB channels are 1.5 GHz around the local oscillator frequencies with 1 GHz bandwidth. By employing a novel design, this unique radiometer measures 3 ECE frequency points at each of the 16 local oscillator frequency points in 118-178 GHz, and the full band can be swept in 0.65 ms period, thus the radiometer measures 48 ECE frequency points in 0.65 ms in principle. Each of the local oscillators' frequency points can be preset by program to meet specific physics interests. Horizontal view of ECE was installed to measure electron temperature profiles; vertically viewing optics along a perpendicular chord was also installed to study nonthermal ECE spectra. Preliminary measurement results were presented during ohmic and pellet injection plasmas

First Results of the Sideband-Separating Mixer for ALMA Band 9 Upgrade

NARCIS (Netherlands)

Khudchenko, Andrey; Hesper, Ronald; Baryshev, Andrey; Mena, F. Patricio; Gerlofma, Gerrit; Zijlstra, Tony; Klapwijk, Teun M.; Kooi, Jacob W.; Spaans, Marco

2011-01-01

Last year, the design and implementation details of a new modular sideband-separating mixer block, intended as an upgrade for the current single-ended ALMA Band 9 mixers, were presented at this conference. In high-frequency observation bands like ALMA Band 9 (600-720 GHz), which is strongly

Wideband optical vector network analyzer based on optical single-sideband modulation and optical frequency comb.

Science.gov (United States)

Xue, Min; Pan, Shilong; He, Chao; Guo, Ronghui; Zhao, Yongjiu

2013-11-15

A novel approach to increase the measurement range of the optical vector network analyzer (OVNA) based on optical single-sideband (OSSB) modulation is proposed and experimentally demonstrated. In the proposed system, each comb line in an optical frequency comb (OFC) is selected by an optical filter and used as the optical carrier for the OSSB-based OVNA. The frequency responses of an optical device-under-test (ODUT) are thus measured channel by channel. Because the comb lines in the OFC have fixed frequency spacing, by fitting the responses measured in all channels together, the magnitude and phase responses of the ODUT can be accurately achieved in a large range. A proof-of-concept experiment is performed. A measurement range of 105 GHz and a resolution of 1 MHz is achieved when a five-comb-line OFC with a frequency spacing of 20 GHz is applied to measure the magnitude and phase responses of a fiber Bragg grating.

Development of a signal-extraction scheme for resonant sideband extraction

International Nuclear Information System (INIS)

Kokeyama, K; Kawazoe, F; Sugamoto, A; Somiya, K; Sato, S; Kawamura, S

2008-01-01

As a future plan, an advanced gravitational-wave detector will employ an optical configuration of resonant sideband extraction (RSE), achieved with an additional mirror at the signal-detection port of the power-recycled Fabry-Perot Michelson interferometer. To control the complex coupled cavity system, one of the most important design issues is how to extract the longitudinal control signals of the cavities. We have developed a new signal-extraction scheme which provides an appropriate sensing matrix. The new method uses two sets of sidebands: one of the sideband components satisfies the critical coupling condition for the RSE interferometer and reaches the signal-extraction port, and the other sideband is completely reflected by the Michelson interferometer. They provide a diagonalized sensing matrix and enable the RSE control to be robust

The generation and suppression of synchrotron sidebands

International Nuclear Information System (INIS)

Warren, R.W.; Goldstein, J.C.

1987-01-01

Computer simulations of FEL lasing differ in the degree to which they approximate real experiments. One of the FEL codes used extensively at Los Alamos takes account of the features of each electron micropulse and follows the growth and saturation of the optical micropulse. With no additional adjustments, this code displays the development of sidebands and demonstrates their control when optical filters of various kinds are used. Other codes that do not include a description of the micropulse do not automatically display sidebands but need to have artificial noise of some kind added. This is not unexpected because sidebands are generated by an FEL instability; instabilities, in general, need some kind of initiating disturbance. In this paper we: identify the disturbance that triggers the instability in the pulse code; discuss a practical way to suppress the instability without using filters; compare these results with experiments; and discuss these findings. 22 refs., 9 figs

Dynamic Rabi sidebands in laser-generated microplasmas: Tunability and control

International Nuclear Information System (INIS)

Compton, R.; Filin, A.; Levis, R. J.; Romanov, D. A.

2011-01-01

Broadband, coherent radiation in the optical-frequency range is generated using microplasma channels in atmospheric gases in a pump-probe experiment. A microplasma medium is created in a gas by a focused intense femtosecond pump pulse. A picosecond probe pulse then interacts with this microplasma channel, producing broad, coherent sidebands that are associated with luminescence lines and are redshifted and blueshifted with respect to the laser carrier frequency. These sidebands originate from the induced Rabi oscillations between pairs of excited states that are coupled by the probe pulse. Thus the sideband radiation intensity tracks the microplasma evolution. The sidebands arise from broad and tunable Rabi shifts corresponding to varying values of the electric-field magnitude in the probe pulse. The ∼10 10 W cm -2 probe beam creates a maximum sideband shift of >90 meV from the carrier frequency, resulting in an effective bandwidth of 200 meV. The sidebands can be tuned and controlled by the intensity and temporal profile of the probe pulse. The fact that the coherence is observed in a microplasma demonstrates that Rabi cycling is possible at high temperature with moderately high laser intensities as long as transitions close to the driving frequency (Δ∼2%ω c ) are available. Plasma excitation combined with Rabi-shifting measurements also serves as a means to simultaneously extract quantitative ratios for the transition-dipole moments between multiple sets of highly excited states with transitions in the optical regime.

The Reg1-interacting proteins, Bmh1, Bmh2, Ssb1, and Ssb2, have roles in maintaining glucose repression in Saccharomyces cerevisiae.

Science.gov (United States)

Dombek, Kenneth M; Kacherovsky, Nataly; Young, Elton T

2004-09-10

In Saccharomyces cerevisiae, a type 1 protein phosphatase complex composed of the Glc7 catalytic subunit and the Reg1 regulatory subunit represses expression of many glucose-regulated genes. Here we show that the Reg1-interacting proteins Bmh1, Bmh2, Ssb1, and Ssb2 have roles in glucose repression. Deleting both BMH genes causes partially constitutive ADH2 expression without significantly increasing the level of Adr1 protein, the major activator of ADH2 expression. Adr1 and Bcy1, the regulatory subunit of cAMP-dependent protein kinase, are both required for this effect indicating that constitutive expression in Deltabmh1Deltabmh2 cells uses the same activation pathway that operates in Deltareg1 cells. Deletion of both BMH genes and REG1 causes a synergistic relief from repression, suggesting that Bmh proteins also act independently of Reg1 during glucose repression. A two-hybrid interaction with the Bmh proteins was mapped to amino acids 187-232, a region of Reg1 that is conserved in different classes of fungi. Deleting this region partially releases SUC2 from glucose repression. This indicates a role for the Reg1-Bmh interaction in glucose repression and also suggests a broad role for Bmh proteins in this process. An in vivo Reg1-Bmh interaction was confirmed by copurification of Bmh proteins with HA(3)-TAP-tagged Reg1. The nonconventional heat shock proteins Ssb1 and Ssb2 are also copurified with HA(3)-TAP-tagged Reg1. Deletion of both SSB genes modestly decreases repression of ADH2 expression in the presence of glucose, suggesting that Ssb proteins, perhaps through their interaction with Reg1, play a minor role in glucose repression.

Dispersion induced power fading for radio frequency signals and its application for fast online PMD and CD monitoring

Science.gov (United States)

Ning, G.; Shum, P.

2007-06-01

We derive the expressions for the power fading including first-order polarization mode dispersion (PMD), chromatic dispersion, chirp parameter as well as polarization-dependent chromatic dispersion (PCD), which is dependent on the angle of precession of output state of polarization around the PMD vector. From the expression for radio frequency (RF) signals power fading, we get the average power fading for chromatic dispersion, chirp parameter, first-order PMD and PCD for both double sideband (DSB) modulation and single sideband (SSB) modulation. We also demonstrate a fast PMD and chromatic dispersion monitoring technology with reduced polarization-dependent gain. The measured results agree well with theoretical analysis.

Purification of ribonucleoproteins by a novel approach: isolation of the SSB1 ribonucleoprotein from yeast and demonstration that it has no role in mRNA splicing.

Science.gov (United States)

Cusick, M E

1992-12-29

A novel approach is described to purify potential ribonucleoproteins (RNP) of yeast. The method assays a yeast RNP complex, assembled in vitro on actin pre-mRNA, by low-ionic strength acrylamide gel electrophoresis. The minimal protein components of this RNP complex were three proteins, one of 30 kDa and two at 42-44 kDa, defined by formation of the complex on biotinylated-RNA, binding of this complex to avidin-agarose, and salt elution of the protein in the biotinylated-RNP complex. Using the assay for RNP complex formation, an RNP protein was purified to homogeneity on the basis of its affinity towards single-stranded DNA and RNA. This RNP protein turned out to be identical to a known RNP protein, the single-stranded binding protein 1 (ssb1) of yeast, on the basis of identical gel electrophoretic migration, antibody cross-reactivity, and identical properties on the gel complex formation assay. In vitro mRNA splicing was normal in extracts made from a yeast strain missing ssb1 (ssb1- strain). Addition of anti-ssb1 antibody to splicing extracts made from a wild type strain did not inhibit or diminish splicing. Instead, mRNA splicing was reproducibly stimulated several fold, indicating competition between ssb1 and splicing factors for binding to single-stranded RNA in the extracts. RNP complexes still formed in the ssb1- strain, demonstrating that it would be possible to purify other RNP proteins from this strain using the gel complex formation assay.

The C-terminal domain of the bacterial SSB protein acts as a DNA maintenance hub at active chromosome replication forks.

Directory of Open Access Journals (Sweden)

Audrey Costes

2010-12-01

Full Text Available We have investigated in vivo the role of the carboxy-terminal domain of the Bacillus subtilis Single-Stranded DNA Binding protein (SSB(Cter as a recruitment platform at active chromosomal forks for many proteins of the genome maintenance machineries. We probed this SSB(Cter interactome using GFP fusions and by Tap-tag and biochemical analysis. It includes at least 12 proteins. The interactome was previously shown to include PriA, RecG, and RecQ and extended in this study by addition of DnaE, SbcC, RarA, RecJ, RecO, XseA, Ung, YpbB, and YrrC. Targeting of YpbB to active forks appears to depend on RecS, a RecQ paralogue, with which it forms a stable complex. Most of these SSB partners are conserved in bacteria, while others, such as the essential DNA polymerase DnaE, YrrC, and the YpbB/RecS complex, appear to be specific to B. subtilis. SSB(Cter deletion has a moderate impact on B. subtilis cell growth. However, it markedly affects the efficiency of repair of damaged genomic DNA and arrested replication forks. ssbΔCter mutant cells appear deficient in RecA loading on ssDNA, explaining their inefficiency in triggering the SOS response upon exposure to genotoxic agents. Together, our findings show that the bacterial SSB(Cter acts as a DNA maintenance hub at active chromosomal forks that secures their propagation along the genome.

Sideband cooling and coherent dynamics in a microchip multi-segmented ion trap

Energy Technology Data Exchange (ETDEWEB)

Schulz, Stephan A; Poschinger, Ulrich; Ziesel, Frank; Schmidt-Kaler, Ferdinand [Universitaet Ulm, Institut fuer Quanteninformationsverarbeitung, Albert-Einstein-Allee 11, D-89069 Ulm (Germany)], E-mail: stephan.schulz@uni-ulm.de

2008-04-15

Miniaturized ion trap arrays with many trap segments present a promising architecture for scalable quantum information processing. The miniaturization of segmented linear Paul traps allows partitioning the microtrap into different storage and processing zones. The individual position control of many ions-each of them carrying qubit information in its long-lived electronic levels-by the external trap control voltages is important for the implementation of next generation large-scale quantum algorithms. We present a novel scalable microchip multi-segmented ion trap with two different adjacent zones, one for the storage and another dedicated to the processing of quantum information using single ions and linear ion crystals. A pair of radio-frequency-driven electrodes and 62 independently controlled dc electrodes allows shuttling of single ions or linear ion crystals with numerically designed axial potentials at axial and radial trap frequencies of a few megahertz. We characterize and optimize the microtrap using sideband spectroscopy on the narrow S{sub 1/2}{r_reversible}D{sub 5/2} qubit transition of the {sup 40}Ca{sup +} ion, and demonstrate coherent single-qubit Rabi rotations and optical cooling methods. We determine the heating rate using sideband cooling measurements to the vibrational ground state, which is necessary for subsequent two-qubit quantum logic operations. The applicability for scalable quantum information processing is proved.

Radiation pressure induced difference-sideband generation beyond linearized description

OpenAIRE

Xiong, Hao; Fan, Y. W.; Yang, X.; Wu, Y.

2016-01-01

We investigate radiation-pressure induced generation of the frequency components at the difference-sideband in an optomechanical system, which beyond the conventional linearized description of optomechanical interactions between cavity fields and the mechanical oscillation. We analytically calculate amplitudes of these signals, and identify a simple square-root law for both the upper and lower difference-sideband generation which can describe the dependence of the intensities of these signals...

RPA70 depletion induces hSSB1/2-INTS3 complex to initiate ATR signaling

OpenAIRE

Kar, Ananya; Kaur, Manpreet; Ghosh, Tanushree; Khan, Md. Muntaz; Sharma, Aparna; Shekhar, Ritu; Varshney, Akhil; Saxena, Sandeep

2015-01-01

The primary eukaryotic single-stranded DNA-binding protein, Replication protein A (RPA), binds to single-stranded DNA at the sites of DNA damage and recruits the apical checkpoint kinase, ATR via its partner protein, ATRIP. It has been demonstrated that absence of RPA incapacitates the ATR-mediated checkpoint response. We report that in the absence of RPA, human single-stranded DNA-binding protein 1 (hSSB1) and its partner protein INTS3 form sub-nuclear foci, associate with the ATR-ATRIP comp...

Sideband cooling of micromechanical motion to the quantum ground state.

Science.gov (United States)

Teufel, J D; Donner, T; Li, Dale; Harlow, J W; Allman, M S; Cicak, K; Sirois, A J; Whittaker, J D; Lehnert, K W; Simmonds, R W

2011-07-06

The advent of laser cooling techniques revolutionized the study of many atomic-scale systems, fuelling progress towards quantum computing with trapped ions and generating new states of matter with Bose-Einstein condensates. Analogous cooling techniques can provide a general and flexible method of preparing macroscopic objects in their motional ground state. Cavity optomechanical or electromechanical systems achieve sideband cooling through the strong interaction between light and motion. However, entering the quantum regime--in which a system has less than a single quantum of motion--has been difficult because sideband cooling has not sufficiently overwhelmed the coupling of low-frequency mechanical systems to their hot environments. Here we demonstrate sideband cooling of an approximately 10-MHz micromechanical oscillator to the quantum ground state. This achievement required a large electromechanical interaction, which was obtained by embedding a micromechanical membrane into a superconducting microwave resonant circuit. To verify the cooling of the membrane motion to a phonon occupation of 0.34 ± 0.05 phonons, we perform a near-Heisenberg-limited position measurement within (5.1 ± 0.4)h/2π, where h is Planck's constant. Furthermore, our device exhibits strong coupling, allowing coherent exchange of microwave photons and mechanical phonons. Simultaneously achieving strong coupling, ground state preparation and efficient measurement sets the stage for rapid advances in the control and detection of non-classical states of motion, possibly even testing quantum theory itself in the unexplored region of larger size and mass. Because mechanical oscillators can couple to light of any frequency, they could also serve as a unique intermediary for transferring quantum information between microwave and optical domains.

Dicty_cDB: SSB373 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp

Translations on Telecommunications Policy, Research and Development No. 18

Science.gov (United States)

1977-10-27

Rico and El Dorado, with an alternative route toward Brazil, through Foz do Iguazu and the enlarged radio connection between Buenos Aires and Campo ...nor the more recently studied infrasound. By sound, in and of itself, we understand noise, music and speech. The first of these, about which there...is used for television audio, and for special radio music . 3. Single sideband (SSB). In this type of transmission, we work with only one of the

The SSB-positive/SSA-negative antibody profile is not associated with key phenotypic features of Sjögren's syndrome

DEFF Research Database (Denmark)

Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C

2015-01-01

phenotypic features. Among SICCA participants classified with SS on the basis of the American-European Consensus Group or American College of Rheumatology criteria, only 2% required the anti-SSB-alone test result to meet these criteria. CONCLUSIONS: The presence of anti-SSB, without anti-SSA antibodies, had...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than...... in those with anti-SSB alone or negative SSA/SSB serology. These between-group differences were highly significant and not explained by confounding by age, race/ethnicity or gender. Participants with anti-SSB alone were comparable to those with negative SSA/SSB serology in their association with these key...

Understanding photon sideband statistics and correlation for determining phonon coherence

Science.gov (United States)

Ding, Ding; Yin, Xiaobo; Li, Baowen

2018-01-01

Generating and detecting coherent high-frequency heat-carrying phonons have been topics of great interest in recent years. Although there have been successful attempts in generating and observing coherent phonons, rigorous techniques to characterize and detect phonon coherence in a crystalline material have been lagging compared to what has been achieved for photons. One main challenge is a lack of detailed understanding of how detection signals for phonons can be related to coherence. The quantum theory of photoelectric detection has greatly advanced the ability to characterize photon coherence in the past century, and a similar theory for phonon detection is necessary. Here, we reexamine the optical sideband fluorescence technique that has been used to detect high-frequency phonons in materials with optically active defects. We propose a quantum theory of phonon detection using the sideband technique and found that there are distinct differences in sideband counting statistics between thermal and coherent phonons. We further propose a second-order correlation function unique to sideband signals that allows for a rigorous distinction between thermal and coherent phonons. Our theory is relevant to a correlation measurement with nontrivial response functions at the quantum level and can potentially bridge the gap of experimentally determining phonon coherence to be on par with that of photons.

Cavity sideband cooling of trapped molecules

NARCIS (Netherlands)

Kowalewski, Markus; Morigi, Giovanna; Pinkse, Pepijn Willemszoon Harry; de Vivie-Riedle, Regina

2011-01-01

The efficiency of cavity sideband cooling of trapped molecules is theoretically investigated for the case in which the infrared transition between two rovibrational states is used as a cycling transition. The molecules are assumed to be trapped either by a radiofrequency or optical trapping

Microfabricated high-bandpass foucault aperture for electron microscopy

Energy Technology Data Exchange (ETDEWEB)

Glaeser, Robert; Cambie, Rossana; Jin, Jian

2014-08-26

A variant of the Foucault (knife-edge) aperture is disclosed that is designed to provide single-sideband (SSB) contrast at low spatial frequencies but retain conventional double-sideband (DSB) contrast at high spatial frequencies in transmission electron microscopy. The aperture includes a plate with an inner open area, a support extending from the plate at an edge of the open area, a half-circle feature mounted on the support and located at the center of the aperture open area. The radius of the half-circle portion of reciprocal space that is blocked by the aperture can be varied to suit the needs of electron microscopy investigation. The aperture is fabricated from conductive material which is preferably non-oxidizing, such as gold, for example.

Quantum Control of a Nitrogen-Vacancy Center using Surface Acoustic Waves in the Resolved Sideband Limit

Science.gov (United States)

Golter, David; Oo, Thein; Amezcua, Maira; Wang, Hailin

Micro-electromechanical systems research is producing increasingly sophisticated tools for nanophononic applications. Such technology is well-suited for achieving chip-based, integrated acoustic control of solid-state quantum systems. We demonstrate such acoustic control in an important solid-state qubit, the diamond nitrogen-vacancy (NV) center. Using an interdigitated transducer to generate a surface acoustic wave (SAW) field in a bulk diamond, we observe phonon-assisted sidebands in the optical excitation spectrum of a single NV center. This exploits the strong strain sensitivity of the NV excited states. The mechanical frequencies far exceed the relevant optical linewidths, reaching the resolved-sideband regime. This enables us to use the SAW field for driving Rabi oscillations on the phonon-assisted optical transition. These results stimulate the further integration of SAW-based technologies with the NV center system.

Ssb1 chaperone is a [PSI+] prion-curing factor.

Science.gov (United States)

Chacinska, A; Szczesniak, B; Kochneva-Pervukhova, N V; Kushnirov, V V; Ter-Avanesyan, M D; Boguta, M

2001-04-01

Yeast SUP7' or SUP11 nonsense suppressors have no phenotypic expression in strains deficient in the isopentenylation of A37 in tRNA. Here we show that such strains spontaneously produce cells with a nonsense suppressor phenotype which is related to the cytoplasmically inherited determinant and manifests all the key features of the [PSI+] prion. A screen of a multicopy yeast genomic library for genes that inactivate the [PSI+]-related suppressor phenotype resulted in the isolation of the SSB1 gene. Moreover, we demonstrate that multicopy plasmid encoding the Ssb1 chaperone cures cells of the [PSI+] prion.

Demonstration of the spatial separation of the entangled quantum sidebands of an optical field

International Nuclear Information System (INIS)

Huntington, E.H.; Milford, G.N.; Robilliard, C.; Ralph, T.C.; Gloeckl, O.; Andersen, U.L.; Lorenz, S.; Leuchs, G.

2005-01-01

Quantum optics experiments on 'bright' beams are based on the spectral analysis of field fluctuations and typically probe correlations between radio-frequency sideband modes. However, the extra degree of freedom represented by this dual-mode picture is generally ignored. We demonstrate the experimental operation of a device which can be used to separate the quantum sidebands of an optical field. We use this device to explicitly demonstrate the quantum entanglement between the sidebands of a squeezed beam

Quadrature measurements of a bright squeezed state via sideband swapping

DEFF Research Database (Denmark)

Schneider, J.; Glockl, O.; Leuchs, G.

2009-01-01

The measurement of an arbitrary quadrature of a bright quantum state of light is a commonly requested action in many quantum information protocols, but it is experimentally challenging with previously proposed schemes. We suggest that the quadrature be measured at a specific sideband frequency...... of a bright quantum state by transferring the sideband modes under interrogation to a vacuum state and subsequently measuring the quadrature via homodyne detection. The scheme is implemented experimentally, and it is successfully tested with a bright squeezed state of light....

A data-driven structural model of hSSB1 (NABP2/OBFC2B) self-oligomerization

OpenAIRE

Touma, Christine; Adams, Mark N.; Ashton, Nicholas W.; Mizzi, Michael; El-Kamand, Serene; Richard, Derek J.; Cubeddu, Liza; Gamsjaeger, Roland

2017-01-01

Abstract The maintenance of genome stability depends on the ability of the cell to repair DNA efficiently. Single-stranded DNA binding proteins (SSBs) play an important role in DNA processing events such as replication, recombination and repair. While the role of human single-stranded DNA binding protein 1 (hSSB1/NABP2/OBFC2B) in the repair of double-stranded breaks has been well established, we have recently shown that it is also essential for the base excision repair (BER) pathway following...

Optical Sideband Generation: a Longitudinal Electron Beam Diagnostic Beyond the Laser Bandwidth Resolution Limit

Energy Technology Data Exchange (ETDEWEB)

Lawrence Berkeley National Laboratory; Tilborg, J. van; Matlis, N. H.; Plateau, G. R.; Leemans, W. P.

2010-06-01

Electro-optic sampling (EOS) is widely used as a technique to measure THz-domain electric field pulses such asthe self-fields of femtosecond electron beams. We present an EOS-based approach for single-shot spectral measurement that excels in simplicity (compatible with fiber integration) and bandwidth coverage (overcomes the laser bandwidth limitation), allowing few-fs electron beams or single-cycle THz pulses to be characterized with conventional picosecond probes. It is shown that the EOS-induced optical sidebands on the narrow-bandwidth optical probe are spectrally-shifted replicas of the THz pulse. An experimental demonstration on a 0-3 THz source is presented.

Note on sideband intensities in one-dimensional magic angle spinning nuclear magnetic resonance

NARCIS (Netherlands)

Well, van H.F.J.M.; Vankan, J.M.J.; Janssen, A.J.E.M.

1991-01-01

It is well known that in the NMR spectra of solid samples spinning at the magic angle centrebands and sidebands occur. The centrebands are found at the isotropic value of the chemical shift and the sidebands are found at integral multiples of the spinning frequency as long as the spinning frequency

Cluster-based single-sink wireless sensor networks and passive optical network converged network incorporating sideband modulation schemes

Science.gov (United States)

Kumar, Love; Sharma, Vishal; Singh, Amarpal

2018-02-01

Wireless sensor networks have tremendous applications, such as civil, military, and environmental monitoring. In most of the applications, sensor data are required to be propagated over the internet/core networks, which result in backhaul setback. Subsequently, there is a necessity to backhaul the sensed information of such networks together with prolonging of the transmission link. Passive optical network (PON) is next-generation access technology emerging as a potential candidate for convergence of the sensed data to the core system. Earlier, the work with single-optical line terminal-PON was demonstrated and investigated merely analytically. This work is an attempt to demonstrate a practical model of a bidirectional single-sink wireless sensor network-PON converged network in which the collected data from cluster heads are transmitted over PON networks. Further, modeled converged structure has been investigated under the influence of double, single, and tandem sideband modulation schemes incorporating a corresponding phase-delay to the sensor data entities that have been overlooked in the past. The outcome illustrates the successful fusion of the sensor data entities over PON with acceptable bit error rate and signal to noise ratio serving as a potential development in the sphere of such converged networks. It has also been revealed that the data entities treated with tandem side band modulation scheme help in improving the performance of the converged structure. Additionally, analysis for uplink transmission reported with queue theory in terms of time cycle, average time delay, data packet generation, and bandwidth utilization. An analytical analysis of proposed converged network shows that average time delay for data packet transmission is less as compared with time cycle delay.

Sideband Separating Mixer for 600-720 GHz

NARCIS (Netherlands)

Khudchenko, Andrey; Hesper, Ronald; Barychev, Andrey; Gerlofma, Gerrit; Mena, Patricio; Zijlstra, Tony; Klapwijk, Teun; Spaans, Marco; Kooi, Jacob W.; Zhang, C; Zhang, XC; Siegel, PH; He, L; Shi, SC

2010-01-01

The ALMA Band 9 receiver cartridge (600-720 GHz) based on Dual Sideband (DSB) superconductor-insulator-superconductor (SIS) mixer is currently in full production. In the case of spectral line observations, the integration time to reach a certain signal-to-noise level can be reduced by about a factor

Control sideband generation for dual-recycled laser interferometric gravitational wave detectors

International Nuclear Information System (INIS)

Barr, B W; Miyakawa, O; Kawamura, S; Weinstein, A J; Ward, R; Vass, S; Strain, K A

2006-01-01

We present a discussion of the problems associated with generation of multiple control sidebands for length sensing and control of dual-recycled, cavity-enhanced Michelson interferometers and the motivation behind more complicated sideband generation methods. We focus on the Mach-Zehnder interferometer as a topological solution to the problem and present results from tests carried out at the Caltech 40 m prototype gravitational wave detector. The consequences for sensing and control for advanced interferometry are discussed, as are the implications for future interferometers such as Advanced LIGO

Improvement of lactic acid production in Saccharomyces cerevisiae by a deletion of ssb1.

Science.gov (United States)

Lee, Jinsuk J; Crook, Nathan; Sun, Jie; Alper, Hal S

2016-01-01

Polylactic acid (PLA) is an important renewable polymer, but current processes for producing its precursor, lactic acid, suffer from process inefficiencies related to the use of bacterial hosts. Therefore, improving the capacity of Saccharomyces cerevisiae to produce lactic acid is a promising approach to improve industrial production of lactic acid. As one such improvement required, the lactic acid tolerance of yeast must be significantly increased. To enable improved tolerance, we employed an RNAi-mediated genome-wide expression knockdown approach as a means to rapidly identify potential genetic targets. In this approach, several gene knockdown targets were identified which confer increased acid tolerance to S. cerevisiae BY4741, of which knockdown of the ribosome-associated chaperone SSB1 conferred the highest increase (52%). This target was then transferred into a lactic acid-overproducing strain of S. cerevisiae CEN.PK in the form of a knockout and the resulting strain demonstrated up to 33% increased cell growth, 58% increased glucose consumption, and 60% increased L-lactic acid production. As SSB1 contains a close functional homolog SSB2 in yeast, this result was counterintuitive and may point to as-yet-undefined functional differences between SSB1 and SSB2 related to lactic acid production. The final strain produced over 50 g/L of lactic acid in under 60 h of fermentation.

Molecular cloning of a Candida albicans gene (SSB1) coding for a protein related to the Hsp70 family.

Science.gov (United States)

Maneu, V; Cervera, A M; Martinez, J P; Gozalbo, D

1997-06-15

We have cloned and sequenced a Candida albicans gene (SSB1) encoding a potential member of the heat-shock protein seventy (hsp70) family. The protein encoded by this gene contains 613 amino acids and shows a high degree (85%) of sequence identity to the ssb subfamily (ssb1 and ssb2) of the Saccharomyces cerevisiae hsp70 family. The transcribed mRNA (2.1 kb) is present in similar amounts both in yeast and germ tube cells of C. albicans.

Sideband instability analysis based on a one-dimensional high-gain free electron laser model

Science.gov (United States)

Tsai, Cheng-Ying; Wu, Juhao; Yang, Chuan; Yoon, Moohyun; Zhou, Guanqun

2017-12-01

When an untapered high-gain free electron laser (FEL) reaches saturation, the exponential growth ceases and the radiation power starts to oscillate about an equilibrium. The FEL radiation power or efficiency can be increased by undulator tapering. For a high-gain tapered FEL, although the power is enhanced after the first saturation, it is known that there is a so-called second saturation where the FEL power growth stops even with a tapered undulator system. The sideband instability is one of the primary reasons leading to this second saturation. In this paper, we provide a quantitative analysis on how the gradient of undulator tapering can mitigate the sideband growth. The study is carried out semianalytically and compared with one-dimensional numerical simulations. The physical parameters are taken from Linac Coherent Light Source-like electron bunch and undulator systems. The sideband field gain and the evolution of the radiation spectra for different gradients of undulator tapering are examined. It is found that a strong undulator tapering (˜10 %) provides effective suppression of the sideband instability in the postsaturation regime.

Precision and broadband frequency swept laser source based on high-order modulation-sideband injection-locking.

Science.gov (United States)

Wei, Fang; Lu, Bin; Wang, Jian; Xu, Dan; Pan, Zhengqing; Chen, Dijun; Cai, Haiwen; Qu, Ronghui

2015-02-23

A precision and broadband laser frequency swept technique is experimentally demonstrated. Using synchronous current compensation, a slave diode laser is dynamically injection-locked to a specific high-order modulation-sideband of a narrow-linewidth master laser modulated by an electro-optic modulator (EOM), whose driven radio frequency (RF) signal can be agilely, precisely controlled by a frequency synthesizer, and the high-order modulation-sideband enables multiplied sweep range and tuning rate. By using 5th order sideband injection-locking, the original tuning range of 3 GHz and tuning rate of 0.5 THz/s is multiplied by 5 times to 15 GHz and 2.5 THz/s respectively. The slave laser has a 3 dB-linewidth of 2.5 kHz which is the same to the master laser. The settling time response of a 10 MHz frequency switching is 2.5 µs. By using higher-order modulation-sideband and optimized experiment parameters, an extended sweep range and rate could be expected.

Saturation of a toroidal Alfvén eigenmode due to enhanced damping of nonlinear sidebands

Science.gov (United States)

Todo, Y.; Berk, H. L.; Breizman, B. N.

2012-09-01

This paper examines nonlinear magneto-hydrodynamic effects on the energetic particle driven toroidal Alfvén eigenmode (TAE) for lower dissipation coefficients and with higher numerical resolution than in the previous simulations (Todo et al 2010 Nucl. Fusion 50 084016). The investigation is focused on a TAE mode with toroidal mode number n = 4. It is demonstrated that the mechanism of mode saturation involves generation of zonal (n = 0) and higher-n (n ⩾ 8) sidebands, and that the sidebands effectively increase the mode damping rate via continuum damping. The n = 0 sideband includes the zonal flow peaks at the TAE gap locations. It is also found that the n = 0 poloidal flow represents a balance between the nonlinear driving force from the n = 4 components and the equilibrium plasma response to the n = 0 fluctuations. The spatial profile of the n = 8 sideband peaks at the n = 8 Alfvén continuum, indicating enhanced dissipation due to continuum damping.

Autodisplay of the La/SSB protein on LPS-free E. coli for the diagnosis of Sjögren's syndrome.

Science.gov (United States)

Yoo, Gu; Dilkaute, Carina; Bong, Ji-Hong; Song, Hyun-Woo; Lee, Misu; Kang, Min-Jung; Jose, Joachim; Pyun, Jae-Chul

2017-05-01

The objective of this study was to present an immunoassay for the diagnosis of Sjögren's syndrome based on the autodisplayed La/SSB protein on the outer membrane of intact E. coli (strain UT-5600) and LPS-free E. coli (ClearColi™). As the first step, an autodisplay vector (pCK002) was transfected into intact E. coli and LPS-free E. coli for comparison of efficiency of autdisplay of La/SSB. The maximal level of La/SSB expression was estimated to be similar for LPS-free E. coli and intact E. coli at different optimal induction periods. Intact E. coli was found to grow twofold faster than LPS-free E. coli, and the maximal level of expression for LPS-free E. coli was obtained with a longer induction period. When the zeta potential was measured, both intact E. coli and LPS-free E. coli showed negative values, and the autodisplay of negatively charged La/SSB protein (pIE. coli and LPS-free E. coli resulted in a slight change in zeta potential values. E. coli with autodisplayed La/SSB protein was used for an immunoassay of anti-La/SSB antibodies for the diagnosis of Sjögren's syndrome. The surface of E. coli with the autodisplayed antigen was modified with rabbit serum and papain to prevent false positive signals because of nonspecific binding of unrelated antibodies from human serum. LPS-free E. coli with autodisplayed La/SSB protein yielded sensitivity and selectivity of 81.6% and 78.6%, respectively. The Bland-Altman test showed that the immunoassays based on LPS-free E. coli and intact E. coli with autodisplayed La/SSB protein were statistically equivalent to a clinical immunoassay for detection of anti-La/SSB antibodies (confidence coefficient 95%). Copyright © 2017 Elsevier Inc. All rights reserved.

Identification and characterization of the SSB1 locus involved in symptom development by Spring beauty latent virus infection in Arabidopsis thaliana.

Science.gov (United States)

Fujisaki, Koki; Hagihara, Fumi; Azukawa, Yoshihiro; Kaido, Masanori; Okuno, Tetsuro; Mise, Kazuyuki

2004-09-01

The natural variation of Arabidopsis thaliana in response to a bromovirus, Spring beauty latent virus (SBLV), was examined. Of 63 Arabidopsis accessions tested, all were susceptible when inoculated with SBLV, although there was a large degree of variation in symptom development. Most accessions, including Columbia (Col-0), were symptomless or developed only mild symptoms, but four accessions, including S96, showed severe symptoms of SBLV infection. Genetic analysis suggested that the difference in the responses of Col-0 and S96 to SBLV was controlled by a single semidominant locus. We have designated this locus SSB1 (symptom development by SBLV infection). By using genetic markers, SSB1 was mapped to chromosome IV. The patterns of distribution and accumulation of SBLV in sensitive accessions were similar to those in the insensitive accessions. In addition, symptom development in S96 by SBLV infection was critically interrupted by the presence of the NahG gene, which encodes salicylic acid (SA) hydroxylase. These data suggest that symptom development in A. thaliana controlled by SSB1 is independent of the efficiency of SBLV multiplication and is dependent on SA signaling.

Nature of infrared-active phonon sidebands to internal vibrations: Spectroscopic studies of solid oxygen and nitrogen

Science.gov (United States)

Brodyanski, A. P.; Medvedev, S. A.; Vetter, M.; Kreutz, J.; Jodl, H. J.

2002-09-01

The ir-active phonon sidebands to internal vibrations of oxygen and nitrogen were precisely investigated by Fourier transform infrared spectroscopy in the fundamental and first overtone spectral regions from 10 K to the boiling points at ambient pressure. We showed that an analysis of ir-active phonon sidebands yields important information on the internal vibrations of molecules in a condensed medium (solid or liquid), being complementary to Raman data on vibron frequencies. Analyzing the complete profile of these bands, we determined the band origin frequencies and explored their temperature behavior in all phases of both substances. We present unambiguous direct experimental proofs that this quality corresponds to the frequency of internal vibrations of single molecules. Considering solid oxygen and nitrogen as two limiting cases for simple molecular solids, we interpret this result as a strong evidence for a general fact that an ir-active phonon sideband possesses the same physical origin in pure molecular solids and in impurity centers. The key characteristics of the fundamental vibron energy zone (environmental and resonance frequency shifts) were deduced from the combined analysis of ir and Raman experimental data and their temperature behavior was explored in solid and liquid phases of oxygen and nitrogen at ambient pressure. The character of the short-range orientational order was established in the β-nitrogen based on our theoretical analysis consistent with the present experimental results. We also present the explanation of the origin of pressure-caused changes in the frequency of the Raman vibron mode of solid oxygen at low temperatures.

The ribosome-bound chaperones RAC and Ssb1/2p are required for accurate translation in Saccharomyces cerevisiae.

Science.gov (United States)

Rakwalska, Magdalena; Rospert, Sabine

2004-10-01

The chaperone homologs RAC (ribosome-associated complex) and Ssb1/2p are anchored to ribosomes; Ssb1/2p directly interacts with nascent polypeptides. The absence of RAC or Ssb1/2p results in a similar set of phenotypes, including hypersensitivity against the aminoglycoside paromomycin, which binds to the small ribosomal subunit and compromises the fidelity of translation. In order to understand this phenomenon we measured the frequency of translation termination and misincorporation in vivo and in vitro with a novel reporter system. Translational fidelity was impaired in the absence of functional RAC or Ssb1/2p, and the effect was further enhanced by paromomycin. The mutant strains suffered primarily from a defect in translation termination, while misincorporation was compromised to a lesser extent. Consistently, a low level of soluble translation termination factor Sup35p enhanced growth defects in the mutant strains. Based on the combined data we conclude that RAC and Ssb1/2p are crucial in maintaining translational fidelity beyond their postulated role as chaperones for nascent polypeptides.

Coherent detection of THz-induced sideband emission from excitons in the nonperturbative regime

Science.gov (United States)

Uchida, K.; Otobe, T.; Mochizuki, T.; Kim, C.; Yoshita, M.; Tanaka, K.; Akiyama, H.; Pfeiffer, L. N.; West, K. W.; Hirori, H.

2018-04-01

Strong interaction of a terahertz (THz) wave with excitons induces nonperturbative optical effects such as Rabi splitting and high-order sideband generation. Here, we investigated coherent properties of THz-induced sideband emissions from GaAs/AlGaAs multiquantum wells. With increasing THz electric field, optical susceptibility of the THz-dressed exciton shows a redshift with spectral broadening and extraordinary phase shift. This implies that the field ionization of the 1 s exciton modifies the THz-dressed exciton in the nonperturbative regime.

hSSB1 (NABP2/OBFC2B) is regulated by oxidative stress

OpenAIRE

Nicolas Paquet; Mark N. Adams; Nicholas W. Ashton; Christine Touma; Roland Gamsjaeger; Liza Cubeddu; Vincent Leong; Sam Beard; Emma Bolderson; Catherine H. Botting; Kenneth J. O’Byrne; Derek J. Richard

2016-01-01

The maintenance of genome stability is an essential cellular process to prevent the development of diseases including cancer. hSSB1 (NABP2/ OBFC2A) is a critical component of the DNA damage response where it participates in the repair of double-strand DNA breaks and in base excision repair of oxidized guanine residues (8-oxoguanine) by aiding the localization of the human 8-oxoguanine glycosylase (hOGG1) to damaged DNA. Here we demonstrate that following oxidative stress, hSSB1 is stabilized ...

Chemo-mechanical pushing of proteins along single-stranded DNA.

Science.gov (United States)

Sokoloski, Joshua E; Kozlov, Alexander G; Galletto, Roberto; Lohman, Timothy M

2016-05-31

Single-stranded (ss)DNA binding (SSB) proteins bind with high affinity to ssDNA generated during DNA replication, recombination, and repair; however, these SSBs must eventually be displaced from or reorganized along the ssDNA. One potential mechanism for reorganization is for an ssDNA translocase (ATP-dependent motor) to push the SSB along ssDNA. Here we use single molecule total internal reflection fluorescence microscopy to detect such pushing events. When Cy5-labeled Escherichia coli (Ec) SSB is bound to surface-immobilized 3'-Cy3-labeled ssDNA, a fluctuating FRET signal is observed, consistent with random diffusion of SSB along the ssDNA. Addition of Saccharomyces cerevisiae Pif1, a 5' to 3' ssDNA translocase, results in the appearance of isolated, irregularly spaced saw-tooth FRET spikes only in the presence of ATP. These FRET spikes result from translocase-induced directional (5' to 3') pushing of the SSB toward the 3' ssDNA end, followed by displacement of the SSB from the DNA end. Similar ATP-dependent pushing events, but in the opposite (3' to 5') direction, are observed with EcRep and EcUvrD (both 3' to 5' ssDNA translocases). Simulations indicate that these events reflect active pushing by the translocase. The ability of translocases to chemo-mechanically push heterologous SSB proteins along ssDNA provides a potential mechanism for reorganization and clearance of tightly bound SSBs from ssDNA.

Resolved-sideband Raman cooling of a bound atom to the 3D zero-point energy

International Nuclear Information System (INIS)

Monroe, C.; Meekhof, D.M.; King, B.E.; Jefferts, S.R.; Itano, W.M.; Wineland, D.J.; Gould, P.

1995-01-01

We report laser cooling of a single 9 Be + ion held in a rf (Paul) ion trap to where it occupies the quantum-mechanical ground state of motion. With the use of resolved-sideband stimulated Raman cooling, the zero point of motion is achieved 98% of the time in 1D and 92% of the time in 3D. Cooling to the zero-point energy appears to be a crucial prerequisite for future experiments such as the realization of simple quantum logic gates applicable to quantum computation. copyright 1995 The American Physical Society

Generation and amplification of a high-order sideband induced by two-level atoms in a hybrid optomechanical system

Science.gov (United States)

Liu, Zeng-Xing; Xiong, Hao; Wu, Ying

2018-01-01

It is quite important to enhance and control the optomechanically induced high-order sideband generation to achieve low-power optical comb and high-sensitivity sensing with an integrable structure. Here we present and analyze a proposal for enhancement and manipulation of optical nonlinearity and high-order sideband generation in a hybrid atom-cavity optomechanical system that is coherently driven by a bichromatic input field consisting of a control field and a probe field and that works beyond the perturbative regime. Our numerical analysis with experimentally achievable parameters confirms that robust high-order sideband generation and typical spectral structures with nonperturbative features can be created even under weak driven fields. The dependence of the high-order sideband generation on the atomic parameters are also discussed in detail, including the decay rate of the atoms and the coupling parameter between the atoms and the cavity field. We show that the cutoff order as well as the amplitude of the higher-order sidebands can be well tuned by the atomic coupling strength and the atomic decay rate. The proposed mechanism of enhancing optical nonlinearity is quite general and can be adopted to optomechanical systems with different types of cavity.

hSSB1 regulates both the stability and the transcriptional activity of p53

OpenAIRE

Xu, Shuangbing; Wu, Yuanzhong; Chen, Qiong; Cao, Jingying; Hu, Kaishun; Tang, Jianjun; Sang, Yi; Lai, Fenju; Wang, Li; Zhang, Ruhua; Li, Sheng-Ping; Zeng, Yi-Xin; Yin, Yuxin; Kang, Tiebang

2012-01-01

The tumor suppressor p53 is essential for several cellular processes that are involved in the response to diverse genotoxic stress, including cell cycle arrest, DNA repair, apoptosis and senescence. Studies of the regulation of p53 have mostly focused on its stability and transactivation; however, new regulatory molecules for p53 have also been frequently identified. Here, we report that human ssDNA binding protein SSB1 (hSSB1), a novel DNA damage-associated protein, can interact with p53 and...

The Effect of Price and Socio-Economic Level on the Consumption of Sugar-Sweetened Beverages (SSB): The Case of Ecuador.

Science.gov (United States)

Paraje, Guillermo

2016-01-01

The objective of this article is to estimate the own-price, cross-price and income elasticities of demand for SSB in Ecuador, as an indispensable step for predicting a reduction in the consumption of said beverages caused by the potential implementation of taxes in Ecuador. In addition, the own-price, cross-price and income elasticities of sugar-free substitutes like mineral water and diet soft drinks and juices are also estimated. The data from the 2011-2012 ENIGHUR, which contains detailed information on household consumption and socioeconomic variables, was used. The estimates are done using Deaton's Almost Ideal Demand System (AIDS) which accounts for differences in the quality of goods purchased. This demand system is estimated for different socio-economic groups, according to total household expenditure. The results reveal own-price elasticities for SSB between -1.17 and -1.33 depending on the socio-economic group, in line with the existing evidence for developed countries. Own-price elasticity for non-SSB is between -1 and -1.24. Income elasticities reveal that both SSB and non-SSB are normal goods with elasticities decreasing for higher socio-economic groups. These results show that the consumption of SSB is sensitive to price changes, meaning that the implementation of taxes on said beverages could be effective in reducing their consumption. The fact that non-SSB are also sensitive to price changes would indicate that subsidies could be implemented for the production of some of them.

PEMBINAAN PRESTASI SEPAK BOLA DI SEKOLAH SEPAK BOLA (SSB TUGU MUDA KOTA SEMARANG TAHUN 2012/2013

Directory of Open Access Journals (Sweden)

Bagus Arif Wicaksono

2015-07-01

Full Text Available The purpose of this study to determine the purpose of the establishment of SSB , organization , training programs , facilities and infrastructure , human resources , the role of parents and the community , funding , distribution athlete in SSB Tugu Muda Semarang in 2013. The approach in this study uses a qualitative descriptive approach. Instruments and methods of data collection by observation, interviews , and documentation. The results showed that the SSB Tugu Muda Semarang existing board of management of systematic organization , in carrying out organizational activities carried out by organizations that exist. Based on the results penilitian , the suggestion that the author can say is keep the existing guidance systems , maintain the achievements that have been achieved so that it can attract more new athletes anymore.

Expression, purification and biochemical characterization of a single-stranded DNA binding protein from Herbaspirillum seropedicae.

Science.gov (United States)

Vernal, Javier; Serpa, Viviane I; Tavares, Carolina; Souza, Emanuel M; Pedrosa, Fábio O; Terenzi, Hernán

2007-05-01

An open reading frame encoding a protein similar in size and sequence to the Escherichia coli single-stranded DNA binding protein (SSB protein) was identified in the Herbaspirillum seropedicae genome. This open reading frame was cloned into the expression plasmid pET14b. The SSB protein from H. seropedicae, named Hs_SSB, was overexpressed in E. coli strain BL21(DE3) and purified to homogeneity. Mass spectrometry data confirmed the identity of this protein. The apparent molecular mass of the native Hs_SSB was estimated by gel filtration, suggesting that the native protein is a tetramer made up of four similar subunits. The purified protein binds to single-stranded DNA (ssDNA) in a similar manner to other SSB proteins. The production of this recombinant protein in good yield opens up the possibility of obtaining its 3D-structure and will help further investigations into DNA metabolism.

The Sidebands of the Equatorial Electrojet: General Characteristic of the Westward Currents, as Deduced From CHAMP

Science.gov (United States)

Zhou, Yun-Liang; Lühr, Hermann; Alken, Patrick

2018-02-01

Based on 5 years (2001-2005) of magnetic field measurements made by the CHAMP satellite, latitudinal profiles of the equatorial electrojet (EEJ) have been derived. This study provides a comprehensive characterization of the reverse current EEJ sidebands. These westward currents peak at ±5° quasi-dipole latitude with typical amplitudes of 35% of the main EEJ. The diurnal amplitude variation is quite comparable with that of the EEJ. Similarly to the EEJ, the intensity is increasing with solar EUV flux, but with a steeper slope, indicating that not only the conductivity plays a role. For the longitude distribution we find, in general, larger amplitudes in the Western than in the Eastern Hemisphere. It is presently a common understanding that the reverse current EEJ sidebands are generated by eastward zonal winds at altitudes above about 120 km. In particular, a positive vertical gradient of wind speed generates westward currents at magnetic latitudes outside of 2° dip latitude. Interesting information about these features can be deduced from the sidebands' tidal characteristics. The longitudinal variation of the amplitude is dominated by a wave-1 pattern, which can primarily be attributed to the tidal components SPW1 and SW3. In case of the hemispheric amplitude differences these same two wave-1 components dominate. The ratio between sideband amplitude and main EEJ is largely controlled by the tidal features of the EEJ. The longitudinal patterns of the latitude, where the sidebands peak, resemble to some extent those of the amplitude. Current densities become larger when the peaks move closer to the magnetic equator.

High-order sideband generation in a semiconductor quantum well driven by two orthogonal terahertz fields

Science.gov (United States)

Yan, Jie-Yun

2017-08-01

The theory of excitonic high-order sideband generation (HSG) in a semiconductor quantum well irradiated by two orthogonal terahertz (THz) fields (one frequency is an integral multiple of the other) is presented. The exact analytical solution to the sideband spectrum is given with the help of the generalized Bessel functions. As a special case, the HSG when the frequencies of these two THz fields are the same is derived and its dependence on the ellipticity of the THz field is discussed. The theory could explain the experiments, especially concerning the sensitive dependence of HSG signals on the ellipticity of the THz field: the signals are strong when the THz field has a linear polarization and totally vanish in case of a circular polarization. More interestingly, it was found that the strongest signal is not produced in the case of linear polarization for some sidebands. The theory is supported by numerical calculations.

Bacterial single-stranded DNA-binding proteins are phosphorylated on tyrosine

DEFF Research Database (Denmark)

Mijakovic, Ivan; Petranovic, Dina; Macek, B

2006-01-01

for phosphotyrosine-containing proteins in Streptomyces griseus by immunoaffinity chromatography identified bacterial SSBs as a novel target of bacterial tyrosine kinases. Since genes encoding protein-tyrosine kinases (PTKs) have not been recognized in streptomycetes, and SSBs from Streptomyces coelicolor (Sc......SSB) and Bacillus subtilis (BsSSB) share 38.7% identity, we used a B.subtilis protein-tyrosine kinase YwqD to phosphorylate two cognate SSBs (BsSSB and YwpH) in vitro. We demonstrate that in vivo phosphorylation of B.subtilis SSB occurs on tyrosine residue 82, and this reaction is affected antagonistically...... by kinase YwqD and phosphatase YwqE. Phosphorylation of B.subtilis SSB increased binding almost 200-fold to single-stranded DNA in vitro. Tyrosine phosphorylation of B.subtilis, S.coelicolor and Escherichia coli SSBs occured while they were expressed in E.coli, indicating that tyrosine phosphorylation...

Effect of antioxidants on x-ray induced DNA SSB and DSB in different cell systems

International Nuclear Information System (INIS)

Ramadu, Kadem

1998-01-01

The effect of x-ray radiation or antioxidants such as actinomycin D, cycloheximide and mitomycin C is studied on CHO, BHK and HeLa cells. X-ray radiation caused DNA single strand breaks (SSB) and double strand breaks (DSB) are prevented by cycloheximide and actinomycin-D. The DSB and SSB are significant in the case of x-ray radiation in combination with MMC, but different with actinomycin-D and cycloheximide in combination with x-ray radiation which causes less number of SSB and DSB. The ISC is observed more with x-ray radiation in combination with antioxidants mitomycin C (MMC) than that of cycloheximide and actinomycin-D, which individually causes inhibition of ISC induced by x-ray radiation. This observation proves that the MMC has an additive effect on x-ray induced ISC during cell proliferation. During cell proliferation, cell viability is observed with x-ray radiation and antioxidants which are dependent on the cell cycle phase. However, in the control cells, the initial Go-phase has shown negligible difference in percent cell viability thereby during S-phase gradual increase in the cell viability, and cell proliferation have been found to be stopped at G2+M-phase. On the contrary, cell viability and the extent of cell proliferation with x-ray radiation in combination with MMC have shown more damage (OH-damage) than is caused by x-ray radiation and MMC, separately. But, the fact is that actinomycin-D and cycloheximide act as antioxidants preventing thereby free radical formation and cell death, caused by x-ray radiation. During cell proliferation, cells observed from S and (G2+M) phase exhibit difference in cell viability in all the treatments alone and in combination. HeLa cells have been found insensitive to x-ray radiation and could be ascribed to the presence of glutathione transferase, which is less in CHO/BHK cell line. (author)

Interaction with Single-stranded DNA-binding Protein Stimulates Escherichia coli Ribonuclease HI Enzymatic Activity.

Science.gov (United States)

Petzold, Christine; Marceau, Aimee H; Miller, Katherine H; Marqusee, Susan; Keck, James L

2015-06-05

Single-stranded (ss) DNA-binding proteins (SSBs) bind and protect ssDNA intermediates formed during replication, recombination, and repair reactions. SSBs also directly interact with many different genome maintenance proteins to stimulate their enzymatic activities and/or mediate their proper cellular localization. We have identified an interaction formed between Escherichia coli SSB and ribonuclease HI (RNase HI), an enzyme that hydrolyzes RNA in RNA/DNA hybrids. The RNase HI·SSB complex forms by RNase HI binding the intrinsically disordered C terminus of SSB (SSB-Ct), a mode of interaction that is shared among all SSB interaction partners examined to date. Residues that comprise the SSB-Ct binding site are conserved among bacterial RNase HI enzymes, suggesting that RNase HI·SSB complexes are present in many bacterial species and that retaining the interaction is important for its cellular function. A steady-state kinetic analysis shows that interaction with SSB stimulates RNase HI activity by lowering the reaction Km. SSB or RNase HI protein variants that disrupt complex formation nullify this effect. Collectively our findings identify a direct RNase HI/SSB interaction that could play a role in targeting RNase HI activity to RNA/DNA hybrid substrates within the genome. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

Interaction with Single-stranded DNA-binding Protein Stimulates Escherichia coli Ribonuclease HI Enzymatic Activity*

Science.gov (United States)

Petzold, Christine; Marceau, Aimee H.; Miller, Katherine H.; Marqusee, Susan; Keck, James L.

2015-01-01

Single-stranded (ss) DNA-binding proteins (SSBs) bind and protect ssDNA intermediates formed during replication, recombination, and repair reactions. SSBs also directly interact with many different genome maintenance proteins to stimulate their enzymatic activities and/or mediate their proper cellular localization. We have identified an interaction formed between Escherichia coli SSB and ribonuclease HI (RNase HI), an enzyme that hydrolyzes RNA in RNA/DNA hybrids. The RNase HI·SSB complex forms by RNase HI binding the intrinsically disordered C terminus of SSB (SSB-Ct), a mode of interaction that is shared among all SSB interaction partners examined to date. Residues that comprise the SSB-Ct binding site are conserved among bacterial RNase HI enzymes, suggesting that RNase HI·SSB complexes are present in many bacterial species and that retaining the interaction is important for its cellular function. A steady-state kinetic analysis shows that interaction with SSB stimulates RNase HI activity by lowering the reaction Km. SSB or RNase HI protein variants that disrupt complex formation nullify this effect. Collectively our findings identify a direct RNase HI/SSB interaction that could play a role in targeting RNase HI activity to RNA/DNA hybrid substrates within the genome. PMID:25903123

Interaction with Single-stranded DNA-binding Protein Stimulates Escherichia coli Ribonuclease HI Enzymatic Activity

Energy Technology Data Exchange (ETDEWEB)

Petzold, Christine; Marceau, Aimee H.; Miller, Katherine H.; Marqusee, Susan; Keck, James L. (UW-MED); (UCB)

2015-04-22

Single-stranded (ss) DNA-binding proteins (SSBs) bind and protect ssDNA intermediates formed during replication, recombination, and repair reactions. SSBs also directly interact with many different genome maintenance proteins to stimulate their enzymatic activities and/or mediate their proper cellular localization. We have identified an interaction formed between Escherichia coli SSB and ribonuclease HI (RNase HI), an enzyme that hydrolyzes RNA in RNA/DNA hybrids. The RNase HI·SSB complex forms by RNase HI binding the intrinsically disordered C terminus of SSB (SSB-Ct), a mode of interaction that is shared among all SSB interaction partners examined to date. Residues that comprise the SSB-Ct binding site are conserved among bacterial RNase HI enzymes, suggesting that RNase HI·SSB complexes are present in many bacterial species and that retaining the interaction is important for its cellular function. A steady-state kinetic analysis shows that interaction with SSB stimulates RNase HI activity by lowering the reaction Km. SSB or RNase HI protein variants that disrupt complex formation nullify this effect. Collectively our findings identify a direct RNase HI/SSB interaction that could play a role in targeting RNase HI activity to RNA/DNA hybrid substrates within the genome.

The Hsp70 homolog Ssb and the 14-3-3 protein Bmh1 jointly regulate transcription of glucose repressed genes in Saccharomyces cerevisiae.

Science.gov (United States)

Hübscher, Volker; Mudholkar, Kaivalya; Chiabudini, Marco; Fitzke, Edith; Wölfle, Tina; Pfeifer, Dietmar; Drepper, Friedel; Warscheid, Bettina; Rospert, Sabine

2016-07-08

Chaperones of the Hsp70 family interact with a multitude of newly synthesized polypeptides and prevent their aggregation. Saccharomyces cerevisiae cells lacking the Hsp70 homolog Ssb suffer from pleiotropic defects, among others a defect in glucose-repression. The highly conserved heterotrimeric kinase SNF1/AMPK (AMP-activated protein kinase) is required for the release from glucose-repression in yeast and is a key regulator of energy balance also in mammalian cells. When glucose is available the phosphatase Glc7 keeps SNF1 in its inactive, dephosphorylated state. Dephosphorylation depends on Reg1, which mediates targeting of Glc7 to its substrate SNF1. Here we show that the defect in glucose-repression in the absence of Ssb is due to the ability of the chaperone to bridge between the SNF1 and Glc7 complexes. Ssb performs this post-translational function in concert with the 14-3-3 protein Bmh, to which Ssb binds via its very C-terminus. Raising the intracellular concentration of Ssb or Bmh enabled Glc7 to dephosphorylate SNF1 even in the absence of Reg1. By that Ssb and Bmh efficiently suppressed transcriptional deregulation of Δreg1 cells. The findings reveal that Ssb and Bmh comprise a new chaperone module, which is involved in the fine tuning of a phosphorylation-dependent switch between respiration and fermentation. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

Microbunching-instability-induced sidebands in a seeded free-electron laser

Directory of Open Access Journals (Sweden)

Zhen Zhang

2016-05-01

Full Text Available Measurements of the multishot-averaged, soft x-ray, self-seeding spectrum at the LCLS free-electron laser often have a pedestal-like distribution around the seeded wavelength, which limits the spectral purity and can negatively affect some user applications not employing a post-undulator monochromator. In this paper, we study the origins of such pedestals, focusing on longitudinal phase space modulations produced by the microbunching instability upstream of the free-electron laser (FEL undulator. We show from theory and numerical simulation that both energy and density modulations can induce sidebands in a high-gain, seeded FEL whose fractional strength typically grows as the square of the undulator length. The results place a tight constraint on the longitudinal phase space uniformity of the electron beam for a seeded FEL, possibly requiring the amplitude of long-wavelength modulations to be much smaller than the typical incoherent energy spread if the output sideband power is to remain only a couple percent or less of the amplified seed power.

Periodically modulated single-photon transport in one-dimensional waveguide

Science.gov (United States)

Li, Xingmin; Wei, L. F.

2018-03-01

Single-photon transport along a one-dimension waveguide interacting with a quantum system (e.g., two-level atom) is a very useful and meaningful simplified model of the waveguide-based optical quantum devices. Thus, how to modulate the transport of the photons in the waveguide structures by adjusting certain external parameters should be particularly important. In this paper, we discuss how such a modulation could be implemented by periodically driving the energy splitting of the interacting atom and the atom-photon coupling strength. By generalizing the well developed time-independent full quantum mechanical theory in real space to the time-dependent one, we show that various sideband-transmission phenomena could be observed. This means that, with these modulations the photon has certain probabilities to transmit through the scattering atom in the other energy sidebands. Inversely, by controlling the sideband transmission the periodic modulations of the single photon waveguide devices could be designed for the future optical quantum information processing applications.

Ar 3p photoelectron sideband spectra in two-color XUV + NIR laser fields

Science.gov (United States)

Minemoto, Shinichirou; Shimada, Hiroyuki; Komatsu, Kazma; Komatsubara, Wataru; Majima, Takuya; Mizuno, Tomoya; Owada, Shigeki; Sakai, Hirofumi; Togashi, Tadashi; Yoshida, Shintaro; Yabashi, Makina; Yagishita, Akira

2018-04-01

We performed photoelectron spectroscopy using femtosecond XUV pulses from a free-electron laser and femtosecond near-infrared pulses from a synchronized laser, and succeeded in measuring Ar 3p photoelectron sideband spectra due to the two-color above-threshold ionization. In our calculations of the first-order time-dependent perturbation theoretical model based on the strong field approximation, the photoelectron sideband spectra and their angular distributions are well reproduced by considering the timing jitter between the XUV and the NIR pulses, showing that the timing jitter in our experiments was distributed over the width of {1.0}+0.4-0.2 ps. The present approach can be used as a method to evaluate the timing jitter inevitable in FEL experiments.

Device localization and dynamic scan plane selection using a wireless MRI detector array

Science.gov (United States)

Riffe, Matthew J.; Yutzy, Stephen R.; Jiang, Yun; Twieg, Michael D.; Blumenthal, Colin J.; Hsu, Daniel P.; Pan, Li; Gilson, Wesley D.; Sunshine, Jeffrey L.; Flask, Christopher A.; Duerk, Jeffrey L.; Nakamoto, Dean; Gulani, Vikas; Griswold, Mark A.

2013-01-01

Purpose A prototype wireless guidance device using single sideband amplitude modulation (SSB) is presented for a 1.5T MRI system. Methods The device contained three fiducial markers each mounted to an independent receiver coil equipped with wireless SSB technology. Acquiring orthogonal projections of these markers determined the position and orientation of the device, which was used to define the scan plane for a subsequent image acquisition. Device localization and scan plane update required approximately 30 ms, so it could be interleaved with high temporal resolution imaging. Since the wireless device is used for localization and doesn’t require full imaging capability, the design of the SSB wireless system was simplified by allowing an asynchronous clock between the transmitter and receiver. Results When coupled to a high readout bandwidth, the error caused by the lack of a shared frequency reference was quantified to be less than one pixel (0.78 mm) in the projection acquisitions. Image-guidance with the prototype was demonstrated with a phantom where a needle was successfully guided to a target and contrast was delivered. Conclusion The feasibility of active tracking with a wireless detector array is demonstrated. Wireless arrays could be incorporated into devices to assist in image-guided procedures. PMID:23900921

Biotransformation of Domestic Wastewater Treatment Plant Sludge by Two-Stage Integrated Processes -Lsb & Ssb

Directory of Open Access Journals (Sweden)

Md. Zahangir Alam, A. H. Molla and A. Fakhru’l-Razi

2012-10-01

Full Text Available The study of biotransformation of domestic wastewater treatment plant (DWTP sludge was conducted in laboratory-scale by two-stage integrated process i.e. liquid state bioconversion (LSB and solid state bioconversion (SSB processes. The liquid wastewater sludge [4% w/w of total suspended solids (TSS] was treated by mixed filamentous fungi Penicillium corylophilum and Aspergillus niger, isolated, screened and mixed cultured in terms of their higher biodegradation potential to wastewater sludge. The biosolids was increased to about 10% w/w. Conversely, the soluble [i.e. Total dissolve solid (TDS] and insoluble substances (TSS in treated supernatant were decreased effectively in the LSB process. In the developed LSB process, 93.8 g kg-1of biosolids were enriched with fungal biomass protein and nutrients (NPK, and 98.8% of TSS, 98.2% of TDS, 97.3% of turbidity, 80.2% of soluble protein, 98.8% of reducing sugar and 92.7% of chemical oxygen demand (COD in treated sludge supernatant were removed after 8 days of treatment. Specific resistance to filtration (1.39x1012 m/kg was decreased tremendously by the microbial treatment of DWTP sludge after 6 days of fermentation. The treated biosolids in DWTP sludge was considered as pretreated resource materials for composting and converted into compost by SSB process. The SSB process was evaluated for composting by monitoring the microbial growth and its subsequent roles in biodegradation in composting bin (CB. The process was conducted using two mixed fungal cultures, Trichoderma harzianum with Phanerochaete chrysosporium 2094 and (T/P and T. harzianum and Mucor hiemalis (T/M; and two bulking materials, sawdust (SD and rice straw (RS. The most encouraging results of microbial growth and subsequent solid state bioconversion were exhibited in the RS than the SD. Significant decrease of the C/N ratio and germination index (GI were attained as well as the higher value of glucosamine was exhibited in compost; which

Complementation of Saccharomyces cerevisiae mutations in genes involved in translation and protein folding (EFB1 and SSB1) with Candida albicans cloned genes.

Science.gov (United States)

Maneu, V; Roig, P; Gozalbo, D

2000-11-01

We have demonstrated that the expression of Candida albicans genes involved in translation and protein folding (EFB1 and SSB1) complements the phenotype of Saccharomyces cerevisiae mutants. The elongation factor 1beta (EF-1beta) is essential for growth and efb1 S. cerevisiae null mutant cells are not viable; however, viable haploid cells, carrying the disrupted chromosomal allele of the S. cerevisiae EFB1 gene and pEFB1, were isolated upon sporulation of a diploid strain which was heterozygous at the EFB1 locus and transformed with pEFB1 (a pEMBLYe23 derivative plasmid containing an 8-kb DNA fragment from the C. albicans genome which contains the EFB1 gene). This indicates that the C. albicans EFB1 gene encodes a functional EF-1beta. Expression of the SSB1 gene from C. albicans, which codes for a member of the 70-kDa heat shock protein family, in S. cerevisiae ssb1 ssb2 double mutant complements the mutant phenotype (poor growth particularly at low temperature, and sensitivity to certain protein synthesis inhibitors, such as paromomycin). This complementation indicates that C. albicans Ssbl may function as a molecular chaperone on the translating ribosomes, as described in S. cerevisiae. Northern blot analysis showed that SSB mRNA levels increased after mild cold shift (28 degrees C to 23 degrees C) and rapidly decreased after mild heat shift (from 28 degrees C to 37 degrees C, and particularly to 42 degrees C), indicating that SSB1 expression is regulated by temperature. Therefore, Ssb1 may be considered as a molecular chaperone whose pattern of expression is similar to that found in ribosomal proteins, according to its common role in translation.

Assembly of presynaptic filaments. Factors affecting the assembly of RecA protein onto single-stranded DNA

DEFF Research Database (Denmark)

Thresher, RJ; Christiansen, Gunna; Griffith, JD

1988-01-01

We have previously shown that the assembly of RecA protein onto single-stranded DNA (ssDNA) facilitated by SSB protein occurs in three steps: (1) rapid binding of SSB protein to the ssDNA; (2) nucleation of RecA protein onto this template; and (3) co-operative polymerization of additional Rec......M in the presence of 12 mM-Mg2+), and relatively low concentrations of SSB protein (1 monomer per 18 nucleotides). Assembly was depressed threefold when SSB protein was added to one monomer per nine nucleotides. These effects appeared to be exerted at the nucleation step. Following nucleation, RecA protein...... assembled onto ssDNA at net rates that varied from 250 to 900 RecA protein monomers per minute, with the rate inversely related to the concentration of SSB protein. Combined sucrose sedimentation and electron microscope analysis established that SSB protein was displaced from the ssDNA during RecA protein...

Simultaneous Faraday filtering of the Mollow triplet sidebands with the Cs-D1 clock transition.

Science.gov (United States)

Portalupi, Simone Luca; Widmann, Matthias; Nawrath, Cornelius; Jetter, Michael; Michler, Peter; Wrachtrup, Jörg; Gerhardt, Ilja

2016-11-25

Hybrid quantum systems integrating semiconductor quantum dots (QDs) and atomic vapours become important building blocks for scalable quantum networks due to the complementary strengths of individual parts. QDs provide on-demand single-photon emission with near-unity indistinguishability comprising unprecedented brightness-while atomic vapour systems provide ultra-precise frequency standards and promise long coherence times for the storage of qubits. Spectral filtering is one of the key components for the successful link between QD photons and atoms. Here we present a tailored Faraday anomalous dispersion optical filter based on the caesium-D 1 transition for interfacing it with a resonantly pumped QD. The presented Faraday filter enables a narrow-bandwidth (Δω=2π × 1 GHz) simultaneous filtering of both Mollow triplet sidebands. This result opens the way to use QDs as sources of single as well as cascaded photons in photonic quantum networks aligned to the primary frequency standard of the caesium clock transition.

Sideband-cooling of trapped ytterbium-ions in the microwave regime

International Nuclear Information System (INIS)

Scharfenberger, Benedikt J.

2012-01-01

Trapped ions in a Paul trap are at present one of the most promising candidates for Quantum Information Processing (QIP). The technique that is used for this purpose in this experiment was introduced in 2001 by F. Mintert and Ch. Wunderlich. The core of this method is the use of atomic transitions in the radio- or microwave region, while a magnetic field gradient along the trap axis (where the ion chain is situated) lifts the degeneracy of the transition frequencies, such that the ions can be distinguished in frequency space; it also serves for the coupling of internal and external degrees of freedom of the ion chain. This method is called MAGIC (MAgnetic Gradient Induced Coupling). The performance of the measurements required that the apparatus of the experiment, which consists of laser sources, lambdameter, vacuum- and microwave system as well as imaging- and detection-units, had to be assembled and tested, which was an important prerequisite for the successful performance of the here described experiments. For the experiments it is advantageous to prepare the ions in an energetic state close to the motional ground state, which contributes to a reduction of the dephasing of the system while manipulating it with microwaves. By using the sideband-cooling technique to the sub-Doppler regime it is taken advantage of the fact, that ions in a linear trap are in good approximation situated in a harmonic oscillator potential and can therefore only populate discrete vibrational energy levels, whose frequency difference is given by the axial trap frequency ω z . If the system is excited by a microwave, which frequency is detuned from resonance to lower energies by a vibrational quantum, the ion looses one such phonon within each cooling-cycle. When this cycle is driven several times, the average phonon number and thus the temperature of the ion can be reduced efficiently and the ion can be initialized in a state close to the motional ground state. As sideband

SSB of Scale Symmetry, Fermion Families and Quintessence without the Long-Range Force Problem

Science.gov (United States)

Guendelman, E. I.; Kaganovich, A. B.

We study a scale-invariant two measures theory where a dilaton field φ has no explicit potentials. The scale transformations include the translation of a dilaton φ-->φ+ const. The theory demonstrates a new mechanism for generation of the exponential potential: in the conformal Einstein frame (CEF), after SSB of scale invariance, the theory develops the exponential potential and, in general, the nonlinear kinetic term is generated as well. The scale symmetry does not allow the appearance of terms breaking the exponential shape of the potential that solves the problem of the flatness of the scalar field potential in the context of quintessential scenarios. As examples, two different possibilities for the choice of the dimensionless parameters are presented where the theory permits to get interesting cosmological results. For the first choice, the theory has standard scaling solutions for φ usually used in the context of the quintessential scenario. For the second choice, the theory allows three different solutions, one of which is a scaling solution with equation of state pφ=wρφ where w is predicted to be restricted by -1single fermionic field we obtain exactly three different types of spin 1/2 particles in CEF that appears to suggest a new approach to the family problem of particle physics. It is automatically achieved that for two of them, fermion masses are constants, the energy-momentum tensor is canonical and the ``fifth force'' is absent. For the third type of particles, a fermionic self-interaction appears as a result of SSB of scale invariance.

Imaginary geometric phases of quantum trajectories in high-order terahertz sideband generation

Science.gov (United States)

Yang, Fan; Liu, Ren-Bao

2014-03-01

Quantum evolution of particles under strong fields can be described by a small number of quantum trajectories that satisfy the stationary phase condition in the Dirac-Feynmann path integral. The quantum trajectories are the key concept to understand the high-order terahertz siedeband generation (HSG) in semiconductors. Due to the nontrivial ``vacuum'' states of band materials, the quantum trajectories of optically excited electron-hole pairs in semiconductors can accumulate geometric phases under the driving of an elliptically polarized THz field. We find that the geometric phase of the stationary trajectory is generally complex with both real and imaginary parts. In monolayer MoS2, the imaginary parts of the geometric phase leads to a changing of the polarization ellipticity of the sideband. We further show that the imaginary part originates from the quantum interference of many trajectories with different phases. Thus the observation of the polarization ellipticity of the sideband shall be a good indication of the quantum nature of the stationary trajectory. This work is supported by Hong Kong RGC/GRF 401512 and the CUHK Focused Investments Scheme.

Mass spectrometric analysis of a UV-cross-linked protein-DNA complex: tryptophans 54 and 88 of E. coli SSB cross-link to DNA

DEFF Research Database (Denmark)

Steen, Hanno; Petersen, Jørgen; Mann, Matthias

2001-01-01

acid and peptide entities present in such heteroconjugates. Sample preparation of the peptide-nucleic acid heteroconjugates is, therefore, a crucial step in any mass spectrometry-based analytical procedure. This study demonstrates the performance of four different MS-based strategies to characterize E....... coli single-stranded DNA binding protein (SSB) that was UV-cross-linked to a 5-iodouracil containing DNA oligomer. Two methods were optimized to circumvent the need for standard liquid chromatography and gel electrophoresis, thereby dramatically increasing the overall sensitivity of the analysis...

International application of sugar-sweetened beverage (SSB) taxation in obesity reduction: factors that may influence policy effectiveness in country-specific contexts.

Science.gov (United States)

Jou, Judy; Techakehakij, Win

2012-09-01

Sugar-sweetened beverage (SSB) taxation is becoming of increasing interest as a policy aimed at addressing the rising prevalence of obesity in many countries. Preliminary evidence indicates its potential to not only reduce obesity prevalence, but also generate public revenue. However, differences in country-specific contexts create uncertainties in its possible outcomes. This paper urges careful consideration of country-specific characteristics by suggesting three points in particular that may influence the effectiveness of a volume-based soft drink excise tax: population obesity prevalence, soft drink consumption levels, and existing baseline tax rates. Data from 19 countries are compared with regard to each point. The authors suggest that SSB or soft drink taxation policy may be more effective in reducing obesity prevalence where existing obesity prevalence and soft drink consumption levels are high. Conversely, in countries where the baseline tax rate is already considered high, SSB taxation may not have a noticeable impact on consumption patterns or obesity prevalence, and may incur negative feedback from the beverage industry or the general public. Thorough evaluation of these points is recommended prior to adopting SSB or soft drink taxation as an obesity reduction measure in any given country. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

Quantitation of ultraviolet-induced single-strand breaks using oligonucleotide chip

International Nuclear Information System (INIS)

Pal, Sukdeb; Kim, Min Jung; Choo, Jaebum; Kang, Seong Ho; Lee, Kyeong-Hee; Song, Joon Myong

2008-01-01

A simple, accurate and robust methodology was established for the direct quantification of ultraviolet (UV)-induced single-strand break (SSB) using oligonucleotide chip. Oligonucleotide chips were fabricated by covalently anchoring the fluorescent-labeled ssDNAs onto silicon dioxide chip surfaces. Assuming that the possibility of more than one UV-induced SSB to be generated in a small oligonucleotide is extremely low, SSB formation was investigated quantifying the endpoint probe density by fluorescence measurement upon UV irradiation. The SSB yields obtained based on the highly sensitive laser-induced fluorometric determination of fluorophore-labeled oligonucleotides were found to coincide well with that predicted from a theoretical extrapolation of the results obtained for plasmid DNAs using conventional agarose gel electrophoresis. The developed method has the potential to serve as a high throughput, sample-thrifty, and time saving tool to realize more realistic, and direct quantification of radiation and chemical-induced strand breaks. It will be especially useful for determining the frequency of SSBs or lesions convertible to SSBs by specific cleaving reagents or enzymes

[Expression and purification of a novel thermophilic bacterial single-stranded DNA-binding protein and enhancement the synthesis of DNA and cDNA].

Science.gov (United States)

Jia, Xiao-Wei; Zhang, Guo-Hui; Shi, Hai-Yan

2012-12-01

Express a novel species of single-stranded DNA-binding protein (SSB) derived from Thermococcus kodakarensis KOD1, abbreviated kod-ssb. And evaluate the effect of kod-ssb on PCR-based DNA amplification and reverse transcription. We express kod-ssb with the Transrtta (DE3), and kod-ssb was purified by affinity chromatography on a Ni2+ Sepharose column, detected by SDS-PAGE. To evaluate the effect of kod-ssb on PCR-based DNA amplification, the human beta globin gene was used as template to amplify a 5-kb, 9-kb and 13-kb. And to detect the effect of kod-ssb on reverse transcription, we used RNA from flu cell culture supernatant extraction as templates to implement qRT-PCR reaction. The plasmid pET11a-kod was transformed into Transetta (DE3) and the recombinant strain Transetta (pET11 a-kod) was obtained. The kod-ssb was highly expressed when the recombinant strain Transetta(pET11a-kod) was induced by IPTG. The specific protein was detected by SDS-PAGE. To confirm that kod-ssb can enhance target DNA synthesis and reduce PCR by-products, 5-, 9-, and 13-kb human beta globin gene fragments were used as templates for PCR. When PCR reactions did not include SSB proteins, the specific PCR product was contaminated with non-specific products. When kod -ssb was added, kod-ssb significantly enhanced amplification of the 5-, 9-and 13-kb target product and minimised the non-specific PCR products. To confirm that kod-ssb can enhance target cDNA synthesis, RNA from flu cell culture supernatant extraction was used as templates for qRT-PCR reaction. The results was that when kod-ssb was added, kod-ssb significantly enhanced the synthesis of cDNA, average Ct value is 19.42, and the average Ct value without kod-ssb is 22.15. kod-ssb may in future be used to enhance DNA and cDNA amplification.

A Multipath Technique for Cancelling Harmonics and Sidebands in a Wideband Power Upconverter

NARCIS (Netherlands)

Shrestha, R.; Mensink, E.; Klumperink, Eric A.M.; Wienk, Gerhardus J.M.; Nauta, Bram

2006-01-01

Switching mixers are power-efficient but produce unwanted harmonics and sidebands. A multipath technique to clean up the spectrum using digital circuits and mixers, but no filters, is applied to a 0.13µm CMOS power upconverter. The circuit delivers 8mW from dc to 2.4GHz with 11% drain efficiency,

Intramolecular binding mode of the C-terminus of Escherichia coli single-stranded DNA binding protein determined by nuclear magnetic resonance spectroscopy

OpenAIRE

Shishmarev, Dmitry; Wang, Yao; Mason, Claire E.; Su, Xun-Cheng; Oakley, Aaron J.; Graham, Bim; Huber, Thomas; Dixon, Nicholas E.; Otting, Gottfried

2013-01-01

Single-stranded DNA (ssDNA) binding protein (SSB) is an essential protein to protect ssDNA and recruit specific ssDNA-processing proteins. Escherichia coli SSB forms a tetramer at neutral pH, comprising a structurally well-defined ssDNA binding domain (OB-domain) and a disordered C-terminal domain (C-domain) of ∼64 amino acid residues. The C-terminal eight-residue segment of SSB (C-peptide) has been shown to interact with the OB-domain, but crystal structures failed to reveal any electron den...

Testing of a Peroxidation Systems, Inc. perox-pure SSB-30

International Nuclear Information System (INIS)

Hodgson, K.M.; Lunsford, T.R.

1994-02-01

A facility is being designed and built at the US Department of Energy (DOE) Hanford Site to treat water containing a variety of organic and inorganic compounds. An ultraviolet light/hydrogen peroxide system, manufactured by Peroxidation Systems, Inc. (PSI), has been chosen to destroy the organic compounds in the feed stream. The PSI perox-pure trademark model SSB-30 has been tested by the Westinghouse Hanford Company (WHC) to provide data for permit documentation and to determine appropriate operating conditions. The destruction of the organic compounds was demonstrated with several feed compositions at different ultraviolet light exposures and hydrogen peroxide concentrations

Delayed repair of DNA single-strand breaks does not increase cytogenetic damage

International Nuclear Information System (INIS)

Morgan, W.F.; Djordjevic, M.C.; Jostes, R.F.; Pantelias, G.E.

1985-01-01

DNA damage and cytogenetic effects of ionizing radiation were investigated in Chinese hamster ovary (CHO) cells and unstimulated human peripheral blood lymphocytes. DNA damage and repair were analysed by alkaline elution under conditions that predominantly measured DNA single-strand breaks (ssb). X-radiation (2.5 Gy) induced ssb in both CHO cells and unstimulated lymphocytes, and the breaks were repaired within 30 and 90 min, respectively. This rapid repair was delayed by the poly(ADP-ribose) polymerase inhibitor, 3-aminobenzamide (3AB). The cytogenetic effects of the 3AB-induced delay in DNA repair were examined by analysing sister chromatid exchange (SCE) frequency in CHO cells and fragmentation of prematurely condensed chromosomes (PCC) in unstimulated human lymphocytes after 2.5 Gy of X-rays. Although 3AB delayed the rejoining of DNA ssb, this delay did not result in increased cytogenetic damage manifested as either SCE or fragmentation of PCC. These results indicate that the rapidly rejoining DNA ssb are not important in the production of chromosome damage. (author)

Si{sub 3}N{sub 4} optomechanical crystals in the resolved-sideband regime

Energy Technology Data Exchange (ETDEWEB)

Davanço, M., E-mail: mdavanco@nist.gov [Center for Nanoscale Science and Technology, National Institute of Standards and Technology, Gaithersburg, Maryland 20899 (United States); Department of Applied Physics, California Institute of Technology, Pasadena, California 91125 (United States); Ates, S.; Liu, Y. [Center for Nanoscale Science and Technology, National Institute of Standards and Technology, Gaithersburg, Maryland 20899 (United States); Maryland NanoCenter, University of Maryland, College Park, Maryland 20742 (United States); Srinivasan, K. [Center for Nanoscale Science and Technology, National Institute of Standards and Technology, Gaithersburg, Maryland 20899 (United States)

2014-01-27

We demonstrate sideband-resolved Si{sub 3}N{sub 4} optomechanical crystals supporting 10{sup 5} quality factor optical modes at 980 nm, coupled to ≈4 GHz frequency mechanical modes with quality factors of ≈3000. Optomechanical electromagnetically induced transparency and absorption are observed at room temperature and in atmosphere with intracavity photon numbers in excess of 10{sup 4}.

Practical aspects of Boersch phase contrast electron microscopy of biological specimens

Energy Technology Data Exchange (ETDEWEB)

Walter, Andreas [Max-Planck-Institute of Biophysics, Department of Structural Biology, Max-von-Laue-Str. 3, D-60439 Frankfurt (Germany); Muzik, Heiko; Vieker, Henning; Turchanin, Andrey; Beyer, Andre; Goelzhaeuser, Armin [University of Bielefeld, Physics of Supramolecular Systems and Surfaces, Universitaetsstr. 25, D-33615 Bielefeld (Germany); Lacher, Manfred; Steltenkamp, Siegfried; Schmitz, Sam; Holik, Peter [Caesar Research Center, Ludwig-Erhard-Allee 2, D-53175 Bonn (Germany); Kuehlbrandt, Werner [Max-Planck-Institute of Biophysics, Department of Structural Biology, Max-von-Laue-Str. 3, D-60439 Frankfurt (Germany); Rhinow, Daniel, E-mail: daniel.rhinow@biophys.mpg.de [Max-Planck-Institute of Biophysics, Department of Structural Biology, Max-von-Laue-Str. 3, D-60439 Frankfurt (Germany)

2012-05-15

Implementation of physical phase plates into transmission electron microscopes to achieve in-focus contrast for ice-embedded biological specimens poses several technological challenges. During the last decade several phase plates designs have been introduced and tested for electron cryo-microscopy (cryoEM), including thin film (Zernike) phase plates and electrostatic devices. Boersch phase plates (BPPs) are electrostatic einzel lenses shifting the phase of the unscattered beam by an arbitrary angle. Adjusting the phase shift to 90 Degree-Sign achieves the maximum contrast transfer for phase objects such as biomolecules. Recently, we reported the implementation of a BPP into a dedicated phase contrast aberration-corrected electron microscope (PACEM) and demonstrated its use to generate in-focus contrast of frozen-hydrated specimens. However, a number of obstacles need to be overcome before BPPs can be used routinely, mostly related to the phase plate devices themselves. CryoEM with a physical phase plate is affected by electrostatic charging, obliteration of low spatial frequencies, and mechanical drift. Furthermore, BPPs introduce single sideband contrast (SSB), due to the obstruction of Friedel mates in the diffraction pattern. In this study we address the technical obstacles in detail and show how they may be overcome. We use X-ray photoelectron spectroscopy (XPS) and Auger electron spectroscopy (AES) to identify contaminants responsible for electrostatic charging, which occurs with most phase plates. We demonstrate that obstruction of low-resolution features is significantly reduced by lowering the acceleration voltage of the microscope. Finally, we present computational approaches to correct BPP images for SSB contrast and to compensate for mechanical drift of the BPP. -- Highlights: Black-Right-Pointing-Pointer Various obstacles need to be overcome before Boersch phase plates can be used routinely. Black-Right-Pointing-Pointer Technical problems include

Practical aspects of Boersch phase contrast electron microscopy of biological specimens

International Nuclear Information System (INIS)

Walter, Andreas; Muzik, Heiko; Vieker, Henning; Turchanin, Andrey; Beyer, André; Gölzhäuser, Armin; Lacher, Manfred; Steltenkamp, Siegfried; Schmitz, Sam; Holik, Peter; Kühlbrandt, Werner; Rhinow, Daniel

2012-01-01

Implementation of physical phase plates into transmission electron microscopes to achieve in-focus contrast for ice-embedded biological specimens poses several technological challenges. During the last decade several phase plates designs have been introduced and tested for electron cryo-microscopy (cryoEM), including thin film (Zernike) phase plates and electrostatic devices. Boersch phase plates (BPPs) are electrostatic einzel lenses shifting the phase of the unscattered beam by an arbitrary angle. Adjusting the phase shift to 90° achieves the maximum contrast transfer for phase objects such as biomolecules. Recently, we reported the implementation of a BPP into a dedicated phase contrast aberration-corrected electron microscope (PACEM) and demonstrated its use to generate in-focus contrast of frozen–hydrated specimens. However, a number of obstacles need to be overcome before BPPs can be used routinely, mostly related to the phase plate devices themselves. CryoEM with a physical phase plate is affected by electrostatic charging, obliteration of low spatial frequencies, and mechanical drift. Furthermore, BPPs introduce single sideband contrast (SSB), due to the obstruction of Friedel mates in the diffraction pattern. In this study we address the technical obstacles in detail and show how they may be overcome. We use X-ray photoelectron spectroscopy (XPS) and Auger electron spectroscopy (AES) to identify contaminants responsible for electrostatic charging, which occurs with most phase plates. We demonstrate that obstruction of low-resolution features is significantly reduced by lowering the acceleration voltage of the microscope. Finally, we present computational approaches to correct BPP images for SSB contrast and to compensate for mechanical drift of the BPP. -- Highlights: ► Various obstacles need to be overcome before Boersch phase plates can be used routinely. ► Technical problems include electrostatic charging, mechanical drift, and image artefacts. �

Persistent fetal sinus bradycardia associated with maternal anti-SSA/Ro and anti-SSB/La antibodies

NARCIS (Netherlands)

Chockalingam, Priya; Jaeggi, Edgar T.; Rammeloo, Lukas A.; Haak, Monique C.; Adama van Scheltema, Phebe N.; Breur, Johannes M. P. J.; Bartelings, Margot M.; Clur, Sally-Ann B.; Blom, Nico A.

2011-01-01

To study the clinical course and outcome of fetal sinus bradycardia (SB) due to maternal antibody-induced sinus node dysfunction. We reviewed the maternal, prenatal, and postnatal findings of fetuses with SB associated with elevated maternal anti-SSA/Ro and anti-SSB/La antibodies. Of the 6 cases

Butanol biorefineries: Use of novel technologies to produce biofuel butanol from sweet sorghum bagasse (SSB)

Science.gov (United States)

In order to produce butanol biofuel at a competitive price, agricultural residues such as SSB should be used. This feedstock was studied as a substitute to corn to lower feedstock costs and broaden beyond a food crop. In addition, cutting edge science & technology was applied. In these studies we us...

Plasmon sidebands in the gain spectrum of an electron-hole plasma

International Nuclear Information System (INIS)

Hoang Ngoc Cam; Nguyen Van Hieu; Nguyen Ai Viet.

1987-06-01

The theory is represented for the recombination of the electron-hole pair into the photon with and without the emission of the plasmon-phonon coupled modes. In calculating the energies of the plasmon and the plasmon-phonon coupled modes as well as the vertices of their effective interactions the quantum field theory method has been applied. The theoretical prediction agrees well with the experimental result in the main part EHP 0 and the first sideband EHP - of the gain spectrum. (author). 6 refs, 9 figs

hSSB1 associates with and promotes stability of the BLM helicase

OpenAIRE

O'BYRNE, KEN

2017-01-01

Background Maintenance of genome stability is critical in human cells. Mutations in or loss of genome stability pathways can lead to a number of pathologies including cancer. hSSB1 is a critical DNA repair protein functioning in the repair and signalling of stalled DNA replication forks, double strand DNA breaks and oxidised DNA lesions. The BLM helicase is central to the repair of both collapsed DNA replication forks and double strand DNA breaks by homologous recombination. Results In this s...

Single-photon sources based on single molecules in solids

International Nuclear Information System (INIS)

Moerner, W E

2004-01-01

Single molecules in suitable host crystals have been demonstrated to be useful single-photon emitters both at liquid-helium temperatures and at room temperature. The low-temperature source achieved controllable emission of single photons from a single terrylene molecule in p-terphenyl by an adiabatic rapid passage technique. In contrast with almost all other single-molecule systems, terrylene single molecules show extremely high photostability under continuous, high-intensity irradiation. A room-temperature source utilizing this material has been demonstrated, in which fast pumping into vibrational sidebands of the electronically excited state achieved efficient inversion of the emissive level. This source yielded a single-photon emission probability p(1) of 0.86 at a detected count rate near 300 000 photons s -1 , with very small probability of emission of more than one photon. Thus, single molecules in solids can be considered as contenders for applications of single-photon sources such as quantum key distribution

Test and assessment method of Automotive Safety Systems (SSB) particularly to monitor traffic incidents

Science.gov (United States)

Pijanowski, B.; Łukjanow, S.; Burliński, R.

2016-09-01

The rapid development of telematics, particularly mobile telephony (GSM), wireless data transmission (GPRS) and satellite positioning (GPS) noticeable in the last decade, resulted in an almost unlimited growth of the possibilities for monitoring of mobile objects. These solutions are already widely used in the so-called “Intelligent Transport Systems” - ITS and affect a significant increase for road safety. The article describes a method of testing and evaluation of Car Safety Systems (Polish abbreviation - SSB) especially for monitoring traffic incidents, such as collisions and accidents. The algorithm of SSB testing process is also presented. Tests are performed on the dynamic test bench, part of which is movable platform with car security system mounted on it. Crash tests with a rigid obstacle are carried out instead of destructive attempts to crash test of the entire vehicle which is expensive. The tested system, depending on the simulated traffic conditions, is mounted in such a position and with the use of components, indicated by the manufacturer for the automotive safety system installation in a vehicle, for which it is intended. Then, the tests and assessments are carried out.

Auxiliary-cavity-assisted ground-state cooling of an optically levitated nanosphere in the unresolved-sideband regime

Science.gov (United States)

Feng, Jin-Shan; Tan, Lei; Gu, Huai-Qiang; Liu, Wu-Ming

2017-12-01

We theoretically analyze the ground-state cooling of an optically levitated nanosphere in the unresolved-sideband regime by introducing a coupled high-quality-factor cavity. On account of the quantum interference stemming from the presence of the coupled cavity, the spectral density of the optical force exerting on the nanosphere gets changed and then the symmetry between the heating and the cooling processes is broken. Through adjusting the detuning of a strong-dissipative cavity mode, one obtains an enhanced net cooling rate for the nanosphere. It is illustrated that the ground-state cooling can be realized in the unresolved sideband regime even if the effective optomechanical coupling is weaker than the frequency of the nanosphere, which can be understood by the picture that the effective interplay of the nanosphere and the auxiliary cavity mode brings the system back to an effective resolved regime. Besides, the coupled cavity refines the dynamical stability of the system.

Vibration Sideband Modulations and Harmonics Separation of a Planetary Helicopter Gearbox with Two Different Configurations

Directory of Open Access Journals (Sweden)

Nader Sawalhi

2016-01-01

Full Text Available This paper examines the spectrum and cepstrum content of vibration signals taken from a helicopter gearbox with two different configurations (3 and 4 planets. It presents a signal processing algorithm to separate synchronous and nonsynchronous components for complete shafts’ harmonic extraction and removal. The spectrum and cepstrum of the vibration signal for two configurations are firstly analyzed and discussed. The effect of changing the number of planets on the fundamental gear mesh frequency (epicyclic mesh frequency and its sidebands is discussed. The paper explains the differences between the two configurations and discusses, in particular, the asymmetry of the modulation sidebands about the epicyclic mesh frequency in the 4 planets arrangement. Finally a separation algorithm, which is based on resampling the order-tracked signal to have an integer number of samples per revolution for a specific shaft, is proposed for a complete removal of the shafts harmonics. The results obtained from the presented separation algorithms are compared to other separation schemes such as discrete random separation (DRS and time synchronous averaging (TSA with clear improvements and better results.

Overproduction of single-stranded-DNA-binding protein specifically inhibits recombination of UV-irradiated bacteriophage DNA in Escherichia coli

International Nuclear Information System (INIS)

Moreau, P.L.

1988-01-01

Overproduction of single-stranded DNA (ssDNA)-binding protein (SSB) in uvr Escherichia coli mutants results in a wide range of altered phenotypes. (i) Cell survival after UV irradiation is decreased; (ii) expression of the recA-lexA regulon is slightly reduced after UV irradiation, whereas it is increased without irradiation; and (iii) recombination of UV-damaged lambda DNA is inhibited, whereas recombination of nonirradiated DNA is unaffected. These results are consistent with the idea that in UV-damaged bacteria, SSB is first required to allow the formation of short complexes of RecA protein and ssDNA that mediate cleavage of the LexA protein. However, in a second stage, SSB should be displaced from ssDNA to permit the production of longer RecA-ssDNA nucleoprotein filaments that are required for strand pairing and, hence, recombinational repair. Since bacteria overproducing SSB appear identical in physiological respects to recF mutant bacteria, it is suggested that the RecF protein (alone or with other proteins of the RecF pathway) may help RecA protein to release SSB from ssDNA

Equivalence of two formalisms for calculating higher order synchrotron sideband spin resonances

International Nuclear Information System (INIS)

Mane, S.R.

1988-01-01

Synchrotron sideband resonances of a first order spin resonance are generally regarded as the most important higher order spin resonances in a high-energy storage ring. Yokoya's formula for these resonances is rederived, including some extra terms, which he neglected, but which turn out to be of comparable magnitude to the terms retained. Including these terms, Yokoya's formalism and the SMILE algorithm are shown to be equivalent to leading order in the resonance strengths. The theoretical calculations are shown to agree with certain measurements from SPEAR

SSB taxes and diet quality in US preschoolers: estimated changes in the 2010 Healthy Eating Index.

Science.gov (United States)

Ford, C N; Poti, J M; Ng, S W; Popkin, B M

2017-04-01

Taxing sugar-sweetened beverages (SSBs) has been proposed as a strategy to combat child obesity. Yet it is unclear how a tax on SSBs might influence the overall quality of diet in preschool children. Thus, we use simulated price increases and the 2010 Healthy Eating Index (HEI-2010) to explore the relationship between SSB taxes and diet quality in preschool children. Price and purchase data from the 2009-2012 Nielsen Homescan Panel and a two-part marginal effects model were used to estimate relative changes in purchases with a 20% increase in the price of SSBs. Demand elasticities were applied to dietary intake data for children ages 2-5 years from the National Health and Nutrition Examination Survey (2009-2010 and 2011-2012) to estimate the impact of a 20% SSB tax on dietary intake and quality (HEI-2010). A 20% increase in the price of SSBs was associated with lower total caloric intake (-28 kcal d -1 , p diet quality as an isolated intervention among US preschool children. © 2016 World Obesity Federation.

Investigation of Sideband Index Response to Prototype Gear Tooth Damage

Science.gov (United States)

Dempsey, Paula J.

2013-01-01

The objective of this analysis was to evaluate the ability of gear condition indicators (CI) to detect contact fatigue damage on spiral bevel gear teeth. Tests were performed in the NASA Glenn Spiral Bevel Gear Fatigue Rig on eight prototype gear sets (pinion/gear). Damage was initiated and progressed on the gear and pinion teeth. Vibration data was measured during damage progression at varying torque values while varying damage modes to the gear teeth were observed and documented with inspection photos. Sideband indexes (SI) and root mean square (RMS) CIs were calculated from the time synchronous averaged vibration data. Results found that both CIs respond differently to varying torque levels, damage levels and damage modes

UV light-induced DNA synthesis arrest in HeLa cells is associated with changes in phosphorylation of human single-stranded DNA-binding protein

International Nuclear Information System (INIS)

Carty, M.P.; Zernik-Kobak, M.; McGrath, S.; Dixon, K.

1994-01-01

We show that DNA replication activity in extracts of human HeLa cells decreases following UV irradiation. Alterations in replication activity in vitro parallel the UV-induced block in cell cycle progression of these cells in culture. UV irradiation also induces specific changes in the pattern of phosphorylation of the 34 kDa subunit of a DNA replication protein, human single-stranded DNA-binding protein (hSSB). The appearance of a hyperphosphorylated form of hSSB correlates with reduced in vitro DNA replication activity in extracts of UV-irradiated cells. Replication activity can be restored to these extracts in vitro by addition of purified hSSB. These results suggest that UV-induced DNA synthesis arrest may be mediated in part through phosphorylation-related alterations in the activity of hSSB, an essential component of the DNA replication apparatus. (Author)

DNA degradation, UV sensitivity and SOS-mediated mutagenesis in strains of Escherichia coli deficient in single-strand DNA binding protein: Effects of mutations and treatments that alter levels of exonuclease V or RecA protein

International Nuclear Information System (INIS)

Lieberman, H.B.; Witkin, E.M.

1983-01-01

Certain strains suppress the temperature-sensitivity caused by ssb-1, which encodes a mutant ssDNA binding protein (SSB). At 42 0 C, such strains are extremely UV-sensitive, degrade their DNA extensively after UV irradiation, and are defficient in UV mutability and UV induction of recA protein synthesis. We transduced recC22, which eliminates Exonuclease V activity, and recAo281, which causes operator-constitutive synthesis of recA protein, into such an ssb-1 strain. Both double mutants degraded their DNA extensively at 42 0 C after UV irradiation, and both were even more UV-sensitive than the ssb-1 single mutant. We conclude that one or more nucleases other than Exonuclease V degrades DNA in the ssb recC strain, and that recA protein, even if synthesized copiously, can function efficiently in recombinational DNA repair and in control of post-UV DNA degradation only if normal SSB is also present. Pretreatment with nalidixic acid at 30 0 C restored normal UV mutability at 42 0 C, but did not increase UV resistance, in an ssb-1 strain. Another ssb allele, ssb-113, which blocks SOS induction at 30 0 C, increases spontaneous mutability more than tenfold. The ssb-113 allele was transduced into the SOS-constitutive recA730 strain SC30. This double mutant expressed the same elevated spontaneous and UV-induced mutability at 30 0 C as the ssb + recA730 strain, and was three times more UV-resistant than its ssb-113 recA + parent. We conclude that ssb-1 at 42 0 C and ssb-113 at 30 0 C block UV-induced activation of recA protease, but that neither allele interferes with subsequent steps in SOS-mediated mutagenesis. (orig.)

Change of conformation and internal dynamics of supercoiled DNA upon binding of Escherichia coli single-strand binding protein

International Nuclear Information System (INIS)

Langowski, J.; Benight, A.S.; Fujimoto, B.S.; Schurr, J.M.; Schomburg, U.

1985-01-01

The influence of Escherichia coli single-strand binding (SSB) protein on the conformation and internal dynamics of pBR322 and pUC8 supercoiled DNAs has been investigated by using dynamic light scattering at 632.8 and 351.1 nm and time-resolved fluorescence polarization anisotropy of intercalated ethidium. SSB protein binds to both DNAs up to a stoichiometry that is sufficient to almost completely relax the superhelical turns. Upon saturation binding, the translational diffusion coefficients (D 0 ) of both DNAs decrease by approximately 20%. Apparent diffusion coefficients (D/sub app/) obtained from dynamic light scattering display the well-known increase with K 2 (K = scattering vector), leveling off toward a plateau value (D/sub plat/) at high K 2 . For both DNAs, the difference D/sub plat/ - D 0 increases upon relaxation of supercoils by SSB protein, which indicates a corresponding enhancement of the subunit mobilities in internal motions. Fluorescence polarization anisotropy measurements on free and complexed pBR322 DNA indicate a (predominantly) uniform torsional rigidity for the saturated DNA/SSB protein complex that is significantly reduced compared to the free DNA. These observations are all consistent with the notion that binding of SSB protein is accompanied by a gradual loss of supercoils and saturates when the superhelical twist is largely removed

SEPIA - a new single pixel receiver at the APEX telescope

Science.gov (United States)

Belitsky, V.; Lapkin, I.; Fredrixon, M.; Meledin, D.; Sundin, E.; Billade, B.; Ferm, S.-E.; Pavolotsky, A.; Rashid, H.; Strandberg, M.; Desmaris, V.; Ermakov, A.; Krause, S.; Olberg, M.; Aghdam, P.; Shafiee, S.; Bergman, P.; Beck, E. De; Olofsson, H.; Conway, J.; Breuck, C. De; Immer, K.; Yagoubov, P.; Montenegro-Montes, F. M.; Torstensson, K.; Pérez-Beaupuits, J.-P.; Klein, T.; Boland, W.; Baryshev, A. M.; Hesper, R.; Barkhof, J.; Adema, J.; Bekema, M. E.; Koops, A.

2018-04-01

Context. We describe the new Swedish-ESO PI Instrument for APEX (SEPIA) receiver, which was designed and built by the Group for Advanced Receiver Development (GARD), at Onsala Space Observatory (OSO) in collaboration with ESO. It was installed and commissioned at the APEX telescope during 2015 with an ALMA Band 5 receiver channel and updated with a new frequency channel (ALMA Band 9) in February 2016. Aim. This manuscript aims to provide, for observers who use the SEPIA receiver, a reference in terms of the hardware description, optics and performance as well as the commissioning results. Methods: Out of three available receiver cartridge positions in SEPIA, the two current frequency channels, corresponding to ALMA Band 5, the RF band 158-211 GHz, and Band 9, the RF band 600-722 GHz, provide state-of-the-art dual polarization receivers. The Band 5 frequency channel uses 2SB SIS mixers with an average SSB noise temperature around 45 K with IF (intermediate frequency) band 4-8 GHz for each sideband providing total 4 × 4 GHz IF band. The Band 9 frequency channel uses DSB SIS mixers with a noise temperature of 75-125 K with IF band 4-12 GHz for each polarization. Results: Both current SEPIA receiver channels are available to all APEX observers.

A new model of Social Support in Bereavement (SSB): An empirical investigation with a Chinese sample.

Science.gov (United States)

Li, Jie; Chen, Sheying

2016-01-01

Bereavement can be an extremely stressful experience while the protective effect of social support is expected to facilitate the adjustment after loss. The ingredients or elements of social support as illustrated by a new model of Social Support in Bereavement (SSB), however, requires empirical evidence. Who might be the most effective providers of social support in bereavement has also been understudied, particularly within specific cultural contexts. The present study uses both qualitative and quantitative analyses to explore these two important issues among bereaved Chinese families and individuals. The results show that three major types of social support described by the SSB model were frequently acknowledged by the participants in this study. Aside from relevant books, family and friends were the primary sources of social support who in turn received support from their workplaces. Helping professionals turned out to be the least significant source of social support in the Chinese cultural context. Differences by gender, age, and bereavement time were also found. The findings render empirical evidence to the conceptual model of Social Support in Bereavement and also offer culturally relevant guidance for providing effective support to the bereaved.

Spectral broadening of VLF transmitter signals and sideband structure observed on Aureol 3 satellite at middle latitudes

International Nuclear Information System (INIS)

Tanaka, Y.; Hayakawa, M.; Lagoutte, D.; Lefeuvre, F.; Tajima, S.

1987-01-01

Electric and magnetic field wave data acquired on Aureol 3 satellite demonstrate the existence of a spectral broadening effect in which VLF transmitter signals from Alpha station (geographic coordinates, 50.5 degree N, 137 degree E) in USSR undergo a significant spectral broadening on electric fields as they propagate through the ionosphere up to the spacecraft in the altitude range of 500-2,000 km at middle latitudes (L ∼ 2). The spectral broadening phenomena may be divided into two types: (1) spectrally broadened components occurring without any association with ELF/VLF emissions under disturbed ionospheric conditions and (2) spectrally broadened components with predominant sideband structure in association with ELF emissions. Bicoherence computation results suggest a nonlinear mode coupling between the transmitter signal and ELF emission which produces sidebands that are quasi-electrostatic in nature. However, faint spectral broadened components in both types 1 and 2 may be connected with Doppler shift of quasi-electrostatic whistler mode waves with a broad spectrum of k near the resonance cone, due to scattering of the transmitter signals from ionospheric irregularities in the F region

Tunable high-order-sideband generation and carrier-envelope-phase-dependent effects via microwave fields in hybrid electro-optomechanical systems

Science.gov (United States)

Si, Liu-Gang; Guo, Ling-Xia; Xiong, Hao; Wu, Ying

2018-02-01

We investigate the high-order-sideband generation (HSG) in a hybrid cavity electro-photomechanical system in which an optical cavity is driven by two optical fields (a monochromatic pump field and a nanosecond Gaussian probe pulse with huge numbers of wave cycles), and at the same time a microwave cavity is driven by a monochromatic ac voltage bias. We show that even if the input powers of two driven optical fields are comparatively low the HSG spectra can be induced and enhanced, and the sideband plateau is extended remarkably with the power of the ac voltage bias increasing. It is also shown that the driven ac voltage bias has profound effects on the carrier-envelope-phase-dependent effects of the HSG in the hybrid cavity electro-photomechanical system. Our research may provide an effective way to control the HSG of optical fields by using microwave fields in cavity optomechanics systems.

Sum-Frequency-Generation-Based Laser Sidebands for Tunable Femtosecond Raman Spectroscopy in the Ultraviolet

Directory of Open Access Journals (Sweden)

Liangdong Zhu

2015-04-01

Full Text Available Femtosecond stimulated Raman spectroscopy (FSRS is an emerging molecular structural dynamics technique for functional materials characterization typically in the visible to near-IR range. To expand its applications we have developed a versatile FSRS setup in the ultraviolet region. We use the combination of a narrowband, ~400 nm Raman pump from a home-built second harmonic bandwidth compressor and a tunable broadband probe pulse from sum-frequency-generation-based cascaded four-wave mixing (SFG-CFWM laser sidebands in a thin BBO crystal. The ground state Raman spectrum of a laser dye Quinolon 390 in methanol that strongly absorbs at ~355 nm is systematically studied as a standard sample to provide previously unavailable spectroscopic characterization in the vibrational domain. Both the Stokes and anti-Stokes Raman spectra can be collected by selecting different orders of SFG-CFWM sidebands as the probe pulse. The stimulated Raman gain with the 402 nm Raman pump is >21 times larger than that with the 550 nm Raman pump when measured at the 1317 cm−1 peak for the aromatic ring deformation and ring-H rocking mode of the dye molecule, demonstrating that pre-resonance enhancement is effectively achieved in the unique UV-FSRS setup. This added tunability in the versatile and compact optical setup enables FSRS to better capture transient conformational snapshots of photosensitive molecules that absorb in the UV range.

New Modeling and Simulation Platform for Communications Systems:(I Double Sideband Suppressed Carrier AM Modulator DSB-SC

Directory of Open Access Journals (Sweden)

H. A. Ahmed

2012-08-01

Full Text Available The main goal of this paper is to introduce a new platform for the implementation and simulation of communication systems. SCILAB/SCICOS is an open source software for conducting communication system related experiments, aiming to provide an experimentation platform for research on communication theories. Double Sideband Suppressed Carrier (DSB-SC Modulator is modeled and simulated using this platform.

Generation of a single-cycle optical pulse

International Nuclear Information System (INIS)

Shverdin, M.Y.; Walker, D.R.; Yavuz, D.D.; Yin, G.Y.; Harris, S.E.

2005-01-01

We make use of coherent control of four-wave mixing to the ultraviolet as a diagnostic and describe the generation of a periodic optical waveform where the spectrum is sufficiently broad that the envelope is approximately a single-cycle in length, and where the temporal shape of this envelope may be synthesized by varying the coefficients of a Fourier series. Specifically, using seven sidebands, we report the generation of a train of single-cycle optical pulses with a pulse width of 1.6 fs, a pulse separation of 11 fs, and a peak power of 1 MW

Sideband-cooling of trapped ytterbium-ions in the microwave regime; Seitenbandkuehlung von gespeicherten Ytterbium-Ionen im Mikrowellenregime

Energy Technology Data Exchange (ETDEWEB)

Scharfenberger, Benedikt J.

2012-12-14

Trapped ions in a Paul trap are at present one of the most promising candidates for Quantum Information Processing (QIP). The technique that is used for this purpose in this experiment was introduced in 2001 by F. Mintert and Ch. Wunderlich. The core of this method is the use of atomic transitions in the radio- or microwave region, while a magnetic field gradient along the trap axis (where the ion chain is situated) lifts the degeneracy of the transition frequencies, such that the ions can be distinguished in frequency space; it also serves for the coupling of internal and external degrees of freedom of the ion chain. This method is called MAGIC (MAgnetic Gradient Induced Coupling). The performance of the measurements required that the apparatus of the experiment, which consists of laser sources, lambdameter, vacuum- and microwave system as well as imaging- and detection-units, had to be assembled and tested, which was an important prerequisite for the successful performance of the here described experiments. For the experiments it is advantageous to prepare the ions in an energetic state close to the motional ground state, which contributes to a reduction of the dephasing of the system while manipulating it with microwaves. By using the sideband-cooling technique to the sub-Doppler regime it is taken advantage of the fact, that ions in a linear trap are in good approximation situated in a harmonic oscillator potential and can therefore only populate discrete vibrational energy levels, whose frequency difference is given by the axial trap frequency {omega}{sub z}. If the system is excited by a microwave, which frequency is detuned from resonance to lower energies by a vibrational quantum, the ion looses one such phonon within each cooling-cycle. When this cycle is driven several times, the average phonon number and thus the temperature of the ion can be reduced efficiently and the ion can be initialized in a state close to the motional ground state. As sideband

Non-uniform binding of single-stranded DNA binding proteins to hybrids of single-stranded DNA and single-walled carbon nanotubes observed by atomic force microscopy in air and in liquid

Energy Technology Data Exchange (ETDEWEB)

Umemura, Kazuo, E-mail: meicun2006@163.com; Ishizaka, Kei; Nii, Daisuke; Izumi, Katsuki

2016-12-01

Highlights: • Conjugates of protein, DNA, and SWNTs were observed by AFM in liquid. • Non-uniform binding of proteins was visualized in liquid. • Thickness of DNA molecules on SWNT surfaces was well characterized in liquid. - Abstract: Using atomic force spectroscopy (AFM), we observed hybrids of single-stranded DNA (ssDNA) and single-walled carbon nanotubes (SWNTs) with or without protein molecules in air and in an aqueous solution. This is the first report of ssDNA–SWNT hybrids with proteins in solution analyzed by AFM. In the absence of protein, the height of the ssDNA–SWNT hybrids was 1.1 ± 0.3 nm and 2.4 ± 0.6 nm in air and liquid, respectively, suggesting that the ssDNA molecules adopted a flexible structure on the SWNT surface. In the presence of single-stranded DNA binding (SSB) proteins, the heights of the hybrids in air and liquid increased to 6.4 ± 3.1 nm and 10.0 ± 4.5 nm, respectively. The AFM images clearly showed binding of the SSB proteins to the ssDNA–SWNT hybrids. The morphology of the SSB–ssDNA–SWNT hybrids was non-uniform, particularly in aqueous solution. The variance of hybrid height was quantitatively estimated by cross-section analysis along the long-axis of each hybrid. The SSB–ssDNA–SWNT hybrids showed much larger variance than the ssDNA–SWNT hybrids.

A low-spurious fast-hopping MB-OFDM UWB synthesizer

Energy Technology Data Exchange (ETDEWEB)

Chen Danfeng; Li Wei; Li Ning; Ren Junyan, E-mail: w-li@fudan.edu.c [State Key Laboratory of ASIC and System, Fudan University, Shanghai 201203 (China)

2010-06-15

A frequency synthesizer for the ultra-wide band (UWB) group no. 1 is proposed. The synthesizer uses a phase-locked loop (PLL) and single-sideband (SSB) mixers to generate the three center frequencies of the first band group by mixing 4224 MHz with {+-}264 MHz and 792 MHz, respectively. A novel multi-QSSB mixer is designed to combine the function of frequency selection and frequency conversion for low power and high linearity. The synthesizer is fabricated in Jazz 0.18-{mu}m RF CMOS technology. The measured reference spur is as low as -69 dBc and the maximum spur is the LO leakage of -32 dBc. A low phase noise of -110 dBc/Hz - 1 MHz offset and an integrated phase noise of 1.86{sup 0} are achieved. The hopping time between different bands is less than 1.8 ns. The synthesizer consumes 30 mA from a 1.8 V supply. (semiconductor integrated circuits)

A low-spurious fast-hopping MB-OFDM UWB synthesizer

International Nuclear Information System (INIS)

Chen Danfeng; Li Wei; Li Ning; Ren Junyan

2010-01-01

A frequency synthesizer for the ultra-wide band (UWB) group no. 1 is proposed. The synthesizer uses a phase-locked loop (PLL) and single-sideband (SSB) mixers to generate the three center frequencies of the first band group by mixing 4224 MHz with ±264 MHz and 792 MHz, respectively. A novel multi-QSSB mixer is designed to combine the function of frequency selection and frequency conversion for low power and high linearity. The synthesizer is fabricated in Jazz 0.18-μm RF CMOS technology. The measured reference spur is as low as -69 dBc and the maximum spur is the LO leakage of -32 dBc. A low phase noise of -110 dBc/Hz - 1 MHz offset and an integrated phase noise of 1.86 0 are achieved. The hopping time between different bands is less than 1.8 ns. The synthesizer consumes 30 mA from a 1.8 V supply. (semiconductor integrated circuits)

Wavelet Based Hilbert Transform with Digital Design and Application to QCM-SS Watermarking

Directory of Open Access Journals (Sweden)

S. P. Maity

2008-04-01

Full Text Available In recent time, wavelet transforms are used extensively for efficient storage, transmission and representation of multimedia signals. Hilbert transform pairs of wavelets is the basic unit of many wavelet theories such as complex filter banks, complex wavelet and phaselet etc. Moreover, Hilbert transform finds various applications in communications and signal processing such as generation of single sideband (SSB modulation, quadrature carrier multiplexing (QCM and bandpass representation of a signal. Thus wavelet based discrete Hilbert transform design draws much attention of researchers for couple of years. This paper proposes an (i algorithm for generation of low computation cost Hilbert transform pairs of symmetric filter coefficients using biorthogonal wavelets, (ii approximation to its rational coefficients form for its efficient hardware realization and without much loss in signal representation, and finally (iii development of QCM-SS (spread spectrum image watermarking scheme for doubling the payload capacity. Simulation results show novelty of the proposed Hilbert transform design and its application to watermarking compared to existing algorithms.

The oxygen enhancement ratio for single- and double-strand breaks induced by tritium incorporated in DNA of cultured human T1 cells. Impact of the transmutation effect.

Science.gov (United States)

Tisljar-Lentulis, G; Henneberg, P; Feinendegen, L E; Commerford, S L

1983-04-01

The effect of oxygen, expressed as the oxygen enhancement ratio (OER), on the number of single-strand breaks (SSB) and double-strand breaks (DSB) induced in DNA by the radioactive decay of tritium was measured in human T1 cells whose DNA had been labeled with tritium at carbon atom number 6 of thymidine. Decays were accumulated in vivo under aerobic conditions at 0-1 degrees C and at -196 degrees C and in a nitrogen atmosphere at 0-1 degrees C. The number of SSB and DSB produced was analyzed by sucrose gradient centrifugation. For each tritium decay there were 0.25 DSB in cells exposed to air at 0-1 degrees C and 0.07 in cells kept under nitrogen, indicating an OER of 3.6, a value expected for such low-LET radiation. However, for each tritium decay there were 1.25 SSB in cells exposed to air at 0-1 degrees C and 0.76 in cells kept under nitrogen indicating an OER of only 1.7. The corresponding values for 60Co gamma radiation, expressed as SSB per 100 eV absorbed energy, were 4.5 and 1.0, giving an OER of 4.5. The low OER value found for SSB induced by tritium decay can be explained if 31% of the total SSB produced in air result from transmutation by a mechanism which does not produce DSB and is unaffected by oxygen.

Phylogenetic and functional analysis of the bacteriophage P1 single-stranded DNA-binding protein

DEFF Research Database (Denmark)

Bendtsen, Jannick Dyrløv; Nilsson, A.S.; Lehnherr, H.

2002-01-01

and does not represent a recent acquirement of the phage. The P1 and E. coli SSB proteins are fully functionally interchangeable. SSB-P1 is nonessential for phage growth in an exponentially growing E. coli host, and it is sufficient to promote bacterial growth in the absence of the E. coli SSB protein....... Expression studies showed that the P1 ssb gene is transcribed only, in an rpoS-independent fashion, during stationary-phase growth in E. coli. Mixed infection experiments demonstrated that a wild-type phage has a selective advantage over an ssb-null mutant when exposed to a bacterial host in the stationary...

Alternative laser system for cesium magneto-optical trap via optical injection locking to sideband of a 9-GHz current-modulated diode laser.

Science.gov (United States)

Diao, Wenting; He, Jun; Liu, Zhi; Yang, Baodong; Wang, Junmin

2012-03-26

By optical injection of an 852-nm extended-cavity diode laser (master laser) to lock the + 1-order sideband of a ~9-GHz-current-modulated diode laser (slave laser), we generate a pair of phase-locked lasers with a frequency difference up to ~9-GHz for a cesium (Cs) magneto-optical trap (MOT) with convenient tuning capability. For a cesium MOT, the master laser acts as repumping laser, locked to the Cs 6S₁/₂ (F = 3) - 6P₃/₂ (F' = 4) transition. When the + 1-order sideband of the 8.9536-GHz-current-modulated slave laser is optically injection-locked, the carrier operates on the Cs 6S₁/₂ (F = 4) - 6P₃/₂ (F' = 5) cooling cycle transition with -12 MHz detuning and acts as cooling/trapping laser. When carrying a 9.1926-GHz modulation signal, this phase-locked laser system can be applied in the fields of coherent population trapping and coherent manipulation of Cs atomic ground states.

Study of microRNAs (miRNAs) that are predicted to target the autoantigens Ro/SSA and La/SSB in primary Sjögren’s Syndrome

Science.gov (United States)

Gourzi, V C; Kapsogeorgou, E K; Kyriakidis, N C; Tzioufas, A G

2015-01-01

The elevated tissue expression of Ro/SSA and La/SSB autoantigens appears to be crucial for the generation and perpetuation of autoimmune humoral responses against these autoantigens in Sjögren’s syndrome (SS). The mechanisms that govern their expression are not known. miRNAs, the post-transcriptional regulators of gene expression, might be implicated. We have identified previously the miRNAs let7b, miR16, miR181a, miR200b-3p, miR200b-5p, miR223 and miR483-5p that are predicted to target Ro/SSA [Ro52/tripartite motif-containing protein 21 (TRIM21), Ro60/TROVE domain family, member 2 (TROVE2)] and La/SSB mRNAs. To study possible associations with autoantigen mRNA expression and disease features, their expression was investigated in minor salivary gland (MSG) tissues, peripheral blood mononuclear cells (PBMC) and long-term cultured non-neoplastic salivary gland epithelial cells (SGEC) from 29 SS patients (20 of 29 positive for autoantibodies to Ro/SSA and La/SSB) and 24 sicca-complaining controls. The levels of miR16 were up-regulated in MSGs, miR200b-3p in SGECs and miR223 and miR483-5p in PBMCs of SS patients compared to sicca-complaining controls. The MSG levels of let7b, miR16, miR181a, miR223 and miR483-5p were correlated positively with Ro52/TRIM21-mRNA. miR181a and miR200b-3p were correlated negatively with Ro52/TRIM21 and Ro60/TROVE2 mRNAs in SGECs, respectively, whereas let7b, miR200b-5p and miR223 associated with La/SSB-mRNA. In PBMCs, let7b, miR16, miR181a and miR483-5p were correlated with Ro52/TRIM21, whereas let7b, miR16 and miR181a were also associated with La/SSB-mRNA expression. Significantly lower miR200b-5p levels were expressed in SS patients with mucosa-associated lymphoid tissue (MALT) lymphoma compared to those without. Our findings indicate that miR16, miR200b-3p, miR223 and miR483-5p are deregulated in SS, but the exact role of this deregulation in disease pathogenesis and autoantigen expression needs to be elucidated. PMID:26201309

Identification of the divergent calmodulin binding motif in yeast Ssb1/Hsp75 protein and in other HSP70 family members.

Science.gov (United States)

Heinen, R C; Diniz-Mendes, L; Silva, J T; Paschoalin, V M F

2006-11-01

Yeast soluble proteins were fractionated by calmodulin-agarose affinity chromatography and the Ca2+/calmodulin-binding proteins were analyzed by SDS-PAGE. One prominent protein of 66 kDa was excised from the gel, digested with trypsin and the masses of the resultant fragments were determined by MALDI/MS. Twenty-one of 38 monoisotopic peptide masses obtained after tryptic digestion were matched to the heat shock protein Ssb1/Hsp75, covering 37% of its sequence. Computational analysis of the primary structure of Ssb1/Hsp75 identified a unique potential amphipathic alpha-helix in its N-terminal ATPase domain with features of target regions for Ca2+/calmodulin binding. This region, which shares 89% similarity to the experimentally determined calmodulin-binding domain from mouse, Hsc70, is conserved in near half of the 113 members of the HSP70 family investigated, from yeast to plant and animals. Based on the sequence of this region, phylogenetic analysis grouped the HSP70s in three distinct branches. Two of them comprise the non-calmodulin binding Hsp70s BIP/GR78, a subfamily of eukaryotic HSP70 localized in the endoplasmic reticulum, and DnaK, a subfamily of prokaryotic HSP70. A third heterogeneous group is formed by eukaryotic cytosolic HSP70s containing the new calmodulin-binding motif and other cytosolic HSP70s whose sequences do not conform to those conserved motif, indicating that not all eukaryotic cytosolic Hsp70s are target for calmodulin regulation. Furthermore, the calmodulin-binding domain found in eukaryotic HSP70s is also the target for binding of Bag-1 - an enhancer of ADP/ATP exchange activity of Hsp70s. A model in which calmodulin displaces Bag-1 and modulates Ssb1/Hsp75 chaperone activity is discussed.

Identification of the divergent calmodulin binding motif in yeast Ssb1/Hsp75 protein and in other HSP70 family members

Directory of Open Access Journals (Sweden)

R.C. Heinen

2006-11-01

Full Text Available Yeast soluble proteins were fractionated by calmodulin-agarose affinity chromatography and the Ca2+/calmodulin-binding proteins were analyzed by SDS-PAGE. One prominent protein of 66 kDa was excised from the gel, digested with trypsin and the masses of the resultant fragments were determined by MALDI/MS. Twenty-one of 38 monoisotopic peptide masses obtained after tryptic digestion were matched to the heat shock protein Ssb1/Hsp75, covering 37% of its sequence. Computational analysis of the primary structure of Ssb1/Hsp75 identified a unique potential amphipathic alpha-helix in its N-terminal ATPase domain with features of target regions for Ca2+/calmodulin binding. This region, which shares 89% similarity to the experimentally determined calmodulin-binding domain from mouse, Hsc70, is conserved in near half of the 113 members of the HSP70 family investigated, from yeast to plant and animals. Based on the sequence of this region, phylogenetic analysis grouped the HSP70s in three distinct branches. Two of them comprise the non-calmodulin binding Hsp70s BIP/GR78, a subfamily of eukaryotic HSP70 localized in the endoplasmic reticulum, and DnaK, a subfamily of prokaryotic HSP70. A third heterogeneous group is formed by eukaryotic cytosolic HSP70s containing the new calmodulin-binding motif and other cytosolic HSP70s whose sequences do not conform to those conserved motif, indicating that not all eukaryotic cytosolic Hsp70s are target for calmodulin regulation. Furthermore, the calmodulin-binding domain found in eukaryotic HSP70s is also the target for binding of Bag-1 - an enhancer of ADP/ATP exchange activity of Hsp70s. A model in which calmodulin displaces Bag-1 and modulates Ssb1/Hsp75 chaperone activity is discussed.

Correlation between cell survival and DNA single-strand break repair proficiency in the Chinese hamster ovary cell lines AA8 and EM9 irradiated with 365-nm ultraviolet-A radiation

Energy Technology Data Exchange (ETDEWEB)

Churchill, M.E.; Peak, J.G.; Peak, M.J. (Argonne National Lab., IL (USA))

1991-02-01

Cell survival parameters and the induction and repair of DNA single-strand breaks were measured in two Chinese hamster ovary cell lines after irradiation with monochromatic UVA radiation of wavelength 365 nm. The radiosensitive mutant cell line EM9 is known to repair ionizing-radiation-induced single-strand breaks (SSB) more slowly than the parent line AA8. EM9 was determined to be 1.7-fold more sensitive to killing by 365-nm radiation than AA8 at the 10% survival level, and EM9 had a smaller shoulder region on the survival curve ({alpha} = 1.76) than AA8 ({alpha} = 0.62). No significant differences were found between the cell lines in the initial yields of SSB induced either by {gamma}-radiation (as determined by alkaline sucrose gradient sedimentation) or by 365-nm UVA (as determined by alkaline elution). For measurement of initial SSB, cells were irradiated at 0.5{sup o}C to minimize DNA repair processes. Rejoining of 365-nm induced SSB was measured by irradiating cells at 0.5{sup o}C, allowing them to repair at 37{sup o}C in full culture medium, and then quantitating the remaining SSB by alkaline elution. The repair of these breaks followed biphasic kinetics in both cell lines. EM9 repaired the breaks more slowly (T{sub 1/2} values of 1.3 and 61.3 min) than did AA8 (T{sub 1/2} values of 0.9 and 53.3 min), and EM9 also left more breaks unrepaired 90 min after irradiation (24% vs 8% for AA8). Thus, the sensitivity of EM9 to 365-nm radiation correlated with its deficiency in repairing DNA lesions revealed as SSB in alkaline elution. These results suggest that DNA may be a critical target in 365-nm induced cellular lethality and that the ability of AA8 and EM9 cells to repair DNA strand breaks may be related to their ability to survive 365-nm radiation. (author).

Lower limit on the achievable temperature in resonator-based sideband cooling

Science.gov (United States)

Grajcar, M.; Ashhab, S.; Johansson, J. R.; Nori, F.

2009-03-01

A resonator with eigenfrequency φr can be effectively used as a cooler for another linear oscillator with a much smaller frequency φmφr. A huge cooling effect, which could be used to cool a mechanical oscillator below the energy of quantum fluctuations, has been predicted by several authors. However, here we show that there is a lower limit T^* on the achievable temperature, given by T^* = Tm; φm/ φr, that was not considered in previous work and can be higher than the quantum limit in realistic experimental realizations. We also point out that the decay rate of the resonator, which previous studies stress should be small, must be larger than the decay rate of the cooled oscillator for effective cooling. M. Grajcar, S. Ashhab, J.R. Johansson, F. Nori, Lower limit on the achievable temperature in resonator-based sideband cooling, Phys. Rev. B 78, 035406 (2008). URL: http://link.aps.org/abstract/PRB/v78/e035406

Molecular dynamics simulation of a DNA containing a single strand break

Energy Technology Data Exchange (ETDEWEB)

Yamaguchi, H.; Siebers, G.; Furukawa, A.; Otagiri, N.; Osman, R

2002-07-01

Molecular dynamics simulations were performed for a dodecamer DNA containing a single strand break (SSB), which has been represented by a 3'-OH deoxyribose and 5'-OH phosphate in the middle of the strand. Molecular force field parameters of the 5'-OH phosphate region were determined from an ab initio calculation at the HF/6-31G level using the program package GAMESS. The DNA was placed in a periodic boundary box with water molecules and Na+ counter-ions to produce a neutralised system. After minimisation, the system was heated to 300 K, equilibrated and a production run at constant NTP was executed for 1 ns using AMBER 4.1. Snapshots of the SSB-containing DNA and a detailed analysis of the equilibriated average structure revealed surprisingly small conformational changes compared to normal DNA. However, dynamic properties calculated using the essential dynamics method showed some features that may be important for the recognition of this damage by repair enzymes. (author)

A tone-aided dual vestigial sideband system for digital communications on fading channels

Science.gov (United States)

Hladik, Stephen M.; Saulnier, Gary J.; Rafferty, William

1989-01-01

A spectrally efficient tone-aided dual vestigial sideband (TA/DVSB) system for digital data communications on fading channels is presented and described analytically. This PSK (phase-shift-keying) system incorporates a feed-forward, tone-aided demodulation technique to compensate for Doppler frequency shift and channel- induced, multipath fading. In contrast to other tone-in-band-type systems, receiver synchronization is derived from the complete data VSBs. Simulation results for the Rician fading channel are presented. These results demonstrate the receiver's ability to mitigate performance degradation due to fading and to obtain proper data carrier synchronization, suggesting that the proposed TA/DVSB system has promise for this application. Simulated BER (bit-error rate) data indicate that the TA/DVSB system effectively alleviates the channel distortions of the land mobile satellite application.

Single and multispecies reference points for Baltic fish stocks

DEFF Research Database (Denmark)

Gislason, Henrik

1999-01-01

reference points. Management advice based on biomass reference points will also differ. In the single species situation the combinations of cod and pelagic fishing effort for which the equilibrium spawning- stock biomass of the three species is above the biomass reference points forms a rectangular area......Single and multispecies models are used to examine the effect of species interaction on biological reference points for cod, herring, and sprat in the Baltic. The results demonstrate that reference points are different in single and multispecies contexts. Reference points for fishing mortality...... based on single-species yield and SSB calculations are difficult to use when natural mortality depends on the absolute abundance of the predators and their alternative prey. Reference points based on maximizing total yield from the system may lead to impractical results when species interact...

Strand displacement by DNA polymerase III occurs through a tau-psi-chi link to single-stranded DNA-binding protein coating the lagging strand template.

Science.gov (United States)

Yuan, Quan; McHenry, Charles S

2009-11-13

In addition to the well characterized processive replication reaction catalyzed by the DNA polymerase III holoenzyme on single-stranded DNA templates, the enzyme possesses an intrinsic strand displacement activity on flapped templates. The strand displacement activity is distinguished from the single-stranded DNA-templated reaction by a high dependence upon single-stranded DNA binding protein and an inability of gamma-complex to support the reaction in the absence of tau. However, if gamma-complex is present to load beta(2), a truncated tau protein containing only domains III-V will suffice. This truncated protein is sufficient to bind both the alpha subunit of DNA polymerase (Pol) III and chipsi. This is reminiscent of the minimal requirements for Pol III to replicate short single-stranded DNA-binding protein (SSB)-coated templates where tau is only required to serve as a scaffold to hold Pol III and chi in the same complex (Glover, B., and McHenry, C. (1998) J. Biol. Chem. 273, 23476-23484). We propose a model in which strand displacement by DNA polymerase III holoenzyme depends upon a Pol III-tau-psi-chi-SSB binding network, where SSB is bound to the displaced strand, stabilizing the Pol III-template interaction. The same interaction network is probably important for stabilizing the leading strand polymerase interactions with authentic replication forks. The specificity constant (k(cat)/K(m)) for the strand displacement reaction is approximately 300-fold less favorable than reactions on single-stranded templates and proceeds with a slower rate (150 nucleotides/s) and only moderate processivity (approximately 300 nucleotides). PriA, the initiator of replication restart on collapsed or misassembled replication forks, blocks the strand displacement reaction, even if added to an ongoing reaction.

Molecular dosimetry of DNA damage caused by alkylation. I. Single-strand breaks induced by ethylating agents in cultured mammalian cells in relation to survival

NARCIS (Netherlands)

Abbondandolo, A.; Dogliotti, E.; Lohman, P.H.M.; Berends, F.

1982-01-01

Cultured Chinese hamster ovary cells were treated with ethylating agents. DNA lesions giving rise to single-strand breaks (ssb) or alkali-labile sites were measured by centrifugation in alkaline sucrose gradients after lysis in alkali. 4 agents with different tendencies to ethylate preferentially

Investigation of the sideband effect for the LCL-type grid-connected inverter with high LCL resonance frequency

DEFF Research Database (Denmark)

Yang, Dongsheng; Wang, Xiongfei; Blaabjerg, Frede

2017-01-01

The LCL-type grid connected inverter has been widely used as the intelligent power interface between the distributed generation unit and the power grid. To reduce the cost and volume of the filter, it is desirable to design the LCL filter with higher resonance frequency provided that the quality...... of injected grid current is not compromised. Actually, it is the typical case for the T-type or NPC three-level inverter to design its LCL resonance frequency close to half of the switching frequency. In this case, however, the sideband effect of SPWM modulation can impose a significant impact on the system...

Interaction of spin and vibrations in transport through single-molecule magnets.

Science.gov (United States)

May, Falk; Wegewijs, Maarten R; Hofstetter, Walter

2011-01-01

We study electron transport through a single-molecule magnet (SMM) and the interplay of its anisotropic spin with quantized vibrational distortions of the molecule. Based on numerical renormalization group calculations we show that, despite the longitudinal anisotropy barrier and small transverse anisotropy, vibrational fluctuations can induce quantum spin-tunneling (QST) and a QST-Kondo effect. The interplay of spin scattering, QST and molecular vibrations can strongly enhance the Kondo effect and induce an anomalous magnetic field dependence of vibrational Kondo side-bands.

Butanol production from sweet sorghum bagasse (SSB) with high solids content: part I – comparison of liquid hot water pretreatment with dilute sulfuric acid

Science.gov (United States)

In these studies we pretreated sweet sorghum bagasse (SSB) using liquid hot water (LHW) or dilute H2SO4 (2 g·L-1) at 190 deg C for zero min (as soon as temperature reached 190 deg C, cooling was started) to reduce generation of sugar degradation fermentation inhibiting products such as furfural and ...

Fusion of Taq DNA polymerase with single-stranded DNA binding-like protein of Nanoarchaeum equitans-Expression and characterization.

Directory of Open Access Journals (Sweden)

Marcin Olszewski

Full Text Available DNA polymerases are present in all organisms and are important enzymes that synthesise DNA molecules. They are used in various fields of science, predominantly as essential components for in vitro DNA syntheses, known as PCR. Modern diagnostics, molecular biology and genetic engineering need DNA polymerases which demonstrate improved performance. This study was aimed at obtaining a new NeqSSB-TaqS fusion DNA polymerase from the Taq DNA Stoffel domain and a single-stranded DNA binding-like protein of Nanoarchaeum equitans in order to significantly improve the properties of DNA polymerase. The DNA coding sequence of Taq Stoffel DNA polymerase and the nonspecific DNA-binding protein of Nanoarchaeum equitans (NeqSSB-like protein were fused. A novel recombinant gene was obtained which was cloned into the pET-30 Ek/LIC vector and introduced into E. coli for expression. The recombinant enzyme was purified and its enzymatic properties including DNA polymerase activity, PCR amplification rate, thermostability, processivity and resistance to inhibitors, were tested. The yield of the target protein reached approximately 18 mg/l after 24 h of the IPTG induction. The specific activity of the polymerase was 2200 U/mg. The recombinant NeqSSB-TaqS exhibited a much higher extension rate (1000 bp template in 20 s, processivity (19 nt, thermostability (half-life 35 min at 95°C and higher tolerance to PCR inhibitors (0.3-1.25% of whole blood, 0.84-13.5 μg of lactoferrin and 4.7-150 ng of heparin than Taq Stoffel DNA polymerase. Furthermore, our studies show that NeqSSB-TaqS DNA polymerase has a high level of flexibility in relation to Mg2+ ions (from 1 to 5 mM and KCl or (NH42SO4 salts (more than 60 mM and 40 mM, respectively. Using NeqSSB-TaqS DNA polymerase instead of the Taq DNA polymerase could be a better choice in many PCR applications.

The validity of sedimentation data from high molecular weight DNA and the effects of additives on radiation-induced single-strand breakage

International Nuclear Information System (INIS)

Dugle, D.L.

1979-10-01

The optimization of many of the factors governing reproducible sedimentation behaviour of high molecular weight single-strand DNA in a particular alkaline sucrose density gradient system is described. A range of angular momenta is defined for which a constant strand breakage efficiency is required, despite a rotor speed effect which increases the measured molecular weights at decreasing rotor speeds for larger DNA molecules. The possibility is discussed that the bimodal control DNA profiles obtained after sedimentation at 11 500 rev/min (12 400 g) or less represent structural subunits of the chromatid. The random induction of single-strand DNA breaks by ionizing radiation is demonstrated by the computer-derived fits to the experimental profiles. The enhancement of single-strand break (SSB) yields in hypoxic cells by oxygen, para-nitroacetophenone (PNAP), or any of the three nitrofuran derivatives used was well correlated with increased cell killing. Furthermore, reductions in SSB yields for known hydroxyl radical (OH.) scavengers correlates with the reactivities of these compounds toward OH.. This supports the contention that some type of OH.-induced initial lesion, which may ultimately be expressed as an unrepaired or misrepaired double-strand break, constitutes a lethal event. (author)

Interaction of spin and vibrations in transport through single-molecule magnets

Directory of Open Access Journals (Sweden)

Falk May

2011-10-01

Full Text Available We study electron transport through a single-molecule magnet (SMM and the interplay of its anisotropic spin with quantized vibrational distortions of the molecule. Based on numerical renormalization group calculations we show that, despite the longitudinal anisotropy barrier and small transverse anisotropy, vibrational fluctuations can induce quantum spin-tunneling (QST and a QST-Kondo effect. The interplay of spin scattering, QST and molecular vibrations can strongly enhance the Kondo effect and induce an anomalous magnetic field dependence of vibrational Kondo side-bands.

A NEXT GENERATION MULTI-BEAM FOCAL PLANE ARRAY RECEIVER OF TRAO FOR 86-115 GHZ BAND

Directory of Open Access Journals (Sweden)

Moon-Hee Chung

2006-03-01

Full Text Available The noise temperature of existing millimeter-wave receivers is already within two or three times quantum noise limit. One of practical ways to increase the observation speed of single dish radio telescope without longer integration time is use of multi-beam focal plane array receiver as demonstrated in several large single dish radio telescopes. In this context the TRAO (Taeduk Radio Astronomy Observatory, which operates a 143n Cassegrain radio telescope, is planning to develop a 4 x 4 beams focal plane array SIS receiver system for 86-115 GHz band. Even though millimeter-wave HEMT LNA-based receivers approach the noise temperature comparable to the SIS receiver at W-band, it is believed that the receiver based on SIS mixer seems to offer a bit more advantages. The critical part of the multi-beam array receiver will be sideband separating SIS mixers. Employing such a type of SIS mixer makes it possible to simplify the quasi-optics of receiver. Otherwise, an SSB filter should be used in front of the mixer or some sophisticated post-processing of observation data is needed. In this paper we will present a preliminary design concept and components needed for the development of a new 3 mm band multi-beam focal plane array receiver.

Broadband demonstrations of true-time delay using linear sideband chirped programming and optical coherent transients

International Nuclear Information System (INIS)

Reibel, R.R.; Barber, Z.W.; Fischer, J.A.; Tian, M.; Babbitt, W.R.

2004-01-01

Linear sideband chirped (LSC) programming is introduced as a means of configuring spatial-spectral holographic gratings for optical coherent transient processors. Similar to linear frequency chirped programming, LSC programming allows the use of broadband integrated electro-optic phase modulators to produce chirps instead of using elaborate broadband chirped lasers. This approach has several advantages including the ability to use a stabilized laser for the optical carrier as well as stable, reproducible chirped optical signals when the modulator is driven digitally. Using LSC programming, we experimentally demonstrate broadband true-time delay as a proof of principle for the optical control of phased array radars. Here both cw phase modulated and binary phase shift keyed probe signals are true-time delayed with bandwidths of 1 GHz and delay resolutions better than 60 ps

Stabilized soliton self-frequency shift and 0.1- PHz sideband generation in a photonic-crystal fiber with an air-hole-modified core.

Science.gov (United States)

Liu, Bo-Wen; Hu, Ming-Lie; Fang, Xiao-Hui; Li, Yan-Feng; Chai, Lu; Wang, Ching-Yue; Tong, Weijun; Luo, Jie; Voronin, Aleksandr A; Zheltikov, Aleksei M

2008-09-15

Fiber dispersion and nonlinearity management strategy based on a modification of a photonic-crystal fiber (PCF) core with an air hole is shown to facilitate optimization of PCF components for a stable soliton frequency shift and subpetahertz sideband generation through four-wave mixing. Spectral recoil of an optical soliton by a red-shifted dispersive wave, generated through a soliton instability induced by high-order fiber dispersion, is shown to stabilize the soliton self-frequency shift in a highly nonlinear PCF with an air-hole-modified core relative to pump power variations. A fiber with a 2.3-microm-diameter core modified with a 0.9-microm-diameter air hole is used to demonstrate a robust soliton self-frequency shift of unamplified 50-fs Ti: sapphire laser pulses to a central wavelength of about 960 nm, which remains insensitive to variations in the pump pulse energy within the range from 60 to at least 100 pJ. In this regime of frequency shifting, intense high- and low-frequency branches of dispersive wave radiation are simultaneously observed in the spectrum of PCF output. An air-hole-modified-core PCF with appropriate dispersion and nonlinearity parameters is shown to provide efficient four-wave mixing, giving rise to Stokes and anti-Stokes sidebands whose frequency shift relative to the pump wavelength falls within the subpetahertz range, thus offering an attractive source for nonlinear Raman microspectroscopy.

Simultaneous single-shot readout of multi-qubit circuits using a traveling-wave parametric amplifier

Science.gov (United States)

O'Brien, Kevin

Observing and controlling the state of ever larger quantum systems is critical for advancing quantum computation. Utilizing a Josephson traveling wave parametric amplifier (JTWPA), we demonstrate simultaneous multiplexed single shot readout of 10 transmon qubits in a planar architecture. We employ digital image sideband rejection to eliminate noise at the image frequencies. We quantify crosstalk and infidelity due to simultaneous readout and control of multiple qubits. Based on current amplifier technology, this approach can scale to simultaneous readout of at least 20 qubits. This work was supported by the Army Research Office.

Low Rate Transmission of Video Signals Using Adaptive Delta Modulation.

Science.gov (United States)

1983-08-15

903-80-C-0476 / . PERFORMING ORGANIZATION NAME AND ADDRESS 10. PROGRAM ELEMENT. PROJECT, TASK AREA & WORK UNIT NUMBERS Research Foundation of CUNY on...transmitted phase, for the demodulation of the signal. AM is presently being used to transmit multilevel * symbols by vestigial or single sideband...34: Vestigial Sideband -- Duobinary 3600 4-Phase + AM 4800" 4-Phase + AM * Vestigial Sideband 8-PSK 7200 Phase and Amplitude Modulation 9600 Phase anl

Role of radiation chemical and enzymatic processes on single-strand breaks at short times after irradiation

Energy Technology Data Exchange (ETDEWEB)

Sapora, O; Loverock, P S; Fielden, E M [Institute of Cancer Research, Sutton (UK). Surrey Branch

1976-10-01

A rapid mixing lysis technique has been used to study the effects of irradiation at different temperatures on two strains of E.coli K12, one lacking in the polymerase I activity (W3110), and the other carrying a ligase temperature-sensitive mutation (DY179), which had full ligase activity at 30/sup 0/C and none at 46/sup 0/C. The results provided direct evidence for the absence of any ligase-dependent repair of SSB at short times. The addition of 5 x 10/sup -3/M cysteine to heat-treated W3110 cells before irradiation in anoxic conditions practically removed the increase in yield of SSB per single strand genome shown by the heat-treated cells; the response was very close to that of normal cells in anoxia. The important contribution of sulphydryl compounds to the anoxic radio-biological response is thereby demonstrated. The basic difference in damage obtained by irradiation under oxic or anoxic conditions is due not to preferential enzymic (ligase) repair but to differences in radiation chemical events.

Hepatocytes, rather than leukocytes reverse DNA damage in vivo induced by whole body y-irradiation of mice, as shown by the alkaline comet assay

Directory of Open Access Journals (Sweden)

JUANA PINCHEIRA

2008-01-01

Full Text Available DNA damage repair was assessed in quiescent (G0 leukocytes and in hepatocytes of mice, after 1 and 2 hours recovery from a single whole body y-irradiation with 0.5, 1 or 2 Gy. Evaluation of single-strand breaks (SSB and alkali-labile sites together were carried out by a single-cell electrophoresis at pH>13.0 (alkaline comet assay. In non-irradiated (control mice, the constitutive, endogenous DNA damage (basal was around 1.5 times higher in leukocytes than in hepatocytes. Irradiation immediately increased SSB frequency in both cell types, in a dose-dependent manner. Two sequential phases took place during the in vivo repair of the radio-induced DNA lesions. The earliest one, present in both hepatocytes and leukocytes, further increased the SSB frequency, making evident the processing of some primary lesions in DNA bases into the SSB repair intermediates. In a second phase, SSB frequency decreased because of their removal. In hepatocytes, such a frequency regressed to the constitutive basal level after 2 hours recovery from either 0.5 orí Gy. On the other hand, the SSB repair phase was specifically abrogated in leukocytes, at the doses and recovery times analyzed. Thus, the efficiency of in vivo repair of radio-induced DNA damage in dormant cells (lymphocytes is quite different from that in hepatocytes whose low proliferation activity accounts only for cell renewal.

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

An I/Q mixer with an integrated differential quadrature all-pass filter for on-chip quadrature LO signal generation

International Nuclear Information System (INIS)

Amin, Najam Muhammad; Wang Zhigong; Li Zhiqun

2015-01-01

A down-conversion in-phase/quadrature (I/Q) mixer employing a folded-type topology, integrated with a passive differential quadrature all-pass filter (D-QAF), in order to realize the final down-conversion stage of a 60 GHz receiver architecture is presented in this work. Instead of employing conventional quadrature generation techniques such as a polyphase filter or a frequency divider for the local oscillator (LO) of the mixer, a passive D-QAF structure is employed. Fabricated in a 65 nm CMOS process, the mixer exhibits a voltage gain of 7–8 dB in an intermediate frequency (IF) band ranging from 10 MHz–1.75 GHz. A fixed LO frequency of 12 GHz is used to down-convert a radio frequency (RF) band of 10.25–13.75 GHz. The mixer displays a third order input referred intercept point (IIP 3 ) ranging from −8.75 to −7.37 dBm for a fixed IF frequency of 10 MHz and a minimum single-sideband noise figure (SSB-NF) of 11.3 dB. The mixer draws a current of 6 mA from a 1.2 V supply voltage dissipating a power of 7.2 mW. (paper)

Simplified atom trap using a single microwave modulated diode laser

International Nuclear Information System (INIS)

Newbury, N.R.; Myatt, C.J.; Wieman, C.E.

1993-01-01

We have demonstrated microwave modulation of a diode laser which is operated with optical feedback from a diffraction grating. By directly modulating the diode laser current at frequencies up to 6.8 GHz, we observed 2-30% of the laser power in a single sideband for 20mW of microwave power. Using such a diode laser modulated at 6.6GHz, we have trapped 87 Rb in a vapor cell. With 10mW of microwave power, the number of trapped atoms was only 15% smaller than the number obtained using two lasers in the conventional manner. A microwave modulated diode laser should also be useful for driving stimulated Raman transitions between the hyperfine levels of Rb or Cs

Pure exciton- and magnon-assisted optical transitionsin the one-dimensional antiferromagnet CsMnCl3x2H2O (CMC)

International Nuclear Information System (INIS)

Jia, W.; Strauss, E.; Yen, W.M.

1981-01-01

We report the first observation of the pure electronic transitions in the 4 T 1 state of Mn 2+ ions in the one-dimensional antiferromagnet CsMnCl 3 x2H 2 O (CMC) in the absorption, excitation, and fluorescence spectra. Selection rules are analyzed: the exciton transition is electric dipole allowed, the magnon sideband in emission is a single-ion process, and is both electric and magnetic dipole allowed; however, the magnon sideband in absorption is an ion-pair process and is a weakened-electric-dipole and magnetic-dipole transition. The density of magnon states and the line profile of the magnon sideband have been calculated. The results explain the peculiar line shapes of the observed sideband emission. An exponential decay of the exciton is observed with a lifetime of 0.576 ms

Supressão das anomalias de fase e batimentos laterais em espectros de RMN 13c obtidos com a sequência de precessão livre no estado estacionário Suppression of phase anomalies and sidebands on 13c NMR spectra obtained with the steady-state free precession sequence

Directory of Open Access Journals (Sweden)

Poliana Macedo dos Santos

2010-01-01

Full Text Available The Steady-State Free Precession (SSFP sequence has been widely used in low-field and low-resolution imaging NMR experiments to increase the signal-to-noise ratio (s/n of the signals. Here, we analyzed the Scrambled Steady State - SSS and Unscrambled Steady State - USS sequences to suppress phase anomalies and sidebands of the 13C NMR spectrum acquired in the SSFP regime. The results showed that the application of the USS sequence allowed a uniform distribution of the time interval between pulses (Tp, in the established time range, allowing a greater suppression of phase anomalies and sidebands, when compared with the SSS sequence.

Experimental investigation of a control scheme for a zero-detuning resonant sideband extraction interferometer for next-generation gravitational-wave detectors

Energy Technology Data Exchange (ETDEWEB)

Kawazoe, Fumiko; Sugamoto, Akio [Ochanomizu University, 2-1-1 Otsuka, Bunkyo-ku, Tokyo 112-8610 (Japan); Leonhardt, Volker; Sato, Shuichi; Yamazaki, Toshitaka; Fukushima, Mitsuhiro; Kawamura, Seiji [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka-shi, Tokyo 181-8588 (Japan); Miyakawa, Osamu [LIGO Laboratory, California Institute of Technology, Pasadena, CA 91125 (United States); Somiya, Kentaro [Max-Planck-Institut fuer Gravitationsphysik, Am Muehlenberg 1, 14476 Potsdam (Germany); Morioka, Tomoko [University of Tokyo, Kashiwa, Chiba 277-8582 (Japan); Nishizawa, Atsushi [Graduate School of Human and Environmental Studies, Kyoto University, Kyoto 606-8501 (Japan)], E-mail: fumiko.kawazoe@aei.mpg.de

2008-10-07

Some next-generation gravitational-wave detectors, such as the American Advanced LIGO project and the Japanese LCGT project, plan to use power recycled resonant sideband extraction (RSE) interferometers for their interferometer's optical configuration. A power recycled zero-detuning (PRZD) RSE interferometer, which is the default design for LCGT, has five main length degrees of freedom that need to be controlled in order to operate a gravitational-wave detector. This task is expected to be very challenging because of the complexity of optical configuration. A new control scheme for a PRZD RSE interferometer has been developed and tested with a prototype interferometer. The PRZD RSE interferometer was successfully locked with the control scheme. It is the first experimental demonstration of a PRZD RSE interferometer with suspended test masses. The result serves as an important step for the operation of LCGT.

Experimental investigation of a control scheme for a zero-detuning resonant sideband extraction interferometer for next-generation gravitational-wave detectors

International Nuclear Information System (INIS)

Kawazoe, Fumiko; Sugamoto, Akio; Leonhardt, Volker; Sato, Shuichi; Yamazaki, Toshitaka; Fukushima, Mitsuhiro; Kawamura, Seiji; Miyakawa, Osamu; Somiya, Kentaro; Morioka, Tomoko; Nishizawa, Atsushi

2008-01-01

Some next-generation gravitational-wave detectors, such as the American Advanced LIGO project and the Japanese LCGT project, plan to use power recycled resonant sideband extraction (RSE) interferometers for their interferometer's optical configuration. A power recycled zero-detuning (PRZD) RSE interferometer, which is the default design for LCGT, has five main length degrees of freedom that need to be controlled in order to operate a gravitational-wave detector. This task is expected to be very challenging because of the complexity of optical configuration. A new control scheme for a PRZD RSE interferometer has been developed and tested with a prototype interferometer. The PRZD RSE interferometer was successfully locked with the control scheme. It is the first experimental demonstration of a PRZD RSE interferometer with suspended test masses. The result serves as an important step for the operation of LCGT

Optical and transport properties of single crystal rubrene: A theoretical study

Energy Technology Data Exchange (ETDEWEB)

Chen, Lipeng [Division of Materials Science, Nanyang Technological University, Singapore 639798 (Singapore); Lu, Jing [Division of Materials Science, Nanyang Technological University, Singapore 639798 (Singapore); Faculty of Chemistry, Northeast Normal University, Changchun (China); Long, Guankui; Zheng, Fulu [Division of Materials Science, Nanyang Technological University, Singapore 639798 (Singapore); Zhang, Jingping [Faculty of Chemistry, Northeast Normal University, Changchun (China); Zhao, Yang, E-mail: YZhao@ntu.edu.sg [Division of Materials Science, Nanyang Technological University, Singapore 639798 (Singapore)

2016-12-20

Optical and charge transport properties of single crystal rubrene are investigated using the multi-mode Brownian oscillator (MBO) model, the charge hopping model with quantum nuclear tunneling, and the Munn–Silbey approach. The MBO model is adopted to calculate absorption and photoluminescence spectra, yielding results in excellent agreement with measurements. In addition, temperature dependence of zero phonon lines (ZPL) and phonon sidebands (PSBs) of absorption spectra is also examined using the MBO model, revealing a nearly linear dependence of line widths of the ZPL and the PSBs on temperature. Model parameters obtained from MBO fitting and TD-DFT computation are then utilized for hole mobility calculations. It is found that temperature dependence of the calculated mobility is in general agreement with measurements, exhibiting “band-like” transport behavior.

Ramsey spectroscopy by direct use of resonant light on isotope atoms for single-photon detuning

Energy Technology Data Exchange (ETDEWEB)

Yu, Hoon; Choi, Mi Hyun; Moon, Ye Lin; Kim, Seung Jin; Kim, Jung Bog [Korea National University of Education, Cheongwon (Korea, Republic of)

2014-03-15

We demonstrate Ramsey spectroscopy with cold {sup 87}Rb atoms via a two-photon Raman process. One laser beam has a cross-over resonant frequency on the {sup 85}Rb transition and the other beam has a 6.8 GHz shifted frequency. These two laser beams fulfill the two-photon Raman resonance condition, which involves a single-photon detuning of -2.6 GHz. By implementing these two lasers on cold {sup 87}Rb atoms, we demonstrate Ramsey spectroscopy with an interrogation time of the intermediate state by using π/2 Raman pulses. In our laser system, we can change the single-photon detuning to 1.2, 4.2 or -5.6 GHz by changing the {sup 85}Rb transition line used as a locking signal and an injected sideband. The laser system that directly uses resonant light on isotope atoms will be described in this paper.

Photonics-based microwave frequency measurement using a double-sideband suppressed-carrier modulation and an InP integrated ring-assisted Mach-Zehnder interferometer filter.

Science.gov (United States)

Fandiño, Javier S; Muñoz, Pascual

2013-11-01

A photonic system capable of estimating the unknown frequency of a CW microwave tone is presented. The core of the system is a complementary optical filter monolithically integrated in InP, consisting of a ring-assisted Mach-Zehnder interferometer with a second-order elliptic response. By simultaneously measuring the different optical powers produced by a double-sideband suppressed-carrier modulation at the outputs of the photonic integrated circuit, an amplitude comparison function that depends on the input tone frequency is obtained. Using this technique, a frequency measurement range of 10 GHz (5-15 GHz) with a root mean square value of frequency error lower than 200 MHz is experimentally demonstrated. Moreover, simulations showing the impact of a residual optical carrier on system performance are also provided.

Chromaticity measurement via the fourier spectrum of transverse oscillations

International Nuclear Information System (INIS)

Xi Yang

2004-01-01

Turn-by-turn data from a single BPM includes information on the chromaticity in sidebands displaced above and below the betatron frequency by an amount of the synchrotron frequency. It may be necessary to induce small amplitude synchrotron oscillation by giving the beam a small kick. Power spectrum of the BPM data gives clear chromatic sidebands, and they can be applied to the chromaticity measurement in the Fermilab Booster

Feasibility of efficient room-temperature solid-state sources of indistinguishable single photons using ultrasmall mode volume cavities

Science.gov (United States)

Wein, Stephen; Lauk, Nikolai; Ghobadi, Roohollah; Simon, Christoph

2018-05-01

Highly efficient sources of indistinguishable single photons that can operate at room temperature would be very beneficial for many applications in quantum technology. We show that the implementation of such sources is a realistic goal using solid-state emitters and ultrasmall mode volume cavities. We derive and analyze an expression for photon indistinguishability that accounts for relevant detrimental effects, such as plasmon-induced quenching and pure dephasing. We then provide the general cavity and emitter conditions required to achieve efficient indistinguishable photon emission and also discuss constraints due to phonon sideband emission. Using these conditions, we propose that a nanodiamond negatively charged silicon-vacancy center combined with a plasmonic-Fabry-Pérot hybrid cavity is an excellent candidate system.

Reduction of intracellular glutathione content and radiosensitivity

International Nuclear Information System (INIS)

Vos, O.; Schans, G.P. van der; Roos-Verheij, W.S.D.

1986-05-01

The intracellular glutathione (GSH) content in HeLa, CHO and V79 cells was reduced by incubating the cells in growth medium containing buthionine sulfoximine (BSO) or diethyl maleate (DEM). Clonogenicity, single strand DNA breaks (ssb) and double strand DNA breaks (dsb) were used as criteria for radiation induced damage after X- or γ irradiation. In survival experiments DEM gave a slightly larger sensitization although it gave a smaller reduction of the intracellular GSH. In general, sensitization was larger for dsb than for ssb, also the reduction of the OER was generally larger for dsb than for ssb. This may be due to the higher dose rate in case of dsb experiments resulting in a higher rate of radiochemical oxygen consumption. In general, no effect was found on post-irradiation repair of ssb and dsb. (Auth.)

Comparison between the radiosensitivity of human, mouse and chicken fibroblast-like cells using short-term endpoints

International Nuclear Information System (INIS)

Diatloff-Zito, C.; Loria, E.; Maciera-Coelho, A.; Deschavanne, P.J.; Malaise, E.P.

1981-01-01

A comparative study has been made of the radiosensitivity of fibroblastic cell lines from three different animal species: human, mouse and chicken. Endpoints reflecting short term responses were utilized: colony forming ability (CFA), DNA single strand break (SSB) repair and repair of potentially lethal damage (PLD). Regardless of the criterion employed, the response to radiation varies from one species to another. According to survival curves, chicken cells appear to be more radioresistant than those of human and mouse. SSB repair is apparently absent in murine cells, partial in chicken cells and complete in human cells. This lack of correlation between survival curves and SSB repair demonstrates that survival of irradiated cells does not depend only (or at all) on the repair of SSB. The repair of PLD is much more efficient in human and chicken cells than in murine cells. (author)

Reduction of intracellular glutathione content and radiosensitivity

International Nuclear Information System (INIS)

Vos, O.; Schans, G.P. van der; Roos-Verheij, W.S.D.

1986-01-01

The intracellular glutathione (GSH) content of HeLa, CHO and V79 cells was reduced by incubating the cells in growth medium containing buthionine sulphoximine or diethyl maleate (DEM). Clonogenicity, single-strand DNA breaks (ssb) and double-strand DNA breaks (dsb) were used as criteria for radiation-induced damage after X- or γ-irradiation. In survival experiments, DEM gave a slightly larger sensitization although it gave a smaller reduction of the intracellular GSH. In general, sensitization was larger for dsb than for ssb, also the reduction of the o.e.r. was generally larger for dsb than for ssb. This may be due to the higher dose rate in case of dsb experiments resulting in a higher rate of radiochemical oxygen consumption. In general, no effect was found on post-irradiation repair of ssb and dsb. (author)

Effect of radiomodifying agents on the ratios of X-ray-induced lesions in cellular DNA: use in lethal lesion determination

International Nuclear Information System (INIS)

Radford, I.R.

1986-01-01

The effect of three radiomodifying agents, cysteamine, hyperthermia, and hypoxia, on the induction of the major classes of X-ray-induced DNA lesions, was studied using mouse L cells and Chinese hamster V79 cells. The use of filter elution techniques allowed most of these studies to be conducted at X-ray doses within the survival-curve range. Cysteamine was found to protect against DNA single-strand breakage (ssb), DNA base damage, and DNA-protein crosslinkage. Hyperthermia had no effect on the level of DNA ssb or DNA base damage, but in L cells (but not in V79 cells) it increased the level of DNA-protein crosslinkage relative to DNA ssb. Hypoxia protected against DNA ssb, had no significant effect on the level of DNA base damage, and enhanced the level of DNA-protein crosslinkage relative to DNA ssb. These results support the previous suggestion that the X-ray-induced lethal lesion is DNA double-strand breakage. Implications of these findings for the mechanisms of formation of X-ray-induced DNA lesions are also discussed. (author)

High Fidelity Preparation of a Single Atom in Its 2D Center of Mass Ground State

Science.gov (United States)

Sompet, Pimonpan; Fung, Yin Hsien; Schwartz, Eyal; Hunter, Matthew D. J.; Phrompao, Jindaratsamee; Andersen, Mikkel F.

2017-04-01

Complete control over quantum states of individual atoms is important for the study of the microscopic world. Here, we present a push button method for high fidelity preparation of a single 85Rb atom in the vibrational ground state of tightly focused optical tweezers. The method combines near-deterministic preparation of a single atom with magnetically-insensitive Raman sideband cooling. We achieve 2D cooling in the radial plane with a ground state population of 0.85, which provides a fidelity of 0.7 for the entire procedure (loading and cooling). The Raman beams couple two sublevels (| F = 3 , m = 0 〉 and | F = 2 , m = 0 〉) that are indifferent to magnetic noise to first order. This leads to long atomic coherence times, and allows us to implement the cooling in an environment where magnetic field fluctuations prohibit previously demonstrated variations. Additionally, we implement the trapping and manipulation of two atoms confined in separate dynamically reconfigurable optical tweezers, to study few-body dynamics.

Tritium dating of underground water from the Jian River valley and Houjialiang loess platform in the basin side-band of the East-Mountain Region of Taiyuan

International Nuclear Information System (INIS)

Yu Songsheng; Wu Qinghua

1991-01-01

The tritium content is measured in underground water from the basin side-band of the East-Mountain Region of Taiyuan, Shanxi Province, and hence the age, i.e. resident time, of underground water is estimated. The region belongs to deep water-poor zone in a long loess ridge situated in a loess hill plateau. The level of underground water is 40-80 m deep hidden. In the runway and the scouring channel the aqueous bed is of river pebble and cobble, with a level of 2-10 m in depth. The age of underground water from different wells were determined to be 23a, 14a, 25a, 41a and 53a respectively

The sensitivity of active and inactive chromatin to ionizing radiation-induced DNA strand breakage

International Nuclear Information System (INIS)

Chiu, S.-M.; Oleinick, N.L.

1982-01-01

The sensitivity of DNA in actively transcribing and inactive states has been compared with regard to γ-radiation-induced single-strand break (SSB) induction. The results indicate that chromatin organization is important in the determination of the sensitivity of cellular DNA toward γ-radiation: Not only the yield but also the rate of repair of SSB is greater in the actively transcribing genes than in the total nuclear DNA. (author)

Cooperation between human cells sensitive to UVA radiations: a clue to the mechanism of cellular hypersensitivity associated with different clinical conditions

International Nuclear Information System (INIS)

Francis, A.J.; Giannelli, F.

1991-01-01

Six fibroblast strains sensitive to long wavelength ultraviolet radiation (UVA) and one control strain were used to see if cooperation between the different cell strains could modify the abnormally high yield of single-strand DNA breaks (SSB) in the sensitive strains caused by UVA irradiation in complete Dulbecco's MEM. The sensitive strains were established from individuals showing proneness to different types of light-induced skin damage (actinic reticuloid, familial actinic keratoses with internal malignancies, and unusual frequency of basal cell carcinomata). When sensitive and normal cells were cocultivated, the UVA-induced SSB decreased in the sensitive cells and increased in the normal ones by amounts proportional to the ratio of the two types of cells in the mixtures. Furthermore the regression of SSB, in the sensitive cells, on the proportion of normal cells in the mixture extrapolated to normal levels of SSB when the proportion of normal cells increased to one. Cocultivation of different sensitive cells did not reduce the UVA-induced SSB to levels below those of the less sensitive cell strains. From these results we conclude that substances, present in limiting amounts, even in normal cells, can be transferred from cell to cell, presumably by metabolic cooperation, and modify the yield of SSB caused by UVA radiation. The abnormal yields of SSB in the sensitive cells appear to be entirely attributable to deficits in the substances responsible for the intercellular cooperation. We suggest that such substances are small molecular weight scavengers of active oxygen species

Chirped laser dispersion spectroscopy using a directly modulated quantum cascade laser

International Nuclear Information System (INIS)

Hangauer, Andreas; Nikodem, Michal; Wysocki, Gerard; Spinner, Georg

2013-01-01

Chirped laser dispersion spectroscopy (CLaDS) utilizing direct modulation of a quantum cascade laser (QCL) is presented. By controlling the laser bias nearly single- and dual-sideband CLaDS operation can be realized in an extremely simplified optical setup with no external optical modulators. Capability of direct single-sideband modulation is a unique feature of QCLs that exhibit a low linewidth enhancement factor. The developed analytical model shows excellent agreement with the experimental, directly modulated CLaDS spectra. This method overcomes major technical limitations of mid-infrared CLaDS systems by allowing significantly higher modulation frequencies and eliminating optical fringes introduced by external modulators

Study of the Calibration Channel Width for a Digital Sideband Separating System for SIS 2SB Receiver

Science.gov (United States)

Khudchenko, Andrey; Finger, R.; Baryshev, A. M.; Mena, F. P.; Rodriguez, R.; Hesper, R.; Fuentes, R.; Bronfman, L.

2018-01-01

A Digital Sideband Separating (DSS) system has been recently applied to a full 2SB receiver, i.e., one with the analog IF hybrid still in place. This concept allows reaching IRR level around 45 dB and it presents additional advantages in calibration stability compared to the case when no IF hybrid is present. If implemented in multipixel cameras, the DSS system relaxes the requirements for the IRR level of the analog receiver substantially enabling to reach at least an IRR of 30 dB with relatively simple hardware. It would be ideal for spectral line surveys since it practically eliminates the line confusion in addition to rejecting the atmospheric noise in the image band. Therefore, the DSS system is a potential option for a future ALMA upgrade. Here we present our study on an important practical question: how wide should the calibration-channel width in order to reach a desired IRR level? This parameter determines, for a large part, the calibration speed of the DSS system and influences the back-end architecture. We estimate that for currently installed ALMA bands (B3-B8), the channel width of the DSS system can be at least 45 MHz to reach a 30db IRR level in entire band.

New results for single stage low energy carbon AMS

International Nuclear Information System (INIS)

Klody, G.M.; Schroeder, J.B.; Norton, G.A.; Loger, R.L.; Kitchen, R.L.; Sundquist, M.L.

2005-01-01

A new configuration of the NEC single stage, low energy carbon AMS system (U.S. Patent 6,815,666 B2) has been built and tested. The injector includes two 40-sample ion sources, electrostatic and magnetic analysis, and fast sequential injection. The gas stripper, analyzing magnet, electrostatic analyzer, and detector are on an open air 250 kV deck. Both 12 C and 13 C currents are measured on the deck after the stripper, and an SSB detector is used for 14 C counting. Injected 12 C and mass 13 ( 13 C and 12 CH) currents are also measured. Automated controls follow a user-specified run list for unattended operation. Initial test results show precision for 14 C/ 12 C ratios of better than 5 per mil, and backgrounds for unprocessed graphite of less than 0.005 x modern. We will report final results for precision, background, and throughput and discuss related design features

Dual-channel amplification in a single-mode diode laser for multi-isotope laser cooling

International Nuclear Information System (INIS)

Booth, James L.; Van Dongen, Janelle; Lebel, Paul; Klappauf, Bruce G.; Madison, Kirk W.

2007-01-01

The output from two grating-stabilized external-cavity diode lasers were injected into a single-mode diode laser. Operating at a wavelength of 780 nm, this laser produced ∼50 mW of power with two main frequency components of the same spectral characteristics of the seed lasers. The power ratio of the amplified components was freely adjustable due to gain saturation, and amplification was observed for frequency differences of the two seed lasers in the range from 73 MHz to 6.6 GHz. This system was used to realize a dual isotope magneto-optic trap (MOT) for rubidium ( 85 Rb and 87 Rb). The resulting position and cloud size of the dual isotope MOT was the same as that of the single species MOTs to within ±10 and ±20 μm, respectively. We also characterized the additional spectral components produced by four wave mixing (FWM) in the diode laser amplifier and utilized a particular FWM sideband to realize hyperfine pumping and subsequent laser trapping of 85 Rb in the absence of a 'repump' laser dedicated to hyperfine pumping

Moessbauer study of the fast magnetization reversal forced in permalloy and invar by an external rf magnetic field

International Nuclear Information System (INIS)

Kopcewicz, M.

1978-01-01

The effect of fast magnetization reversal leading to fast relaxation of the hyperfine field (collapse effect) forced by an external rf magnetic field is studied using the Moessbauer technique for permalloy and invar. The rf collapse and sideband effects are investigated as a function of external rf field, frequency, and intensity. The collapse of the hfs spectrum through unresolved hfs spectrum, triangular shape to a single line, as well as the formation of sidebands is observed. The rf collapse effect is attributed to the rf forced uniform rotation of internal magnetization which causes fast magnetization reversal leading to fast relaxation of the hyperfine field as a result of which the average field at the Moessbauer nuclei is reduced to zero. The difference of the magnetization reversal process in permalloy and invar are discussed. It is shown that the origin of collapse and sideband effects is totaly different: the collapse effect being of purely magnetic origin while the formation of sidebands is due to the rf induced mechanical vibrations of iron atoms within the sample. It is possible to damp sidebands without affecting the collapse effect. The results obtained show that the application of the rf field to ferromagnetic materials gives a unique possibility to force, simulate, and control the relaxation effects in ferromagnetic materials. (author)

Genetic and Biochemical Identification of a Novel Single-Stranded DNA-Binding Complex in Haloferax volcanii.

Science.gov (United States)

Stroud, Amy; Liddell, Susan; Allers, Thorsten

2012-01-01

Single-stranded DNA (ssDNA)-binding proteins play an essential role in DNA replication and repair. They use oligonucleotide/oligosaccharide-binding (OB)-folds, a five-stranded β-sheet coiled into a closed barrel, to bind to ssDNA thereby protecting and stabilizing the DNA. In eukaryotes the ssDNA-binding protein (SSB) is known as replication protein A (RPA) and consists of three distinct subunits that function as a heterotrimer. The bacterial homolog is termed SSB and functions as a homotetramer. In the archaeon Haloferax volcanii there are three genes encoding homologs of RPA. Two of the rpa genes (rpa1 and rpa3) exist in operons with a novel gene specific to Euryarchaeota; this gene encodes a protein that we have termed RPA-associated protein (rpap). The rpap genes encode proteins belonging to COG3390 group and feature OB-folds, suggesting that they might cooperate with RPA in binding to ssDNA. Our genetic analysis showed that rpa1 and rpa3 deletion mutants have differing phenotypes; only Δrpa3 strains are hypersensitive to DNA damaging agents. Deletion of the rpa3-associated gene rpap3 led to similar levels of DNA damage sensitivity, as did deletion of the rpa3 operon, suggesting that RPA3 and RPAP3 function in the same pathway. Protein pull-downs involving recombinant hexahistidine-tagged RPAs showed that RPA3 co-purifies with RPAP3, and RPA1 co-purifies with RPAP1. This indicates that the RPAs interact only with their respective associated proteins; this was corroborated by the inability to construct rpa1 rpap3 and rpa3 rpap1 double mutants. This is the first report investigating the individual function of the archaeal COG3390 RPA-associated proteins (RPAPs). We have shown genetically and biochemically that the RPAPs interact with their respective RPAs, and have uncovered a novel single-stranded DNA-binding complex that is unique to Euryarchaeota.

Single mode CO2 laser frequency modulation up to 350 MHz

Science.gov (United States)

Leeb, W. R.; Peruso, C. J.

1977-01-01

Experiments on internal frequency modulation (FM) of a CO2 laser showed no limitation of FM by the linewidth. However, distortions in the form of strong enhancement of sideband amplitude arise for frequencies equal to the cavity resonant frequencies, most pronounced if the modulator is positioned near a cavity mirror.

Repair of γ-irradiation-induced DNA single-strand breaks in human bone marrow cells. Analysis of unfractionated and CD34+ cells using single-cell gel electrophoresis

International Nuclear Information System (INIS)

Lankinen, Maarit H.; Vilpo, Juhani A.

1997-01-01

Human bone marrow mononuclear cells (BMMNCs) were separated by density gradient centrifugation, and a subpopulation of progenitor cells was further isolated using anti-CD34-coated magnetic beads. The cells were irradiated with γ-rays (0.93-5.43 Gy) from a 137 Cs source. The extent of DNA damage, i.e., single-strand breaks (SSBs) and alkali-labile lesions of individual cells, was investigated using the alkaline single-cell gel electrophoresis technique. The irradiation resulted in a dose-dependent increase in DNA migration, reflecting the number of detectable DNA lesions. An approximately similar extent of SSB formation was observed in BMMNCs and CD34+ cells. Damage was repaired when the cells were incubated at 37C: a fast initial repair phase was followed by a slower rejoining of SSBs in both BMMNC and CD34+ cell populations. A significantly longer time was required to repair the lesions caused by 5.43 Gy than those caused by 0.93 Gy. In the present work we report, for the first time, the induction and repair of DNA SSBs at the level of single human bone marrow cells when exposed to ionizing radiation at clinically relevant doses. These data, together with our previous results with human blood granulocytes and lymphocytes, indicate an approximately similar extent of formation and repair of γ-irradiation-induced DNA SSBs in immature and mature human hematopoietic cells

Mode Engineering of Single Photons from Cavity Spontaneous Parametric Down-Conversion Source and Quantum Dots

Science.gov (United States)

Paudel, Uttam

the visibility exceeding 95%. As an alternative approach to modifying the spectral mode of single photons, we performed phase modulation of photons emitted by a QD to generate additional sidebands that are separated by several GHz. By performing HOM measurements, we have shown that the central component and the sidebands are in the superposition states and the spectrally modified photons have a well-preserved indistinguishability. Such spectrally engineered photons can be used for phase-encoded cryptography applications. These experimental results should lay the foundations towards building a scalable hybrid quantum network.

Numerical simulation of lowest-order short-crested wave instabilities

DEFF Research Database (Denmark)

Fuhrman, David R.; Madsen, Per A.; Bingham, Harry

2006-01-01

instabilities. These correctly lead to well-known (nearly symmetric) recurrence cycles below a previously established breaking threshold steepness, and to an asymmetric evolution (characterized by a permanent transfer of energy to the lower side-band) above this threshold, with dissipation from a smoothing...... that the unstable evolution of these initially three-dimensional waves leads to an asymmetric evolution, even for weakly nonlinear cases presumably well below breaking. This is characterized by an energy transfer to the lower side-band, which is also accompanied by a similar transfer to more distant upper side......-bands. At larger steepness, the evolution leads to a permanent downshift of both the mean and peak frequencies, driven in part by dissipation, effectively breaking the quasi-recurrence cycle. A single case involving a class Ib short-crested wave instability at relatively large steepness is also considered, which...

Development of a suspended-mass RSE interferometer using third harmonic demodulation

CERN Document Server

Miyakawa, O; Heinzel, G; Kawamura, S

2002-01-01

The most important point of a resonant sideband extraction (RSE) experiment is the signal extraction for control of the interferometer. We proposed a new signal-sensing method for the single modulation scheme. This method uses the third harmonic demodulation (THD) with a particular asymmetry in the interferometer which makes the third-order sidebands vanish at the detecting port. We have successfully locked a suspended-mass RSE interferometer for the first time by the THD method. The transfer function of the interferometer was measured to confirm the RSE effect.

Development of a suspended-mass RSE interferometer using third harmonic demodulation

International Nuclear Information System (INIS)

Miyakawa, Osamu; Somiya, Kentaro; Heinzel, Gerhard; Kawamura, Seiji

2002-01-01

The most important point of a resonant sideband extraction (RSE) experiment is the signal extraction for control of the interferometer. We proposed a new signal-sensing method for the single modulation scheme. This method uses the third harmonic demodulation (THD) with a particular asymmetry in the interferometer which makes the third-order sidebands vanish at the detecting port. We have successfully locked a suspended-mass RSE interferometer for the first time by the THD method. The transfer function of the interferometer was measured to confirm the RSE effect

Spectral negentropy based sidebands and demodulation analysis for planet bearing fault diagnosis

Science.gov (United States)

Feng, Zhipeng; Ma, Haoqun; Zuo, Ming J.

2017-12-01

Planet bearing vibration signals are highly complex due to intricate kinematics (involving both revolution and spinning) and strong multiple modulations (including not only the fault induced amplitude modulation and frequency modulation, but also additional amplitude modulations due to load zone passing, time-varying vibration transfer path, and time-varying angle between the gear pair mesh lines of action and fault impact force vector), leading to difficulty in fault feature extraction. Rolling element bearing fault diagnosis essentially relies on detection of fault induced repetitive impulses carried by resonance vibration, but they are usually contaminated by noise and therefor are hard to be detected. This further adds complexity to planet bearing diagnostics. Spectral negentropy is able to reveal the frequency distribution of repetitive transients, thus providing an approach to identify the optimal frequency band of a filter for separating repetitive impulses. In this paper, we find the informative frequency band (including the center frequency and bandwidth) of bearing fault induced repetitive impulses using the spectral negentropy based infogram. In Fourier spectrum, we identify planet bearing faults according to sideband characteristics around the center frequency. For demodulation analysis, we filter out the sensitive component based on the informative frequency band revealed by the infogram. In amplitude demodulated spectrum (squared envelope spectrum) of the sensitive component, we diagnose planet bearing faults by matching the present peaks with the theoretical fault characteristic frequencies. We further decompose the sensitive component into mono-component intrinsic mode functions (IMFs) to estimate their instantaneous frequencies, and select a sensitive IMF with an instantaneous frequency fluctuating around the center frequency for frequency demodulation analysis. In the frequency demodulated spectrum (Fourier spectrum of instantaneous frequency) of

Radiosensitization of mammalian cells by misonidazole and oxygen: DNA damage exposed by Micrococcus luteus enzymes

International Nuclear Information System (INIS)

Skov, K.A.; Palcic, B.; Skarsgard, L.D.

1979-01-01

When misonidazole is present during irradiation of hypoxic mammalian cells, an enhancement of single-strand breaks (SSB) in DNA is observed. Oxygen also enhances SSB, presumably in a manner similar to that of misonidazole. The dose-modifying factor (DMF) for 15 mM misonidazole was found to be 3.4, compared to an oxygen enhancement ratio (OER) of 3.5. Another class of DNA damage, namely, sites exposed by an extract of Micrococcus luteus, was examined. Radiation-induced M. luteus extract-sensitive sites (MLS) were also found to be enhanced by the presence of misonidazole or molecular oxygen. The DMF for this damage by 15 mM misonidazole was 1.6 while the OER was 2.5. The ratio of MLS to SSB is approximately 1.25 under hypoxia, 0.9 in the presence of oxygen, and 0.6 in the presence of 15 mM misonidazole under hypoxic conditions. Incubation with misonidazole under conditions which are toxic to mammalian cells (37 0 C, hypoxia), and which result in many SSB, produces no detectable lesions sensitive to the M. luteus extract

Predicting sugar-sweetened behaviours with theory of planned behaviour constructs: Outcome and process results from the SIPsmartER behavioural intervention.

Science.gov (United States)

Zoellner, Jamie M; Porter, Kathleen J; Chen, Yvonnes; Hedrick, Valisa E; You, Wen; Hickman, Maja; Estabrooks, Paul A

2017-05-01

Guided by the theory of planned behaviour (TPB) and health literacy concepts, SIPsmartER is a six-month multicomponent intervention effective at improving SSB behaviours. Using SIPsmartER data, this study explores prediction of SSB behavioural intention (BI) and behaviour from TPB constructs using: (1) cross-sectional and prospective models and (2) 11 single-item assessments from interactive voice response (IVR) technology. Quasi-experimental design, including pre- and post-outcome data and repeated-measures process data of 155 intervention participants. Validated multi-item TPB measures, single-item TPB measures, and self-reported SSB behaviours. Hypothesised relationships were investigated using correlation and multiple regression models. TPB constructs explained 32% of the variance cross sectionally and 20% prospectively in BI; and explained 13-20% of variance cross sectionally and 6% prospectively. Single-item scale models were significant, yet explained less variance. All IVR models predicting BI (average 21%, range 6-38%) and behaviour (average 30%, range 6-55%) were significant. Findings are interpreted in the context of other cross-sectional, prospective and experimental TPB health and dietary studies. Findings advance experimental application of the TPB, including understanding constructs at outcome and process time points and applying theory in all intervention development, implementation and evaluation phases.

Predicting sugar-sweetened behaviours with theory of planned behaviour constructs: Outcome and process results from the SIPsmartER behavioural intervention

Science.gov (United States)

Zoellner, Jamie M.; Porter, Kathleen J.; Chen, Yvonnes; Hedrick, Valisa E.; You, Wen; Hickman, Maja; Estabrooks, Paul A.

2017-01-01

Objective Guided by the theory of planned behaviour (TPB) and health literacy concepts, SIPsmartER is a six-month multicomponent intervention effective at improving SSB behaviours. Using SIPsmartER data, this study explores prediction of SSB behavioural intention (BI) and behaviour from TPB constructs using: (1) cross-sectional and prospective models and (2) 11 single-item assessments from interactive voice response (IVR) technology. Design Quasi-experimental design, including pre- and post-outcome data and repeated-measures process data of 155 intervention participants. Main Outcome Measures Validated multi-item TPB measures, single-item TPB measures, and self-reported SSB behaviours. Hypothesised relationships were investigated using correlation and multiple regression models. Results TPB constructs explained 32% of the variance cross sectionally and 20% prospectively in BI; and explained 13–20% of variance cross sectionally and 6% prospectively. Single-item scale models were significant, yet explained less variance. All IVR models predicting BI (average 21%, range 6–38%) and behaviour (average 30%, range 6–55%) were significant. Conclusion Findings are interpreted in the context of other cross-sectional, prospective and experimental TPB health and dietary studies. Findings advance experimental application of the TPB, including understanding constructs at outcome and process time points and applying theory in all intervention development, implementation and evaluation phases. PMID:28165771

Quantum interference effects in a cavity QED system

International Nuclear Information System (INIS)

Akram, Uzma; Ficek, Z

2003-01-01

We consider the effect of quantum interference on population distribution and photon statistics of a cavity field interacting with dressed states of a strongly driven three-level atom. We analyse three coupling configurations of the cavity field to the driven atom, with the cavity frequency tuned to the outer Rabi sideband, the inner Rabi sideband and the central frequency of the 'singly dressed' three-level atom. The quantum doubly dressed states for each configuration are identified and the population distribution and photon statistics are interpreted in terms of transitions among these dressed states and their populations. We find that the population distribution depends strongly on quantum interference and the cavity damping. For the cavity field tuned to the outer or inner Rabi sidebands the cavity damping induces transitions between the dressed states which are forbidden for the ordinary spontaneous emission. Moreover, we find that in the case of the cavity field coupled to the inner Rabi sideband the population distribution is almost Poissonian with a large average number of photons that can be controlled by quantum interference. This system can be considered as a one-atom dressed-state laser with controlled intensity

Detection of UVR-induced DNA damage in mouse epidermis in vivo using alkaline elution

International Nuclear Information System (INIS)

Kinley, J.S.; Moan, J.; Brunborg, G.

1995-01-01

Alkaline elution has been used to detect ultraviolet radiation (UVR)-induced DNA damage in the epidermis of C3H/Tif hr/hr mice. This technique detects DNA damage in the form of single-strand breaks and alkali-labile sites (SSB) formed directly by UVA (320-400 nm) or indirectly by UVB (280-320 nm). The latter induces DNA damage such as cyclobutane pyrimidine dimers and pyrimidine-pyrimidone (6-4)-photoproducts, which are then converted into transient SSB by cellular endonucleases, during nucleotide excision repair (NER). (Author)

A high-power two stage traveling-wave tube amplifier

International Nuclear Information System (INIS)

Shiffler, D.; Nation, J.A.; Schachter, L.; Ivers, J.D.; Kerslick, G.S.

1991-01-01

Results are presented on the development of a two stage high-efficiency, high-power 8.76-GHz traveling-wave tube amplifier. The work presented augments previously reported data on a single stage amplifier and presents new data on the operational characteristics of two identical amplifiers operated in series and separated from each other by a sever. Peak powers of 410 MW have been obtained over the complete pulse duration of the device, with a conversion efficiency from the electron beam to microwave energy of 45%. In all operating conditions the severed amplifier showed a ''sideband''-like structure in the frequency spectrum of the microwave radiation. A similar structure was apparent at output powers in excess of 70 MW in the single stage device. The frequencies of the ''sidebands'' are not symmetric with respect to the center frequency. The maximum, single frequency, average output power was 210 MW corresponding to an amplifier efficiency of 24%. Simulation data is also presented that indicates that the short amplifiers used in this work exhibit significant differences in behavior from conventional low-power amplifiers. These include finite length effects on the gain characteristics, which may account for the observed narrow bandwidth of the amplifiers and for the appearance of the sidebands. It is also found that the bunching length for the beam may be a significant fraction of the total amplifier length

Measurement of DNA breakage and breakage repair in mice spleen cells induced by ionizing radiation

International Nuclear Information System (INIS)

Wang Qin; Xue Jingying; Li Jin; Mu Chuanjie; Fan Feiyue

2007-01-01

Objective: To investigate the radioresistance mechanism of IBM-2 mice through measuring DNA single-strand break(SSB) and double-strands break (DSB) as well as their repair. Methods: Pulsed-field gel electrophoresis was used to measure DSB and SSB in IRM-2 mice and their parental mice ICR/JCL and 615 mice after exposure to different doses of γ-ray at different postirradiation time. Results: The initial DNA damages, ie the quantities of DSB and SSB in unirradiation IRM-2 mice were less serious than that of their parental mice ICR/JCL and 615 alice(P<0.01). The percent- age of DSB and SSB in IBM -2 mice was significantly lower than that of ICB/JCL and 615 mice after exposure to various doses of γ-ray(P<0.01 and P<0.05). There were not statistic differences in DSB and SSB repair between IRM-2 mice and their parental mice after exposure to 2Gy radiation. The DNA damage repair rate induced by 4Gy and 8Gy radiation in IRM - 2 mice was rapid, ie the repair rate of SSB and DSB after 0.5h and 1h postirradiation in IRM-2 mice was higher than that of their' parental mice (P<0.01 and P<0.05). And remaining damages after repair in IRM-2 mice were lower than that of ICR/JCL and 615 mice. Conclusion: The DNA damages in IBM-2 mice were lower than that of their parental mice after exposure to ionizing radiation. Moreover, the repair rate of SSB and DSB was higher than that of their parental mice, which perhaps were the radioresistance causes of IBM-2 mice. Therefore IRM-2 mice are naturally resistant to DNA damages induced by ionizing radiation. (authors)

A homogeneous and “off–on” fluorescence aptamer-based assay for chloramphenicol using vesicle quantum dot-gold colloid composite probes

Energy Technology Data Exchange (ETDEWEB)

Miao, Yang-Bao [State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo 315211 (China); Ren, Hong-Xia [Key Laboratory of Asymmetric Synthesis and Chirotechnology of Sichuan Province, Chengdu Institute of Organic Chemistry, Chinese Academy of Sciences, Chengdu 610041 (China); University of Chinese Academy of Sciences, Beijing 10049 (China); Gan, Ning, E-mail: ganning@nbu.edu.cn [State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo 315211 (China); Zhou, You [State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo 315211 (China); Cao, Yuting, E-mail: caoyuting@nbu.edu.cn [State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo 315211 (China); Li, Tianhua [State Key Laboratory Base of Novel Functional Materials and Preparation Science, Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo 315211 (China); Chen, Yinji [Faculty of Food Science and Engineering, Nanjing University of Finance and Economics, Nanjing 210000 (China)

2016-07-27

In this work, a novel homogeneous and signal “off–on” aptamer based fluorescence assay was successfully developed to detect chloramphenicol (CAP) residues in food based on the fluorescence resonance energy transfer (FRET). The vesicle nanotracer was prepared through labeling single stranded DNA binding protein (SSB) on limposome-CdSe/ZnS quantum dot (SSB/L-QD) complexes. It was worth mentioning that the signal tracer (SSB/L-QD) with vesicle shape, which was fabricated being encapsulated with a number of quantum dots and SSB. The nanotracer has excellent signal amplification effects. The vesicle composite probe was formed by combining aptamer labeled nano-gold (Au-Apt) and SSB/L-QD. Which based on SSB's specific affinity towards aptamer. This probe can't emit fluoresce which is in “off” state because the signal from SSB/L-QD as donor can be quenched by the Au-aptas acceptor. When CAP was added in the composite probe solution, the aptamer on the Au-Apt can be preferentially bounded with CAP then release from the composite probe, which can turn the “off” signal of SSB/L-QD tracer into “on” state. The assay indicates excellent linear response to CAP from 0.001 nM to 10 nM and detection limit down to 0.3 pM. The vesicle probes with size of 88 nm have strong signal amplification. Because a larger number of QDs can be labeled inside the double phosphorus lipid membrane. Besides, it was employed to detect CAP residues in the milk samples with results being agreed well with those from ELISA, verifying its accuracy and reliability. - Highlights: • Homogeneous and “off–on” fluorescence aptamer-based assay was developed to detect chloramphenicol (CAP) residues in food. • This probe was fabricated based on a vesicle QDs signal tracer (SSB/L-QD) combining with Au-Aptamer. • The detection mechanism was based on FRET with high specificity. • The results for CAP detection in the milk samples agreed well with those from ELISA, while

Short pulse generation from a passively mode-locked fiber optical parametric oscillator with optical time-stretch.

Science.gov (United States)

Qiu, Yi; Wei, Xiaoming; Du, Shuxin; Wong, Kenneth K Y; Tsia, Kevin K; Xu, Yiqing

2018-04-16

We propose a passively mode-locked fiber optical parametric oscillator assisted with optical time-stretch. Thanks to the lately developed optical time-stretch technique, the onset oscillating spectral components can be temporally dispersed across the pump envelope and further compete for the parametric gain with the other parts of onset oscillating sidebands within the pump envelope. By matching the amount of dispersion in optical time-stretch with the pulse width of the quasi-CW pump and oscillating one of the parametric sidebands inside the fiber cavity, we numerically show that the fiber parametric oscillator can be operated in a single pulse regime. By varying the amount of the intracavity dispersion, we further verify that the origin of this single pulse mode-locking regime is due to the optical pulse stretching and compression.

Study of Raman-free photon pair generation using inter-modal four-wave mixing in a few-mode silica fiber

DEFF Research Database (Denmark)

Friis, Søren Michael Mørk; Christensen, Jesper Bjerge; Koefoed, Jacob Gade

2017-01-01

Single-photon sources are key components in applications of photonic quantum technologies such as quantum key distribution (QKD) [1]. One way of realizing single-photon sources is generation of photon pairs (PP) using spontaneous four-wave mixing (FWM): two photons from a pump p annihilate...... and create two side-band photons at frequencies determined partly by the energy conservation 2ωρ = ω1 + ω2, where ωp,ω1,ω2 are the frequencies of the pump and the two side-bands, respectively, and partly by the phase-matching condition. PP generated spontaneously arrive at indeterministic times but even so......, they are useful for QKD because one of the photons can be heralded by detecting the other. The heralded photons are then used for transmitting the quantum key....

Radiation dose response of strand breaks in SINPV-DNA

International Nuclear Information System (INIS)

Zhang Chunxiang; Luo Daling; Li Mianfeng; Liu Xiaowei; Zeng Rong; Wang Xunzhang

1995-01-01

The Spodoplera litura Nuclear Polyhedrosis Viruses (SINPV) is a kind of insectile virus with a simple structure, in which a double helix DNA is encapsulated in a protein coat and there is no function of enzymatic repair. The SINPV samples in dry powdered form held in sealed plastic tube were irradiated by 1-100 kGy gamma rays. The single strand breaks (SSB) and double strand breaks (DSB) induced in SINPV after irradiation were measured by neutral and alkaline agarose gel electrophoresis. A dose-response function combining the responses of one-hit and two-hit events was used to describe the SSB and DSB dose-response curves. It is shown that the SSB are one-hit events and the DSB are the combination of both one-hit, and two-hit events, and two-hit events are predominant in the DSB process

Torsional regulation of hRPA-induced unwinding of double-stranded DNA

NARCIS (Netherlands)

De Vlaminck, I.; Vidic, I.; Van Loenhout, M.T.J.; Kanaar, R.; Lebbink, J.H.G.; Dekker, C.

2010-01-01

All cellular single-stranded (ss) DNA is rapidly bound and stabilized by single stranded DNA-binding proteins (SSBs). Replication protein A, the main eukaryotic SSB, is able to unwind double-stranded (ds) DNA by binding and stabilizing transiently forming bubbles of ssDNA. Here, we study the

A broadband beam-steered fiber mm-wave link with high energy-spectral-spatial efficiency for 5G coverage

NARCIS (Netherlands)

Cao, Z.; Zhao, X.; Jiao, Y.; Deng, X.; Tessema, N.; Raz, O.; Koonen, A.M.J.

2017-01-01

Utilizing an integrated optical-tunable-delay-line, reversely-modulated single sideband modulation, and Nyquist subcarrier modulation, we demonstrate an 8 Gbps mm-wave beam steered link with a spatial-spectral efficiency of 16 bits/s/Hz.

Full correspondence between asymmetric filling of slits and first-order phase transition lines

Directory of Open Access Journals (Sweden)

Leszek Szybisz

2011-12-01

Full Text Available Adsorption on single planar walls and filling of slits with identical planar walls are investigated in the frame of the density functional theory. In this sort of slits the external potential is symmetric with respect to its central plane. Calculations were carried out by applying both the canonical and grand canonical ensembles (CE and GCE, respectively. The behavior is analyzed by varying the strength of the adsorbate-substrate attraction, the temperature T, and the coverage Γℓ. Results obtained for physisorption of Xe on alkaline surfaces are reported in the present work. Prewetting (PW lines and wetting temperatures, Tw, are determined from the analysis of adsorption on single walls. The filling of slits is analyzed for temperatures T > Tw. It is found that whenever for a given Xe-substrate combination the adsorption on a single wall exhibits a first-order wetting transition then asymmetric profiles that break the left-right symmetry of the external potential appear in the filling of an equivalent slit. These spontaneously symmetry breaking (SSB solutions occur in a restricted range of Γℓ with a T-dependent width. In the case of closed slits analyzed in the CE scheme, the obtained asymmetric profiles exhibit lower Helmholtz free energies than the symmetric species and, therefore, could be stabilized in this geometry. For open slits, the GCE scheme yields all the symmetric and SSB states in the corresponding convex regimes of the free energy. It is shown that both the CE and the GCE frames yield three coexistent states, two symmetric and one asymmetric twofold degenerate. Both a PW line and the related SSB effect terminate at the same temperature. For rather strongly attractive surfaces reentrant SSB states are found at a fixed value of T.

Caffeine increases sugar-sweetened beverage consumption in a free-living population: a randomised controlled trial.

Science.gov (United States)

Keast, Russell S J; Swinburn, Boyd A; Sayompark, Dhoungsiri; Whitelock, Susie; Riddell, Lynn J

2015-01-28

Excessive sugar-sweetened beverage (SSB) consumption has been associated with overweight and obesity. Caffeine is a common additive to SSB, and through dependence effects, it has the potential to promote the consumption of caffeine-containing foods. The objective of the present study was to assess the influence that caffeine has on the consumption of SSB. Participants (n 99) were blindly assigned to either a caffeinated SSB (C-SSB) or a non-caffeinated SSB (NC-SSB) group. Following randomisation, all participants completed a 9 d flavour-conditioning paradigm. They then completed a 28 d ad libitum intake intervention where they consumed as much or as little of C-SSB or NC-SSB as desired. The amount consumed (ml) was recorded daily, 4 d diet diaries were collected and liking of SSB was assessed at the start and end of the intervention. Participants (n 50) consuming the C-SSB had a daily SSB intake of 419 (sd 298) ml (785 (sd 559) kJ/d) over the 28 d intervention, significantly more than participants (n 49) consuming the NC-SSB (273 (sd 278) ml/d, 512 (sd 521) kJ/d) (P=0.05). However, participants who consumed the C-SSB liked the SSB more than those who consumed the NC-SSB (6.3 v. 6.0 on a nine-point hedonic scale, P= 0.022). The addition of low concentrations of caffeine to the SSB significantly increases the consumption of the SSB. Regulating caffeine as a food additive may be an effective strategy to decrease the consumption of nutrient-poor high-energy foods and beverages.

Radio-frequency transparent demodulation for broadband hybrid wireless-optical links

DEFF Research Database (Denmark)

Zibar, Darko; Sambaraju, Rakesh; Alemany, Ruben

2010-01-01

A novel demodulation technique which is transparent to radio-frequency (RF) carrier frequency is presented and experimentally demonstrated for multigigabit wireless signals. The presented demodulation technique employs optical single-sideband filtering, coherent detection, and baseband digital si...

Regulation of DNA repair processes in mammalian cell

International Nuclear Information System (INIS)

Bil'din, V.N.; Sergina, T.B.; Zhestyanikov, V.D.

1992-01-01

A study was made of the repair of ionizing radiation-induced DNA single-strand breaks (SSB) in proliferating and quiescent mouse Swiss 3T6 cells and in those stimulated from the quiet status by epidermal growth factor in combination with insulin, in the presence of specific inhibitors of DNA polymerase α and β (aphidicolin) and DNA polymerase β (2', 3'-dideoxythjymidine-5'-triphosphate). The repair of DNA SSB induced by X-ray-irradiation (10 Gy) or by γ-ray irradiation (150 Gy) is more sensitive to aphidicolin and mitogen-simulated cells three times stronger than in proliferating cells. The influence of 2', 3'-dideoxythymidine-5'-triphosphate on the rate of DNA SSB repair in cells of all the three types does not differ. Thus, the decrease in DNA repair efficiency in quiescent cells is connected with a decrease in the activity of aphidicolin-sensitive DNA polymerase, apparently DNA polymerase α

DNA repair in human bronchial epithelial cells

International Nuclear Information System (INIS)

Fornace, A.J. Jr.; Lechner, J.F.; Grafstrom, R.C.; Harris, C.C.

1982-01-01

The purpose of this investigation was to compare the response of human cell types (bronchial epithelial cells and fibroblasts and skin fibroblasts) to various DNA damaging agents. Repair of DNA single strand breaks (SSB) induced by 5 krads of X-ray was similar for all cell types; approximately 90% of the DNA SSB were rejoined within one hour. During excision repair of DNA damage from u.v.-radiation, the frequencies of DNA SSB as estimated by the alkaline elution technique, were similar in all cell types. Repair replication as measured by BND cellulose chromatography was also similar in epithelial and fibroblastic cells after u.v.-irradiation. Similar levels of SSB were also observed in epithelial and fibroblastic cells after exposure to chemical carcinogens: 7,12-dimethylbenz[a]anthracene; benzo[a]pyrene diol epoxide (BPDE); or N-methyl-N-nitro-N-nitrosoguanidine. Significant repair replication of BPDE-induced DNA damage was detected in both bronchial epithelial and fibroblastic cells, although the level in fibroblasts was approximately 40% of that in epithelial cells. The pulmonary carcinogen asbestos did not damage DNA. DNA-protein crosslinks induced by formaldehyde were rapidly removed in bronchial cells. Further, epithelial and fibroblastic cells, which were incubated with formaldehyde and the polymerase inhibitor combination of cytosine arabinoside and hydroxyurea, accumulated DNA SSB at approximately equal frequencies. These results should provide a useful background for further investigations of the response of human bronchial cells to various DNA damaging agents

Current perspectives on genotype classification and individualized ...

African Journals Online (AJOL)

Tropical Journal of Pharmaceutical Research February 2018; 17 (2): 359-364. ISSN: 1596-5996 (print); ... In this review, relevant studies and ... mesenchymal stem-like (MSL) subtypes with ... DNA single-strand break (SSB) without repair led.

Foods and Beverages Associated with Higher Intake of Sugar-Sweetened Beverages

Science.gov (United States)

Mathias, Kevin C.; Slining, Meghan M.; Popkin, Barry M.

2013-01-01

Background Although consumption of sugar-sweetened beverages (SSBs) is associated with higher caloric intakes, the amount SSBs contribute to higher intakes has not been addressed. Purpose To estimate the amount SSB contribute to higher caloric intakes and determine how the diets of SSB consumers and nonconsumers differ. Methods The WWEI America (What We Eat in America), NHANES 2003–2010 surveys were combined into a sample of 13,421 children; analyses were conducted in December 2012. To determine the contribution of SSB to higher caloric intakes, total non-SSB, food, and non-SSB beverage intakes of SSB consumers and nonconsumers were compared using linear regression models controlling for demographic and socioeconomic factors. Analyses also compared intakes between nonconsumers and SSB consumers with different amounts of SSB consumption. Results For children aged 2–5 years and 6–11 years, non-SSB intakes did not differ between nonconsumers and SSB consumers at any level of SSB consumption, indicating that SSBs were primarily responsible for the higher caloric intakes among SSB consumers. A similar finding was observed among children aged 12–18 years; however, both food and SSB contribute to higher caloric intakes of adolescents consuming ≥500 kcal of SSBs. Among those aged 12–18 years, higher intakes of foods (e.g., pizza, burgers, fried potatoes, and savory snacks) and lower intakes of non-SSB beverages (e.g., fluid milk and fruit juice) were associated with increased SSB intake. Conclusions Sugar-sweetened beverages are primarily responsible for the higher caloric intakes of SSB consumers, and SSB consumption is associated with intake of a select number of food and beverage groups, some of which are often unhealthy (e.g., pizza and grain-based desserts). PMID:23498100

Single and double strand breaks induced by 3H incorporated in DNA of cultured human kidney cells

International Nuclear Information System (INIS)

Tisljar-Lentulis, G.; Henneberg, P.; Mielke, T.; Feinendegen, L.E.

1978-01-01

In the course of the investigations of the biological effects of radionuclides incorporated in DNA single (SSB) and double strand breaks (DSB) caused tritium-decay were measured and compared with respective data resulting from 125 I. Tritium bound to thymidine and iododeoxyuridine seems to be more effective than tritium bound to other DNA-precursors. On the basis of decay, methyl- 3 H thymidine appears to be more effective with regard to the production of strand breaks than 3 H in position 6 of the pyrimidine ring. Based on the numbers of strand-breaks per rad, position 6 is more effective in accordance with data obtained by F. Krasin et al. The ratio of SSBs to DSBs per tritium decay appears to be approximately 8 in mammlian cells. Not only SSBs but also DSBs induced by 3 H in mammalian cells are reapairable. (orig./AJ) [de

Quantification of complex DNA damage by ionising radiation. An experimental and theoretical approach

International Nuclear Information System (INIS)

Fulford, J.

2000-05-01

Ionising radiation potentially produces a broad spectrum of damage in DNA including single and double strand breaks (ssb and dsb) and base damages. It has been hypothesised that sites of complex damage within cellular DNA have particular biological significance due to an associated decreased efficiency in repair. The aim of this study is to gain further understanding of the formation of complex DNA damage. Irradiations of plasmid DNA illustrate that an increase in ionising density of the radiation results in a decrease in ssb yields/Gy but an increase in dsb per ssb, indicative of an increase in the number of complex damage sites per simple isolated damage site. As the mechanism for damage formation shifts from purely indirect at low scavenging capacities to a significant proportion of direct at higher scavenging capacities the proportion of complex damage increases. Comparisons with the yields of ssb and dsb simulated by Monte-Carlo calculations for Al K USX and α-particles also indicate this correspondence. The ionisation density of low energy, secondary electrons produced by photons was assessed experimentally from the dependence of the yield of OH radicals escaping intra-track recombination on photon energy. As energy decreases the OH radical yield initially decreases reflecting an increased ionisation density. However, with further decrease in photon energy the yield of OH radicals increases in line with theoretical calculations. Base damage yields were determined for low and high ionising density radiation over a range of scavenging capacities. As scavenging capacity increases the base damage: ssb ratios increases implying a contribution from electrons to base damage. It is proposed that base damage contributes to DNA damage complexity. Complex damage analysis reveals that at cell mimetic scavenging capacities, 23% and 72% of ssb have an additional spatially close damage site following γ-ray and α-particle irradiation respectively. (author)

The Association between the Availability of Sugar-Sweetened Beverage in School Vending Machines and Its Consumption among Adolescents in California: A Propensity Score Matching Approach

Directory of Open Access Journals (Sweden)

Lu Shi

2010-01-01

Full Text Available There is controversy over to what degree banning sugar-sweetened beverage (SSB sales at schools could decrease the SSB intake. This paper uses the adolescent sample of 2005 California Health Interview Survey to estimate the association between the availability of SSB from school vending machines and the amount of SSB consumption. Propensity score stratification and kernel-based propensity score matching are used to address the selection bias issue in cross-sectional data. Propensity score stratification shows that adolescents who had access to SSB through their school vending machines consumed 0.170 more drinks of SSB than those who did not (<.05. Kernel-based propensity score matching shows the SSB consumption difference to be 0.158 on the prior day (<.05. This paper strengthens the evidence for the association between SSB availability via school vending machines and the actual SSB consumption, while future studies are needed to explore changes in other beverages after SSB becomes less available.

Modulation of X ray DNA damage by SR-2508 +/- buthionine sulfoximine

International Nuclear Information System (INIS)

Kinsella, T.J.; Dobson, P.P.; Russo, A.; Mitchell, J.B.; Fornace, A.J. Jr.

1986-01-01

It has been demonstrated that glutathione (GSH) depletion with buthionine sulfoximine (BSO) potentiates SR-2508 radiosensitization in hypoxic cells. We have measured the effect of SR-2508 alone, BSO alone, and combined treatment on radiation-induced DNA strand breaks in hypoxic V79 cells using alkaline and neutral elution. DNA base damage recognized by a damage specific endonuclease from M. luteus was also studied. Hypoxic irradiation markedly reduces the efficiency of single-strand (SSB) and double-strand breaks (DSB) to 10-20% compared to oxic irradiation. Hypoxia had less effect on the efficiency of base damage (ESS). BSO treatment alone, resulting in GSH depletion to less than 5% of controls, had little effect of hypoxic-SSB, DSB, and ESS. SR-2508 (5 mM) treatment alone in hypoxic cells increased the number of SSB, DSB and ESS to approximately half of that resulting from oxic irradiation. However, the combination of BSO and SR-2508 in hypoxic cells resulted in SSB and DSB comparable to oxic irradiation. This combined treatment resulted in less effect on ESS. We conclude that the observed hypoxic radiosensitization, using clonogenic survival assays with combined BSO-SR-2508, correlates with our results assessing DNA strand breaks and base damage

Protein interactions in genome maintenance as novel antibacterial targets.

Directory of Open Access Journals (Sweden)

Aimee H Marceau

Full Text Available Antibacterial compounds typically act by directly inhibiting essential bacterial enzyme activities. Although this general mechanism of action has fueled traditional antibiotic discovery efforts for decades, new antibiotic development has not kept pace with the emergence of drug resistant bacterial strains. These limitations have severely restricted the therapeutic tools available for treating bacterial infections. Here we test an alternative antibacterial lead-compound identification strategy in which essential protein-protein interactions are targeted rather than enzymatic activities. Bacterial single-stranded DNA-binding proteins (SSBs form conserved protein interaction "hubs" that are essential for recruiting many DNA replication, recombination, and repair proteins to SSB/DNA nucleoprotein substrates. Three small molecules that block SSB/protein interactions are shown to have antibacterial activity against diverse bacterial species. Consistent with a model in which the compounds target multiple SSB/protein interactions, treatment of Bacillus subtilis cultures with the compounds leads to rapid inhibition of DNA replication and recombination, and ultimately to cell death. The compounds also have unanticipated effects on protein synthesis that could be due to a previously unknown role for SSB/protein interactions in translation or to off-target effects. Our results highlight the potential of targeting protein-protein interactions, particularly those that mediate genome maintenance, as a powerful approach for identifying new antibacterial compounds.

Specificity of DNA repair in plants exposed at low dose-rate

International Nuclear Information System (INIS)

Semov, A.B.; Ptitsina, S.N.; Shevchenko, V.A.

1997-01-01

Intensity of gamma-ray induced unscheduled DNA synthesis (UDS) as well as yield and repair of single-strand DNA breaks (SSB) were investigated in control and exposed higher plant populations. Populations of V. cracca have been chronically irradiating by 90 Sr-beta-particles due to Kyshtym accident (South Ural) or have been growing on the uranium-miner tails (alpha-irradiation). In former case increased radioresistance was revealed (the phenomenon previously called radio-adaptation and that probably has something in common with adaptive response). This radioresistance correlates with higher intensity of UDS. On the basis of experiments with specific inhibitors of alpha- and beta- like DNA polymerases (aphidicolin, di-deoxy-thymidine) and protein synthesis (cycloheximide) it was assumed that the enhanced UDS in radioresistant population is an partially inducible process in which both DNA polymerases take part. In control population UDS is not inducible and totally inhibited by ddT. Differences in induction and repair of gamma-ray induced SSB between control and radioresistant populations were not registered. In case of chronic alpha-irradiation increased radiosensitivity and slightly decreased UDS were found. In this population and in some populations from Chernobyl vicinity, analyzed in 1986-1991, higher yield of SSB was registered but repair of SSB was not differ from control ones. (authors)

Primary Sjögren syndrome: report of a 10 years old girl with local edema and positivity of anti SS-A and anti SS-B autoantibodies

Directory of Open Access Journals (Sweden)

V. Gerloni

2011-09-01

Full Text Available Sjögren-Larsson syndrome (SLS is an autoimmune disease, uncommon in childhood. We report a case of SLS in a 10-year-old girl with a history of tumor, calor and rubor in the back of her toes almost every month, which resolved in 4-5 days without therapy. She did not complain of dry mouth or dry eyes. The laboratory fi ndings showed high infl ammation markers, rheumatoid factor 128 IU, Waaler-Rose 256 IU, anti nuclear antibody (ANA 1/640, SSA (anti Sjögren antigen A and SSB (anti Sjögren antigen B positive and hypergammaglobulinemia. The Schirmer’s test resulted to be pathologic, the ultrasonography images and biopsy of minor salivary glands revealed focal periductal lymphocytic infi ltrate and sialoduct ectasia class IV of juvenile Sjögren syndrome. The juvenile Sjögren syndrome is frequently under-diagnosed. Clinical manifestations in children might be different from the adult form, although laboratory fi ndings may be similar to those found in adults.

47 CFR 2.202 - Bandwidths.

Science.gov (United States)

2010-10-01

... three numerals and one letter. The letter occupies the position of the decimal point and represents the... quality desired Speech and music, M=4000, Bandwidth: 8000 Hz= 8 kHz 8K00A3E Sound broadcasting, single... desired Speech and music, M=4000, Bandwidth: 4000 Hz= 4 kHz 4K00R3E Sound broadcasting, single-sideband...

The Association between the Availability of Sugar-Sweetened Beverage in School Vending Machines and Its Consumption among Adolescents in California: A Propensity Score Matching Approach

Science.gov (United States)

Shi, Lu

2010-01-01

There is controversy over to what degree banning sugar-sweetened beverage (SSB) sales at schools could decrease the SSB intake. This paper uses the adolescent sample of 2005 California Health Interview Survey to estimate the association between the availability of SSB from school vending machines and the amount of SSB consumption. Propensity score stratification and kernel-based propensity score matching are used to address the selection bias issue in cross-sectional data. Propensity score stratification shows that adolescents who had access to SSB through their school vending machines consumed 0.170 more drinks of SSB than those who did not (P vending machines and the actual SSB consumption, while future studies are needed to explore changes in other beverages after SSB becomes less available. PMID:20976298

The association between the availability of sugar-sweetened beverage in school vending machines and its consumption among adolescents in California: a propensity score matching approach.

Science.gov (United States)

Shi, Lu

2010-01-01

There is controversy over to what degree banning sugar-sweetened beverage (SSB) sales at schools could decrease the SSB intake. This paper uses the adolescent sample of 2005 California Health Interview Survey to estimate the association between the availability of SSB from school vending machines and the amount of SSB consumption. Propensity score stratification and kernel-based propensity score matching are used to address the selection bias issue in cross-sectional data. Propensity score stratification shows that adolescents who had access to SSB through their school vending machines consumed 0.170 more drinks of SSB than those who did not (P vending machines and the actual SSB consumption, while future studies are needed to explore changes in other beverages after SSB becomes less available.

High Speed Wireless Signal Generation and Demodulation

DEFF Research Database (Denmark)

Caballero Jambrina, Antonio; Sambaraju, Rakesh; Zibar, Darko

We present the experimental demonstration of high speed wireless generation, up to 40 Gb/s, in the 75-110 GHz wireless band. All-optical OFDM and photonic up-conversion are used for generation and single side-band modulation with digital coherent detection for demodulation....

A Mixed Methods Analysis of Beverage Choices in Adolescents and Their Parents Using the Theory of Planned Behavior

Science.gov (United States)

Riebl, Shaun K; MacDougall, Carly; Hill, Catelyn; Estabrooks, Paul A; Dunsmore, Julie C; Savla, Jyoti; Frisard, Madlyn I; Dietrich, Andrea M; Davy, Brenda M

2015-01-01

Background Added sugar intake in the form of sugar-sweetened beverages (SSB) has been considered a contributor to weight gain and cardiometabolic dysfunction in adults and youth. Adolescents are some of the highest consumers of added sugars, taking in ~16% of their total calories from added sugars with ~40% of these calories coming from SSB. Youth’s food preferences and self-regulation of dietary intake can be influenced by parents. Objective To evaluate the Theory of Planned Behavior’s (TPB) effectiveness in understanding and predicting adolescents' SSB consumption, identify which constructs are the most important when evaluating SSB consumption in adolescents, and determine if and how adolescents' beverage choices are influenced by parents' reactions to their beverage choices. Design Measurements for this cross-sectional study included four record-assisted 24-hour dietary recalls and responses to a SSB-specific TPB questionnaire from 100 adolescents. Consenting parents completed a beverage intake questionnaire, a TPB questionnaire, and Parent Response to Beverage Choice Questionnaire. Results The TPB explained 34% of the variance in adolescents' and parents' intention to limit SSB to less than one cup per day. Parents' perceived behavioral control (b=1.35, p=0.002) and adolescents' subjective norms (b=0.57, p=0.001) were the strongest predictors of intention, and intention was the strongest predictor of SSB consumption in both adolescents and parents (b=−37, p=0.026, b=−49, p=0.003). The TPB explained more variance in parent SSB consumption (R2=0.38) than adolescents (R2=0.22). Parents did more discouraging of SSB and encouraging of non-SSB. Adolescents' intention to limit SSB moderated the relationship between parents' reactions encouraging SSB and adolescents' predicted SSB consumption (p=0.021). Conclusions The TPB explained a small, but significant amount of variance in adolescents' SSB consumption. When addressing adolescent SSB intake, people in

Effect of phonon-bath dimensionality on the spectral tuning of single-photon emitters in the Purcell regime

Science.gov (United States)

Chassagneux, Yannick; Jeantet, Adrien; Claude, Théo; Voisin, Christophe

2018-05-01

We develop a theoretical frame to investigate the spectral dependence of the brightness of a single-photon source made of a solid-state nanoemitter embedded in a high-quality factor microcavity. This study encompasses the cases of localized excitons embedded in a one-, two-, or three-dimensional matrix. The population evolution is calculated based on a spin-boson model, using the noninteracting blip approximation. We find that the spectral dependence of the single-photon source brightness (hereafter called spectral efficiency) can be expressed analytically through the free-space emission and absorption spectra of the emitter, the vacuum Rabi splitting, and the loss rates of the system. In other words, the free-space spectrum of the emitter encodes all the relevant information on the interaction between the exciton and the phonon bath to obtain the dynamics of the cavity-coupled system. We compute numerically the spectral efficiency for several types of localized emitters differing by the phonon bath dimensionality. In particular, in low-dimensional systems where this interaction is enhanced, a pronounced asymmetric energy exchange between the emitter and the cavity on the phonon sidebands yields a considerable extension of the tuning range of the source through phonon-assisted cavity feeding, possibly surpassing that of a purely resonant system.

An Optomechanical Elevator: Transport of a Bloch Oscillating Bose–Einstein Condensate up and down an Optical Lattice by Cavity Sideband Amplification and Cooling

Directory of Open Access Journals (Sweden)

B. Prasanna Venkatesh

2015-12-01

Full Text Available In this paper we give a new description, in terms of optomechanics, of previous work on the problem of an atomic Bose–Einstein condensate interacting with the optical lattice inside a laser-pumped optical cavity and subject to a bias force, such as gravity. An atomic wave packet in a tilted lattice undergoes Bloch oscillations; in a high-finesse optical cavity the backaction of the atoms on the light leads to a time-dependent modulation of the intracavity lattice depth at the Bloch frequency which can in turn transport the atoms up or down the lattice. In the optomechanical picture, the transport dynamics can be interpreted as a manifestation of dynamical backaction-induced sideband damping/amplification of the Bloch oscillator. Depending on the sign of the pump-cavity detuning, atoms are transported either with or against the bias force accompanied by an up- or down-conversion of the frequency of the pump laser light. We also evaluate the prospects for using the optomechanical Bloch oscillator to make continuous measurements of forces by reading out the Bloch frequency. In this context, we establish the significant result that the optical spring effect is absent and the Bloch frequency is not modified by the backaction.

Decreased DNA repair capacity in familial, but not in sporadic Alzheimer's disease

NARCIS (Netherlands)

M.E.T.I. Boerrigter; C.M. van Duijn (Cornelia); E. Mullaart; P. Eikelenboom (Piet); C.M.A. van der Togt; D.L. Knook; J. Vijg (Jan); A. Hofman (Albert)

1991-01-01

textabstractUsing the alkaline filter elution technique we determined the induction and disappearance of DNA single-strand breaks (SSB) in freshly isolated peripheral blood lymphocytes (PBL) from 43 Alzheimer's disease (AD) patients and 48 normal, healthy age- and sex-matched control subjects

The overexpression of insect endogenous small RNAs in transgenic rice inhibits growth and delays pupation of striped stem borer (Chilo suppressalis).

Science.gov (United States)

Jiang, Shan; Wu, Hao; Liu, Haoju; Zheng, Jie; Lin, Yongjun; Chen, Hao

2017-07-01

The striped stem borer (SSB), Chilo suppressalis Walker, is a major rice insect pest worldwide. RNA interference (RNAi) has become a promising strategy for developing insect-resistant crops. In a previous study, five double-stranded RNAs (dsRNAs) targeting important SSB housekeeping genes were overexpressed in rice, but none of the acquired dsRNA-transgenic rice plants showed significant effects on SSB. Thirteen selected SSB endogenous small RNAs, predicted as SSB novel microRNAs (miRNAs), were overexpressed in rice using artificial miRNA (amiRNA) expression technology. Feeding tests showed that two out of 13 selected SSB novel miRNAs caused significant growth inhibition for feeding SSB larvae based on transgenic rice expression. Pupation was delayed 4 days when SSB larvae consecutively fed on transgenic rice expressing the SSB novel miRNA candidate csu-novel-miR15 (csu-15 rice). Gene expression analysis confirmed that the expression levels of at least six SSB unigenes significantly changed (i.e., were up- or down-regulated) after feeding on csu-15 rice. Our research demonstrated a novel RNAi strategy using SSB endogenous small RNAs to develop RNAi crops for pest management; this strategy is different from the common RNAi resulting from transgenic dsRNAs or amiRNAs targeting certain insect endogenous genes. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Cavity QED with single trapped Ca+-ions

International Nuclear Information System (INIS)

Mundt, A.B.

2003-02-01

This thesis reports on the design and setup of a vacuum apparatus allowing the investigation of cavity QED effects with single trapped 40 Ca + ions. The weak coupling of ion and cavity in the 'bad cavity limit' may serve to inter--convert stationary and flying qubits. The ion is confined in a miniaturized Paul trap and cooled via the Doppler effect to the Lamb--Dicke regime. The extent of the atomic wave function is less than 30 nm. The ion is enclosed by a high finesse optical cavity. The technically--involved apparatus allows movement of the trap relative to the cavity and the trapped ion can be placed at any position in the standing wave. By means of a transfer lock the cavity can be resonantly stabilized with the S 1/2 ↔ D 5/2 quadrupole transition at 729 nm (suitable as a qubit) without light at that wavelength being present in the cavity. The coupling of the cavity field to the S 1/2 ↔ D 5/2 quadrupole transition is investigated with various techniques in order to determine the spatial dependence as well as the temporal dynamics. The orthogonal coupling of carrier and first--order sideband transitions at field nodes and antinodes is explored. The coherent interaction of the ion and the cavity field is confirmed by exciting Rabi oscillations with short resonant pulses injected into the cavity. Finally, first experimental steps towards the observation of cavity enhanced spontaneous emission have been taken. (author)

Photonic integrated single-sideband modulator / frequency shifter based on surface acoustic waves

DEFF Research Database (Denmark)

Barretto, Elaine Cristina Saraiva; Hvam, Jørn Märcher

2010-01-01

Optical frequency shifters are essential components of many systems. In this paper, a compact integrated optical frequency shifter is designed making use of the combination of surface acoustic waves and Mach-Zehnder interferometers. It has a very simple operation setup and can be fabricated...

Development of viable solutions for the synthesis of sulfur bearing single crystals

Science.gov (United States)

Lin, Xiao; Bud'ko, Sergey L.; Canfield, Paul C.

2012-07-01

The discovery of high temperature superconductivity in FeAs and FeSe based compounds has once again focused the condensed matter community on the need to systematically explore compounds containing chalcogens and pnictogens. Whereas some solution growth techniques have been developed to handle P and As, and Sb and Bi are versatile solvents in their own right, S has remained a problematic element to incorporate into conventional solution growth. To a large extent its low boiling point, combined with its polymeric nature in a molten state have made S an uninviting solvent. In this paper we present our development of a range of binary sulfur bearing solutions (some even sulfur rich) and demonstrate how we have been able to use these as useful starting points for the growth of a wide range of transition metal-sulfur-X ternary compounds. We present growth details and basic characterization data for Ni3Bi2S2, Co3Sn2S2, Fe2GeS4, CoSSb, and CePd3S4. In addition we present a remarkably simple method for the growth of single crystalline Co with crystallization taking place below the Curie temperature.

The impact of a local sugar sweetened beverage health promotion and price increase on sales in public leisure centre facilities.

Science.gov (United States)

Breeze, Penny; Womack, Robert; Pryce, Robert; Brennan, Alan; Goyder, Elizabeth

2018-01-01

We aimed to evaluate the impact of a local sugar sweetened beverages (SSB) health promotion and 20p price increase in leisure centre venues and estimate the impact on consumption. Monthly cold drinks sales data and attendance at leisure centres across the city of Sheffield were analysed over the period January 2015-July 2017. Interrupted time-series methods were employed to estimate changes in consumption per attendance of SSB and non-SSB cold drinks following the introduction of the SSB policy from August 2016 adjusting for seasonal variation and autocorrelation. SSB price elasticities were estimated with fixed effects log-log models by SSB product type (soda can, soda bottle, soda post mix, energy drinks, juice from concentrate). We estimated a 31% (95% CI 4%, 59%) reduction in units of SSB sold per attendance in the year since the policy was introduced. We did not observe substitution effects to fruit juice or water but found sales of other artificially sweetened non-SSB products increased by 27% (95% CI 6%, 47%) after the introduction of the tax. Price elasticity analysis identified that a 1% increase in price alongside health promotion leads to a 3.8% (95% CI 3.1% 4.4%) decrease in demand for SSB's. Price elasticity of demand was highest for child friendly and high caffeine energy drinks. Demand for SSB drinks at leisure centre venues is highly responsive to the policy, particularly for child-friendly and high caffeine energy drinks, compared with other SSB tax policy evaluations. The policy also increased purchases of carbonated non-SSB.

Effects of Glycosylation on Biodistribution and Imaging Quality of Necrotic Myocardium of Iodine-131-Labeled Sennidins.

Science.gov (United States)

Li, Ling; Zhang, Dongjian; Yang, Shengwei; Song, Shaoli; Li, Jindian; Wang, Qin; Wang, Cong; Feng, Yuanbo; Ni, Yicheng; Zhang, Jian; Liu, Wei; Yin, Zhiqi

2016-12-01

Sennidins are necrosis-avid agents for noninvasive assessment of myocardial viability which is important for patients with myocardial infarction (MI). However, high accumulation of radioactivity in the liver interferes with the assessment of myocardial viability. In this study, we compared sennidins with sennosides to investigate the effects of glycosylation on biodistribution and imaging quality of sennidins. Sennidin A (SA), sennidin B (SB), sennoside A (SSA), and sennoside B (SSB) were labeled with I-131. In vitro binding to necrotic cells and hepatic cells and in vivo biodistribution in rats with muscular necrosis were evaluated by gamma counting, autoradiography, and histopathology. Single photon emission computed tomography/computed tomography (SPECT/CT) images were acquired in rats with acute MI. The uptake of [ 131 I]SA, [ 131 I]SSA, [ 131 I]SB, and [ 131 I]SSB in necrotic cells was significantly higher than that in viable cells (p sennosides than those with [ 131 I]sennidins (p < 0.01). Autoradiography showed preferential accumulation of these four radiotracers in necrotic areas of muscle, confirmed by histopathology. SPECT/CT imaging studies showed better image quality with [ 131 I]SSB than with [ 131 I]SB due to less liver interference. Glycosylation significantly decreased the liver uptake and improved the quality of cardiac imaging. [ 131 I]SSB may serve as a promising necrosis-avid agent for noninvasive assessment of myocardial viability.

A synchronous serial bus for multidimensional array acoustic logging tool

Science.gov (United States)

Men, Baiyong; Ju, Xiaodong; Lu, Junqiang; Qiao, Wenxiao

2016-12-01

In high-temperature and spatial borehole applications, a distributed structure is employed in a multidimensional array acoustic logging tool (MDALT) based on a phased array technique for electronic systems. However, new challenges, such as synchronous multichannel data acquisition, multinode real-time control and bulk data transmission in a limited interval, have emerged. To address these challenges, we developed a synchronous serial bus (SSB) in this study. SSB works in a half-duplex mode via a master-slave architecture. It also consists of a single master, several slaves, a differential clock line and a differential data line. The clock line is simplex, whereas the data line is half-duplex and synchronous to the clock line. A reliable communication between the master and the slaves with real-time adjustment of synchronisation is achieved by rationally designing the frame format and protocol of communication and by introducing a scramble code and a Hamming error-correcting code. The control logic of the master and the slaves is realized in field programmable gate array (FPGA) or complex programmable logic device (CPLD). The clock speed of SSB is 10 MHz, the effective data rate of the bulk data transmission is over 99%, and the synchronous errors amongst the slaves are less than 10 ns. Room-temperature test, high-temperature test (175 °C) and field test demonstrate that the proposed SSB is qualified for MDALT.

A Case Study of the Philadelphia Sugar-Sweetened Beverage Tax Policymaking Process: Implications for Policy Development and Advocacy.

Science.gov (United States)

Purtle, Jonathan; Langellier, Brent; Lê-Scherban, Félice

Policymakers are increasingly proposing sugar-sweetened beverage (SSB) taxes as an evidence-based strategy to reduce chronic disease risk; and local health departments (LHDs) are well-positioned to play a role in SSB policy development and advocacy. However, most SSB tax proposals fail to become law and limited empiric guidance exists to inform advocacy efforts. In June 2016, Philadelphia, Pennsylvania, passed an SSB tax. To identify features of the Philadelphia SSB tax policymaking process that contributed to the proposal's passage. Qualitative case study. Semistructured interviews were conducted with key informants closely involved with the policymaking process. Interviews were audio-recorded and transcribed. Local news media about the SSB tax proposal were analyzed to triangulate interview findings. Analysis was conducted in NVivo 10 using inductive qualitative content analysis. Philadelphia, Pennsylvania, during the SSB tax policymaking in process. Nine key informants (2 city councilpersons, 4 city agency officials, 1 community-based advocate, 1 news reporter, and 1 researcher). The Philadelphia SSB tax proposal was introduced with the explicit goal of financing universal prekindergarten and deliberately not framed as a health intervention. This framing shifted contentious debates about government involvement in individual behavior toward discussions about how to finance universal prekindergarten, a goal for which broad support existed. The LHD played an important role in communicating research evidence about potential health benefits of the SSB tax proposal at the end of the policymaking process. During local SSB tax policy development processes, LHD officials and other advocates should encourage policymakers to design SSB tax policies so that revenue is directed toward community investments for which broad public support exists. When communicating with policymakers and the public, LHDs should consider emphasizing how SSB tax revenue will be used in addition

Quantitative proteomics and network analysis of SSA1 and SSB1 deletion mutants reveals robustness of chaperone HSP70 network in Saccharomyces cerevisiae.

Science.gov (United States)

Jarnuczak, Andrew F; Eyers, Claire E; Schwartz, Jean-Marc; Grant, Christopher M; Hubbard, Simon J

2015-09-01

Molecular chaperones play an important role in protein homeostasis and the cellular response to stress. In particular, the HSP70 chaperones in yeast mediate a large volume of protein folding through transient associations with their substrates. This chaperone interaction network can be disturbed by various perturbations, such as environmental stress or a gene deletion. Here, we consider deletions of two major chaperone proteins, SSA1 and SSB1, from the chaperone network in Sacchromyces cerevisiae. We employ a SILAC-based approach to examine changes in global and local protein abundance and rationalise our results via network analysis and graph theoretical approaches. Although the deletions result in an overall increase in intracellular protein content, correlated with an increase in cell size, this is not matched by substantial changes in individual protein concentrations. Despite the phenotypic robustness to deletion of these major hub proteins, it cannot be simply explained by the presence of paralogues. Instead, network analysis and a theoretical consideration of folding workload suggest that the robustness to perturbation is a product of the overall network structure. This highlights how quantitative proteomics and systems modelling can be used to rationalise emergent network properties, and how the HSP70 system can accommodate the loss of major hubs. © 2015 The Authors. PROTEOMICS published by Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Decreased DNA repair capacity in familial, but not in sporadic Alzheimer's disease

NARCIS (Netherlands)

Boerrigter, M. E.; van Duijn, C. M.; Mullaart, E.; Eikelenboom, P.; van der Togt, C. M.; Knook, D. L.; Hofman, A.; Vijg, J.

1991-01-01

Using the alkaline filter elution technique we determined the induction and disappearance of DNA single-strand breaks (SSB) in freshly isolated peripheral blood lymphocytes (PBL) from 43 Alzheimer's disease (AD) patients and 48 normal, healthy age- and sex-matched control subjects following in vitro

The school environment and sugar-sweetened beverage consumption among Guatemalan adolescents.

Science.gov (United States)

Godin, Katelyn M; Chacón, Violeta; Barnoya, Joaquin; Leatherdale, Scott T

2017-11-01

The current study sought to examine Guatemalan adolescents' consumption of sugar-sweetened beverages (SSB), identify which individual-level characteristics are associated with SSB consumption and describe school characteristics that may influence students' SSB consumption. Within this observational pilot study, a questionnaire was used to assess students' consumption of three varieties of SSB (soft drinks, energy drinks, sweetened coffees/teas), as well as a variety of sociodemographic and behavioural characteristics. We collected built environment data to examine aspects of the school food environment. We developed Poisson regression models for each SSB variety and used descriptive analyses to characterize the sample. Guatemala City, Guatemala. Guatemalan adolescents (n 1042) from four (two public, two private) secondary schools. Built environment data revealed that students from the two public schools lacked access to water fountains/coolers. The SSB industry had a presence in the schools through advertisements, sponsored food kiosks and products available for sale. Common correlates of SSB consumption included school type, sedentary behaviour, frequency of purchasing lunch in the cafeteria, and frequency of purchasing snacks from vending machines in school and off school property. Guatemalan adolescents frequently consume SSB, which may be encouraged by aspects of the school environment. Schools represent a viable setting for equitable population health interventions designed to reduce SSB consumption, including increasing access to clean drinking-water, reducing access to SSB, restricting SSB marketing and greater enforcement of existing food policies.

Exploring perceptions of the Mexican sugar-sweetened beverage tax among adolescents in north-west Mexico: a qualitative study.

Science.gov (United States)

Ortega-Avila, Ana G; Papadaki, Angeliki; Jago, Russell

2018-02-01

To explore awareness and perceptions of the sugar-sweetened beverage (SSB) tax implemented in Mexico in 2014 among a sample of Mexican adolescents, and to investigate how the tax has affected their purchases and intake of SSB. Qualitative. Semi-structured interviews were conducted in April-May 2016. The data were analysed using thematic analysis. Adolescents residing in north-west Mexico (n 29, 55·2 % females), aged 15-19 years. Four main themes emerged: awareness of taxation; perceptions of how the tax has affected SSB intake; reasons why the tax was not perceived to have affected SSB intake; and preferences for substitution of the taxed SSB. Participants were mostly unaware of the tax and perceived that it would not cause reductions in their intake of SSB; they felt that the price increase was low and insufficient to affect intake. Taste preferences and 'addiction' to SSB were highlighted as the main reasons why participants perceived taxation would not affect intake. If SSB prices were to increase further via a higher tax, participants would consider substituting SSB with other beverages, namely home-made drinks (e.g. 100 % fruit juices), non-caloric, instant-flavoured drinks and water. These findings provide important insights into the views of this sample of Mexican adolescents regarding the taxation of SSB, by pointing out several possible limitations of the tax policy in Mexico. These results could inform the design of future interventions directed at Mexican youth that would complement and strengthen the current SSB taxation.

(Pheo)melanin photosensitizes UVA-induced DNA damage in cultured human melanocytes

NARCIS (Netherlands)

Wenczl, E.; Schans, G.P. van der; Roza, L.; Kolb, R.M.; Timmerman, A.J.; Smit, N.P.M.; Pavel, S.; Schothorst, A.A.

1998-01-01

The question of whether melanins are photoprotecting and/or photosensitizing in human skin cells continues to be debated. To evaluate the role of melanin upon UVA irradiation, DNA single-strand breaks (ssb) were measured in human melanocytes differing only in the amount of pigment produced by

Sugar sweetened beverage consumption by Australian children: Implications for public health strategy

Directory of Open Access Journals (Sweden)

Hafekost Katherine

2011-12-01

Full Text Available Abstract Background High consumption of sugar sweetened beverages (SSBs has been linked to unhealthy weight gain and nutrition related chronic disease. Intake of SSB among children remains high in spite of public health efforts to reduce consumption, including restrictions on marketing to children and limitations on the sale of these products in many schools. Much extant literature on Australian SSB consumption is out-dated and lacks information on several key issues. We sought to address this using a contemporary Australian dataset to examine purchase source, consumption pattern, dietary factors, and demographic profile of SSB consumption in children. Methods Data were from the 2007 Australian National Children's Nutrition and Physical Activity Survey, a representative random sample of 4,834 Australian children aged 2-16 years. Mean SSB intake by type, location and source was calculated and logistic regression models were fitted to determine factors associated with different levels of consumption. Results SSB consumption was high and age-associated differences in patterns of consumption were evident. Over 77% of SSB consumed was purchased via supermarkets and 60% of all SSB was consumed in the home environment. Less than 17% of SSB was sourced from school canteens and fast food establishments. Children whose parents had lower levels of education consumed more SSB on average, while children whose parents had higher education levels were more likely to favour sweetened juices and flavoured milks. Conclusions SSB intake by Australian children remains high and warrants continued public health attention. Evidence based and age-targeted interventions, which also recognise supermarkets as the primary source of SSB, are recommended to reduce SSB consumption among children. Additionally, education of parents and children regarding the health consequences of high consumption of both carbonated and non-carbonated SSBs is required.

Sugar sweetened beverage consumption by Australian children: implications for public health strategy.

Science.gov (United States)

Hafekost, Katherine; Mitrou, Francis; Lawrence, David; Zubrick, Stephen R

2011-12-22

High consumption of sugar sweetened beverages (SSBs) has been linked to unhealthy weight gain and nutrition related chronic disease. Intake of SSB among children remains high in spite of public health efforts to reduce consumption, including restrictions on marketing to children and limitations on the sale of these products in many schools. Much extant literature on Australian SSB consumption is out-dated and lacks information on several key issues. We sought to address this using a contemporary Australian dataset to examine purchase source, consumption pattern, dietary factors, and demographic profile of SSB consumption in children. Data were from the 2007 Australian National Children's Nutrition and Physical Activity Survey, a representative random sample of 4,834 Australian children aged 2-16 years. Mean SSB intake by type, location and source was calculated and logistic regression models were fitted to determine factors associated with different levels of consumption. SSB consumption was high and age-associated differences in patterns of consumption were evident. Over 77% of SSB consumed was purchased via supermarkets and 60% of all SSB was consumed in the home environment. Less than 17% of SSB was sourced from school canteens and fast food establishments. Children whose parents had lower levels of education consumed more SSB on average, while children whose parents had higher education levels were more likely to favour sweetened juices and flavoured milks. SSB intake by Australian children remains high and warrants continued public health attention. Evidence based and age-targeted interventions, which also recognise supermarkets as the primary source of SSB, are recommended to reduce SSB consumption among children. Additionally, education of parents and children regarding the health consequences of high consumption of both carbonated and non-carbonated SSBs is required.

[Study on the relations among the screen-based sedentary behaviors, family factors and body mass index of children].

Science.gov (United States)

Wei, Dong-mei; Wu, Li-jing; Gao, Ai-yu; Li, Qin; Cheng, Lan; Wang, Hai-jun

2015-06-18

To explore the relations among screen-based sedentary behaviors (SSB), family factors and body mass index (BMI) of children, and to study how family factors have effect on BMI through influencing SSB. A total of 1,846 students aged 7-11 years from 12 primary schools in one district of Beijing were included. Their body weight and height were measured to calculate the BMI. The time of SSB and family factors were investigated by using questionnaires. The time of SSB was the total time of watching TV and videos, playing computer games and iPad each day during the past 7 days recalled by children. The family factors included the parents' education, occupation, the parents'time of SSB, whether the parents told their child the harm of SSB, the parents'time limit for the children's SSB. The parents'education and occupation were used for calculating the family socioeconomic score. The median time of SSB for children was 1 hour/day, and the interquartile range was 1 hour/day. The BMI of the children with the parents' time limit for the children's SSB less than 120 min/day were smaller than the children with the parents'time limit not less than 120 min/day, in both the boys (1.63 kg/m2, Peffects of SSB time for children on the association between the parents'time limit for the children's SSB and BMI were -0.222 kg/m2 (95%CI:-0.432, -0.095) for boys and -0.187 kg/m2 (95%CI: -0.507, -0.049) for girls, which accounted for 13.67% of the total effects for boys and 22.11% for girls. The parents' time limit for the children's SSB has effect on their BMI through influencing their SSB time. Parents' supervision on the behaviors of children produces larger benefit for BMI than health education conveyed by parents. Therefore, parents' participation in supervising the behaviors of children are indispensable for preventing and controlling childhood obesity.

New Service Status Board

CERN Multimedia

2013-01-01

On Monday 14 October, the Service Status Board for GS and IT will change. The new Status Board will be integrated with the CERN Service Portal and with the CERN Service Catalogue.   As of today, the SSB will display “Service Incidents”, “Planned Interventions” and “Service Changes”. References valid from 14 October: CERN SSB at https://cern.ch/ssb Computing SSB (previously IT SSB) at https://cern.ch/itssb   Nicole Cremel, IT and GS Service Management Support

Young adults' responses to alternative messages describing a sugar-sweetened beverage price increase.

Science.gov (United States)

Gollust, Sarah E; Tang, Xuyang; White, James M; French, Simone A; Runge, Carlisle Ford; Rothman, Alexander J

2017-01-01

Many jurisdictions in the USA and globally are considering raising the prices of sugar-sweetened beverages (SSB) through taxes as a strategy to reduce their consumption. The objective of the present study was to identify whether the rationale provided for an SSB price increase affects young adults' behavioural intentions and attitudes towards SSB. Participants were randomly assigned to receive one of eight SSB price increase rationales. Intentions to purchase SSB and attitudes about the product and policy were measured. A forty-six-item cross-sectional Internet survey. Undergraduate students (n 494) at a large US Midwestern university. Rationale type was significantly associated with differences in participants' purchasing intentions for the full sample (F 7,485=2·53, P=0·014). Presenting the rationale for an SSB price increase as a user fee, an effort to reduce obesity, a strategy to offset health-care costs or to protect children led to lower SSB purchasing intentions compared with a message with no rationale. Rationale type was also significantly associated with differences in perceptions of soda companies (F 7,485=2·10, P=0·043); among low consumers of SSB, messages describing the price increase as a user fee or tax led to more negative perceptions of soda companies. The rationale attached to an SSB price increase could influence consumers. However, these message effects may depend on individuals' level of SSB consumption.

Support for Food and Beverage Worksite Wellness Strategies and Sugar-Sweetened Beverage Intake Among Employed U.S. Adults.

Science.gov (United States)

Lee-Kwan, Seung Hee; Pan, Liping; Kimmons, Joel; Foltz, Jennifer; Park, Sohyun

2017-03-01

Sugar-sweetened beverage (SSB) consumption is high among U.S. adults and is associated with obesity. Given that more than 100 million Americans consume food or beverages at work daily, the worksite may be a venue for interventions to reduce SSB consumption. However, the level of support for these interventions is unknown. We examined associations between workday SSB intake and employees' support for worksite wellness strategies (WWSs). We conducted a cross-sectional study using data from Web-based annual surveys that gather information on health-related attitudes and behaviors. Study setting was the United States. A total of 1924 employed adults (≥18 years) selected using probability-based sampling. The self-reported independent variable was workday SSB intake (0, food/drink, (3) available healthy options, and (4) less available SSB. Multivariable logistic regression was used to control for sociodemographic variables, employee size, and availability of cafeteria/vending machine. About half of employees supported accessible free water (54%), affordable healthy food/drink (49%), and available healthy options (46%), but only 28% supported less available SSB. Compared with non-SSB consumers, daily SSB consumers were significantly less supportive of accessible free water (adjusted odds ratio, .67; p < .05) or less available SSB (odds ratio, .49; p < .05). Almost half of employees supported increasing healthy options within worksites, although daily workday SSB consumers were less supportive of certain strategies. Lack of support could be a potential barrier to the successful implementation of certain worksite interventions.

Strain cupling of a nitrogen-vacancy center spin to a diamond mechanical oscillator

OpenAIRE

Teissier, J.; Barfuss, A.; Appel, P.; Neu, E.; Maletinsky, P.

2014-01-01

We report on single electronic spins coupled to the motion of mechanical resonators by a novel mechanism based on crystal strain. Our device consists of single-crystal diamond cantilevers with embedded nitrogen-vacancy center spins. Using optically detected electron spin resonance, we determine the unknown spin-strain coupling constants and demonstrate that our system resides well within the resolved sideband regime. We realize coupling strengths exceeding 10 MHz under mechanical driving and ...

Genetic and biochemical identification of a novel single-stranded DNA binding complex in Haloferax volcanii

Directory of Open Access Journals (Sweden)

Amy eStroud

2012-06-01

Full Text Available Single-stranded DNA binding proteins play an essential role in DNA replication and repair. They use oligosaccharide-binding folds, a five-stranded ß-sheet coiled into a closed barrel, to bind to single-stranded DNA thereby protecting and stabilizing the DNA. In eukaryotes the single-stranded DNA binding protein is known as replication protein A (RPA and consists of three distinct subunits that function as a heterotrimer. The bacterial homolog is termed single-stranded DNA-binding protein (SSB and functions as a homotetramer. In the archaeon Haloferax volcanii there are three genes encoding homologs of RPA. Two of the rpa genes (rpa1 and rpa3 exist in operons with a novel gene specific to Euryarchaeota, this gene encodes a protein that we have termed rpa-associated protein (RPAP. The rpap genes encode proteins belonging to COG3390 group and feature oligosaccharide-binding folds, suggesting that they might cooperate with RPA in binding to single-stranded DNA. Our genetic analysis showed that rpa1 and rpa3 deletion mutants have differing phenotypes; only ∆rpa3 strains are hypersensitive to DNA damaging agents. Deletion of the rpa3-associated gene rpap3 led to similar levels of DNA damage sensitivity, as did deletion of the rpa3 operon, suggesting that RPA3 and RPAP3 function in the same pathway. Protein pull-downs involving recombinant hexahistidine-tagged RPAs showed that RPA3 co-purifies with RPAP3, and RPA1 co-purifies with RPAP1. This indicates that the RPAs interact only with their respective associated proteins; this was corroborated by the inability to construct rpa1 rpap3 and rpa3 rpap1 double mutants. This is the first report investigating the individual function of the archaeal COG3390 RPA-associated proteins. We have shown genetically and biochemically that the RPAPs interact with their respective RPAs, and have uncovered a novel single-stranded DNA binding complex that is unique to Euryarchaeota.

Dissipative optomechanics in a Michelson-Sagnac interferometer.

Science.gov (United States)

Xuereb, André; Schnabel, Roman; Hammerer, Klemens

2011-11-18

Dissipative optomechanics studies the coupling of the motion of an optical element to the decay rate of a cavity. We propose and theoretically explore a realization of this system in the optical domain, using a combined Michelson-Sagnac interferometer, which enables a strong and tunable dissipative coupling. Quantum interference in such a setup results in the suppression of the lower motional sideband, leading to strongly enhanced cooling in the non-sideband-resolved regime. With state-of-the-art parameters, ground-state cooling and low-power quantum-limited position transduction are both possible. The possibility of a strong, tunable dissipative coupling opens up a new route towards observation of such fundamental optomechanical effects as nonlinear dynamics. Beyond optomechanics, the suggested method can be readily transferred to other setups involving nonlinear media, atomic ensembles, or single atoms.

Dietary experience modifies horses' feeding behavior and selection patterns of three macronutrient rich diets.

Science.gov (United States)

Redgate, S E; Cooper, J J; Hall, S; Eady, P; Harris, P A

2014-04-01

Choice feeding is often used to investigate an animal's nutritional requirements and dietary preferences. A problem with this approach is that animals with long gut transit times, such as the horse, may find it difficult to associate a chosen food with its nutritional consequence when alternative foods are presented simultaneously. One solution is to present foods singly for a period of time before a simultaneous choice session to allow the development of learned associations. This method was used to determine if horse's voluntary intake and feeding behavior was influenced by the macronutrient composition of the diet. Seven stabled horses, maintained on a low intensity exercise regimen, were allowed, on an ad libitum basis, haylage and 3 isocaloric forage based diets that were rich in 1 of 3 macronutrients (protein, lipid, and hydrolyzable carbohydrate). Initially, diets were presented as a 3-way choice for 5 d (self-selection a [SSa]), then singly (monadic phase) with exposure to each diet for 2 separate periods of 3 d each, and finally again as a choice for 5 d (self-selection b [SSb]). The total amount of trial diet offered differed with trial phase, with 2 to 2.5% of BW during SSa and the monadic phase, increasing to ad libitum access during SSb. To control differences in the total amount of trial diet offered, 2 measurements of voluntary intake were taken at 4 and 22 h postpresentation. Daily macronutrient and energy intakes were estimated from proximate analysis of the trial diets and batches of haylage fed. Feeding behavior was observed over a single 4-h period during both self-selection phases. Horses showed no initial preference after 4 h for any 1 diet during SSa. Following the monadic phase, horses demonstrated a preference for the protein and hydrolyzable carbohydrate rich diets over the lipid rich diet (P < 0.001). Dietary experience modified foraging behavior as the total number of visits to the diets decreased during SSb (P < 0.005). Analysis of 24

Permanent tooth loss and sugar-sweetened beverage intake in U.S. young adults.

Science.gov (United States)

Kim, Sunkyung; Park, Sohyun; Lin, Mei

2017-03-01

In young adults, sugar-sweetened beverage (SSB) intake is associated with dental caries, which in turn is a major contributor to tooth loss. The independent role of SSB intake on tooth loss, however, has not been well-described. This cross-sectional study examined associations between tooth loss and SSB intake among U.S. young adults. The outcome was number of permanent teeth lost because of dental caries or periodontal disease (0, 1-5, ≥6 teeth). Data from the 2012 Behavioral Risk Factor Surveillance System were used. The 22,526 adults aged 18-39 years completed the Sugar Drink Module. The exposure variable was daily frequency of SSB intake. We used multinomial logistic regression to examine the adjusted associations between tooth loss and daily SSB consumption (0, >0 to 2 times/day). Approximately, 26% of young adults reported losing at least one permanent tooth. Tooth loss was positively associated with SSB intake frequency; the odds of losing 1-5 teeth were higher among adults drinking SSBs >0-2 times/day (OR = 1.97, 95%CI = 1.51-2.58) than non-SSB consumers. The odds of losing ≥6 teeth were higher among adults drinking SSBs 1-2 times/day (OR = 2.20, 95%CI = 1.15-4.22) and >2 times/day (OR = 2.81, 95%CI = 1.37-5.76) than non-SSB consumers. Frequency of SSB consumption was positively associated with tooth loss among young adults even when the average SSB intake was less than one time per day. This study suggests that efforts to reduce SSB intake among young adults may help to decrease the risk of tooth loss. © 2016 American Association of Public Health Dentistry.

Development of strong-sense validation benchmarks for the fluoride salt-cooled high-temperature reactor

International Nuclear Information System (INIS)

Blandford, E. D.

2012-01-01

The Fluoride salt-cooled High-temperature Reactor (FHR) is a class of reactor concepts currently under development for the U. S. Dept. of Energy. The FHR is defined as a Generation IV reactor that features low-pressure liquid fluoride salt cooling, coated-particle fuel, a high-temperature power cycle, and fully passive decay heat rejection. Recent experimental work using simulant fluids have been performed to demonstrate key 'proof of principle' FHR concepts and have helped inform the reactor design process. An important element of developing FHR technology is to sufficiently validate the predictive accuracy of the computer codes used to model system response. This paper presents a set of thermal-hydraulics experiments, defined as Strong-Sense Benchmarks (SSB's), which will help establish the FHR validation domain for simulant fluid suitability. These SSB's are more specifically designed to investigate single-phase natural circulation which is the dominant mode of FHR decay heat removal during off-normal conditions. SSB s should be viewed as engineering reference standards and differ from traditional confirmatory experiments in the sense that they are more focused on fundamental physics as opposed to reproducing high levels of physical similarity with the prototypical design. (authors)

Glutathione requirement for the rejoining of radiation-induced DNA breaks in misonidazole-treated cells

International Nuclear Information System (INIS)

Edgren, M.; Revesz, L.

1985-01-01

The role of glutathione (GSH) in the rejoining of radiation-induced single-strand DNA breaks (ssb) was studied in human fibroblast cultures sensitized to radiation by a 30 min treatment with 1 mM misonidazole (MISO). Hypoxically irradiated cells, deficient in GSH, either inherently, or due to a 16 h incubation with 1 mM buthionine sulphoximine (BSO), rejoined the breaks after MISO treatment at a lower rate and to a lesser extent than did GSH-proficient cells. Without MISO treatment, the hypoxically induced ssb were rejoined in the GSH-deficient cells as effectively as in the proficient cells. It is concluded that a large proportion of the breaks which arise after hypoxic irradiation in the presence of MISO are of a different type to those which arise in the absence of the drug, and require a particular GSH-dependent, enzymatic repair system. This requirement for rejoining in hypoxically irradiated, MISO-treated cells is similar to that seen earlier in MISO-untreated, oxically irradiated cells, and suggests that the ssb induced by radiation in the presence of MISO or oxygen are of a similar nature. (author)

The effect of 2-[(aminopropyl)amino] ethanethiol (WR 1065) on radiation-induced DNA damage and repair and cell progression in V79 cells

International Nuclear Information System (INIS)

Grdina, D.J.; Nagy, B.

1986-01-01

The radioprotector 2-[(aminopropyl)amino] ethanethiol (WR 1065) was investigated with respect to its ability to affect radiation-induced DNA damage and repair in V79 cells. At a concentration of 4mM, WR 1065 protected against the formation of single strand breaks (SSB), when present during irradiation. The protector appeared, however, to inhibit the subsequent postirradiation repair or rejoining of SSB. While repair was complete within 24h, the protector reduced the rate of repair by a factor of 3. This inhibitory effect on the rate of repair did not correlate with either measured differences in cell survival or mutagenesis. WR 1065 present in the growth medium inhibited the progression of cells through S-phase, and cell-doubling time following a 3h exposure to the protector was increased from 11 to 18h. These data are consistent with the property of thiols to inhibit DNA polymerase activity. It was concluded that, while the presence of WR 1065 during irradiation reduced SSB-DNA damage, its effect on the subsequent rejoining of these breaks could not be correlated with its observed effect on protecting against radiation-induced mutagenesis. (author)

Coherent manipulation of a ⁴⁰Ca⁺ spin qubit in a micro ion trap

DEFF Research Database (Denmark)

Poschinger, U.G.; Huber, G.; Ziesel, F.

2009-01-01

the initialization and readout of the qubit levels with 99.5% efficiency. We employ a Raman transition close to the S1/2-P1/2 resonance for coherent manipulation of the qubit. We observe single qubit rotations with 96% fidelity and gate times below 5 µs. Rabi oscillations on the blue motional sideband are used...

Less-healthy eating behaviors have a greater association with a high level of sugar-sweetened beverage consumption among rural adults than among urban adults

Directory of Open Access Journals (Sweden)

Wesley R. Dean

2011-04-01

Full Text Available Background: Sugar-sweetened beverage (SSB consumption is associated with the increasing prevalence of overweight and obesity in the United States; however, little is known about how less-healthy eating behaviors influence high levels of SSB consumption among rural adults. Objective: We assessed the frequency of SSB consumption among rural and urban adults, examined the correlates of frequent SSB consumption, and determined difference in correlates between rural and urban adults in a large region of Texas. Design: A cross-sectional study using data on 1,878 adult participants (urban = 734 and rural = 1,144, who were recruited by random digit dialing to participate in the seven-county 2006 Brazos Valley Community Health Assessment. Data included demographic characteristics, eating behaviors (SSB consumption, frequency of fast-food meals, frequency of breakfast meals, and daily fruit and vegetable intake, and household food insecurity. Results: The prevalence of any consumption of SSB and the prevalence of high consumption of SSB were significantly higher among rural adults compared with urban counterparts. The multivariable logistic regression models indicated that a high level of SSB consumption (≥3 cans or glasses SSB/day was associated with demographic characteristics (poverty-level income and children in the home, frequent consumption of fast-food meals, infrequent breakfast meals, low fruit and vegetable intake, and household food insecurity especially among rural adults. Conclusions: This study provides impetus for understanding associations among multiple eating behaviors, especially among economically and geographically disadvantaged adults. New strategies are needed for educating consumers, not only about how to moderate their SSB intake, but also how to simultaneously disrupt the co-occurrence of undesirable eating and promote healthful eating.

Sugar-Sweetened Beverage Consumption and Risks of Obesity and Hypertension in Chinese Children and Adolescents: A National Cross-Sectional Analysis

Directory of Open Access Journals (Sweden)

Zhao-Huan Gui

2017-11-01

Full Text Available We investigated the consumption of sugar-sweetened beverage (SSB and its association with obesity and hypertension in a national sample of children and adolescents in China, where many low- and middle-income families live. Data were obtained from a 2014 national intervention program against obesity in Chinese children and adolescents aged 6–17 years. Height, weight, waist circumference, and blood pressure were measured. Information of SSB consumption, socioeconomic status, dietary intake, screen time, and physical activity were self-reported. Multivariate logistic regression was used to assess the association of SSB consumption with obesity and hypertension. A total of 66.6% of the 53,151 participants reported consuming SSB. The per capita and per consumer SSB intake were 2.84 ± 5.26 servings/week and 4.26 ± 5.96 servings/week, respectively. Boys, older children, and adolescents, and individuals with long screen time or high physical activity or low parental education level were more likely to consume SSB. Participants who were high SSB consumers had a higher odds ratio (1.133, 95% CI: 1.054–1.217 than non-consumers for having abdominal obesity after adjustment for age, sex, residence, socioeconomic status, diet, screen time, and physical activity. However, SSB consumption was not associated with general obesity or hypertension in children and adolescents. In conclusion, more than half of the children and adolescents in China consumed SSB, which was independently related to a high risk of abdominal obesity. The results of this study indicated that SSB reduction strategies and policies may be useful in preventing obesity among Chinese children and adolescents.

Adults Who Order Sugar-Sweetened Beverages

Science.gov (United States)

Taksler, Glen B.; Kiszko, Kamila; Abrams, Courtney; Elbel, Brian

2016-01-01

Introduction Approximately 30% of adults consume sugar-sweetened beverages (SSBs) daily, many at fast food restaurants. Researchers examined fast food purchases to better understand which consumers order SSBs, particularly large SSBs. Methods Fast food customers in New York City and New Jersey provided receipts and participated in a survey during 2013–2014 (N=11,614). Logistic regression analyses predicted three outcomes: ordering no beverage or a non-SSB, a small/medium SSB, or a large SSB. Among respondents who ordered a beverage (n=3,775), additional analyses predicted number of beverage calories and odds of ordering an SSB. Covariates included demographic and behavioral factors. Results Respondents aged 18–29 years were 88% more likely to order a large SSB than a non-SSB or no beverage, as compared with respondents aged ≥50 years (pbeverage, respondents ordered more beverage calories with a large combination meal (+85.13 kcal, p=0.001) or if the restaurant had a large cup size >30 ounces (+36.07 kcal, p=0.001). Hispanic and Asian respondents were less likely to order a large SSB (AOR=0.49 and 0.52, respectively, both p≤0.026) than non-Hispanic white respondents. Odds of ordering a large SSB were higher for respondents who ate in the restaurant (AOR=1.66, pbeverage based on price (AOR=2.02, pbeverage calories increased with meal size. Increased understanding of these factors is an important step toward limiting unhealthy SSB consumption. PMID:27662697

The independence of the Shari’a supervisory board in the Islamic financial institutions of the GCC countries

Directory of Open Access Journals (Sweden)

Samy Nathan Garas

2010-07-01

Full Text Available Islamic Financial Institutions (IFIs are governed by two boards: the Board of Directors (BoD and the Shari’a Supervisory Board (SSB. The SSB is a panel of Shari’a scholars who act independently from other governance organs. This paper discriminates between dependent SSBs and independent SSBs by using twenty one variables, which are classified into three groups: the implementation of governance best practices, the recruitment of SSB members, and the relationship between the SSB members and other governance organs. This study is one of the first studies that provide empirical results about the SSB independence. Nevertheless, the research focuses exclusively on the Gulf Cooperation Council (GCC countries and excludes the other countries where Shari’a supervision might have different forms. The study has developed a hypothesis, which was tested by a questionnaire. Data was collected from 76 Shari’a Supervisory Boards, 73 Boards of Directors, and 59 shareholders of IFIs in the GCC countries (Bahrain, Kuwait, Qatar, Saudi Arabia, and UAE during 2009. The discriminant analysis has been used in identifying both dependent and independent SSBs. The paper finds five variables relevant in discriminating the two groups. These variables are the incentives provided to the SSB; the average remuneration to the SSB members; the existence of the policy of penalties for violating the code of conduct; the relation between the SSB members and the BoD; and the role of executive management in recruiting SSB members.

Socio-economic inequalities in children's snack consumption and sugar-sweetened beverage consumption: the contribution of home environmental factors.

Science.gov (United States)

van Ansem, Wilke J C; van Lenthe, Frank J; Schrijvers, Carola T M; Rodenburg, Gerda; van de Mheen, Dike

2014-08-14

In the present study, we examined the association between maternal education and unhealthy eating behaviour (the consumption of snack and sugar-sweetened beverages (SSB)) and explored environmental factors that might mediate this association in 11-year-old children. These environmental factors include home availability of snacks and SSB, parental rules about snack and SSB consumption, parental intake of snacks and SSB, peer sensitivity and children's snack-purchasing behaviour. Data were obtained from the fourth wave of the INPACT (IVO Nutrition and Physical Activity Child cohorT) study (2011), in which 1318 parent-child dyads completed a questionnaire. Data were analysed using multivariate regression models. Children of mothers with an intermediate educational level were found to consume more snacks than those of mothers with a high educational level (B= 1·22, P= 0·02). This association was not mediated by environmental factors. Children of mothers with a low educational level were found to consume more SSB than those of mothers with a high educational level (B= 0·63, Pconsumption was found to be mediated by parental intake of snacks and SSB and home availability of SSB. The home environment seems to be a promising setting for interventions on reducing socio-economic inequalities in children's SSB consumption.

Sugar-Sweetened Beverage Consumption by Adult Caregivers and Their Children: The Role of Drink Features and Advertising Exposure.

Science.gov (United States)

Hennessy, Michael; Bleakley, Amy; Piotrowski, Jessica Taylor; Mallya, Giridhar; Jordan, Amy

2015-10-01

To examine how parents' beliefs about beverage attributes and exposure to sugar-sweetened beverage (SSB) advertising are associated with parents' and their children's SSB consumption. Cross-sectional representative telephone survey of Philadelphia parents in households with children between the ages of 3 and 16 years. Three hundred and seventy-one randomly selected survey respondents. The response rate was 27% using the American Association for Public Opinion Research RR3 formula. SSB consumption, health ratings of SSBs, exposure to SSB ads, and exposure to anti-SSB public service advertisements. Seemingly unrelated regression was used to correct for Type I error and significance levels were set at .05 or less. Assessment of SSB "healthiness" was associated with the increased adult consumption of SSBs for three of the five SSBs and associated with children's consumption for all four SSBs with child consumption data. For both groups, ratings of SSB sugar and caloric content were not related to consumption. Adult exposure to SSB-specific advertising was related to consumption for three of five SSBs and two of four SSBs consumed by children. These results suggest that sugar and calories are not relevant to consumption, absent an explicit connection to a healthiness evaluation of SSBs. © 2015 Society for Public Health Education.

Towards a centralized Grid Speedometer

International Nuclear Information System (INIS)

Dzhunov, I; Andreeva, J; Saiz, P; Fajardo, E; Gutsche, O; Luyckx, S

2014-01-01

Given the distributed nature of the Worldwide LHC Computing Grid and the way CPU resources are pledged and shared around the globe, Virtual Organizations (VOs) face the challenge of monitoring the use of these resources. For CMS and the operation of centralized workflows, the monitoring of how many production jobs are running and pending in the Glidein WMS production pools is very important. The Dashboard Site Status Board (SSB) provides a very flexible framework to collect, aggregate and visualize data. The CMS production monitoring team uses the SSB to define the metrics that have to be monitored and the alarms that have to be raised. During the integration of CMS production monitoring into the SSB, several enhancements to the core functionality of the SSB were required; They were implemented in a generic way, so that other VOs using the SSB can exploit them. Alongside these enhancements, there were a number of changes to the core of the SSB framework. This paper presents the details of the implementation and the advantages for current and future usage of the new features in SSB.

Sensitivity enhancement by multiple-contact cross-polarization under magic-angle spinning.

Science.gov (United States)

Raya, J; Hirschinger, J

2017-08-01

Multiple-contact cross-polarization (MC-CP) is applied to powder samples of ferrocene and l-alanine under magic-angle spinning (MAS) conditions. The method is described analytically through the density matrix formalism. The combination of a two-step memory function approach and the Anderson-Weiss approximation is found to be particularly useful to derive approximate analytical solutions for single-contact Hartmann-Hahn CP (HHCP) and MC-CP dynamics under MAS. We show that the MC-CP sequence requiring no pulse-shape optimization yields higher polarizations at short contact times than optimized adiabatic passage through the HH condition CP (APHH-CP) when the MAS frequency is comparable to the heteronuclear dipolar coupling, i.e., when APHH-CP through a single sideband matching condition is impossible or difficult to perform. It is also shown that the MC-CP sideband HH conditions are generally much broader than for single-contact HHCP and that efficient polarization transfer at the centerband HH condition can be reintroduced by rotor-asynchronous multiple equilibrations-re-equilibrations with the proton spin bath. Boundary conditions for the successful use of the MC-CP experiment when relying on spin-lattice relaxation for repolarization are also examined. Copyright © 2017 Elsevier Inc. All rights reserved.

Effects of coal combustion residues on survival, antioxidant potential, and genotoxicity resulting from full-lifecycle exposure of grass shrimp (Palaemonetes pugio Holthius)

International Nuclear Information System (INIS)

Kuzmick, Danika M.; Mitchelmore, Carys L.; Hopkins, William A.; Rowe, Christopher L.

2007-01-01

Coal combustion residues (CCRs), largely derived from coal-fired electrical generation, are rich in numerous trace elements that have the potential to induce sublethal effects including oxidative stress, alterations in antioxidant status and DNA single strand breaks (SSB). CCRs are frequently discharged into natural and man-made aquatic systems. As the effects of CCRs have received relatively little attention in estuarine systems, the estuarine grass shrimp, Palaemonetes pugio, was chosen for this study. Grass shrimp were exposed in the laboratory to CCR-enriched sediments and food over a full life cycle. Survival to metamorphosis was significantly reduced in CCR-exposed larvae (17 ± 4 versus 70 ± 13% in the controls) but not in the juveniles or adults. The COMET assay, a general but sensitive assay for genotoxicity, was used to quantify DNA SSB in the adults. Total antioxidant potential was examined to assess the overall antioxidant scavenging capacity of CCR-exposed and non-exposed adult grass shrimp. Grass shrimp exposed to CCR significantly accumulated selenium and cadmium compared to unexposed shrimp, although an inverse relationship was seen for mercury accumulation. Chronic CCR exposure caused DNA SSB in hepatopancreas cells, as evidenced by the significantly increased percent tail DNA, tail moment, and tail length as compared to reference shrimp. However, no significant difference was observed in total antioxidant potential. Our findings suggest that genotoxicity may be an important mode of toxicity of CCR, and that DNA SSB may serve as a useful biomarker of exposure and effect of this very common, complex waste stream

Effects of coal combustion residues on survival, antioxidant potential, and genotoxicity resulting from full-lifecycle exposure of grass shrimp (Palaemonetes pugio Holthius)

Energy Technology Data Exchange (ETDEWEB)

Kuzmick, Danika M.; Mitchelmore, Carys L.; Rowe, Christopher L. [University of Maryland Center for Environmental Science, Chesapeake Biological Laboratory, 1, Williams Street, PO Box 38, Solomons, MD, 20688 (United States); Hopkins, William A. [Department of Fisheries and Wildlife Sciences, Virginia Polytechnic Institute and State University, 100 Cheatham Hall, Blacksburg, VA (United States)

2007-02-01

Coal combustion residues (CCRs), largely derived from coal-fired electrical generation, are rich in numerous trace elements that have the potential to induce sublethal effects including oxidative stress, alterations in antioxidant status and DNA single strand breaks (SSB). CCRs are frequently discharged into natural and man-made aquatic systems. As the effects of CCRs have received relatively little attention in estuarine systems, the estuarine grass shrimp, Palaemonetes pugio, was chosen for this study. Grass shrimp were exposed in the laboratory to CCR-enriched sediments and food over a full life cycle. Survival to metamorphosis was significantly reduced in CCR-exposed larvae (17 {+-} 4 versus 70 {+-} 13% in the controls) but not in the juveniles or adults. The COMET assay, a general but sensitive assay for genotoxicity, was used to quantify DNA SSB in the adults. Total antioxidant potential was examined to assess the overall antioxidant scavenging capacity of CCR-exposed and non-exposed adult grass shrimp. Grass shrimp exposed to CCR significantly accumulated selenium and cadmium compared to unexposed shrimp, although an inverse relationship was seen for mercury accumulation. Chronic CCR exposure caused DNA SSB in hepatopancreas cells, as evidenced by the significantly increased percent tail DNA, tail moment, and tail length as compared to reference shrimp. However, no significant difference was observed in total antioxidant potential. Our findings suggest that genotoxicity may be an important mode of toxicity of CCR, and that DNA SSB may serve as a useful biomarker of exposure and effect of this very common, complex waste stream. (author)

Children’s sugar-sweetened beverages consumption: associations with family and home-related factors, differences within ethnic groups explored

Directory of Open Access Journals (Sweden)

V. M. van de Gaar

2017-02-01

Full Text Available Abstract Background The consumption of sugar-sweetened beverages (SSB may contribute to the development of overweight among children. The present study aimed to evaluate associations between family and home-related factors and children’s SSB consumption. We explored associations within ethnic background of the child. Methods Cross-sectional data from the population-based ‘Water Campaign’ study were used. Parents (n = 644 of primary school children (6-13 years completed a questionnaire on socio-demographic characteristics, family and home-related factors and child’s SSB intake. The family and home-related factors under study were: cognitive variables (e.g. parental attitude, subjective norm, environmental variables (e.g. availability of SSB, parenting practices, and habitual variables (e.g. habit strength, taste preference. Regression analyses were used to evaluate the associations between family and home-related factors and child’s SSB intake (p < 0.05. Results Mean age of the children was 9.4 years (SD: 1.8 and 54.1% were girls. The child’s average SSB intake was 0.9 litres (SD: 0.6 per day. Child’s age, parents’ subjective norm, parenting practices, and parental modelling were positively associated with the child’s SSB intake. The availability of SSB at home and school and parental attitude were negatively associated with the child’s SSB intake. The associations under study differed according to the child’s ethnic background, with the explained variance of the full models ranging from 8.7% for children from Moroccan or Turkish ethnic background to 44.4% for children with Dutch ethnic background. Conclusions Our results provide support for interventions targeting children’s SSB intake focussing on the identified family and home-related factors, with active participation of parents. Also, the relationships between these factors and the child’s SSB intake differed for children with distinct ethnic backgrounds

The sub-bandgap energy loss satellites in the RIXS spectra of beryllium compounds

International Nuclear Information System (INIS)

Kuusik, I.; Kaeaembre, T.; Kooser, K.; Pustovarov, V.; Ivanov, V.; Kukk, E.; Kikas, A.

2011-01-01

Research highlights: → Be 1s RIXS spectra have been measured in Be containing crystals phenakite and chrysoberyl. → A strong energy loss sideband to the elastic scattering peak similar to BeO is found in both minerals. → Additionally the Si 2p RIXS spectra of phenakite also show a strong energy loss sideband to the elastic scattering peak. → The energy loss shoulder appears to result from lattice relaxation in the absorption site. - Abstract: Resonant X-ray inelastic scattering spectra have been measured in BeO, phenakite (Be 2 SiO 4 ) and chrysoberyl (BeAl 2 O 4 ) with the excitation energy near the beryllium K edge. The RIXS spectra excited in the vicinity of the Be 1s core resonance show two principal features: the scattering on a valence excitation (which at higher excitation energies verges into the characteristic K α emission), and a remarkably strong energy loss sideband to the elastic scattering peak. The energy loss shoulder appears to result from lattice relaxation in the absorption site. The comparison of the RIXS spectra of phenakite, chrysoberyl and BeO shows that the strength of the low energy sideband differs greatly; it is strongest in BeO and weakest in phenakite. The Si 2p RIXS spectra of phenakite also display a similar strong sub-bandgap energy loss tail. To gain further insight to this process, transitions in a system with a single vibrational mode have been modelled. The phonon relaxation has been simulated empirically by 'smearing' the photoabsortion-populated vibrational levels with lower levels. This simple model is able to qualitatively explain this wide energy loss shoulder.

The sub-bandgap energy loss satellites in the RIXS spectra of beryllium compounds

Energy Technology Data Exchange (ETDEWEB)

Kuusik, I., E-mail: ivar@fi.tartu.ee [Institute of Physics, University of Tartu, Riia 142, 51014 Tartu (Estonia); Kaeaembre, T. [Institute of Physics, University of Tartu, Riia 142, 51014 Tartu (Estonia); Kooser, K. [Institute of Physics, University of Tartu, Riia 142, 51014 Tartu (Estonia); Department of Physics and Astronomy, University of Turku, Turku (Finland); Pustovarov, V.; Ivanov, V. [Ural State Technical University-UPI, Yekaterinburg (Russian Federation); Kukk, E. [Department of Physics and Astronomy, University of Turku, Turku (Finland); Kikas, A. [Institute of Physics, University of Tartu, Riia 142, 51014 Tartu (Estonia)

2011-07-15

Research highlights: {yields} Be 1s RIXS spectra have been measured in Be containing crystals phenakite and chrysoberyl. {yields} A strong energy loss sideband to the elastic scattering peak similar to BeO is found in both minerals. {yields} Additionally the Si 2p RIXS spectra of phenakite also show a strong energy loss sideband to the elastic scattering peak. {yields} The energy loss shoulder appears to result from lattice relaxation in the absorption site. - Abstract: Resonant X-ray inelastic scattering spectra have been measured in BeO, phenakite (Be{sub 2}SiO{sub 4}) and chrysoberyl (BeAl{sub 2}O{sub 4}) with the excitation energy near the beryllium K edge. The RIXS spectra excited in the vicinity of the Be 1s core resonance show two principal features: the scattering on a valence excitation (which at higher excitation energies verges into the characteristic K{sub {alpha}} emission), and a remarkably strong energy loss sideband to the elastic scattering peak. The energy loss shoulder appears to result from lattice relaxation in the absorption site. The comparison of the RIXS spectra of phenakite, chrysoberyl and BeO shows that the strength of the low energy sideband differs greatly; it is strongest in BeO and weakest in phenakite. The Si 2p RIXS spectra of phenakite also display a similar strong sub-bandgap energy loss tail. To gain further insight to this process, transitions in a system with a single vibrational mode have been modelled. The phonon relaxation has been simulated empirically by 'smearing' the photoabsortion-populated vibrational levels with lower levels. This simple model is able to qualitatively explain this wide energy loss shoulder.

Health benefits of reducing sugar-sweetened beverage intake in high risk populations of California: results from the cardiovascular disease (CVD policy model.

Directory of Open Access Journals (Sweden)

Tekeshe A Mekonnen

Full Text Available Consumption of sugar-sweetened beverage (SSB has risen over the past two decades, with over 10 million Californians drinking one or more SSB per day. High SSB intake is associated with risk of type 2 diabetes, obesity, hypertension, and coronary heart disease (CHD. Reduction of SSB intake and the potential impact on health outcomes in California and among racial, ethnic, and low-income sub-groups has not been quantified.We projected the impact of reduced SSB consumption on health outcomes among all Californians and California subpopulations from 2013 to 2022. We used the CVD Policy Model - CA, an established computer simulation of diabetes and heart disease adapted to California. We modeled a reduction in SSB intake by 10-20% as has been projected to result from proposed penny-per-ounce excise tax on SSB and modeled varying effects of this reduction on health parameters including body mass index, blood pressure, and diabetes risk. We projected avoided cases of diabetes and CHD, and associated health care cost savings in 2012 US dollars.Over the next decade, a 10-20% SSB consumption reduction is projected to result in a 1.8-3.4% decline in the new cases of diabetes and an additional drop of 0.5-1% in incident CHD cases and 0.5-0.9% in total myocardial infarctions. The greatest reductions are expected in African Americans, Mexican Americans, and those with limited income regardless of race and ethnicity. This reduction in SSB consumption is projected to yield $320-620 million in medical cost savings associated with diabetes cases averted and an additional savings of $14-27 million in diabetes-related CHD costs avoided.A reduction of SSB consumption could yield substantial population health benefits and cost savings for California. In particular, racial, ethnic, and low-income subgroups of California could reap the greatest health benefits.

Adults Who Order Sugar-Sweetened Beverages: Sociodemographics and Meal Patterns at Fast Food Chains.

Science.gov (United States)

Taksler, Glen B; Kiszko, Kamila; Abrams, Courtney; Elbel, Brian

2016-12-01

Approximately 30% of adults consume sugar-sweetened beverages (SSBs) daily, many at fast food restaurants. Researchers examined fast food purchases to better understand which consumers order SSBs, particularly large SSBs. Fast food customers in New York City and New Jersey provided receipts and participated in a survey during 2013-2014 (N=11,614). Logistic regression analyses predicted three outcomes: ordering no beverage or a non-SSB, a small/medium SSB, or a large SSB. Among respondents who ordered a beverage (n=3,775), additional analyses predicted number of beverage calories and odds of ordering an SSB. Covariates included demographic and behavioral factors. Respondents aged 18-29 years were 88% more likely to order a large SSB than a non-SSB or no beverage, as compared with respondents aged ≥50 years (pbeverage, respondents ordered more beverage calories with a large combination meal (+85.13 kcal, p=0.001) or if the restaurant had a large cup size >30 ounces (+36.07 kcal, p=0.001). Hispanic and Asian respondents were less likely to order a large SSB (AOR=0.49 and 0.52, respectively, both p≤0.026) than non-Hispanic white respondents. Odds of ordering a large SSB were higher for respondents who ate in the restaurant (AOR=1.66, pbeverage based on price (AOR=2.02, pbeverage calories increased with meal size. Increased understanding of these factors is an important step toward limiting unhealthy SSB consumption. Copyright © 2016 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

Nonlinear dynamics of magnetic vortices in single-crystal and ion-damaged NbSe2

International Nuclear Information System (INIS)

Zhang, J.; De Long, L.E.; Majidi, V.; Budhani, R.C.

1996-01-01

Nonlinear dynamics of magnetic flux lines in superconducting NbSe 2 are studied using the vibrating-reed technique and a resonance-line-shape analysis. A yield point for plastic deformation of the flux-line lattice is linked to the onset of a dissipation anomaly previously associated with a flux-line lattice melting transition. The resonance (10 kHz range) of radiation-damaged samples bifurcates into patterned sidebands at high drives, with additional nonlinear response emerging above 200 kHz, which may signal the onset of chaos. copyright 1996 The American Physical Society

Novel sensing and control schemes for a three-mirror coupled cavity

International Nuclear Information System (INIS)

Huttner, S H; Barr, B W; Plissi, M V; Taylor, J R; Sorazu, B; Strain, K A

2007-01-01

We present two options for length sensing and control of a three-mirror coupled cavity. The control of the first cavity uses amplitude or single sideband modulation and phase modulation in combination with a beat-frequency demodulation scheme, whereas the control scheme for the second cavity incorporates phase modulation and single demodulation. The theoretical and experimental performance is discussed as well as the relevance to a research programme to develop interferometric techniques for application in future interferometric gravitational wave detectors

A novel technique using DNA denaturation to detect multiply induced single-strand breaks in a hydrated plasmid DNA molecule by X-ray and 4He2+ ion irradiation

International Nuclear Information System (INIS)

Yokoya, A.; Shikazono, N.; Fujii, K.; Noguchi, M.; Urushibara, A.

2011-01-01

To detect multiple single-strand breaks (SSBs) produced in plasmid DNA molecules by direct energy deposition from radiation tracks, we have developed a novel technique using DNA denaturation by which irradiated DNA is analysed as single-strand DNA (SS-DNA). The multiple SSBs that arise in both strands of DNA, but do not induce a double-strand break, are quantified as loss of SS-DNA using agarose gel electrophoresis. We have applied this method to X-ray and 4 He 2+ ion-irradiated samples of fully hydrated pUC18 plasmid DNA. The fractions of both SS-DNA and closed circular DNA (CC-DNA) exponentially decrease with the increasing dose of X rays and 4 He 2+ ions. The efficiency of the loss of SS-DNA was half that of CC-DNA for both types of irradiation, indicating that one of two strands in DNA is not broken when one SSB is produced in CC-DNA by irradiation. Contrary to our initial expectation, these results indicate that SSBs are not multiply induced even by high linear energy transfer radiation distributed in both strands. (authors)

Automating ATLAS Computing Operations using the Site Status Board

CERN Document Server

Andreeva, J; The ATLAS collaboration; Campana, S; Di Girolamo, A; Espinal Curull, X; Gayazov, S; Magradze, E; Nowotka, MM; Rinaldi, L; Saiz, P; Schovancova, J; Stewart, GA; Wright, M

2012-01-01

The automation of operations is essential to reduce manpower costs and improve the reliability of the system. The Site Status Board (SSB) is a framework which allows Virtual Organizations to monitor their computing activities at distributed sites and to evaluate site performance. The ATLAS experiment intensively uses SSB for the distributed computing shifts, for estimating data processing and data transfer efficiencies at a particular site, and for implementing automatic exclusion of sites from computing activities, in case of potential problems. ATLAS SSB provides a real-time aggregated monitoring view and keeps the history of the monitoring metrics. Based on this history, usability of a site from the perspective of ATLAS is calculated. The presentation will describe how SSB is integrated in the ATLAS operations and computing infrastructure and will cover implementation details of the ATLAS SSB sensors and alarm system, based on the information in SSB. It will demonstrate the positive impact of the use of SS...

Projected Impact of Mexico’s Sugar-Sweetened Beverage Tax Policy on Diabetes and Cardiovascular Disease: A Modeling Study

Science.gov (United States)

Sánchez-Romero, Luz Maria; Penko, Joanne; Coxson, Pamela G.; Fernández, Alicia; Mason, Antoinette; Moran, Andrew E.; Ávila-Burgos, Leticia; Barquera, Simón; Bibbins-Domingo, Kirsten

2016-01-01

Background Rates of diabetes in Mexico are among the highest worldwide. In 2014, Mexico instituted a nationwide tax on sugar-sweetened beverages (SSBs) in order to reduce the high level of SSB consumption, a preventable cause of diabetes and cardiovascular disease (CVD). We used an established computer simulation model of CVD and country-specific data on demographics, epidemiology, SSB consumption, and short-term changes in consumption following the SSB tax in order to project potential long-range health and economic impacts of SSB taxation in Mexico. Methods and Findings We used the Cardiovascular Disease Policy Model–Mexico, a state transition model of Mexican adults aged 35–94 y, to project the potential future effects of reduced SSB intake on diabetes incidence, CVD events, direct diabetes healthcare costs, and mortality over 10 y. Model inputs included short-term changes in SSB consumption in response to taxation (price elasticity) and data from government and market research surveys and public healthcare institutions. Two main scenarios were modeled: a 10% reduction in SSB consumption (corresponding to the reduction observed after tax implementation) and a 20% reduction in SSB consumption (possible with increases in taxation levels and/or additional measures to curb consumption). Given uncertainty about the degree to which Mexicans will replace calories from SSBs with calories from other sources, we evaluated a range of values for calorie compensation. We projected that a 10% reduction in SSB consumption with 39% calorie compensation among Mexican adults would result in about 189,300 (95% uncertainty interval [UI] 155,400–218,100) fewer incident type 2 diabetes cases, 20,400 fewer incident strokes and myocardial infarctions, and 18,900 fewer deaths occurring from 2013 to 2022. This scenario predicts that the SSB tax could save Mexico 983 million international dollars (95% UI $769 million–$1,173 million). The largest relative and absolute reductions in

Projected Impact of Mexico's Sugar-Sweetened Beverage Tax Policy on Diabetes and Cardiovascular Disease: A Modeling Study.

Science.gov (United States)

Sánchez-Romero, Luz Maria; Penko, Joanne; Coxson, Pamela G; Fernández, Alicia; Mason, Antoinette; Moran, Andrew E; Ávila-Burgos, Leticia; Odden, Michelle; Barquera, Simón; Bibbins-Domingo, Kirsten

2016-11-01

Rates of diabetes in Mexico are among the highest worldwide. In 2014, Mexico instituted a nationwide tax on sugar-sweetened beverages (SSBs) in order to reduce the high level of SSB consumption, a preventable cause of diabetes and cardiovascular disease (CVD). We used an established computer simulation model of CVD and country-specific data on demographics, epidemiology, SSB consumption, and short-term changes in consumption following the SSB tax in order to project potential long-range health and economic impacts of SSB taxation in Mexico. We used the Cardiovascular Disease Policy Model-Mexico, a state transition model of Mexican adults aged 35-94 y, to project the potential future effects of reduced SSB intake on diabetes incidence, CVD events, direct diabetes healthcare costs, and mortality over 10 y. Model inputs included short-term changes in SSB consumption in response to taxation (price elasticity) and data from government and market research surveys and public healthcare institutions. Two main scenarios were modeled: a 10% reduction in SSB consumption (corresponding to the reduction observed after tax implementation) and a 20% reduction in SSB consumption (possible with increases in taxation levels and/or additional measures to curb consumption). Given uncertainty about the degree to which Mexicans will replace calories from SSBs with calories from other sources, we evaluated a range of values for calorie compensation. We projected that a 10% reduction in SSB consumption with 39% calorie compensation among Mexican adults would result in about 189,300 (95% uncertainty interval [UI] 155,400-218,100) fewer incident type 2 diabetes cases, 20,400 fewer incident strokes and myocardial infarctions, and 18,900 fewer deaths occurring from 2013 to 2022. This scenario predicts that the SSB tax could save Mexico 983 million international dollars (95% UI $769 million-$1,173 million). The largest relative and absolute reductions in diabetes and CVD events occurred in the

Projected Impact of Mexico's Sugar-Sweetened Beverage Tax Policy on Diabetes and Cardiovascular Disease: A Modeling Study.

Directory of Open Access Journals (Sweden)

Luz Maria Sánchez-Romero

2016-11-01

Full Text Available Rates of diabetes in Mexico are among the highest worldwide. In 2014, Mexico instituted a nationwide tax on sugar-sweetened beverages (SSBs in order to reduce the high level of SSB consumption, a preventable cause of diabetes and cardiovascular disease (CVD. We used an established computer simulation model of CVD and country-specific data on demographics, epidemiology, SSB consumption, and short-term changes in consumption following the SSB tax in order to project potential long-range health and economic impacts of SSB taxation in Mexico.We used the Cardiovascular Disease Policy Model-Mexico, a state transition model of Mexican adults aged 35-94 y, to project the potential future effects of reduced SSB intake on diabetes incidence, CVD events, direct diabetes healthcare costs, and mortality over 10 y. Model inputs included short-term changes in SSB consumption in response to taxation (price elasticity and data from government and market research surveys and public healthcare institutions. Two main scenarios were modeled: a 10% reduction in SSB consumption (corresponding to the reduction observed after tax implementation and a 20% reduction in SSB consumption (possible with increases in taxation levels and/or additional measures to curb consumption. Given uncertainty about the degree to which Mexicans will replace calories from SSBs with calories from other sources, we evaluated a range of values for calorie compensation. We projected that a 10% reduction in SSB consumption with 39% calorie compensation among Mexican adults would result in about 189,300 (95% uncertainty interval [UI] 155,400-218,100 fewer incident type 2 diabetes cases, 20,400 fewer incident strokes and myocardial infarctions, and 18,900 fewer deaths occurring from 2013 to 2022. This scenario predicts that the SSB tax could save Mexico 983 million international dollars (95% UI $769 million-$1,173 million. The largest relative and absolute reductions in diabetes and CVD events

A 21.7 kb DNA segment on the left arm of yeast chromosome XIV carries WHI3, GCR2, SPX18, SPX19, an homologue to the heat shock gene SSB1 and 8 new open reading frames of unknown function.

Science.gov (United States)

Jonniaux, J L; Coster, F; Purnelle, B; Goffeau, A

1994-12-01

We report the amino acid sequence of 13 open reading frames (ORF > 299 bp) located on a 21.7 kb DNA segment from the left arm of chromosome XIV of Saccharomyces cerevisiae. Five open reading frames had been entirely or partially sequenced previously: WHI3, GCR2, SPX19, SPX18 and a heat shock gene similar to SSB1. The products of 8 other ORFs are new putative proteins among which N1394 is probably a membrane protein. N1346 contains a leucine zipper pattern and the corresponding ORF presents an HAP (global regulator of respiratory genes) upstream activating sequence in the promoting region. N1386 shares homologies with the DNA structure-specific recognition protein family SSRPs and the corresponding ORF is preceded by an MCB (MluI cell cycle box) upstream activating factor.

Enhanced detection of a low-frequency signal by using broad squeezed light and a bichromatic local oscillator

Science.gov (United States)

Li, Wei; Jin, Yuanbin; Yu, Xudong; Zhang, Jing

2017-08-01

We experimentally study a protocol of using the broadband high-frequency squeezed vacuum to detect the low-frequency signal. In this scheme, the lower sideband field of the squeezed light carries the low-frequency modulation signal, and the two strong coherent light fields are applied as the bichromatic local oscillator in the homodyne detection to measure the quantum entanglement of the upper and lower sideband for the broadband squeezed light. The power of one of the local oscillators for detecting the upper sideband can be adjusted to optimize the conditional variance in the low-frequency regime by subtracting the photocurrent of the upper sideband field of the squeezed light from that of the lower sideband field. By means of the quantum correlation of the upper and lower sideband for the broadband squeezed light, the low-frequency signal beyond the standard quantum limit is measured. This scheme is appropriate for enhancing the sensitivity of the low-frequency signal by the aid of the broad squeezed light, such as gravitational waves detection, and does not need to directly produce the low-frequency squeezing in an optical parametric process.

Taxing Sugar-Sweetened Beverages: Not a “Holy Grail” but a Cup at Least Half; Comment on “Food Taxes: A New Holy Grail?”

Directory of Open Access Journals (Sweden)

Jason Block

2013-01-01

Full Text Available In this commentary, we argue for the implementation of a sugar-sweetened beverage (SSB tax as a tool to help address the global obesity and diabetes epidemics. Consumption of SSBs has increased exponentially over the last several decades, a trend that has been an important contributor to the obesity and diabetes epidemics. Prior evidence demonstrates that a SSB tax will likely decrease SSB consumption without significantly increasing consumption of other unhealthy food or beverages. Further, this tax is unlikely to have effects on income inequality and should not contribute to weight-based discrimination. A SSB tax also should raise revenue for government entities that already pay, through health care expenditures and health programs, for the consequences of excess SSB consumption.

Observation of Broadband Time-Dependent Rabi Shifting in Microplasmas

International Nuclear Information System (INIS)

Compton, Ryan; Filin, Alex; Romanov, Dmitri A.; Levis, Robert J.

2009-01-01

Coherent broadband radiation in the form of Rabi sidebands is observed when a ps probe laser propagates through a weakly ionized, electronically excited microplasma generated in the focus of an intense pump beam. The sidebands arise from the interaction of the probe beam with pairs of excited states of a constituent neutral atom via the probe-induced Rabi oscillation. Sideband shifting of >90 meV from the probe carrier frequency results in an effective bandwidth of 200 meV. The sidebands are controlled by the intensity and temporal profile of the probe pulse; with amplitude and shift in agreement with the predictions of a time-dependent generalized Rabi cycling model.

Investigating Vibration Properties of a Planetary Gear Set with a Cracked Tooth in a Planet Gear

Science.gov (United States)

2014-12-23

sidebands appear at mfm±nfplanet± kfc or mfm±nfplanet±kfp, where m, n and k are all integers; fp represents rotation frequency of the planet gear and...region from 43 fm to 45 fm. Sidebands are not symmetric and sizable sidebands located at mfm±nfplanet± kfc or mfm±nfplanet±kfp, where m, n and k are

Swimming behaviour of Daphnia clones: differentiation through predator infochemicals

NARCIS (Netherlands)

Weber, A.; Van Noordwijk, A.J.

2002-01-01

We studied variation in small-scale swimming behavior (SSB) in four clones of Daphnia galeata (water flea) in response to predator infochemicals. The aim of this study was 3-fold. First, we tested for differences in SSB in Daphnia; second, we examined the potential of differences in SSB to explain

High-resolution observation by double-biprism electron holography

International Nuclear Information System (INIS)

Harada, Ken; Tonomura, Akira; Matsuda, Tsuyoshi; Akashi, Tetsuya; Togawa, Yoshihiko

2004-01-01

High-resolution electron holography has been achieved by using a double-biprism interferometer implemented on a 1 MV field emission electron microscope. The interferometer was installed behind the first magnifying lens to narrow carrier fringes and thus enabled complete separation of sideband Fourier spectrum from center band in reconstruction process. Holograms of Au fine particles and single-crystalline thin films with the finest fringe spacing of 4.2 pm were recorded and reconstructed. The overall holography system including the reconstruction process performed well for holograms in which carrier fringes had a spacing of around 10 pm. High-resolution lattice images of the amplitude and phase were clearly reconstructed without mixing of the center band and sideband information. Additionally, entire holograms were recorded without Fresnel fringes normally generated by the filament electrode of the biprism, and the holograms were thus reconstructed without the artifacts caused by Fresnel fringes

Trends in beverage prices following the introduction of a tax on sugar-sweetened beverages in Barbados.

Science.gov (United States)

Alvarado, Miriam; Kostova, Deliana; Suhrcke, Marc; Hambleton, Ian; Hassell, Trevor; Samuels, T Alafia; Adams, Jean; Unwin, Nigel

2017-12-01

A 10% excise tax on sugar sweetened beverages (SSBs) was implemented in Barbados in September 2015. A national evaluation has been established to assess the impact of the tax. We present a descriptive analysis of initial price changes following implementation of the SSB tax using price data provided by a major supermarket chain in Barbados over the period 2014-2016. We summarize trends in price changes for SSBs and non-SSBs before and after the tax using year-on-year mean price per liter. We find that prior to the tax, the year-on-year growth of SSB and non-SSB prices was very similar (approximately 1%). During the quarter in which the tax was implemented, the trends diverged, with SSB price growth increasing to 3% and that of non-SSBs decreasing slightly. The growth of SSB prices outpaced non-SSBs prices in each quarter thereafter, reaching 5.9% compared to tax price changes. A continued examination of the impact of the SSB tax in Barbados will expand the evidence base available to policymakers worldwide in considering SSB taxes as a lever for reducing the consumption of added sugar at the population level. Copyright © 2017. Published by Elsevier Inc.

Beverage Choices of Adolescents and Their Parents Using the Theory of Planned Behavior: A Mixed Methods Analysis.

Science.gov (United States)

Riebl, Shaun K; MacDougal, Carly; Hill, Catelyn; Estabrooks, Paul A; Dunsmore, Julie C; Savla, Jyoti; Frisard, Madlyn I; Dietrich, Andrea M; Davy, Brenda M

2016-02-01

Added sugar intake in the form of sugar-sweetened beverages (SSBs) has been considered a contributor to weight gain and cardiometabolic dysfunction in adults and youth. Adolescents are some of the highest consumers of added sugars, taking in ∼16% of their total calories from added sugars with ∼40% of these calories coming from SSBs. Food preferences and self-regulation of dietary intake by youth can be influenced by parents. To evaluate the effectiveness of the Theory of Planned Behavior (TPB) in understanding and predicting adolescents' SSB consumption, identify which constructs are the most important when evaluating SSB consumption in adolescents, and determine whether and how adolescents' beverage choices are influenced by parents' reactions to their beverage choices. Measurements for this cross-sectional study included four record-assisted 24-hour dietary recalls and responses to an SSB-specific TPB questionnaire from 100 adolescents. Consenting parents completed a beverage intake questionnaire, a TPB questionnaire, and the Parent Response to Beverage Choice Questionnaire. The TPB explained 34% of the variance in adolescents' and parents' intention to limit SSBs to behavioral control (b=1.35; P=0.002) and adolescents' subjective norms (b=0.57; P=0.001) were the strongest predictors of intention, and intention was the strongest predictor of SSB consumption in both adolescents and parents (b=-37 [P=0.026] and b=-49 [P=0.003], respectively). The TPB explained more variance in parent SSB consumption (R(2)=0.38) than adolescents (R(2)=0.22). Parents did more discouraging of SSBs and encouraging of non-SSBs. Adolescents' intention to limit SSB consumption moderated the relationship between parents' reactions encouraging SSBs and adolescents' predicted SSB consumption (P=0.021). The TPB explained a small but significant amount of variance in adolescents' SSB consumption. When addressing adolescent SSB intake, people in addition to parents may influence their

Beverage intake and obesity in Australian children

Directory of Open Access Journals (Sweden)

Clifton Peter M

2011-12-01

Full Text Available Abstract Background There have been increases in the obesity and overweight rates in Australian children over the past 25 years and it has been suggested that sugar sweetened beverages (SSB have played a role in this increase. Objective The objectives of this study were to: (1 examine SSB intakes in the 2007 Australian Children's Nutrition and Physical Activity Survey (2 relate SSB intake to rates of overweight and obesity, socio-economic status (SES, TV viewing time, and activity levels and (3 compare 2007 SSB intakes with data from the 1995 National Nutrition Survey. Design A computer assisted 24 h dietary recall in 4,400 children aged 2-16 years was performed. Results In the 2007 survey 47% of all children reported drinking SSBs with 25% consuming sugar sweetened soft drinks on the day of the survey. The mean consumption of soft drink was 436 g/d/consumer. Activity levels were unrelated to SSB consumption. Television viewing was positively related to soft drink consumption with a difference of 55 g/day from bottom to top tertile of time spent TV viewing (p = 0.015 in children aged 9-16 years. 55% of SSB consumption occurred at home and 10% occurred at school. Lower SES status was associated with a greater prevalence of SSB consumption- 30% for the lowest SES quartile vs 19% in the highest quartile. The proportion of overweight who consumed SSBs (which excludes 100% fruit was not different from the non-overweight children although the proportion of SSB consumers in the 6% of children who were obese was significant compared with the non-overweight children (59% vs 47%, p Conclusions This cross-sectional data set provides evidence that SSB consumption for Australian children is still high despite the decrease since 1995 in some age groups. It provides little support to conclude that overweight in children is currently being driven by excessive SSB consumption although it may be factor in some obese children. Conclusions are limited by the cross

Sugar-sweetened beverages, vascular risk factors and events

DEFF Research Database (Denmark)

Keller, Amelie; Heitmann, Berit L; Olsen, Nanna

2015-01-01

, while two of three studies, including both men and women, found direct associations between SSB consumption and stroke; however, the association was significant among women only. All included studies examining vascular risk factors found direct associations between SSB consumption and change in blood...... pressure, blood lipid or blood sugar. CONCLUSIONS: The reviewed studies generally showed that SSB intake was related to vascular risk factors, whereas associations with vascular events were less consistent. Due to a limited number of published papers, especially regarding vascular events, the strength......OBJECTIVE: A high intake of sugar-sweetened beverages (SSB) has been linked to weight gain, obesity and type 2 diabetes; however, the influence on CVD risk remains unclear. Therefore, our objective was to summarize current evidence for an association between SSB consumption and cardiovascular risk...

Price elasticity of the demand for sugar sweetened beverages and soft drinks in Mexico.

Science.gov (United States)

Colchero, M A; Salgado, J C; Unar-Munguía, M; Hernández-Ávila, M; Rivera-Dommarco, J A

2015-12-01

A large and growing body of scientific evidence demonstrates that sugar drinks are harmful to health. Intake of sugar-sweetened beverages (SSB) is a risk factor for obesity and type 2 diabetes. Mexico has one of the largest per capita consumption of soft drinks worldwide and high rates of obesity and diabetes. Fiscal approaches such as taxation have been recommended as a public health policy to reduce SSB consumption. We estimated an almost ideal demand system with linear approximation for beverages and high-energy food by simultaneous equations and derived the own and cross price elasticities for soft drinks and for all SSB (soft drinks, fruit juices, fruit drinks, flavored water and energy drinks). Models were stratified by income quintile and marginality index at the municipality level. Price elasticity for soft drinks was -1.06 and -1.16 for SSB, i.e., a 10% price increase was associated with a decrease in quantity consumed of soft drinks by 10.6% and 11.6% for SSB. A price increase in soft drinks is associated with larger quantity consumed of water, milk, snacks and sugar and a decrease in the consumption of other SSB, candies and traditional snacks. The same was found for SSB except that an increase in price of SSB was associated with a decrease in snacks. Higher elasticities were found among households living in rural areas (for soft drinks), in more marginalized areas and with lower income. Implementation of a tax to soft drinks or to SSB could decrease consumption particularly among the poor. Substitutions and complementarities with other food and beverages should be evaluated to assess the potential impact on total calories consumed. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

Towards a centralized Grid Speedometer

CERN Document Server

Gutsche, Oliver

2013-01-01

Given the distributed nature of the grid and the way CPU resources are pledged and scared around the globe, VOs are facing the challenge to monitor the use of these resources. For CMS and the operation of centralized workflows the monitoring of how many production jobs are running and pending in the Glidein WMS production pools is very important. The Dashboard SSB (Site Status Board) provides a very flexible framework to collect, aggregate and visualize data. The CMS production monitoring team uses the SSB to define the metrics that have to be monitored and the alarms that have to be set. During the integration of the CMS production monitoring into the SSB, several enhancements to the core functionality of the SSB were implemented; all in a generic way, so that other VOs using the SSB can use them as well. Alongside these enhancements, there were a few changes to the core of the SSB framework from which the CMS production team was able to benefit. We will present the details of the implementation and the adva...

News Coverage of Sugar-Sweetened Beverage Taxes: Pro- and Antitax Arguments in Public Discourse

Science.gov (United States)

Gollust, Sarah E.; Jarlenski, Marian P.; Nathanson, Ashley M.; Barry, Colleen L.

2013-01-01

Objectives. We examined news coverage of public debates about large taxes on sugar-sweetened beverages (SSBs) to illuminate how the news media frames the debate and to inform future efforts to promote obesity-related public policy. Methods. We conducted a quantitative content analysis in which we assessed how frequently 30 arguments supporting or opposing SSB taxes appeared in national news media and in news outlets serving jurisdictions where SSB taxes were proposed between January 2009 and June 2011. Results. News coverage included more discrete protax than antitax arguments on average. Supportive arguments about the health consequences and financial benefits of SSB taxes appeared most often. The most frequent opposing arguments focused on how SSB taxes would hurt the economy and how they constituted inappropriate governmental intrusion. Conclusions. News outlets that covered the debate on SSB taxes in their jurisdictions framed the issue in largely favorable ways. However, because these proposals have not gained passage, it is critical for SSB tax advocates to reach audiences not yet persuaded about the merits of this obesity prevention policy. PMID:23597354

Spontaneous symmetry breaking of Bose-Fermi mixtures in double-well potentials

International Nuclear Information System (INIS)

Adhikari, S. K.; Malomed, B. A.; Salasnich, L.; Toigo, F.

2010-01-01

We study the spontaneous symmetry breaking (SSB) of a superfluid Bose-Fermi (BF) mixture in a double-well potential (DWP). The mixture is described by the Gross-Pitaevskii equation (GPE) for the bosons, coupled to an equation for the order parameter of the Fermi superfluid, which is derived from the respective density functional in the unitarity limit (a similar model applies to the BCS regime, too). Straightforward SSB in the degenerate Fermi gas loaded into a DWP is impossible, as it requires an attractive self-interaction, and the intrinsic nonlinearity in the Fermi gas is repulsive. Nonetheless, we demonstrate that the symmetry breaking is possible in the mixture with attraction between fermions and bosons, like 40 K and 87 Rb. Numerical results are represented by dependencies of asymmetry parameters for both components on particle numbers of the mixture, N F and N B , and by phase diagrams in the (N F ,N B ) plane, which displays regions of symmetric and asymmetric ground states. The dynamical picture of the SSB, induced by a gradual transformation of the single-well potential into the DWP, is reported too. An analytical approximation is proposed for the case when the GPE for the boson wave function may be treated by means of the Thomas-Fermi (TF) approximation. Under a special linear relationship between N F and N B , the TF approximation allows us to reduce the model to a single equation for the fermionic function, which includes competing repulsive and attractive nonlinear terms. The latter one directly displays the mechanism of the generation of the effective attraction in the Fermi superfluid, mediated by the bosonic component of the mixture.

Effects of three-mode field interactions in laser instabilities and in beat-frequency spectroscopy

International Nuclear Information System (INIS)

Herdow, S.T.

1982-01-01

Population pulsations are fluctuations in the population difference (of a two level system) due to the presence of two or more coherent waves interfering in the medium. In this work, the author shows that population pulsations generated by three waves, a central wave and two mode-locked sidebands, are responsible for both the multiwavelength and the single-wavelength instabilities of single-mode lasers containing homgeneously-broadened media. The role of the population pulsations in establishing these instabilities, however, diminish as the central mode is detuned away from the atomic resonance frequency. For homogeneously-broadened lasers, the author finds two regions of single-wavelength instability. The first is at line center, for which population pulsations are solely responsible, and the second is off line center where the unsaturated medium provides the required gain and anomalous dispersion. For the case of inhomogeneously-broadened lasers, the author shows that population pulsations significantly increase the instability range over that predicted by Casperson for single-mode bad-cavity lasers. Both the unidirectional ring and the standing-wave cavities are treated. The Fourier expansion technique, used in this work, for treating three-frequency operation in saturation spectroscopy is shown to be equivalent (in appropriate limits) to the linear stability analysis in laser theory and optical bistability. The author also shows, in single-sideband saturation spectroscopy, that for long interaction lengths propagation effects can significantly influence the absorption and dispersion coefficients of the medium. Finally, the author shows that under certain conditions the pronounced splitting effects of the population pulsations develop into regions of intense absorption

Food Purchasing Behaviors and Sugar-Sweetened Beverage Consumption among Canadian Secondary School Students in the COMPASS Study.

Science.gov (United States)

Godin, Katelyn M; Chaurasia, Ashok; Hammond, David; Leatherdale, Scott T

2018-02-23

To examine whether several food purchasing behaviors (ie, sources of meals or snacks) are associated with adolescents' sugar-sweetened beverage (SSB) consumption and whether these associations vary by province. Cross-sectional observational study. Alberta and Ontario, Canada. Secondary school students from Alberta (n = 3,300) and Ontario (n = 37,999) participating in year 2 (2013-2014) of the Cannabis Use, Obesity, Mental Health, Physical Activity, Alcohol Use, Smoking, Sedentary Behavior (COMPASS) study. Participants' self-reported frequency of consuming 3 SSB types (soft drinks, sweetened coffees/teas, and energy drinks) in a typical week. Hierarchical Poisson regression analyses. Participants from Alberta had a significantly (P purchasing meals or snacks from school food outlets compared with their Ontario counterparts. Most of the food purchasing behaviors were significantly (P purchases on weekends (vs weekdays) and from food outlets off school property (vs on school property) had a greater association with SSB consumption. Eating a home-packed lunch was protective against SSB consumption across models. Adolescents' food purchasing behaviors have a significant impact on their propensity for SSB consumption. These data demonstrate potentially important contexts for SSB consumption and have implications for possible settings and strategies for future interventions to reduce adolescents' SSB intake. Copyright © 2017 Society for Nutrition Education and Behavior. Published by Elsevier Inc. All rights reserved.

The relationship of perceptions of tap water safety with intake of sugar-sweetened beverages and plain water among US adults.

Science.gov (United States)

Onufrak, Stephen J; Park, Sohyun; Sharkey, Joseph R; Sherry, Bettylou

2014-01-01

Research is limited on whether mistrust of tap water discourages plain water intake and leads to a greater intake of sugar-sweetened beverages (SSB). The objective of the present study was to examine demographic differences in perceptions of tap water safety and determine if these perceptions are associated with intake of SSB and plain water. The study examined perceptions of tap water safety and their cross-sectional association with intake of SSB and plain water. Racial/ethnic differences in the associations of tap water perceptions with SSB and plain water intake were also examined. Nationally weighted data from the 2010 HealthStyles Survey (n 4184). US adults aged ≥18 years. Overall, 13·0 % of participants disagreed that their local tap water was safe to drink and 26·4 % of participants agreed that bottled water was safer than tap water. Both mistrust of tap water safety and favouring bottled water differed by region, age, race/ethnicity, income and education. The associations of tap water mistrust with intake of SSB and plain water were modified by race/ethnicity (P beverages should recognize the potential impact of tap water perceptions on water and SSB intake among minority populations.

U.S. adults and child snacking patterns among sugar sweetened beverage drinkers and non-drinkers

Science.gov (United States)

Bleich, Sara N.; Wolfson, Julia A.

2015-01-01

Objective To provide national estimates of snack patterns for sugar sweetened beverage (SSB) drinkers and non-SSB drinkers among U.S. children and adults. Methods We analyzed 24-hour dietary recall data obtained from the National Health and Nutrition Examination Survey 1999–2010 among children (ages 2 to 19) and adults (aged 20 and older) (N = 46,932). Results For children and adults, SSB drinkers were significantly more likely than non-SSB drinkers to consume snacks (children: salty – 60% vs. 50%; sweet – 69% vs. 65%; adults: salty – 64% vs. 58%; sweet – 64% vs. 58%), calories from snacks (children: salty snacks – 258 vs. 213 kcal; sweet snacks – 322 vs. 291 kcal; adults: salty snacks – 261 vs. 236 kcal; sweet snacks – 370 vs. 350 kcal), and total calories (children: 2098 vs. 1804 kcal; adults: 2329 vs. 2049 kcal) (p snack consumers than Whites and Hispanics (SSB consumers: White – 79%; Black – 86%, Hispanic – 82%; salty snack consumers: White – 56%; Black – 62%, Hispanic – 54%; p snacks at home (p snack and consume more calories from snacks than non-SSB drinkers, particularly Black adolescents and young adults. PMID:25584987

Is Sugar the new Tobacco? Insights from Laboratory Studies, Consumer Surveys and Public Health.

Science.gov (United States)

Le Bodo, Yann; Paquette, Marie-Claude; Vallières, Maggie; Alméras, Natalie

2015-03-01

In the Americas, mean energy intake from added sugar exceeds recent World Health Organization recommendations for free sugars in the diet. As a leading contributor to this excess, sugar-sweetened beverage (SSB) overconsumption represents a risk for the population's health. This article provides an overview of clinical and epidemiological evidence, marketing practices, corporate influence and prevention strategies related to added sugar and SSB. For each aspect of this multidimensional profile, we briefly compare SSB to the case of tobacco pointing to similarities but also major differences. Tobacco control has demonstrated the effectiveness of long term multifaceted prevention strategies in multiple settings supported by strong public policies which may be applied to the consumption of SSB. However, translating these policies to the specific case of SSB is urgently needed, to inform preventive actions, decide which intervention mix will be used, and evaluate the process and impact of the chosen strategy.

Divergent Roles of RPA Homologs of the Model Archaeon Halobacterium salinarum in Survival of DNA Damage.

Science.gov (United States)

Evans, Jessica J; Gygli, Patrick E; McCaskill, Julienne; DeVeaux, Linda C

2018-04-20

The haloarchaea are unusual in possessing genes for multiple homologs to the ubiquitous single-stranded DNA binding protein (SSB or replication protein A, RPA) found in all three domains of life. Halobacterium salinarum contains five homologs: two are eukaryotic in organization, two are prokaryotic and are encoded on the minichromosomes, and one is uniquely euryarchaeal. Radiation-resistant mutants previously isolated show upregulation of one of the eukaryotic-type RPA genes. Here, we have created deletions in the five RPA operons. These deletion mutants were exposed to DNA-damaging conditions: ionizing radiation, UV radiation, and mitomycin C. Deletion of the euryarchaeal homolog, although not lethal as in Haloferax volcanii , causes severe sensitivity to all of these agents. Deletion of the other RPA/SSB homologs imparts a variable sensitivity to these DNA-damaging agents, suggesting that the different RPA homologs have specialized roles depending on the type of genomic insult encountered.

Experimental investigation of a small-sized betatron with superposed magnetization

International Nuclear Information System (INIS)

Kas'yanov, V.A.; Rychkov, M.V.; Filimonov, A.A.; Furman, Eh.G.; Chakhlov, V.L.; Chertov, A.S.; Shtejn, M.M.

2001-01-01

The aim of the paper is to study possibilities of small-sized betatrons (SSB) with direct current superposed magnetization (DSM). It is shown that DSM permits to decrease the SSB weight and cost of the electromagnet and capacitor storage and to shape the prolonged beam dump. It is noted that the DSM realization has the most expediency in SSB operating in a short-time mode [ru

Multichannel photonic Hilbert transformers based on complex modulated integrated Bragg gratings.

Science.gov (United States)

Cheng, Rui; Chrostowski, Lukas

2018-03-01

Multichannel photonic Hilbert transformers (MPHTs) are reported. The devices are based on single compact spiral integrated Bragg gratings on silicon with coupling coefficients precisely modulated by the phase of each grating period. MPHTs with up to nine wavelength channels and a single-channel bandwidth of up to ∼625  GHz are achieved. The potential of the devices for multichannel single-sideband signal generation is suggested. The work offers a new possibility of utilizing wavelength as an extra degree of freedom in designing radio-frequency photonic signal processors. Such multichannel processors are expected to possess improved capacities and a potential to greatly benefit current widespread wavelength division multiplexed systems.

Sugar Sweetened Beverage Consumption among Adults with Gout or Type 2 Diabetes.

Directory of Open Access Journals (Sweden)

Rinki Murphy

Full Text Available Current guidelines for the management of type 2 diabetes and gout recommend that people with these conditions limit their sugar sweetened beverage (SSB intake. We examined self-reported SSB intake among New Zealand adults with gout or type 2 diabetes, including those on hemodialysis.1023 adults with gout and 580 adults (including 206 receiving hemodialysis with type 2 diabetes, participated in this study of between 2009 and 2012. Participants completed an interviewer-administered SSB intake question "how many sugar sweetened drinks (including fruit juice, but not including diet drinks, do you normally drink per day?" SSB consumption was recorded as a circled number 0, 1, 2, 3, 4, 5, or >5, cans or large glasses (300 mL per day.Consuming one or more SSB per day was reported by 64% (622/1023 of subjects with gout, 49% (176/374 with type 2 diabetes without dialysis, and 47% (96/206 with diabetes on dialysis. Consuming four or more SSBs per day was reported by 18% (179/1023, 9% (31/374 and 9% (18/206, respectively. Such high consumers of SSB were characterized after multivariable analysis to be more likely to be male (adjusted odds ratio (OR 1.8; 95% confidence interval 1.1-2.9, younger in age (40 vs 65 years: 1.6; 1.1-2.3, current smoker (5.2; 2.7-10.1, obese (BMI 41 vs 26 kg/m(2: 1.4; 1-1.9, and report Māori (1.8; 1.2-2.8 or Pacific (1.6; 1.1-2.5 ancestry, compared to Caucasian. People with gout were more likely to report heavy SSB intake compared to people with diabetes (OR 2.4, 95% CI 1.5-3.9. Heavy SSB consumption reported by people with diabetes was similar if they did or did not require dialysis.A high proportion of patients with gout and type 2 diabetes, including those on haemodialysis, are not responding to health messages to abstain from SSB consumption.

Analysis of the Capabilities Supporting Humanitarian Assistance and Disaster Relief Operations of the Indonesian Navy (TNI AL) and the United States Marine Corps Marine Expeditionary Unit (USMC MEU)

Science.gov (United States)

2015-12-01

Operating Procedure SPMAGTF Special Purpose Marine Air Ground Task Force SSB Single Side Band STP Shock Trauma Platoon TACRON Tactical Air Control...Platoon ( STP ) that is capable of conducting emergency treatment and triage. The remaining corpsmen are dispersed throughout the individual sub-units of...Jane’s navigating the emerging markets , Indonesia. Retrieved from Jane’s Information Group https://janes.ihs.com.libproxy.nps.edu/CustomPages/Janes

RecO protein initiates DNA recombination and strand annealing through two alternative DNA binding mechanisms.

Science.gov (United States)

Ryzhikov, Mikhail; Gupta, Richa; Glickman, Michael; Korolev, Sergey

2014-10-17

Recombination mediator proteins (RMPs) are important for genome stability in all organisms. Several RMPs support two alternative reactions: initiation of homologous recombination and DNA annealing. We examined mechanisms of RMPs in both reactions with Mycobacterium smegmatis RecO (MsRecO) and demonstrated that MsRecO interacts with ssDNA by two distinct mechanisms. Zinc stimulates MsRecO binding to ssDNA during annealing, whereas the recombination function is zinc-independent and is regulated by interaction with MsRecR. Thus, different structural motifs or conformations of MsRecO are responsible for interaction with ssDNA during annealing and recombination. Neither annealing nor recombinase loading depends on MsRecO interaction with the conserved C-terminal tail of single-stranded (ss) DNA-binding protein (SSB), which is known to bind Escherichia coli RecO. However, similarly to E. coli proteins, MsRecO and MsRecOR do not dismiss SSB from ssDNA, suggesting that RMPs form a complex with SSB-ssDNA even in the absence of binding to the major protein interaction motif. We propose that alternative conformations of such complexes define the mechanism by which RMPs initiate the repair of stalled replication and support two different functions during recombinational repair of DNA breaks. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

The influence of oxygen on the induction of radiation damage in DNA in mammalian cells after sensitization by intracellular glutathione depletion

International Nuclear Information System (INIS)

Schans, G.P. van der; Vos, O.; Roos-Verheij, W.S.D.; Lohman, P.H.M.

1986-05-01

Treatment of mammalian cells with buthionine sulphoximine (BSO) or diethyl maleate (DEM) results in a decrease in the intracellular GSH (glutathione) and NPSH (non-protein-bound SH) levels. The effect of depletion of GSH and NPSH on radiosensitivity was studied in relation to the concentration of oxygen during irradiation. Single- and double-strand DNA breaks (ssb and dsb) and cell killing were used as criteria for radiation damage. Under aerobic conditions, BSO and DEM treatment gave a small sensitization of 10-20% for the 3 types of radiation damage. Also under severely hypoxic conditions (0.01 μM oxygen in the medium) the sensitizing effect of both compounds on the induction of ssb and dsb and on cell killing was small (0-30%). At somewhat higher concentrations of oxygen (0.5-10 μM) however, the sensitization amounted to about 90% for the induction of ssb and dsb and about 50% for cell killing. These results strengthen the widely accepted idea that intracellular SH-compounds compete with oxygen and other electron-affinic radiosensitizers with respect to reaction with radiation-induced damage, thus preventing the fixation of DNA damages by oxygen. These results imply that the extent to which SH-compounds affect the radiosensitivity of cells in vivo depends strongly on the local concentration of oxygen. (Auth.)

Calculation of direct effects of {sup 60}Co gamma rays on the different DNA structural levels: A simulation study using the Geant4-DNA toolkit

Energy Technology Data Exchange (ETDEWEB)

Tajik, Marjan; Rozatian, Amir S.H. [Department of Physics, University of Isfahan, Hezar Jarib Street, Isfahan 81746-73441 (Iran, Islamic Republic of); Semsarha, Farid, E-mail: Semsarha@ibb.ut.ac.ir [Institute of Biochemistry and Biophysics (IBB), University of Tehran, P.O. Box: 13145-1384, Tehran (Iran, Islamic Republic of)

2015-03-01

In this study, simple single strand breaks (SSB) and double strand breaks (DSB) due to direct effects of the secondary electron spectrum of {sup 60}Co gamma rays on different organizational levels of a volume model of the B-DNA conformation have been calculated using the Geant4-DNA toolkit. Result of this study for the direct DSB yield shows a good agreement with other theoretical and experimental results obtained by both photons and their secondary electrons; however, in the case of SSB a noticeable difference can be observed. Moreover, regarding the almost constant yields of the direct strand breaks in the different structural levels of the DNA, calculated in this work, and compared with some theoretical studies, it can be deduced that the direct strand breaks yields depend mainly on the primary double helix structure of the DNA and the higher-order structures cannot have a noticeable effect on the direct DNA damage inductions by {sup 60}Co gamma rays. In contrast, a direct dependency between the direct SSB and DSB yields and the volume of the DNA structure has been found. Also, a further study on the histone proteins showed that they can play an important role in the trapping of low energy electrons without any significant effect on the direct DNA strand breaks inductions, at least in the range of energies used in the current study.

Children's sugar-sweetened beverages consumption: associations with family and home-related factors, differences within ethnic groups explored.

Science.gov (United States)

van de Gaar, V M; van Grieken, A; Jansen, W; Raat, H

2017-02-14

The consumption of sugar-sweetened beverages (SSB) may contribute to the development of overweight among children. The present study aimed to evaluate associations between family and home-related factors and children's SSB consumption. We explored associations within ethnic background of the child. Cross-sectional data from the population-based 'Water Campaign' study were used. Parents (n = 644) of primary school children (6-13 years) completed a questionnaire on socio-demographic characteristics, family and home-related factors and child's SSB intake. The family and home-related factors under study were: cognitive variables (e.g. parental attitude, subjective norm), environmental variables (e.g. availability of SSB, parenting practices), and habitual variables (e.g. habit strength, taste preference). Regression analyses were used to evaluate the associations between family and home-related factors and child's SSB intake (p ethnic background, with the explained variance of the full models ranging from 8.7% for children from Moroccan or Turkish ethnic background to 44.4% for children with Dutch ethnic background. Our results provide support for interventions targeting children's SSB intake focussing on the identified family and home-related factors, with active participation of parents. Also, the relationships between these factors and the child's SSB intake differed for children with distinct ethnic backgrounds. Therefore, we would recommend to tailor interventions taking into account the ethnic background of the family. Number NTR3400 ; date April 4th 2012; retrospectively registered.

Space Synthetic Biology (SSB)

Data.gov (United States)

National Aeronautics and Space Administration — This project focused on employing advanced biological engineering and bioelectrochemical reactor systems to increase life support loop closure and in situ resource...

Data-driven background predictions for a search of direct gluino pair production in the single-lepton final state using 13 TeV pp-collisions at the CMS experiment

Energy Technology Data Exchange (ETDEWEB)

Lobanov, Artur; Seitz, Claudia; Melzer-Pellmann, Isabell [DESY, Hamburg (Germany)

2016-07-01

We present a search for direct gluino-pair production in events with a single lepton using 13 TeV pp-collisions at the CMS experiment. This final state is characterised by high multiplicities of jets and b-quark jets, as well as a large scalar sum of all jet transverse momenta, and a large scalar sum of the transverse missing momentum and the lepton transverse momentum, called L{sub T}. The dominating Standard Model backgrounds in this phase-space are tt+jets and W+jets production. A data-driven method is used to estimate the background in the search regions. All backgrounds except for QCD in the (high ΔΦ(W,l)) signal regions are predicted by from the number of events in the low ΔΦ(W,l) region, with transfer factors determined also from data, while for the multi-jet events a fake-lepton enriched side-band is used. We conclude by showing predictions and final results from data corresponding to 2.1 fb{sup -1} integrated luminosity recorded with the CMS detector during the LHC Run2 in 2015.

Electron Beam Induced Radiation Damage of the Semiconductor Radiation Detector based on Silicon

International Nuclear Information System (INIS)

Kim, Han Soo; Kim, Yong Kyun; Park, Se Hwan; Haa, Jang Ho; Kang, Sang Mook; Chung, Chong Eun; Cho, Seung Yeon; Park, Ji Hyun; Yoon, Tae Hyung

2005-01-01

A Silicon Surface Barrier (SSB) semiconductor detector which is generally used to detect a charged particle such as an alpha particle was developed. The performance of the developed SSB semiconductor detector was measured with an I-V curve and an alpha spectrum. The response for an alpha particle was measured by Pu-238 sources. A SSB semiconductor detector was irradiated firstly at 30sec, at 30μA and secondly 40sec, 40μA with a 2MeV pulsed electron beam generator in KAERI. And the electron beam induced radiation damage of a homemade SSB detector and the commercially available PIN photodiode were investigated. An annealing effect of the damaged SSB and PIN diode detector were also investigated using a Rapid Thermal Annealing (RTA). This data may assist in designing the silicon based semiconductor radiation detector when it is operated in a high radiation field such as space or a nuclear power plant

Controlled cohort evaluation of the LiveLighter mass media campaign's impact on adults' reported consumption of sugar-sweetened beverages.

Science.gov (United States)

Morley, Belinda C; Niven, Philippa H; Dixon, Helen G; Swanson, Maurice G; McAleese, Alison B; Wakefield, Melanie A

2018-04-25

To evaluate the LiveLighter 'Sugary Drinks' campaign impact on awareness, knowledge and sugar-sweetened beverage (SSB) consumption. Cohort study with population surveys undertaken in intervention and comparison states at baseline (n=900 each), with 78% retention at follow-up (intervention: n=673; comparison: n=730). Analyses tested interactions by state (intervention, comparison) and time (baseline, follow-up). Adults aged 25-49 years residing in the Australian states of Victoria and South Australia. The 6-week mass media campaign ran in Victoria in October/November 2015. It focused on the contribution of SSBs to the development of visceral 'toxic fat', graphically depicted around vital organs, and ultimately serious disease. Paid television advertising was complemented by radio, cinema, online and social media advertising, and stakeholder and community engagement. Self-reported consumption of SSBs, artificially sweetened drinks and water. Campaign recall and recognition; knowledge of the health effects of overweight and SSB consumption; perceived impact of SSB consumption on body weight and of reduced consumption on health. A significant reduction in frequent SSB consumption was observed in the intervention state (intervention: 31% compared with 22%, comparison: 30% compared with 29%; interaction pinteraction p=0.09) among overweight/obese SSB consumers. This group also showed increased knowledge of the health effects of SSB consumption (intervention: 60% compared with 71%, comparison: 63% compared with 59%; interaction pinteraction p=0.06). The findings provide evidence of reduced SSB consumption among adults in the target age range following the LiveLighter campaign. This is notable in a context where public health campaigns occur against a backdrop of heavy commercial product advertising promoting increased SSB consumption. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial

Perception v. actual intakes of junk food and sugar-sweetened beverages in Australian young adults: assessed using the mobile food record.

Science.gov (United States)

Harray, Amelia J; Boushey, Carol J; Pollard, Christina M; Panizza, Chloe E; Delp, Edward J; Dhaliwal, Satvinder S; Kerr, Deborah A

2017-09-01

To determine perception v. actual intakes of energy-dense nutrient-poor 'junk food' (JF) and sugar-sweetened beverages (SSB) in young adults, using the mobile food record (mFR). Before-and-after eating images using a 4 d mFR were assessed for standardised 600 kJ (143 kcal) servings of JF and SSB (excluding diet drinks). Participants reported their concern about the health aspects of their diet, perceptions and intentions regarding JF and SSB. Perth, Western Australia. Adults (n 246) aged 18-30 years. The mean (sd) intake of JF+SSB was 3·7 (2·0) servings/d. Women thinking about drinking less SSB consumed more SSB servings/d (1·5 (1·2)) than men (0·7 (0·5); P<0·05) who were thinking about drinking less. Men not thinking about cutting down JF consumed more servings/d (4·6 (2·4)) than women (2·5 (0·7); P<0·01) who were not thinking about cutting down. Those who paid a lot of attention to the health aspects of their diet consumed less JF+SSB than those who took only a bit of notice (P<0·001), were not really thinking much about it (P<0·001) or who didn't think at all about the health aspects of food (P<0·01). Perceptions and attitudes regarding JF and SSB were associated with level of consumption. Those not thinking about cutting down their intake of these foods represent an important target group as they consume more than their peers. Further research is needed to identify how amenable young adults are to changing their intake, particularly given the lack of attention paid to the health aspects of their diet.

Transverse and temporal characteristics of a high-gain free-electron laser in the saturation regime

CERN Document Server

Huang Zhi Rong

2002-01-01

The transverse and the temporal characteristics of a high-gain free-electron laser are governed by refractive guiding and sideband instability, respectively. Using the self-consistent Vlasov-Maxwell equations, we explicitly determine the effective index of refraction and the guided radiation mode for an electron beam with arbitrary transverse size. Electrons trapped by the guided radiation execute synchrotron oscillation and hence are susceptible to the sideband instability. We explain the spectral evolution and determine the sideband growth rate. These theoretical predictions agree well with GINGER simulation results.

Middle school food environments and racial/ethnic differences in sugar-sweetened beverage consumption: findings from the Healthy Choices study.

Science.gov (United States)

Richmond, Tracy K; Spadano-Gasbarro, Jennifer L; Walls, Courtney E; Austin, S Bryn; Greaney, Mary L; Wang, Monica L; Mezegebu, Solomon; Peterson, Karen E

2013-11-01

Prior studies have demonstrated disproportionate clustering of fast food outlets around schools. The purpose of this study is to determine if racial/ethnic differences in middle school student self-reported sugar-sweetened beverage (SSB) consumption is explained by differential distributions of food outlets surrounding their schools. Baseline (2005) data were analyzed from 18,281 middle school students in 47 Massachusetts schools participating in Healthy Choices, an obesity prevention program. Linear mixed effects models were used to examine the association of individual race/ethnicity and daily SSB consumption and the potential mediating effect of the density of food outlets (the number of fast food outlets and convenience stores in a 1500 m buffer area surrounding the school) on this association adjusting for individual and school demographics. More SSB consumption was reported by students of all racial/ethnic minority groups compared to their White peers except Asians. The density of fast food restaurants and convenience stores was not associated with individual SSB consumption (β=0.001, p=0.875) nor did it mediate the association of race/ethnicity and SSB consumption. Racial and ethnic differences in SSB consumption among MA middle school students cannot be fully explained by the location of fast food restaurants and convenience stores. © 2013.

Caloric compensation for sugar-sweetened beverages in meals: A population-based study in Brazil.

Science.gov (United States)

Gombi-Vaca, Maria Fernanda; Sichieri, Rosely; Verly, Eliseu

2016-03-01

Sugar-sweetened beverage (SSB) consumption can cause positive energy balance, therefore leading to weight gain. A plausible biological mechanism to explain this association is through weak caloric compensation for liquid calories. However, there is an ongoing debate surrounding SSB calorie compensation. The body of evidence comes from a diversity of study designs and highly controlled settings assessing food and beverage intake. Our study aimed to test for caloric compensation of SSB in the free-living setting of daily meals. We analyzed two food records of participants (age 10 years or older) from the 2008-2009 National Dietary Survey (Brazil, N = 34,003). We used multilevel analyses to estimate the within-subject effects of SSB on food intake. Sugar-sweetened beverage calories were not compensated for when comparing daily energy intake over two days for each individual. When comparing meals, we found 42% of caloric compensation for breakfast, no caloric compensation for lunch and zero to 22% of caloric compensation for dinner, differing by household per capita income. In conclusion, SSB consumption contributed to higher energy intake due to weak caloric compensation. Discouraging the intake of SSB especially during lunch and dinner may help reduce excessive energy intake and lead to better weight management. Copyright © 2015 Elsevier Ltd. All rights reserved.

Carrier tracking by smoothing filter improves symbol SNR

Science.gov (United States)

Pomalaza-Raez, Carlos A.; Hurd, William J.

1986-01-01

The potential benefit of using a smoothing filter to estimate carrier phase over use of phase locked loops (PLL) is determined. Numerical results are presented for the performance of three possible configurations of the deep space network advanced receiver. These are residual carrier PLL, sideband aided residual carrier PLL, and finally sideband aiding with a Kalman smoother. The average symbol signal to noise ratio (SNR) after losses due to carrier phase estimation error is computed for different total power SNRs, symbol rates and symbol SNRs. It is found that smoothing is most beneficial for low symbol SNRs and low symbol rates. Smoothing gains up to 0.4 dB over a sideband aided residual carrier PLL, and the combined benefit of smoothing and sideband aiding relative to a residual carrier loop is often in excess of 1 dB.

Carrier tracking by smoothing filter can improve symbol SNR

Science.gov (United States)

Hurd, W. J.; Pomalaza-Raez, C. A.

1985-01-01

The potential benefit of using a smoothing filter to estimate carrier phase over use of phase locked loops (PLL) is determined. Numerical results are presented for the performance of three possible configurations of the deep space network advanced receiver. These are residual carrier PLL, sideband aided residual carrier PLL, and finally sideband aiding with a Kalman smoother. The average symbol signal to noise ratio (CNR) after losses due to carrier phase estimation error is computed for different total power SNRs, symbol rates and symbol SNRs. It is found that smoothing is most beneficial for low symbol SNRs and low symbol rates. Smoothing gains up to 0.4 dB over a sideband aided residual carrier PLL, and the combined benefit of smoothing and sideband aiding relative to a residual carrier loop is often in excess of 1 dB.

Properties of solar gravity mode signals in total irradiance observations

International Nuclear Information System (INIS)

Kroll, R.J.; Chen, J.; Hill, H.A.

1988-01-01

Further evidence has been found that a significant fraction of the gravity mode power density in the total irradiance observations appears in sidebands of classified eigenfrequencies. These sidebands whose amplitudes vary from year to year are interpreted as harmonics of the rotational frequencies of the nonuniform solar surface. These findings are for non axisymmetric modes and corroborate the findings of Kroll, Hill and Chen for axisymmetric modes. It is demonstrated the the generation of the sidebands lifts the usual restriction on the parity of the eigenfunctions for modes detectable in total irradiance observations. 14 refs

Oceanic Area System Improvement Study (OASIS). Volume V. North Atlantic, Central East Pacific, and Caribbean Regions Communication Systems Description.

Science.gov (United States)

1981-09-01

system SENEAM Servicies a la Navagacion en el Espacio Aero Mexicano SSB Single side band USB Upper side band VFR Visual flight rules VHF Very-high...working may mitigate many historical problems associated with HF communications. The ambient noise associated with monitoring an HF frequency led to...airports all have their VHF facilities on site. Communications are the responsibility of the Administration de l’Aeroport International Francois

Averting obesity and type 2 diabetes in India through sugar-sweetened beverage taxation: an economic-epidemiologic modeling study.

Directory of Open Access Journals (Sweden)

Sanjay Basu

2014-01-01

Full Text Available Taxing sugar-sweetened beverages (SSBs has been proposed in high-income countries to reduce obesity and type 2 diabetes. We sought to estimate the potential health effects of such a fiscal strategy in the middle-income country of India, where there is heterogeneity in SSB consumption, patterns of substitution between SSBs and other beverages after tax increases, and vast differences in chronic disease risk within the population.Using consumption and price variations data from a nationally representative survey of 100,855 Indian households, we first calculated how changes in SSB price alter per capita consumption of SSBs and substitution with other beverages. We then incorporated SSB sales trends, body mass index (BMI, and diabetes incidence data stratified by age, sex, income, and urban/rural residence into a validated microsimulation of caloric consumption, glycemic load, overweight/obesity prevalence, and type 2 diabetes incidence among Indian subpopulations facing a 20% SSB excise tax. The 20% SSB tax was anticipated to reduce overweight and obesity prevalence by 3.0% (95% CI 1.6%-5.9% and type 2 diabetes incidence by 1.6% (95% CI 1.2%-1.9% among various Indian subpopulations over the period 2014-2023, if SSB consumption continued to increase linearly in accordance with secular trends. However, acceleration in SSB consumption trends consistent with industry marketing models would be expected to increase the impact efficacy of taxation, averting 4.2% of prevalent overweight/obesity (95% CI 2.5-10.0% and 2.5% (95% CI 1.0-2.8% of incident type 2 diabetes from 2014-2023. Given current consumption and BMI distributions, our results suggest the largest relative effect would be expected among young rural men, refuting our a priori hypothesis that urban populations would be isolated beneficiaries of SSB taxation. Key limitations of this estimation approach include the assumption that consumer expenditure behavior from prior years, captured in price

Averting obesity and type 2 diabetes in India through sugar-sweetened beverage taxation: an economic-epidemiologic modeling study.

Science.gov (United States)

Basu, Sanjay; Vellakkal, Sukumar; Agrawal, Sutapa; Stuckler, David; Popkin, Barry; Ebrahim, Shah

2014-01-01

Taxing sugar-sweetened beverages (SSBs) has been proposed in high-income countries to reduce obesity and type 2 diabetes. We sought to estimate the potential health effects of such a fiscal strategy in the middle-income country of India, where there is heterogeneity in SSB consumption, patterns of substitution between SSBs and other beverages after tax increases, and vast differences in chronic disease risk within the population. Using consumption and price variations data from a nationally representative survey of 100,855 Indian households, we first calculated how changes in SSB price alter per capita consumption of SSBs and substitution with other beverages. We then incorporated SSB sales trends, body mass index (BMI), and diabetes incidence data stratified by age, sex, income, and urban/rural residence into a validated microsimulation of caloric consumption, glycemic load, overweight/obesity prevalence, and type 2 diabetes incidence among Indian subpopulations facing a 20% SSB excise tax. The 20% SSB tax was anticipated to reduce overweight and obesity prevalence by 3.0% (95% CI 1.6%-5.9%) and type 2 diabetes incidence by 1.6% (95% CI 1.2%-1.9%) among various Indian subpopulations over the period 2014-2023, if SSB consumption continued to increase linearly in accordance with secular trends. However, acceleration in SSB consumption trends consistent with industry marketing models would be expected to increase the impact efficacy of taxation, averting 4.2% of prevalent overweight/obesity (95% CI 2.5-10.0%) and 2.5% (95% CI 1.0-2.8%) of incident type 2 diabetes from 2014-2023. Given current consumption and BMI distributions, our results suggest the largest relative effect would be expected among young rural men, refuting our a priori hypothesis that urban populations would be isolated beneficiaries of SSB taxation. Key limitations of this estimation approach include the assumption that consumer expenditure behavior from prior years, captured in price elasticities

Projected Impact of Mexico?s Sugar-Sweetened Beverage Tax Policy on Diabetes and Cardiovascular Disease: A Modeling Study

OpenAIRE

S?nchez-Romero, Luz Maria; Penko, Joanne; Coxson, Pamela G.; Fern?ndez, Alicia; Mason, Antoinette; Moran, Andrew E.; ?vila-Burgos, Leticia; Odden, Michelle; Barquera, Sim?n; Bibbins-Domingo, Kirsten

2016-01-01

Background Rates of diabetes in Mexico are among the highest worldwide. In 2014, Mexico instituted a nationwide tax on sugar-sweetened beverages (SSBs) in order to reduce the high level of SSB consumption, a preventable cause of diabetes and cardiovascular disease (CVD). We used an established computer simulation model of CVD and country-specific data on demographics, epidemiology, SSB consumption, and short-term changes in consumption following the SSB tax in order to project potential long-...

A Conceptually Simple Modeling Approach for Jason-1 Sea State Bias Correction Based on 3 Parameters Exclusively Derived from Altimetric Information

Directory of Open Access Journals (Sweden)

Nelson Pires

2016-07-01

Full Text Available A conceptually simple formulation is proposed for a new empirical sea state bias (SSB model using information retrieved entirely from altimetric data. Nonparametric regression techniques are used, based on penalized smoothing splines adjusted to each predictor and then combined by a Generalized Additive Model. In addition to the significant wave height (SWH and wind speed (U10, a mediator parameter designed by the mean wave period derived from radar altimetry, has proven to improve the model performance in explaining some of the SSB variability, especially in swell ocean regions with medium-high SWH and low U10. A collinear analysis of scaled sea level anomalies (SLA variance differences shows conformity between the proposed model and the established SSB models. The new formulation aims to be a fast, reliable and flexible SSB model, in line with the well-settled SSB corrections, depending exclusively on altimetric information. The suggested method is computationally efficient and capable of generating a stable model with a small training dataset, a useful feature for forthcoming missions.

Association Between Sugar-Sweetened Beverage Intake and Proxies of Acculturation Among U.S. Hispanic and Non-Hispanic White Adults

Science.gov (United States)

Park, Sohyun; Blanck, Heidi M.; Dooyema, Carrie A.; Ayala, Guadalupe X.

2015-01-01

Purpose This study examined associations between sugar-sweetened beverage (SSB) intake and acculturation among a sample representing civilian noninstitutionalized U.S. adults. Design Quantitative, cross-sectional study. Setting National. Subjects The 2010 National Health Interview Survey data for 17,142 Hispanics and U.S.-born non-Hispanic whites (≥18 years). Measures The outcome variable was daily SSB intake (nondiet soda, fruit drinks, sports drinks, energy drinks, and sweetened coffee/tea drinks). Exposure variables were Hispanic ethnicity and proxies of acculturation (language of interview, birthplace, and years living in the United States). Analysis We used multivariate logistic regression to estimate adjusted odds ratios (ORs) for the exposure variables associated with drinking SSB ≥ 1 time/d after controlling for covariates. Results The adjusted odds of drinking SSB ≥ 1 time/d was significantly higher among Hispanics who completed the interview in Spanish (OR = 1.65) than U.S.-born non-Hispanic whites. Compared with those who lived in the United States for important subpopulations that may benefit from targeted intervention to reduce SSB intake. PMID:27404644

Targeting Overconsumption of Sugar-Sweetened Beverages vs. Overall Poor Diet Quality for Cardiometabolic Diseases Risk Prevention: Place Your Bets!

Science.gov (United States)

Arsenault, Benoit J; Lamarche, Benoît; Després, Jean-Pierre

2017-06-13

Chronic overconsumption of sugar-sweetened beverages (SSBs) is amongst the dietary factors most consistently found to be associated with obesity, type 2 diabetes (T2D) and cardiovascular disease (CVD) risk in large epidemiological studies. Intervention studies have shown that SSB overconsumption increases intra-abdominal obesity and ectopic lipid deposition in the liver, and also exacerbates cardiometabolic risk. Similar to the prevalence of obesity and T2D, national surveys of food consumption have shown that chronic overconsumption of SSBs is skyrocketing in many parts of the world, yet with marked heterogeneity across countries. SSB overconsumption is also particularly worrisome among children and adolescents. Although the relationships between SSB overconsumption and obesity, T2D, and CVD are rather consistent in epidemiological studies, it has also been shown that SSB overconsumption is part of an overall poor dietary pattern and is particularly prevalent among subgroups of the population with low socioeconomic status, thereby questioning the major focus on SSBs to target/prevent cardiometabolic diseases. Public health initiatives aimed specifically at decreasing SSB overconsumption will most likely be successful in influencing SSB consumption per se. However, comprehensive strategies targeting poor dietary patterns and aiming at improving global dietary quality are likely to have much more impact in addressing the unprecedented public health challenges that we are currently facing.

The government policy related to sugar-sweetened beverages in Indonesia

Directory of Open Access Journals (Sweden)

Mohamad Thahir Haning

2016-09-01

Full Text Available Background: There are several options to enforce reduction in the use of sugary drinks such as strengthening regulations, taxation on the products and food labeling.  Aims & Objectives: 1 Identify the policy in Indonesia that regulates the quantity and the use of sugar in a beverage product; 2 Describe the sugar content in sugar-sweetened beverages (SSB and its impact on human health. Material & Methods: Literature search on sugar use and tax policies on SSB was conducted and 6 relevant documents were found. A total of 91 SSB products were selected systematically by randomly selecting 5 beverages per day for 20 days. Beverages chosen were certified Halal by Majelis Ulama Indonesia, having product labeling, and certified by BPOM. Results: Indonesia has no policy related to restriction of sugar use. The contribution of sugar to energy of SSB products is quite high (75.68%. SSB intake may increase the risk of obesity and non-communicable diseases. Conclusion: The absence of tax policy and rules for regulating the use of sugar in a product can cause an increase in sugar consumption per day. It could potentially lead to non-communicable diseases and could have enormous consequences in health financing. The government needs to create policies for preventing the widespread impact of sugar consumption. Advocacy efforts to encourage the establishment of SSB taxation should be done.

School beverage environment and children's energy expenditure associated with physical education class: an agent-based model simulation.

Science.gov (United States)

Chen, H-J; Xue, H; Kumanyika, S; Wang, Y

2017-06-01

Physical activity contributes to children's energy expenditure and prevents excess weight gain, but fluid replacement with sugar-sweetened beverages (SSBs) may diminish this benefit. The aim of this study was to explore the net energy expenditure (EE) after physical education (PE) class given the competition between water and SSB consumption for rehydration and explore environmental factors that may influence the net EE, e.g. PE duration, affordability of SSB and students' SSB preference. We built an agent-based model that simulates the behaviour of 13-year-old children in a PE class with nearby water fountains and SSB vending machines available. A longer PE class contributed to greater prevalence of dehydration and required more time for rehydration. The energy cost of a PE class with activity intensity equivalent to 45 min of jogging is about 300 kcal on average, i.e. 10-15% of average 13-year-old children's total daily EE. Adding an SSB vending machine could offset PE energy expenditure by as much as 90 kcal per child, which was associated with PE duration, students' pocket money and SSB preference. Sugar-sweetened beverage vending machines in school may offset some of the EE in PE classes. This could be avoided if water is the only readily available source for children's fluid replacement after class. © 2016 World Obesity Federation.

Targeting Overconsumption of Sugar-Sweetened Beverages vs. Overall Poor Diet Quality for Cardiometabolic Diseases Risk Prevention: Place Your Bets!

Directory of Open Access Journals (Sweden)

Benoit J. Arsenault

2017-06-01

Full Text Available Chronic overconsumption of sugar-sweetened beverages (SSBs is amongst the dietary factors most consistently found to be associated with obesity, type 2 diabetes (T2D and cardiovascular disease (CVD risk in large epidemiological studies. Intervention studies have shown that SSB overconsumption increases intra-abdominal obesity and ectopic lipid deposition in the liver, and also exacerbates cardiometabolic risk. Similar to the prevalence of obesity and T2D, national surveys of food consumption have shown that chronic overconsumption of SSBs is skyrocketing in many parts of the world, yet with marked heterogeneity across countries. SSB overconsumption is also particularly worrisome among children and adolescents. Although the relationships between SSB overconsumption and obesity, T2D, and CVD are rather consistent in epidemiological studies, it has also been shown that SSB overconsumption is part of an overall poor dietary pattern and is particularly prevalent among subgroups of the population with low socioeconomic status, thereby questioning the major focus on SSBs to target/prevent cardiometabolic diseases. Public health initiatives aimed specifically at decreasing SSB overconsumption will most likely be successful in influencing SSB consumption per se. However, comprehensive strategies targeting poor dietary patterns and aiming at improving global dietary quality are likely to have much more impact in addressing the unprecedented public health challenges that we are currently facing.

Comparison of DNA strand-break simulated with different DNA models

International Nuclear Information System (INIS)

Xie, Wenzhang; Li, Junli; Qiu, Rui; Yan, Congchong; Zeng, Zhi; Li, Chunyan

2013-01-01

Full text of the publication follows. In Monte Carlo simulation of DNA damage, the geometric model of DNA is of great importance. To study the influence of DNA model on the simulation of DNA damage, three DNA models were created in this paper. They were a volume model and two atomic models with different parameters. Direct DNA strand-break induced by low-energy electrons were simulated respectively with the three models. The results show that most of the energy depositions in the DNA segments do not lead to strand-breaks. The simple single strand-break (SSB) tends to be the predominant damage type, and the contribution of complex double strand-break (DSB) to the total DSB cannot be neglected. Among the yields of all the three DNA target models applied here, the yields of the volume model are the highest, the yields of the atomic model with double van der Waals radii (r) take the second place, whereas the yields of the atomic model with single r come last. On average, the ratios of SSB yields are approximately equivalent to the corresponding ratios of the models' volume. However, there seems to be no clear relationship between the DSB yields and the models' volume. (authors)

Sugar-sweetened beverage intake and cardiovascular risk factor profile in youth with type 1 diabetes: application of measurement error methodology in the SEARCH Nutrition Ancillary Study.

Science.gov (United States)

Liese, Angela D; Crandell, Jamie L; Tooze, Janet A; Kipnis, Victor; Bell, Ronny; Couch, Sarah C; Dabelea, Dana; Crume, Tessa L; Mayer-Davis, Elizabeth J

2015-08-14

The SEARCH Nutrition Ancillary Study aims to investigate the role of dietary intake on the development of long-term complications of type 1 diabetes in youth, and capitalise on measurement error (ME) adjustment methodology. Using the National Cancer Institute (NCI) method for episodically consumed foods, we evaluated the relationship between sugar-sweetened beverage (SSB) intake and cardiovascular risk factor profile, with the application of ME adjustment methodology. The calibration sample included 166 youth with two FFQ and three 24 h dietary recall data within 1 month. The full sample included 2286 youth with type 1 diabetes. SSB intake was significantly associated with higher TAG, total and LDL-cholesterol concentrations, after adjusting for energy, age, diabetes duration, race/ethnicity, sex and education. The estimated effect size was larger (model coefficients increased approximately 3-fold) after the application of the NCI method than without adjustment for ME. Compared with individuals consuming one serving of SSB every 2 weeks, those who consumed one serving of SSB every 2 d had 3.7 mg/dl (0.04 mmol/l) higher TAG concentrations and 4.0 mg/dl (0.10 mmol/l) higher total cholesterol and LDL-cholesterol concentrations, after adjusting for ME and covariates. SSB intake was not associated with measures of adiposity and blood pressure. Our findings suggest that SSB intake is significantly related to increased lipid levels in youth with type 1 diabetes, and that estimates of the effect size of SSB on lipid levels are severely attenuated in the presence of ME. Future studies in youth with diabetes should consider a design that will allow for the adjustment for ME when studying the influence of diet on health status.

A tax on sugar sweetened beverages in Colombia: Estimating the impact on overweight and obesity prevalence across socio economic levels.

Science.gov (United States)

Vecino-Ortiz, Andres I; Arroyo-Ariza, Daniel

2018-05-26

Colombia has a high prevalence of overweight (56%) and obesity (19%) among adults and is experiencing a growing trend in the prevalence of associated chronic conditions. Evidence suggests that sugar sweetened beverages (SSB) are associated to overweight/obesity, and that taxes on these beverages could reduce their associated health consequences. This paper assesses the potential effect of different levels of a SSB tax in Colombia on overweight and obesity prevalence. Using peer-reviewed local data on own-price elasticity of SSB, we applied a comparative risk assessment strategy to simulate the effect of the SSB tax on a nationally representative nutritional survey with 7140 adults in 2010 (ENSIN, 2010). Our results varied depending on the tax scenario, pass-through assumption and household socio economic strata (SES). We found that among individuals belonging to lower SES households, the SSB tax would reduce overweight and obesity between 1.5-4.9 and 1.1-2.4 percentage points (p tax rate of at least 75 cents of Colombian peso (0.75 COP) per milliliter (24% of the average price) is needed to have statistically significant effects on both overweight and obesity prevalence among lower SES households. The results of this study suggest that a SSB tax could reduce the overweight and obesity prevalence in Colombia, especially among lower SES households. This study shows that SSB taxes have a particularly beneficial effect in the most vulnerable population. Additional social and individual benefits, or individual costs arising from the tax are not assessed in this research, implying that even larger health gains could be observed. Copyright © 2018 Elsevier Ltd. All rights reserved.

Measurement of Secular Motion Frequency in Miniature Paul Trap to Ascertain the Stability Parameters

International Nuclear Information System (INIS)

Bin, Guo; Hua, Guan; Qu, Liu; Yao, Huang; Xue-Ren, Huang; Ke-Lin, Gao

2010-01-01

40 Ca + ions are trapped and laser cooled in a miniature Paul trap. The secular motion was observed by the radio-frequency resonance of the ion cloud and Zeeman profile sidebands of a single ion experimentally. The trap stability parameters a and q are determined with an uncertainty under 1 % by the secular motion frequency measurement. The trap efficiency is 0.75. A practicable suggestion is given for the benefits of a new trap design. (atomic and molecular physics)

Ultraviolet light induces double-strand breaks in DNA of cultured human P3 cells as measured by neutral filter elution

International Nuclear Information System (INIS)

Peak, J.G.; Peak, M.J.

1990-01-01

Neutral filter elution at pH 7.2 and 9.6 was used to measure the induction of DNA lesions in human P3 teratocarcinoma cells by monochromatic 254-, 270-, 313-, 334-, 334-,365-, and 405-nm radiation and by 60 gamma rays. In this assay DNA double-strand breaks (dsb) increase the rate of elution of DNA from cell lysates on a filter. Yields of dsb as measured by this procedure were determined by using a calibration of the assay that correlates elution parameters with number of dsb caused by disintegration of 125 I incorporated into the DNA. Analysis of fluence responses obtained by using the calibrated assay indicated that the number of dsb induced per dalton of DNA as measured by this assay is proportional to the square of the fluence at all the energies of radiation studied, implying that the induction of these lesions may be a two-hit event. Analysis of the relative efficiencies for the induction of dsb by ultraviolet radiation, corrected for quantum efficiency, revealed a spectrum that coincided closely with that for the induction of single-strand breaks (ssb) in the same cells, having a close fit with the spectrum of nucleic acid in the UVC and UVB region below 313 nm, and a shoulder in the UVA region. It was calculated, however, that there may be too few ssb for dsb to result from randomly distributed closely opposed ssb. (author)

Cleavage of thymine N3-H bonds by low-energy electrons attached to base π* orbitals

International Nuclear Information System (INIS)

Theodore, Magali; Sobczyk, Monika; Simons, Jack

2006-01-01

In this work, we extend our earlier studies on single strand break (SSB) formation in DNA to consider the possibility of cleaving a thymine N 3 -H bond to generate a nitrogen-centered anion and a hydrogen radical which might proceed to induce further bond cleavages. In earlier studies, we considered SSBs induced by low-energy electrons that attach to DNA bases' π* orbitals or to phosphate P=O π* orbitals to cleave sugar-phosphate C-O bonds or base-sugar N 1 -C bonds. We also studied the effects of base π-stacking on the rates of such bond cleavages. To date, our results suggest that sugar-phosphate C-O bonds have the lowest barriers to cleavage, that attachment of electrons with energies below 2 eV most likely occurs at the base π* orbitals, that electrons with energy above 2 eV can also attach to phosphate P=O π* orbitals, and that base π stacking has a modest but slowing effect on the rates of SSB formation. However, we had not yet examined the possibility that base N 3 -H bonds could rupture subsequent to base π* orbital capture. In the present work, the latter possibility is considered and it is found that the barrier to cleavage of the N 3 -H bond in thymine is considerably higher than for cleaving sugar-phosphate C-O bonds, so our prediction that SSB formation is dominated by C-O bond cleavage remains intact

Employment Impact of Sugar-Sweetened Beverage Taxes

Science.gov (United States)

Powell, Lisa M.; Wada, Roy; Persky, Joseph J.; Chaloupka, Frank J.

2014-01-01

Objectives. We assessed the impact of sugar-sweetened beverage (SSB) taxes on net employment. Methods. We used a macroeconomic simulation model to assess the employment impact of a 20% SSB tax accounting for changes in SSB demand, substitution to non-SSBs, income effects, and government expenditures of tax revenues for Illinois and California in 2012. Results. We found increased employment of 4406 jobs in Illinois and 6654 jobs in California, representing a respective 0.06% and 0.03% change in employment. Declines in employment within the beverage industry occurred but were offset by new employment in nonbeverage industry and government sectors. Conclusions. SSB taxes do not have a negative impact on state-level employment, and industry claims of regional job losses are overstated and may mislead lawmakers and constituents. PMID:24524492

Full-duplex radio-over-fiber system with tunable millimeter-wave signal generation and wavelength reuse for upstream signal.

Science.gov (United States)

Wang, Yiqun; Pei, Li; Li, Jing; Li, Yueqin

2017-06-10

A full-duplex radio-over-fiber system is proposed, which provides both the generation of a millimeter-wave (mm-wave) signal with tunable frequency multiplication factors (FMFs) and wavelength reuse for uplink data. A dual-driving Mach-Zehnder modulator and a phase modulator are cascaded to form an optical frequency comb. An acousto-optic tunable filter based on a uniform fiber Bragg grating (FBG-AOTF) is employed to select three target optical sidebands. Two symmetrical sidebands are chosen to generate mm waves with tunable FMFs up to 16, which can be adjusted by changing the frequency of the applied acoustic wave. The optical carrier is reused at the base station for uplink connection. FBG-AOTFs driven by two acoustic wave signals are experimentally fabricated and further applied in the proposed scheme. Results of the research indicate that the 2-Gbit/s data can be successfully transmitted over a 25-km single-mode fiber for bidirectional full-duplex channels with power penalty of less than 2.6 dB. The feasibility of the proposed scheme is verified by detailed simulations and partial experiments.

Dimension-dependent stimulated radiative interaction of a single electron quantum wavepacket

Science.gov (United States)

Gover, Avraham; Pan, Yiming

2018-06-01

In the foundation of quantum mechanics, the spatial dimensions of electron wavepacket are understood only in terms of an expectation value - the probability distribution of the particle location. One can still inquire how the quantum electron wavepacket size affects a physical process. Here we address the fundamental physics problem of particle-wave duality and the measurability of a free electron quantum wavepacket. Our analysis of stimulated radiative interaction of an electron wavepacket, accompanied by numerical computations, reveals two limits. In the quantum regime of long wavepacket size relative to radiation wavelength, one obtains only quantum-recoil multiphoton sidebands in the electron energy spectrum. In the opposite regime, the wavepacket interaction approaches the limit of classical point-particle acceleration. The wavepacket features can be revealed in experiments carried out in the intermediate regime of wavepacket size commensurate with the radiation wavelength.

Functional characterization of an alkaline exonuclease and single strand annealing protein from the SXT genetic element of Vibrio cholerae

Directory of Open Access Journals (Sweden)

Huang Jian-dong

2011-04-01

Full Text Available Abstract Background SXT is an integrating conjugative element (ICE originally isolated from Vibrio cholerae, the bacterial pathogen that causes cholera. It houses multiple antibiotic and heavy metal resistance genes on its ca. 100 kb circular double stranded DNA (dsDNA genome, and functions as an effective vehicle for the horizontal transfer of resistance genes within susceptible bacterial populations. Here, we characterize the activities of an alkaline exonuclease (S066, SXT-Exo and single strand annealing protein (S065, SXT-Bet encoded on the SXT genetic element, which share significant sequence homology with Exo and Bet from bacteriophage lambda, respectively. Results SXT-Exo has the ability to degrade both linear dsDNA and single stranded DNA (ssDNA molecules, but has no detectable endonuclease or nicking activities. Adopting a stable trimeric arrangement in solution, the exonuclease activities of SXT-Exo are optimal at pH 8.2 and essentially require Mn2+ or Mg2+ ions. Similar to lambda-Exo, SXT-Exo hydrolyzes dsDNA with 5'- to 3'-polarity in a highly processive manner, and digests DNA substrates with 5'-phosphorylated termini significantly more effectively than those lacking 5'-phosphate groups. Notably, the dsDNA exonuclease activities of both SXT-Exo and lambda-Exo are stimulated by the addition of lambda-Bet, SXT-Bet or a single strand DNA binding protein encoded on the SXT genetic element (S064, SXT-Ssb. When co-expressed in E. coli cells, SXT-Bet and SXT-Exo mediate homologous recombination between a PCR-generated dsDNA fragment and the chromosome, analogous to RecET and lambda-Bet/Exo. Conclusions The activities of the SXT-Exo protein are consistent with it having the ability to resect the ends of linearized dsDNA molecules, forming partially ssDNA substrates for the partnering SXT-Bet single strand annealing protein. As such, SXT-Exo and SXT-Bet may function together to repair or process SXT genetic elements within infected V

Nativity is associated with sugar-sweetened beverage and fast-food meal consumption among mexican-origin women in Texas border colonias

Directory of Open Access Journals (Sweden)

Johnson Cassandra M

2011-09-01

Full Text Available Abstract Background Trends of increasing obesity are especially pronounced among Mexican-origin women. There is little understanding of dietary patterns among U.S.- and Mexico-born Mexican-origin individuals residing in new-destination immigrant communities in the United States, especially behaviors related to obesity, such as consumption of sugar-sweetened beverages (SSB and fast-food meals (FFM. Methods The study used survey data of 599 adult Mexican-origin women from the 610 women who completed the 2009 Colonia Household and Community Food Resource Assessment (C-HCFRA, which was completed in person by trained promotora-researchers in 44 colonias near the Texas border towns of Progreso and La Feria. Data included demographic characteristics (age, education, nativity or country of birth, household income, household composition, and employment status, access to transportation, self-reported height and weight, food and nutrition assistance program participation, and consumption of SSB and FFM. Descriptive statistics were calculated by nativity (U.S.-born vs. Mexico-born; multivariable linear regression models were estimated for correlates of consumption of SSB and FFM. Results There are three major findings related to nativity. First, U.S.-born women consumed more SSB and FFM than Mexican-born counterparts in the same areas of colonias. Second, in the combined sample and controlling for other population characteristics, being born in Mexico was independently associated with FFM (fewer FFM, but not with SSB. Third, in analyses stratified by nativity, FFM and SSB were associated with each other among both nativity groups. Among Mexico-born women only, age, presence of a child, or being a lone parent was significantly associated with SSB; full-time employment, being a lone parent, and SSB consumption were each independently associated with increased frequency of FFM. Conclusions Our analyses revealed differences in prevalence and correlates of SSB

Sugar-Sweetened Beverages and Obesity Risk in Children and Adolescents: A Systematic Analysis on How Methodological Quality May Influence Conclusions.

Science.gov (United States)

Bucher Della Torre, Sophie; Keller, Amélie; Laure Depeyre, Jocelyne; Kruseman, Maaike

2016-04-01

In the context of a worldwide high prevalence of childhood obesity, the role of sugar-sweetened beverage (SSB) consumption as a cause of excess weight gain remains controversial. Conflicting results may be due to methodological issues in original studies and in reviews. The aim of this review was to systematically analyze the methodology of studies investigating the influence of SSB consumption on risk of obesity and obesity among children and adolescents, and the studies' ability to answer this research question. A systematic review of cohort and experimental studies published until December 2013 in peer-reviewed journals was performed on Medline, CINAHL, Web of Knowledge, and ClinicalTrials.gov. Studies investigating the influence of SSB consumption on risk of obesity and obesity among children and adolescents were included, and methodological quality to answer this question was assessed independently by two investigators using the Academy of Nutrition and Dietetics Quality Criteria Checklist. Among the 32 identified studies, nine had positive quality ratings and 23 studies had at least one major methodological issue. Main methodological issues included SSB definition and inadequate measurement of exposure. Studies with positive quality ratings found an association between SSB consumption and risk of obesity or obesity (n=5) (ie, when SSB consumption increased so did obesity) or mixed results (n=4). Studies with a neutral quality rating found a positive association (n=7), mixed results (n=9), or no association (n=7). The present review shows that the majority of studies with strong methodology indicated a positive association between SSB consumption and risk of obesity or obesity, especially among overweight children. In addition, study findings highlight the need for the careful and precise measurement of the consumption of SSBs and of important confounders. Copyright © 2016 Academy of Nutrition and Dietetics. Published by Elsevier Inc. All rights reserved.

Controlled cohort evaluation of the LiveLighter mass media campaign’s impact on adults’ reported consumption of sugar-sweetened beverages

Science.gov (United States)

Morley, Belinda C; Niven, Philippa H; Dixon, Helen G; Swanson, Maurice G; McAleese, Alison B; Wakefield, Melanie A

2018-01-01

Objective To evaluate the LiveLighter ‘Sugary Drinks’ campaign impact on awareness, knowledge and sugar-sweetened beverage (SSB) consumption. Design Cohort study with population surveys undertaken in intervention and comparison states at baseline (n=900 each), with 78% retention at follow-up (intervention: n=673; comparison: n=730). Analyses tested interactions by state (intervention, comparison) and time (baseline, follow-up). Setting and participants Adults aged 25–49 years residing in the Australian states of Victoria and South Australia. Intervention The 6-week mass media campaign ran in Victoria in October/November 2015. It focused on the contribution of SSBs to the development of visceral ‘toxic fat’, graphically depicted around vital organs, and ultimately serious disease. Paid television advertising was complemented by radio, cinema, online and social media advertising, and stakeholder and community engagement. Primary outcome measure Self-reported consumption of SSBs, artificially sweetened drinks and water. Secondary outcome measures Campaign recall and recognition; knowledge of the health effects of overweight and SSB consumption; perceived impact of SSB consumption on body weight and of reduced consumption on health. Results A significant reduction in frequent SSB consumption was observed in the intervention state (intervention: 31% compared with 22%, comparison: 30% compared with 29%; interaction pconsumers. This group also showed increased knowledge of the health effects of SSB consumption (intervention: 60% compared with 71%, comparison: 63% compared with 59%; interaction padvertising promoting increased SSB consumption. PMID:29695387

Contrasting effects of ethylene biosynthesis on induced plant resistance against a chewing and a piercing-sucking herbivore in rice.

Science.gov (United States)

Lu, Jing; Li, Jiancai; Ju, Hongping; Liu, Xiaoli; Erb, Matthias; Wang, Xia; Lou, Yonggen

2014-11-01

Ethylene is a stress hormone with contrasting effects on herbivore resistance. However, it remains unknown whether these differences are plant- or herbivore-specific. We cloned a rice 1-aminocyclopropane-1-carboxylic acid (ACC) synthase gene, OsACS2, whose transcripts were rapidly up-regulated in response to mechanical wounding and infestation by two important pests: the striped stem borer (SSB) Chilo suppressalis and the brown planthopper (BPH) Nilaparvata lugens. Antisense expression of OsACS2 (as-acs) reduced elicited ethylene emission, SSB-elicited trypsin protease inhibitor (TrypPI) activity, SSB-induced volatile release, and SSB resistance. Exogenous application of ACC restored TrypPI activity and SSB resistance. In contrast to SSB, BPH infestation increased volatile emission in as-acs lines. Accordingly, BPH preferred to feed and oviposit on wild-type (WT) plants--an effect that could be attributed to two repellent volatiles, 2-heptanone and 2-heptanol, that were emitted in higher amounts by as-acs plants. BPH honeydew excretion was reduced and natural enemy attraction was enhanced in as-acs lines, resulting in higher overall resistance to BPH. These results demonstrate that ethylene signaling has contrasting, herbivore-specific effects on rice defense responses and resistance against a chewing and a piercing-sucking insect, and may mediate resistance trade-offs between herbivores of different feeding guilds in rice. © The Author 2014. Published by the Molecular Plant Shanghai Editorial Office in association with Oxford University Press on behalf of CSPB and IPPE, SIBS, CAS.

Two-Copy Wavelength Conversion of an 80 Gbit/s Serial Data Signal Using Cross-Phase Modulation in a Silicon Nanowire and Detailed Pump-Probe Characterisation

DEFF Research Database (Denmark)

Ji, Hua; Cleary, C. S.; Dailey, J. M.

2012-01-01

We experimentally demonstrate 80 Gbit/s wavelength conversion to two copies by simultaneously extracting the blue- and red-shifted sidebands from XPM in a silicon nanowire. Bit error rates of 10-9 with only ~2 dB power penalty is achieved for both sidebands. Detailed pump-probe characterisation r...

Quasiperiodic Raman technique for ultrashort pulse generation

International Nuclear Information System (INIS)

Yavuz, D.D.; Walker, D.R.; Shverdin, M.Y.; Yin, G.Y.; Harris, S.E.

2003-01-01

We report the experimental demonstration of a new Raman technique that produces 200 sidebands, ranging in wavelength from 3 μm to 195 nm. By studying multiphoton ionization of nitric oxide (NO) molecules, we show mutual phase coherence among 15 visible sidebands covering 0.63 octaves of bandwidth

Gender Differences in the relationship between carbonated sugar-sweetened beverage intake and the likelihood of hypertension according to obesity.

Science.gov (United States)

Song, Hong Ji; Paek, Yu Jin; Choi, Min Kyu; Yoo, Ki-Bong; Kang, Jae-Heon; Lee, Hae-Jeung

2017-06-01

The aim of the present study was to investigate the association between hypertension and carbonated sugar-sweetened beverages (SSB) intake according to gender and obesity. The study used data from 2007, 2008 and 2009 Korea National Health and Nutrition Examination Surveys. A total of 9869 subjects (men = 3845 and women = 6024) were included. SSB intakes were calculated from food frequency questionnaires. Odds ratios (ORs) and 95 % confidence interval (CI) for hypertension were assessed using survey logistic regression and multivariable adjusted models. A total of 14.5 % of individuals were classified as having hypertension. The likelihood of hypertension in the third, fourth and fifth quintiles for SSB intake increased to OR 1.00, 1.20 and 1.42 respectively, after adjusting for confounding factors. Compared to the participants in the lowest tertile for SSB intake, participants in the third tertile showed an increased likelihood of hypertension with ORs (CI) of 2.00 (1.21-3.31) and 1.75 (1.23-2.49) for obese women and non-obese men, respectively. The present study showed gender differences in the relationship between carbonated SSB intake and the hypertension according to obesity.

Strategic messaging to promote taxation of sugar-sweetened beverages: lessons from recent political campaigns.

Science.gov (United States)

Jou, Judy; Niederdeppe, Jeff; Barry, Colleen L; Gollust, Sarah E

2014-05-01

This study explored the use of strategic messaging by proponents of sugar-sweetened beverage (SSB) taxation to influence public opinion and shape the policy process, emphasizing the experiences in El Monte and Richmond, California, with SSB tax proposals in 2012. We conducted 18 semistructured interviews with key stakeholders about the use and perceived effectiveness of messages supporting and opposing SSB taxation, knowledge sharing among advocates, message dissemination, and lessons learned from their messaging experiences. The protax messages most frequently mentioned by respondents were reinvesting tax revenue into health-related programs and linking SSB consumption to health outcomes such as obesity and diabetes. The most frequently mentioned antitax messages addressed negative economic effects on businesses and government restriction of personal choice. Factors contributing to perceived messaging success included clearly defining "sugar-sweetened beverage" and earmarking funds for obesity prevention, incorporating cultural sensitivity into messaging, and providing education about the health effects of SSB consumption. Sugar-sweetened beverage taxation has faced significant challenges in gaining political and public support. Future campaigns can benefit from insights gained through the experiences of stakeholders involved in previous policy debates.

Sugar Sweetened Beverage Consumption among Primary School Students: Influence of the Schools' Vicinity.

Science.gov (United States)

Lebel, Alexandre; Morin, Pascale; Robitaille, Éric; Lalonde, Benoit; Florina Fratu, Ramona; Bisset, Sherri

2016-01-01

The purpose of the research was to explore the associations between the characteristics of schools' vicinity and the risk of sugar sweetened beverage (SSB) consumption in elementary students. Findings exposed an important variation in student's SSB consumption between schools. Schools with a lower socioeconomic status or in a densely built environment tend to have higher proportion of regular SSB drinkers. These characteristics of the school's vicinity partly explained the variation observed between them. We estimated that a student moving to a school with a higher proportion of SSB drinkers may increase his/her chances by 52% of becoming a daily consumer. Important changes in dietary preferences can occur when children are in contact with a new social environment. Findings also support the idea that dietary behaviors among children result from the complex interactions between biological, social, and environmental factors.

Silicon surface barrier detector and study of energy spectrum of alpha particles from radioactive source

International Nuclear Information System (INIS)

Verma, S.D.; Sinha, Vijaya

1986-01-01

The principles of working of three commonly used radiation detectors, namely ionization chambers, scintillation counters with photomultiplier tube (PMT) systems and semiconductor detectors are briefly discussed. Out of the semiconductor detectors, the silicon surface barrier (SSB) detector has distinct advantages for detection of radiations, alpha particles in particular. The experimental setup to obtain the energy spectrum of alpha particles from 241 Am source using SSB fabricated in the Physics Department of Gujarat University, Ahmedabad is described. Its performance is compared with scintillation counter using PMT. SSB detector shows a sharp peak of #approx # 3 per cent energy resolution. The factors affecting the peak, namely, electronic noise, source dependent factors and detector-dependent factors are discussed. A method of calibrating SSB detectors based on energy loss mechanism of alpha particles in thin absorbers is described. Applications of such detectors are indicated. (M.G.B.)

Sugar-sweetened beverage intake in relation to semen quality and reproductive hormone levels in young men

DEFF Research Database (Denmark)

Chiu, Y H; Afeiche, M C; Gaskins, A J

2014-01-01

STUDY QUESTION: Is consumption of sugar-sweetened beverages (SSB) associated with semen quality? SUMMARY ANSWER: Higher consumption of SSB was associated with lower sperm motility among healthy, young men. WHAT IS KNOWN ALREADY: The existing literature on the potential role of SSBs on male...... reproductive function is scarce and primarily focused on the relation between caffeinated beverages and semen quality. However, a rodent model suggests that SSBs may hamper male fertility. STUDY DESIGN, SIZE, DURATION: The Rochester Young Men's Study; a cross-sectional study of 189 healthy young men carried...... on the relation between SSB intake and low semen quality beyond the contribution of caffeinated beverages. While our findings are in agreement with recent experimental data in rodents, more studies are required to draw conclusions on the relation of SSB with semen quality or male infertility. STUDY FUNDING...

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

Low frequency phase signal measurement with high frequency squeezing

OpenAIRE

Zhai, Zehui; Gao, Jiangrui

2011-01-01

We calculate the utility of high-frequency squeezed-state enhanced two-frequency interferometry for low-frequency phase measurement. To use the high-frequency sidebands of the squeezed light, a two-frequency intense laser is used in the interferometry instead of a single-frequency laser as usual. We find that the readout signal can be contaminated by the high-frequency phase vibration, but this is easy to check and avoid. A proof-of-principle experiment is in the reach of modern quantum optic...

SU-E-T-05: Comparing DNA Strand Break Yields for Photons under Different Irradiation Conditions with Geant4-DNA.

Science.gov (United States)

Pater, P; Bernal, M; Naqa, I El; Seuntjens, J

2012-06-01

To validate and scrutinize published DNA strand break data with Geant4-DNA and a probabilistic model. To study the impact of source size, electronic equilibrium and secondary electron tracking cutoff on direct relative biological effectiveness (DRBE). Geant4 (v4.9.5) was used to simulate a cylindrical region of interest (ROI) with r = 15 nm and length = 1.05 mm, in a slab of liquid water of 1.06 g/cm 3 density. The ROI was irradiated with mono-energetic photons, with a uniformly distributed volumetric isotropic source (0.28, 1.5 keV) or a plane beam (0.662, 1.25 MeV), of variable size. Electrons were tracked down to 50 or 10 eV, with G4-DNA processes and energy transfer greater than 10.79 eV was scored. Based on volume ratios, each scored event had a 0.0388 probability of happening on either DNA helix (break). Clusters of at least one break on each DNA helix within 3.4 nm were found using a DBSCAN algorithm and categorized as double strand breaks (DSB). All other events were categorized as single strand breaks (SSB). Geant4-DNA is able to reproduce strand break yields previously published. Homogeneous irradiation conditions should be present throughout the ROI for DRBE comparisons. SSB yields seem slightly dependent on the primary photon energy. DRBEs show a significant increasing trend for lower energy incident photons. A lower electron cutoff produces higher SSB yields, but decreases the SSB/DSB yields ratio. The probabilistic and geometrical DNA models can predict equivalent results. Using Geant4, we were able to reproduce previously published results on the direct strand break yields of photon and study the importance of irradiation conditions. We also show an ascending trend for DRBE with lower incident photon energies. A probabilistic model coupled with track structure analysis can be used to simulate strand break yields. NSERC, CIHR. © 2012 American Association of Physicists in Medicine.

Indications for solar influence on radon signal in the subsurface of Tenerife (Canary Islands, Spain)

International Nuclear Information System (INIS)

Steinitz, G.; Piatibratova, O.; Martin-Luis, M.C.

2015-01-01

Radon at two locations in Tenerife is investigated. The MM-0 site is located in a bunker near Teide volcano. Daily radon (DR) signals are dominated by a 12-hour (S2) periodicity. Continuous wavelet transform (CWT) analysis of day-time and night-time series results in a day-night differentiation, which does not occur in the coeval temperature and pressure. This indicates that the radon system is directly affected by the rotation of Earth around its axis, and not via the pressure and/or temperature pattern. San Fernando sites are in an underground gallery, located at 2.1 and 3 km from the entrance. Alpha and gamma time series show DR signals having an S1 and a strong S2 periodicity. Sidebands occur around the S1 periodicity. The lower sideband is close to 0.9972696 cycles per day (CPD; = sidereal frequency) and the upper sideband at a symmetric frequency above. They reflect a driver containing two waveforms having periodicities of rotation of Earth around its axis and around the Sun that influences radon in a non-linear fashion, leading to the sidebands around the S1 periodicity. Observation in Tenerife of sidebands and day-night phenomena substantiates the notion that the periodic components in the diurnal and annual frequency band of radon time series are due to the influence of a component in solar radiation. (authors)

Consumption of sugar-sweetened beverages and artificially sweetened beverages from childhood to adulthood in relation to socioeconomic status - 15 years follow-up in Norway.

Science.gov (United States)

Bolt-Evensen, Kathrine; Vik, Frøydis N; Stea, Tonje Holte; Klepp, Knut-Inge; Bere, Elling

2018-01-17

In Norway, social inequalities in health and health-related behaviors have been reported despite the well-developed welfare state. The objective of the present study was to analyze; (i) the development in frequency of consumption of sugar-sweetened beverages (SSB) and artificially sweetened beverages (ASB) from childhood to adulthood; (ii) socioeconomic inequalities in the consumption of SSB and ASB using different indicators of socioeconomic status (SES); (iii) time trends in potential disparities in SSB and ASB consumption among different socioeconomic groups to assess the development in socioeconomic inequality from childhood to adulthood. This study uses data from the Fruits and Vegetables Make the Marks (FVMM) longitudinal cohort, including participants (n = 437) from 20 random schools from two Norwegian counties. Data from the first survey in 2001 (mean age 11.8) and follow-up surveys in 2005 (mean age 15.5) and 2016 (mean age 26.5) were used. Consumption of SSB and ASB were measured using a food frequency questionnaire, which the participants completed at school in 2001 and 2005, and online in 2016. Various indicators of SES were included; in 2001, parental education and income were measured, in 2005, participants' educational intentions in adolescence were measured, and in 2016, participants' own education and income were measured. The main analyses conducted were linear mixed effects analysis of the repeated measures. Between 2001 and 2016, a decrease in frequency of consumption of SSB (2.8 v 1.3 times/week; p = consumption of ASB (1.1 v 1.6 times/week; p = 0.002) were observed. Participants with a higher educational level in adulthood and higher educational intentions in adolescence had a significantly lower frequency of consumption of SSB at all time points (2001, 2005 and 2016). No significant widening (or narrowing) of inequalities were observed from childhood to adulthood. A decrease in consumption of SSB and an increase in consumption of

From policy to practice: Addressing snack quality, consumption, and price in afterschool programs

Science.gov (United States)

Beets, Michael W.; Tilley, Falon; Weaver, Robert G.; Turner-McGrievy, Brie; Moore, Justin B.; Webster, Collin

2013-01-01

Objective To evaluate a community partnership between afterschool programs (ASPs) and grocery store to provide discounted pricing on snacks to meet the National Afterschool Association Healthy Eating Standards that call for serving a fruit/vegetable (FV) daily, while eliminating sugar-based foods/beverages. Methods A single-group, pre- with multiple post-test design (Spring 2011–2013) in four large-scale ASPs serving 500 children/day was used along with direct observation of snacks served, consumed, and cost. Results At baseline FV, sugar-sweetened beverages (SSB), and desserts were served 0.1±0.5, 1.7±2.0, and 2.0±1.4 days/wk. By Spring 2013, FV increased to 5.0±0.0 days/wk, while SSB and desserts were eliminated. Eighty-four percent of children consumed the fruit; 59% consumed the vegetables. Cost associated with purchasing snacks resulted in a $2,000–$3,000 savings over a standard 180day school year. Conclusions and Implications This partnership can serve as a model for successfully meeting nutrition policies established for ASP snacks. PMID:24268299

A miR-590/Acvr2a/Rad51b Axis Regulates DNA Damage Repair during mESC Proliferation

Directory of Open Access Journals (Sweden)

Qidong Liu

2014-12-01

Full Text Available Embryonic stem cells (ESCs enable rapid proliferation that also causes DNA damage. To maintain genomic stabilization during rapid proliferation, ESCs must have an efficient system to repress genotoxic stress. Here, we show that withdrawal of leukemia inhibitory factor (LIF, which maintains the self-renewal capability of mouse ESCs (mESCs, significantly inhibits the cell proliferation and DNA damage of mESCs and upregulates the expression of miR-590. miR-590 promotes single-strand break (SSB and double-strand break (DSB damage repair, thus slowing proliferation of mESCs without influencing stemness. miR-590 directly targets Activin receptor type 2a (Acvr2a to mediate Activin signaling. We identified the homologous recombination-mediated repair (HRR gene, Rad51b, as a downstream molecule of the miR-590/Acvr2a pathway regulating the SSB and DSB damage repair and cell cycle. Our study shows that a miR-590/Acvr2a/Rad51b signaling axis ensures the stabilization of mESCs by balancing DNA damage repair and rapid proliferation during self-renewal.

Susceptibility to Food Advertisements and Sugar-Sweetened Beverage Intake in Non-Hispanic Black and Non-Hispanic White Adolescents.

Science.gov (United States)

Cervi, Meredith M; Agurs-Collins, Tanya; Dwyer, Laura A; Thai, Chan L; Moser, Richard P; Nebeling, Linda C

2017-08-01

Obesity among adolescents in the United States has risen by 16% in the past 30 years. One important contributing factor may be the increased consumption of sugar sweetened beverages (SSBs), which is encouraged by advertisements for unhealthy foods and drinks that are targeted to adolescents. The purpose of this analysis was to determine the association between susceptibility to food and drink advertisements and sugar-sweetened beverage (SSB) consumption in non-Hispanic black (NHB) and non-Hispanic white (NHW) adolescents and to examine if BMI is associated with SSB consumption. Data were obtained from 765 NHB and NHW of ages 14-17 who were surveyed in the Family Life, Activity, Sun, Health, and Eating study sponsored by the National Cancer Institute. Two weighted adjusted logistic regression models were conducted. The first examined the associations of advertisement susceptibility, race, and BMI with SSB consumption. The second examined the associations of race and BMI with advertisement susceptibility. Adolescents with high advertisement susceptibility were more likely to consume at least one SSB daily (OR 1.73, 95% CI 1.21, 2.47). Additionally, non-Hispanic blacks were more likely to consume at least one SSB daily (OR 1.75, 95% CI 1.08, 2.85) and more likely to be highly susceptible to advertisements (OR 1.72, 95% CI 1.19, 2.48) than non-Hispanic whites. No significant associations were found between BMI and advertising susceptibility or BMI and daily SSB consumption. One approach to addressing the consumption of SSBs may be to reduce advertising that markets unhealthy food and beverages to adolescents and minorities.

Identifying Financially Sustainable Pricing Interventions to Promote Healthier Beverage Purchases in Small Neighborhood Stores.

Science.gov (United States)

Nau, Claudia; Kumanyika, Shiriki; Gittelsohn, Joel; Adam, Atif; Wong, Michelle S; Mui, Yeeli; Lee, Bruce Y

2018-01-25

Residents of low-income communities often purchase sugar-sweetened beverages (SSBs) at small, neighborhood "corner" stores. Lowering water prices and increasing SSB prices are potentially complementary public health strategies to promote more healthful beverage purchasing patterns in these stores. Sustainability, however, depends on financial feasibility. Because in-store pricing experiments are complex and require retailers to take business risks, we used a simulation approach to identify profitable pricing combinations for corner stores. The analytic approach was based on inventory models, which are suitable for modeling business operations. We used discrete-event simulation to build inventory models that use data representing beverage inventory, wholesale costs, changes in retail prices, and consumer demand for 2 corner stores in Baltimore, Maryland. Model outputs yielded ranges for water and SSB prices that increased water demand without loss of profit from combined water and SSB sales. A 20% SSB price increase allowed lowering water prices by up to 20% while maintaining profit and increased water demand by 9% and 14%, for stores selling SSBs in 12-oz cans and 16- to 20-oz bottles, respectively. Without changing water prices, profits could increase by 4% and 6%, respectively. Sensitivity analysis showed that stores with a higher volume of SSB sales could reduce water prices the most without loss of profit. Various combinations of SSB and water prices could encourage water consumption while maintaining or increasing store owners' profits. This model is a first step in designing and implementing profitable pricing strategies in collaboration with store owners.

A systematic approach to evaluate parameter consistency in the inlet stream of source separated biowaste composting facilities: A case study in Colombia.

Science.gov (United States)

Oviedo-Ocaña, E R; Torres-Lozada, P; Marmolejo-Rebellon, L F; Torres-López, W A; Dominguez, I; Komilis, D; Sánchez, A

2017-04-01

Biowaste is commonly the largest fraction of municipal solid waste (MSW) in developing countries. Although composting is an effective method to treat source separated biowaste (SSB), there are certain limitations in terms of operation, partly due to insufficient control to the variability of SSB quality, which affects process kinetics and product quality. This study assesses the variability of the SSB physicochemical quality in a composting facility located in a small town of Colombia, in which SSB collection was performed twice a week. Likewise, the influence of the SSB physicochemical variability on the variability of compost parameters was assessed. Parametric and non-parametric tests (i.e. Student's t-test and the Mann-Whitney test) showed no significant differences in the quality parameters of SSB among collection days, and therefore, it was unnecessary to establish specific operation and maintenance regulations for each collection day. Significant variability was found in eight of the twelve quality parameters analyzed in the inlet stream, with corresponding coefficients of variation (CV) higher than 23%. The CVs for the eight parameters analyzed in the final compost (i.e. pH, moisture, total organic carbon, total nitrogen, C/N ratio, total phosphorus, total potassium and ash) ranged from 9.6% to 49.4%, with significant variations in five of those parameters (CV>20%). The above indicate that variability in the inlet stream can affect the variability of the end-product. Results suggest the need to consider variability of the inlet stream in the performance of composting facilities to achieve a compost of consistent quality. Copyright © 2017 Elsevier Ltd. All rights reserved.

Self-reported advertising exposure to sugar-sweetened beverages among US youth.

Science.gov (United States)

Kumar, Gayathri; Onufrak, Stephen; Zytnick, Deena; Kingsley, Beverly; Park, Sohyun

2015-05-01

According to the Federal Trade Commission, in 2009, the top food category with teen-directed marketing expenditures was sugar-sweetened beverages (SSB). The present study reports on exposure to SSB advertisements using self-report data from adolescents. Cross-sectional study design using descriptive statistics to assess self-reported frequency of exposure to SSB advertisements and multivariable logistic regression to examine associations between frequency of SSB advertising exposure and sociodemographic variables. Online survey conducted at home. US adolescents aged 12-17 years (n 847). Among the surveyed adolescents, 42 % to 54 % reported seeing/hearing SSB advertisements ≥1 time/d. Those aged 14-15 years were more likely to report seeing/hearing soda, sports drink and energy drink advertisements ≥1 time/d than 16- to 17-year-olds. Males were more likely to report seeing/hearing sports drink advertising ≥1 time/d than females. Non-Hispanic black adolescents were more likely to report seeing/hearing fruit drink and sports drink advertisements ≥1 time/d than non-Hispanic white adolescents. Adolescents whose parents had high-school education or less were more likely to report seeing/hearing soda, fruit drink and energy drink advertisements ≥1 time/d than adolescents whose parents were college graduates. Almost half of the adolescents sampled reported daily SSB advertising exposure, with higher exposure among African Americans and adolescents with less educated parents. These data can help inform potential actions that decision makers might take, such as education of adolescents and their caregivers on the potential impact of beverage advertising, especially among groups at higher risk for obesity.

Observational demonstration of a high image rejection SIS mixer receiver using a new waveguide filter at 230 GHz

Science.gov (United States)

Hasegawa, Yutaka; Asayama, Shinichiro; Harada, Ryohei; Tokuda, Kazuki; Kimura, Kimihiro; Ogawa, Hideo; Onishi, Toshikazu

2017-12-01

A new sideband separation method was developed for use in millimeter-/submillimeter-band radio receivers using a novel waveguide frequency separation filter (FSF), which consists of two branch line hybrid couplers and two waveguide high-pass filters. The FSF was designed to allow the radio frequency (RF) signal to pass through to an output port when the frequency is higher than a certain value (225 GHz), and to reflect the RF signal back to another output port when the frequency is lower. The FSF is connected to two double sideband superconductor-insulator-superconductor (SIS) mixers, and an image rejection ratio (IRR) is determined by the FSF characteristics. With this new sideband separation method, we can achieve good and stable IRR without the balancing two SIS mixers such as is necessary for conventional sideband-separating SIS mixers. To demonstrate the applicability of this method, we designed and developed an FSF for simultaneous observations of the J = 2-1 rotational transition lines of three CO isotopes (12CO, 13CO, and C18O): the 12CO line is in the upper sideband and the others are in the lower sideband with an intermediate-frequency range of 4-8 GHz at the radio frequency of 220/230 GHz. This FSF was then installed in the receiver system of the 1.85 m radio telescope of Osaka Prefecture University, and was used during the 2014 observation season. The observation results indicate that the IRR of the proposed receiver is 25 dB or higher for the 12CO line, and no significant fluctuation larger than 1 dB in the IRR was observed throughout the season. These results demonstrate the practical utility of the FSF receiver for observations like extensive molecular cloud surveys in specified lines with a fixed frequency setting.

Obstacles and opportunities in the commercialization of the solid-state-electronic fluorescent-lighting ballast

Energy Technology Data Exchange (ETDEWEB)

Johnson, D.R.; Marcus, A.A.; Campbell, R.S.; Sommers, P.; Skumatz, L.; Berk, B.; Petty, P.; Eschbach, C.

1981-10-01

The Solid State Ballast (SSB) Program, aimed at improving the efficiency of fluorescent lights, is described. The first generation of solid state electronic ballasts has been developed and the technology has been transferred to the private sector. This report examines the opportunities for rapid dissemination of this technology into the marketplace. It includes a description of product characteristics and their influence on the commercialization of the SSB, a description of the technology delivery system presently used by the ballast industry, an analysis of the market for SSB, and identification of some high-leverage opportunities to accelerate the commercialization process. (MCW)

Nonlinear ultrasonic wave modulation for online fatigue crack detection

Science.gov (United States)

Sohn, Hoon; Lim, Hyung Jin; DeSimio, Martin P.; Brown, Kevin; Derriso, Mark

2014-02-01

This study presents a fatigue crack detection technique using nonlinear ultrasonic wave modulation. Ultrasonic waves at two distinctive driving frequencies are generated and corresponding ultrasonic responses are measured using permanently installed lead zirconate titanate (PZT) transducers with a potential for continuous monitoring. Here, the input signal at the lower driving frequency is often referred to as a 'pumping' signal, and the higher frequency input is referred to as a 'probing' signal. The presence of a system nonlinearity, such as a crack formation, can provide a mechanism for nonlinear wave modulation, and create spectral sidebands around the frequency of the probing signal. A signal processing technique combining linear response subtraction (LRS) and synchronous demodulation (SD) is developed specifically to extract the crack-induced spectral sidebands. The proposed crack detection method is successfully applied to identify actual fatigue cracks grown in metallic plate and complex fitting-lug specimens. Finally, the effect of pumping and probing frequencies on the amplitude of the first spectral sideband is investigated using the first sideband spectrogram (FSS) obtained by sweeping both pumping and probing signals over specified frequency ranges.

A Multicomponent Intervention Helped Reduce Sugar-Sweetened Beverage Intake in Economically Disadvantaged Hispanic Children.

Science.gov (United States)

Feng, Du; Song, Huaxin; Esperat, M Christina; Black, Ipuna

2016-11-01

This study aimed to examine the effect of a multicomponent intervention program on consumption of sugar-sweetened beverages (SSBs), and lifestyle factors associated with SSB intake, in Hispanic children from low-income families. A five-wave longitudinal study using a quasi-experimental design was conducted. Five elementary schools in West Texas served as the setting. Participants included 555 predominantly Hispanic children (ages 5-9 years) from low-income families and their parents (n = 525). A multicomponent intervention program was implemented. Children's anthropometric measures were obtained. Their weight status was determined based on body mass index for age and gender. Parents responded to a demographic questionnaire, a shelf inventory, an acculturation scale, and a family survey. Growth curve analyses were used to test differences between intervention and comparison participants' SSB intake and to examine potential covariates. Comparison group children's daily SSB intake significantly increased over time (B = 1.06 ± .40 ounces per month, p food intake, and more types of SSBs available at home were associated with higher SSB intake. Risk factors of childhood obesity were associated with each other. The intervention program produced a modest reduction in SSB consumed by economically disadvantaged and predominantly Hispanic children. © 2016 by American Journal of Health Promotion, Inc.

Sugar-Sweetened Beverage, Obesity, and Type 2 Diabetes in Children and Adolescents: Policies, Taxation, and Programs.

Science.gov (United States)

Yoshida, Yilin; Simoes, Eduardo J

2018-04-18

Obesity has grown at an alarming rate in children and adolescents. Concurrently, consumption on sugar-sweetened beverages (SSBs) also rose significantly. This review provides an overview of obesity and type 2 diabetes mellitus (T2DM) related to SSBs and current policies restricting SSBs in schools, school-based interventions, and taxation on reducing SSB intake and obesity. We also discuss challenges of and future steps for these initiatives. Clinical and epidemiological studies suggest a strong association between SSB intake and obesity and T2DM. School food policies have been initiated at federal, state, and local levels. School-based interventions have shown positive effects on SSB intake and obesity reduction. Taxation on SSBs is promising in combating obesity and in generating revenue. Challenges towards compliance and implementation of the policies and programs exist. The relationship between SSB and obesity and T2DM is a complex problem which requires comprehensive solutions. Continued efforts in restricting SSBs in schools are needed. Intervention programs should be tailored to age, gender, language, and culture and involve participation from families and local communities. Taxation can reduce SSB consumption by direct economic incentive, earmarking revenues to support healthy foods, and sending negative message. However, a higher tax rate may be necessary to have a measurable effect on weight.

Sugar-Sweetened Beverage and Water Intake in Relation to Diet Quality in U.S. Children.

Science.gov (United States)

Leung, Cindy W; DiMatteo, S Gemma; Gosliner, Wendi A; Ritchie, Lorrene D

2018-03-01

Sugar-sweetened beverages (SSBs) are a major contributor to children's added sugar consumption. This study examines whether children's SSB and water intakes are associated with diet quality and total energy intake. Using data on children aged 2-18 years from the 2009-2014 National Health and Nutrition Examination Survey, linear regression models were used to analyze SSB and water intake in relation to Healthy Eating Index 2010 (HEI-2010) scores and total energy intake. Generalized linear models were used to analyze SSB and water intake in relation to the HEI-2010 scores. Analyses were conducted including and excluding caloric contributions from SSBs and were conducted in 2016-2017. SSB intake was inversely associated with the HEI-2010 total scores (9.5-point lower score comparing more than two servings/day with zero servings/day, p-trendempty calories. Water intake was positively associated with most of the same HEI-2010 component scores. Children who consume SSBs have poorer diet quality and higher total energy intake than children who do not consume SSBs. Interventions for obesity and chronic disease should focus on replacing SSBs with water and improving other aspects of diet quality that correlate with SSB consumption. Copyright © 2017 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

Do You Know What Your Kids Are Drinking? Evaluation of a Media Campaign to Reduce Consumption of Sugar-Sweetened Beverages.

Science.gov (United States)

Bleakley, Amy; Jordan, Amy; Mallya, Giridhar; Hennessy, Michael; Piotrowski, Jessica Taylor

2017-01-01

This study evaluates a citywide media campaign that targeted reducing sugar-sweetened beverage (SSB) consumption as a strategy for addressing obesity. Rolling cross-sectional survey data, collected before and during the media campaign, with 1367 parents to assess exposure to and effect of a televised public service advertisement (TV PSA) developed using a reasoned action approach. Televised public service advertisement campaign created by the Philadelphia Department of Public Health and disseminated on cable television channels within the Philadelphia market. Philadelphia parents/primary caregivers with a child between the ages of 3 and 16. Linear regression analysis shows that exposure to the TV PSA was significantly associated with intention to substitute nonsugary drinks for SSBs for the parent ( P = .04) and the child ( P = .02). The effect of exposure on intention to reduce child's SSB consumption increased the longer the campaign was in the field. Exposure was also significantly associated with the belief that reducing SSB consumption decreases the risk of diabetes ( P = .04) and was significantly negatively related to the belief that reducing SSB consumption would make mealtimes less enjoyable ( P = .04). These findings suggest that a theory-based mass media campaign can achieve positive changes in intention related to SSB consumption by changing relevant and salient underlying beliefs.

The Canadian Bandaging Trial: Evidence-informed leg ulcer care and the effectiveness of two compression technologies

Directory of Open Access Journals (Sweden)

Hopman Wilma M

2011-10-01

Full Text Available Abstract Background Objective: To determine the relative effectiveness of evidence-informed practice using two high compression systems: four-layer (4LB and short-stretch bandaging (SSB in community care of venous leg ulcers. Design and Setting: Pragmatic, multi-centre, parallel-group, open-label, randomized controlled trial conducted in 10 centres. Cognitively intact adults (≥18 years referred for community care (home or clinic with a venous ulceration measuring ≥0.7cm and present for ≥1 week, with an ankle brachial pressure index (ABPI ≥0.8, without medication-controlled Diabetes Mellitus or a previous failure to improve with either system, were eligible to participate. Methods Consenting individuals were randomly allocated (computer-generated blocked randomization schedule to receive either 4LB or SSB following an evidence-informed protocol. Primary endpoint: time-to- healing of the reference ulcer. Secondary outcomes: recurrence rates, health-related quality of life (HRQL, pain, and expenditures. Results 424 individuals were randomized (4LB n = 215; SSB n = 209 and followed until their reference ulcer was healed (or maximum 30 months. An intent-to-treat analysis was conducted on all participants. Median time to ulcer healing in the 4LB group was 62 days [95% confidence interval (CI 51 to 73], compared with 77 days (95% CI 63 to 91 in the SSB group. The unadjusted Kaplan-Meier curves revealed the difference in the distribution of cumulative healing times was not significantly different between group (log rank χ2 = 0.001, P = 0.98 nor ulcers recurrence (4LB, 10.1%; SSB, 13.3%; p = 0.345. Multivariable Cox Proportional Hazard Modeling also showed no significant between-bandage differences in healing time after controlling for significant covariates (p = 0.77. At 3-months post-baseline there were no differences in pain (no pain: 4LB, 22.7%; SSB, 26.7%; p = 0.335, or HRQL (SF-12 Mental Component Score: 4LB, 55.1; SSB, 55.8; p = 0.615; SF

The Canadian Bandaging Trial: Evidence-informed leg ulcer care and the effectiveness of two compression technologies

Science.gov (United States)

2011-01-01

Background Objective: To determine the relative effectiveness of evidence-informed practice using two high compression systems: four-layer (4LB) and short-stretch bandaging (SSB) in community care of venous leg ulcers. Design and Setting: Pragmatic, multi-centre, parallel-group, open-label, randomized controlled trial conducted in 10 centres. Cognitively intact adults (≥18 years) referred for community care (home or clinic) with a venous ulceration measuring ≥0.7cm and present for ≥1 week, with an ankle brachial pressure index (ABPI) ≥0.8, without medication-controlled Diabetes Mellitus or a previous failure to improve with either system, were eligible to participate. Methods Consenting individuals were randomly allocated (computer-generated blocked randomization schedule) to receive either 4LB or SSB following an evidence-informed protocol. Primary endpoint: time-to- healing of the reference ulcer. Secondary outcomes: recurrence rates, health-related quality of life (HRQL), pain, and expenditures. Results 424 individuals were randomized (4LB n = 215; SSB n = 209) and followed until their reference ulcer was healed (or maximum 30 months). An intent-to-treat analysis was conducted on all participants. Median time to ulcer healing in the 4LB group was 62 days [95% confidence interval (CI) 51 to 73], compared with 77 days (95% CI 63 to 91) in the SSB group. The unadjusted Kaplan-Meier curves revealed the difference in the distribution of cumulative healing times was not significantly different between group (log rank χ2 = 0.001, P = 0.98) nor ulcers recurrence (4LB, 10.1%; SSB, 13.3%; p = 0.345). Multivariable Cox Proportional Hazard Modeling also showed no significant between-bandage differences in healing time after controlling for significant covariates (p = 0.77). At 3-months post-baseline there were no differences in pain (no pain: 4LB, 22.7%; SSB, 26.7%; p = 0.335), or HRQL (SF-12 Mental Component Score: 4LB, 55.1; SSB, 55.8; p = 0.615; SF-12 Physical

On structures developed by spinodal decomposition; the interpretation of the X-ray diffraction and the role of excess vacancies in the coarsening

International Nuclear Information System (INIS)

Keijser, Th. H. de

1977-01-01

Structures developed by spinodal decomposition in a AuPt (20-80) alloy were studied by X-ray diffraction. The structures consist of a quasi-periodic concentration modulation which causes a modulation of the lattice spacing in the cube directions. The modulation of the lattice spacing gives rise to the occurrence of side-bands in an X-ray diffraction pattern. Information on the nature of the modulation was deduced from the intensities of the side-bands. From the positions of the side-bands, the wavelength of the modulation was determined. The increase of the wavelength with aging time was investigated. Special attention was paid to the role of quenched-in excess vacancies in the coarsening process

Lower-hybrid wave penetration and effects on electron population

International Nuclear Information System (INIS)

Dupas, L.; Grelot, P.; Parlange, F.; Weisse, J.

1981-01-01

In a high-power-density lower-hybrid experiment (approximately 10kW.cm -2 ), a parallel index spectrum was measured and the radial position where sidebands are excited was deduced from pump and sideband wavenumber measurements. On this basis, some considerations on wave propagation are given which are compatible with some effects observed on electron population. (author)

The relative reinforcing value of sweet versus savory snack foods after consumption of sugar- or non-nutritive-sweetened beverages

Science.gov (United States)

The effects of sugar-sweetened (SSB) and non-nutritive sweetened (NSB) beverages on the regulation of appetite, energy intake and body weight regulation remain controversial. Using a behavioral choice paradigm, we sought to determine the effects of consuming a SSB or NSB on appetite and the reinforc...

Mixed methods evaluation of a randomized control pilot trial targeting sugar-sweetened beverage behaviors.

Science.gov (United States)

Zoellner, Jamie; Cook, Emily; Chen, Yvonnes; You, Wen; Davy, Brenda; Estabrooks, Paul

2013-02-01

This Excessive sugar-sweetened beverage (SSB) consumption and low health literacy skills have emerged as two public health concerns in the United States (US); however, there is limited research on how to effectively address these issues among adults. As guided by health literacy concepts and the Theory of Planned Behavior (TPB), this randomized controlled pilot trial applied the RE-AIM framework and a mixed methods approach to examine a sugar-sweetened beverage (SSB) intervention (SipSmartER), as compared to a matched-contact control intervention targeting physical activity (MoveMore). Both 5-week interventions included two interactive group sessions and three support telephone calls. Executing a patient-centered developmental process, the primary aim of this paper was to evaluate patient feedback on intervention content and structure. The secondary aim was to understand the potential reach (i.e., proportion enrolled, representativeness) and effectiveness (i.e. health behaviors, theorized mediating variables, quality of life) of SipSmartER. Twenty-five participants were randomized to SipSmartER (n=14) or MoveMore (n=11). Participants' intervention feedback was positive, ranging from 4.2-5.0 on a 5-point scale. Qualitative assessments reavealed several opportunties to improve clarity of learning materials, enhance instructions and communication, and refine research protocols. Although SSB consumption decreased more among the SipSmartER participants (-256.9 ± 622.6 kcals), there were no significant group differences when compared to control participants (-199.7 ± 404.6 kcals). Across both groups, there were significant improvements for SSB attitudes, SSB behavioral intentions, and two media literacy constructs. The value of using a patient-centered approach in the developmental phases of this intervention was apparent, and pilot findings suggest decreased SSB may be achieved through targeted health literacy and TPB strategies. Future efforts are needed to examine

Sugar-Sweetened Beverage Consumption by Adult Caregivers and Their Children: The Role of Drink Features and Advertising Exposure

Science.gov (United States)

Hennessy, Michael; Bleakley, Amy; Piotrowski, Jessica Taylor; Mallya, Giridhar; Jordan, Amy

2015-01-01

Objective: To examine how parents' beliefs about beverage attributes and exposure to sugar-sweetened beverage (SSB) advertising are associated with parents' and their children's SSB consumption. Design: Cross-sectional representative telephone survey of Philadelphia parents in households with children between the ages of 3 and 16 years.…

Effects of DNA double-strand and single-strand breaks on intrachromosomal recombination events in cell-cycle-arrested yeast cells

International Nuclear Information System (INIS)

Galli, A.; Schiestl, R.H.

1998-01-01

Intrachromosomal recombination between repeated elements can result in deletion (DEL recombination) events. We investigated the inducibility of such intrachromosomal recombination events at different stages of the cell cycle and the nature of the primary DNA lesions capable of initiating these events. Two genetic systems were constructed in Saccharomyces cerevisiae that select for DEL recombination events between duplicated alleles of CDC28 and TUB2. We determined effects of double-strand breaks (DSBs) and single-strand breaks (SSBs) between the duplicated alleles on DEL recombination when induced in dividing cells or cells arrested in G1 or G2. Site-specific DSBs and SSBs were produced by overexpression of the I-Sce I endonuclease and the gene II protein (gIIp), respectively. I-Sce I-induced DSBs caused an increase in DEL recombination frequencies in both dividing and cell-cycle-arrested cells, indicating that G1- and G2-arrested cells are capable of completing DSB repair. In contrast, gIIp-induced SSBs caused an increase in DEL recombination frequency only in dividing cells. To further examine these phenomena we used both γ-irradiation, inducing DSBs as its most relevant lesion, and UV, inducing other forms of DNA damage. UV irradiation did not increase DEL recombination frequencies in G1 or G2, whereas γ-rays increased DEL recombination frequencies in both phases. Both forms of radiation, however, induced DEL recombination in dividing cells. The results suggest that DSBsbut not SSBs induce DEL recombination, probably via the single-strand annealing pathway. Further, DSBs in dividing cells may result from the replication of a UV or SSB-damaged template. Alternatively, UV induced events may occur by replication slippage after DNA polymerase pausing in front of the damage. (author)

Alkyladenine DNA glycosylase (AAG) localizes to mitochondria and interacts with mitochondrial single-stranded binding protein (mtSSB)

OpenAIRE

van Loon, Barbara; Samson, Leona D.

2013-01-01

Due to a harsh environment mitochondrial genomes accumulate high levels of DNA damage, in particular oxidation, hydrolytic deamination, and alkylation adducts. While repair of alkylated bases in nuclear DNA has been explored in detail, much less is known about the repair of DNA alkylation damage in mitochondria. Alkyladenine DNA glycosylase (AAG) recognizes and removes numerous alkylated bases, but to date AAG has only been detected in the nucleus, even though mammalian mitochondria are known...

Daily sugar-sweetened beverage consumption and insulin resistance in European adolescents: the HELENA (Healthy Lifestyle in Europe by Nutrition in Adolescence) Study.

Science.gov (United States)

Kondaki, Katerina; Grammatikaki, Evangelia; Jiménez-Pavón, David; De Henauw, Stefaan; González-Gross, Marcela; Sjöstrom, Michael; Gottrand, Frédéric; Molnar, Dénes; Moreno, Luis A; Kafatos, Anthony; Gilbert, Chantal; Kersting, Mathilde; Manios, Yannis

2013-03-01

The present study aimed to evaluate the relationship between the consumption of selected food groups and insulin resistance, with an emphasis on sugar-sweetened beverages (SSB). The present research is a large multicentre European study in adolescents, the HELENA-CSS (Healthy Lifestyle in Europe by Nutrition in Adolescence Cross-Sectional Study). Homeostasis model assessment-insulin resistance index (HOMA-IR) was calculated. Several anthropometric and lifestyle characteristics were recorded. Dietary assessment was conducted by using a short FFQ. The participants were a subset of the original sample (n 546) with complete data on glucose, insulin and FFQ. All participants were recruited at schools. Median (25th, 75th percentile) HOMA-IR was 0.62 (0.44, 0.87). Mean HOMA-IR was significantly higher among adolescents consuming brown bread ≤1 time/week than among those consuming 2-6 times/week (P = 0·011). Mean values of HOMA-IR were also higher in adolescents consuming SSB >5 times/week compared with those consuming less frequently, although a statistically significant difference was detected between those consuming SSB 5-6 times/week and 2-4 times/week (P = 0.049). Multiple linear regression analysis showed that only the frequency of SSB consumption was significantly associated with HOMA-IR after controlling for potential confounders. In particular, it was found that HOMA-IR levels were higher among adolescents consuming SSB 5-6 times/week and ≥1 time/d compared with those consuming ≤1 time/week by 0.281 and 0.191 units, respectively (P = 0.009 and 0.046, respectively). The present study revealed that daily consumption of SSB was related with increased HOMA-IR in adolescents.

Predicting Dietary Intake among Children Classified as Overweight or at Risk for Overweight: Independent and Interactive Effects of Parenting Practices and Styles

Science.gov (United States)

Langer, Shelby L.; Seburg, Elisabeth; JaKa, Meghan M.; Sherwood, Nancy E.; Levy, Rona L.

2017-01-01

Using baseline data from a randomized controlled pediatric obesity prevention trial, this study sought to examine general parenting style as a potential moderator of the association between feeding-specific parenting practices and child dietary intake. Four hundred and twenty-one parent-child dyads served as participants (49% girls and 93% mothers). Children were, on average, 6.6 years old and either overweight or at-risk for overweight (mean BMI percentile = 84.9). Data were collected in participants’ homes. Study staff measured children’s height and weight. Parents completed questionnaires designed to assess general parenting styles (authoritative, authoritarian and permissive) and child feeding practices (restriction and monitoring). Child dietary intake was assessed using a 24-hour recall system. Outcomes were daily servings of fruits and vegetables, sugar-sweetened beverages (SSB), and unhealthy snacks. Results were as follows: Permissive parenting was inversely associated with fruit and vegetable consumption, and parental monitoring was inversely associated with SSB consumption. There were no other main effects of parenting style or feeding practice on child dietary consumption. Authoritarian parenting moderated the association between restriction and SSB intake (a marginally significant effect after correcting for multiple comparisons). Restriction was inversely associated with SSB consumption when authoritarianism was high but unassociated with SSB consumption when authoritarianism was low. Findings indicate that the parenting practice of monitoring child dietary intake was associated with more healthful consumption regardless of parenting style; interventions may thus benefit from encouraging parental monitoring. The parenting strategy of restricting child dietary intake, in contrast, was associated with lower SSB intake in the context of higher parental authoritarianism but inconsequential in the context of lower parental authoritarianism. This

Cross-polarization phenomena in the NMR of fast spinning solids subject to adiabatic sweeps

Energy Technology Data Exchange (ETDEWEB)

Wi, Sungsool, E-mail: sungsool@magnet.fsu.edu, E-mail: lucio.frydman@weizmann.ac.il; Gan, Zhehong [National High Magnetic Field Laboratory, Tallahassee, Florida 32304 (United States); Schurko, Robert [Department of Chemistry and Biochemistry, University of Windsor, 401 Sunset Avenue, Windsor N9B 3P4, Ontario (Canada); Frydman, Lucio, E-mail: sungsool@magnet.fsu.edu, E-mail: lucio.frydman@weizmann.ac.il [National High Magnetic Field Laboratory, Tallahassee, Florida 32304 (United States); Department of Chemical Physics, Weizmann Institute of Sciences, 76100 Rehovot (Israel)

2015-02-14

Cross-polarization magic-angle spinning (CPMAS) experiments employing frequency-swept pulses are explored within the context of obtaining broadband signal enhancements for rare spin S = 1/2 nuclei at very high magnetic fields. These experiments employ adiabatic inversion pulses on the S-channel ({sup 13}C) to cover a wide frequency offset range, while simultaneously applying conventional spin-locking pulse on the I-channel ({sup 1}H). Conditions are explored where the adiabatic frequency sweep width, Δν, is changed from selectively irradiating a single magic-angle-spinning (MAS) spinning centerband or sideband, to sweeping over multiple sidebands. A number of new physical features emerge upon assessing the swept-CP method under these conditions, including multiple zero- and double-quantum CP transfers happening in unison with MAS-driven rotary resonance phenomena. These were examined using an average Hamiltonian theory specifically designed to tackle these experiments, with extensive numerical simulations, and with experiments on model compounds. Ultrawide CP profiles spanning frequency ranges of nearly 6⋅γB{sub 1}{sup s} were predicted and observed utilizing this new approach. Potential extensions and applications of this extremely broadband transfer conditions are briefly discussed.

Substantial decline in sugar-sweetened beverage consumption among California’s children and adolescents

Directory of Open Access Journals (Sweden)

Lu Shi

2010-08-01

Full Text Available Lu Shi, Jeroen van MeijgaardUCLA Health Forecasting, UCLA School of Public Health, Los Angeles, CA, USAIntroduction: Few studies have looked at changes among risk factors that might help explain why childhood obesity prevalence in the US has leveled off in recent years. We present an analysis of the California Health Interview Survey (CHIS that examines trends in childhood and adolescent obesity as well as trends in sugar-sweetened beverage (SSB consumption.Method: We compared 3 separate cross-sectional samples (2003, 2005, and 2007 from biennial CHIS for 3 age groups, age 2–5, age 6–11 and age 12–17. We calculated the prevalence of high SSB consumption (defined as having more than one SSB during the previous day. 2 measures of obesity were used – weight-for-age at or above the 95th percentile on national growth charts for children aged 2–11, and body mass index for age at or above the 95th percentile on national growth charts for adolescents aged 12–17. Logistic regression analysis is used to estimate adjusted odds ratios of high SSB consumption in 2005 and 2007 compared with the baseline year of 2003.Results: From 2003 to 2007, each age group experienced a substantial decline in high SSB consumption (16.4%–5.0% for age 2–5, P < 0.001; 22.5%–9.9% for age 6–11, P < 0.001; 35.7%–25.7% for age 12–17, P < 0.001. Declines in the prevalence of children’s obesity were significant among children age 2–5 (P < 0.001 and age 6–11 (P < 0.05 but not among adolescents (P = 0.42. Children and teenagers in 2005 and 2007 were significantly less likely than those surveyed in 2003 to have high SSB consumption after adjusting for gender, age, race/ethnicity, poverty level, and parental education (P < 0.001.Conclusion: Policy actions may have impacted the prevalence of SSB consumption in the population. Further research is needed to examine the contribution of declining SSB consumption on the leveling off of obesity trends and the

The application of strand invasion phenomenon, directed by peptide nucleic acid (PNA) and single-stranded DNA binding protein (SSB) for the recognition of specific sequences of human endogenous retroviral HERV-W family.

Science.gov (United States)

Machnik, Grzegorz; Bułdak, Łukasz; Ruczyński, Jarosław; Gąsior, Tomasz; Huzarska, Małgorzata; Belowski, Dariusz; Alenowicz, Magdalena; Mucha, Piotr; Rekowski, Piotr; Okopień, Bogusław

2017-05-01

The HERV-W family of human endogenous retroviruses represents a group of numerous sequences that show close similarity in genetic composition. It has been documented that some members of HERV-W-derived expression products are supposed to play significant role in humans' pathology, such as multiple sclerosis or schizophrenia. Other members of the family are necessary to orchestrate physiological processes (eg, ERVWE1 coding syncytin-1 that is engaged in syncytiotrophoblast formation). Therefore, an assay that would allow the recognition of particular form of HERV-W members is highly desirable. A peptide nucleic acid (PNA)-mediated technique for the discrimination between multiple sclerosis-associated retrovirus and ERVWE1 sequence has been developed. The assay uses a PNA probe that, being fully complementary to the ERVWE1 but not to multiple sclerosis-associated retrovirus (MSRV) template, shows high selective potential. Single-stranded DNA binding protein facilitates the PNA-mediated, sequence-specific formation of strand invasion complex and, consequently, local DNA unwinding. The target DNA may be then excluded from further analysis in any downstream process such as single-stranded DNA-specific exonuclease action. Finally, the reaction conditions have been optimized, and several PNA probes that are targeted toward distinct loci along whole HERV-W env sequences have been evaluated. We believe that PNA/single-stranded DNA binding protein-based application has the potential to selectively discriminate particular HERV-W molecules as they are at least suspected to play pathogenic role in a broad range of medical conditions, from psycho-neurologic disorders (multiple sclerosis and schizophrenia) and cancers (breast cancer) to that of an auto-immunologic background (psoriasis and lupus erythematosus). Copyright © 2016 John Wiley & Sons, Ltd.

Exploring the Theory of Planned Behavior to Explain Sugar-Sweetened Beverage Consumption

Science.gov (United States)

Zoellner, Jamie; Estabrooks, Paul A.; Davy, Brenda M.; Chen, Yi-Chun; You, Wen

2012-01-01

Objective: To describe sugar-sweetened beverage (SSB) consumption and to establish psychometric properties and utility of a Theory of Planned Behavior (TPB) instrument for SSB consumption. Methods: This cross-sectional survey included 119 southwest Virginia participants. Most of the respondents were female (66%), white (89%), and had at least a…

On the stability of whistler and 'pearl' type electromagnetic waves in the magnetosphere

International Nuclear Information System (INIS)

Buloshnikov, A.M.; Feodorov, E.E.

1977-01-01

Nonlinear evolution of 'whistlers' and pearls in magnetosphere has been considered. The analysis of the possibility of side-band generation in two particular cases (for the train with abrupt boundaries and for the wave train with the amplitude which is increasing gradually) has been studied. The theoretical results have been compared with the known experimental data to solve the problem. The investigation concerns mainly electron-cyclotron waves. The conclusions are the following: the stability of whistler depends on the steepness of wave train increase. It is possible that such effect was observed in the side-bands generation by the pearls. It is a positive argument in the application of nonlinear theory of side-bands with the ion-cyclotron waves propagating in the magnetosphere of the earth

Modeling of Nonlinear Beat Signals of TAE's

Science.gov (United States)

Zhang, Bo; Berk, Herbert; Breizman, Boris; Zheng, Linjin

2012-03-01

Experiments on Alcator C-Mod reveal Toroidal Alfven Eigenmodes (TAE) together with signals at various beat frequencies, including those at twice the mode frequency. The beat frequencies are sidebands driven by quadratic nonlinear terms in the MHD equations. These nonlinear sidebands have not yet been quantified by any existing codes. We extend the AEGIS code to capture nonlinear effects by treating the nonlinear terms as a driving source in the linear MHD solver. Our goal is to compute the spatial structure of the sidebands for realistic geometry and q-profile, which can be directly compared with experiment in order to interpret the phase contrast imaging diagnostic measurements and to enable the quantitative determination of the Alfven wave amplitude in the plasma core

Linearized theory of inhomogeneous multiple 'water-bag' plasmas

Science.gov (United States)

Bloomberg, H. W.; Berk, H. L.

1973-01-01

Equations are derived for describing the inhomogeneous equilibrium and small deviations from the equilibrium, giving particular attention to systems with trapped particles. An investigation is conducted of periodic systems with a single trapped-particle water bag, taking into account the behavior of the perturbation equations at the turning points. An outline is provided concerning a procedure for obtaining the eigenvalues. The results of stability calculations connected with the sideband effects are considered along with questions regarding the general applicability of the multiple water-bag approach in stability calculations.

Demonstration of a squeezed-light-enhanced power- and signal-recycled Michelson interferometer.

Science.gov (United States)

Vahlbruch, Henning; Chelkowski, Simon; Hage, Boris; Franzen, Alexander; Danzmann, Karsten; Schnabel, Roman

2005-11-18

We report on the experimental combination of three advanced interferometer techniques for gravitational wave detection, namely, power recycling, detuned signal recycling, and squeezed field injection. For the first time, we experimentally prove the compatibility of especially the latter two. To achieve a broadband nonclassical sensitivity improvement, we applied a filter cavity for compensation of quadrature rotation. The signal-to-noise ratio was improved by up to 2.8 dB beyond the coherent state's shot noise. The complete setup was stably locked for arbitrary times and characterized by injected single-sideband modulation fields.

Sugar-sweetened beverage consumption and age at menarche in a prospective study of US girls.

Science.gov (United States)

Carwile, J L; Willett, W C; Spiegelman, D; Hertzmark, E; Rich-Edwards, J; Frazier, A L; Michels, K B

2015-03-01

Is sugar-sweetened beverage (SSB) consumption associated with age at menarche? More frequent SSB consumption was associated with earlier menarche in a population of US girls. SSB consumption is associated with metabolic changes that could potentially impact menarcheal timing, but direct associations with age at menarche have yet to be investigated. The Growing up Today Study, a prospective cohort study of 16 875 children of Nurses' Health Study II participants residing in all 50 US states. This analysis followed 5583 girls, aged 9-14 years and premenarcheal at baseline, between 1996 and 2001. During 10 555 person-years of follow-up, 94% (n = 5227) of girls reported their age at menarche, and 3% (n = 159) remained premenarcheal in 2001; 4% (n = 197) of eligible girls were censored, primarily for missing age at menarche. Cumulative updated SSB consumption (composed of non-carbonated fruit drinks, sugar-sweetened soda and iced tea) was calculated using annual Youth/Adolescent Food Frequency Questionnaires from 1996 to 1998. Age at menarche was self-reported annually. The association between SSB consumption and age at menarche was assessed using Cox proportional hazards regression. More frequent SSB consumption predicted earlier menarche. At any given age between 9 and 18.5 years, premenarcheal girls who reported consuming >1.5 servings of SSBs per day were, on average, 24% more likely [95% confidence interval (CI): 13, 36%; P-trend: 1.5 SSBs daily had an estimated 2.7-month earlier menarche (95% CI: -4.1, -1.3 months) relative to those consuming ≤2 SSBs weekly. The frequency of non-carbonated fruit drink (P-trend: 0.03) and sugar-sweetened soda (P-trend: 0.001), but not iced tea (P-trend: 0.49), consumption also predicted earlier menarche. The effect of SSB consumption on age at menarche was observed in every tertile of baseline BMI. Diet soda and fruit juice consumption were not associated with age at menarche. Although we adjusted for a variety of suspected

Decay instability of a whistler in a plasma

International Nuclear Information System (INIS)

Tewari, D.P.; Sharma, R.R.

1982-01-01

The parametric instabilities of a high power whistler in a high density plasma possess large growth rate when the scattered sideband is an electrostatic lower hybrid mode. The efficient channels of decay include oscillating two stream instability, nonlinear Landau damping and resonant decay involving ion acoustic and ion cyclotron modes. The processes of nonlinear scattering, i.e., the ones possessing whistler sidebands are relatively less significant. (author)

Luminescence the instrumental key to the future of nanotechnology

CERN Document Server

Gilmore, Adam M

2013-01-01

PrefaceImportant Spectral and Polarized Properties of Semiconducting SWNT Photoluminescence Shigeo Maruyama and Yuhei MiyauchiImportant Spectral FeaturesPhonon Sideband in AbsorptionVarious Sidebands in EmissionCross-Polarized AbsorptionTransverse Quasi-Dark ExcitonsAdvanced Aspects of Photoluminescence Instrumentation for Carbon Nanotubes Said Kazaoui, Y. Futami, Konstantin Iakoubovskii, and Nobutsugu MinamiIntroductionCNT Thin-Film Fabrication MethodsNIR-PL-Mapping InstrumentsOutlookDevelopments in Catalytic Me

Taxes on Sugar-Sweetened Beverages to Reduce Overweight and Obesity in Middle-Income Countries: A Systematic Review.

Directory of Open Access Journals (Sweden)

Sharon S Nakhimovsky

Full Text Available The consumption of sugar-sweetened beverages (SSBs, which can lead to weight gain, is rising in middle-income countries (MICs. Taxing SSBs may help address this challenge. Systematic reviews focused on high-income countries indicate that taxing SSBs may reduce SSB consumption. Responsiveness to price changes may differ in MICs, where governments are considering the tax. To help inform their policy decisions, this review compiles evidence from MICs, assessing post-tax price increases (objective 1, changes in demand for SSBs and other products, overall and by socio-economic groups (objective 2, and effects on overweight and obesity prevalence (objective 3.We conducted a systematic review on the effectiveness of SSB taxation in MICs (1990-2016 and identified nine studies from Brazil, Ecuador, India, Mexico, Peru, and South Africa. Estimates for own-price elasticity ranged from -0.6 to -1.2, and decreases in SSB consumption ranged from 5 to 39 kilojoules per person per day given a 10% increase in SSB prices. The review found that milk is a likely substitute, and foods prepared away from home, snacks, and candy are likely complements to SSBs. A quasi-experimental study and two modeling studies also found a negative relationship between SSB prices and obesity outcomes after accounting for substitution effects. Estimates are consistent despite variation in baseline obesity prevalence and per person per day consumption of SSBs across countries studied.The review indicates that taxing SSBs will increase the prices of SSBs, especially sugary soda, in markets with few producers. Taxing SSBs will also reduce net energy intake by enough to prevent further growth in obesity prevalence, but not to reduce population weight permanently. Additional research using better survey data and stronger study designs is needed to ascertain the long-term effectiveness of an SSB tax on obesity prevalence in MICs.

Taxes on Sugar-Sweetened Beverages to Reduce Overweight and Obesity in Middle-Income Countries: A Systematic Review.

Science.gov (United States)

Nakhimovsky, Sharon S; Feigl, Andrea B; Avila, Carlos; O'Sullivan, Gael; Macgregor-Skinner, Elizabeth; Spranca, Mark

The consumption of sugar-sweetened beverages (SSBs), which can lead to weight gain, is rising in middle-income countries (MICs). Taxing SSBs may help address this challenge. Systematic reviews focused on high-income countries indicate that taxing SSBs may reduce SSB consumption. Responsiveness to price changes may differ in MICs, where governments are considering the tax. To help inform their policy decisions, this review compiles evidence from MICs, assessing post-tax price increases (objective 1), changes in demand for SSBs and other products, overall and by socio-economic groups (objective 2), and effects on overweight and obesity prevalence (objective 3). We conducted a systematic review on the effectiveness of SSB taxation in MICs (1990-2016) and identified nine studies from Brazil, Ecuador, India, Mexico, Peru, and South Africa. Estimates for own-price elasticity ranged from -0.6 to -1.2, and decreases in SSB consumption ranged from 5 to 39 kilojoules per person per day given a 10% increase in SSB prices. The review found that milk is a likely substitute, and foods prepared away from home, snacks, and candy are likely complements to SSBs. A quasi-experimental study and two modeling studies also found a negative relationship between SSB prices and obesity outcomes after accounting for substitution effects. Estimates are consistent despite variation in baseline obesity prevalence and per person per day consumption of SSBs across countries studied. The review indicates that taxing SSBs will increase the prices of SSBs, especially sugary soda, in markets with few producers. Taxing SSBs will also reduce net energy intake by enough to prevent further growth in obesity prevalence, but not to reduce population weight permanently. Additional research using better survey data and stronger study designs is needed to ascertain the long-term effectiveness of an SSB tax on obesity prevalence in MICs.

Predicting dietary intake among children classified as overweight or at risk for overweight: Independent and interactive effects of parenting practices and styles.

Science.gov (United States)

Langer, Shelby L; Seburg, Elisabeth; JaKa, Meghan M; Sherwood, Nancy E; Levy, Rona L

2017-03-01

Using baseline data from a randomized controlled pediatric obesity prevention trial, this study sought to examine general parenting style as a potential moderator of the association between feeding-specific parenting practices and child dietary intake. Four hundred and twenty-one parent-child dyads served as participants (49% girls and 93% mothers). Children were, on average, 6.6 years old and either overweight or at-risk for overweight (mean BMI percentile = 84.9). Data were collected in participants' homes. Study staff measured children's height and weight. Parents completed questionnaires designed to assess general parenting styles (authoritative, authoritarian and permissive) and child feeding practices (restriction and monitoring). Child dietary intake was assessed using a 24-h recall system. Outcomes were daily servings of fruits and vegetables, sugar-sweetened beverages (SSB), and unhealthy snacks. Results were as follows: Permissive parenting was inversely associated with fruit and vegetable consumption, and parental monitoring was inversely associated with SSB consumption. There were no other main effects of parenting style or feeding practice on child dietary consumption. Authoritarian parenting moderated the association between restriction and SSB intake (a marginally significant effect after correcting for multiple comparisons). Restriction was inversely associated with SSB consumption when authoritarianism was high but unassociated with SSB consumption when authoritarianism was low. Findings indicate that the parenting practice of monitoring child dietary intake was associated with more healthful consumption regardless of parenting style; interventions may thus benefit from encouraging parental monitoring. The parenting strategy of restricting child dietary intake, in contrast, was associated with lower SSB intake in the context of higher parental authoritarianism but inconsequential in the context of lower parental authoritarianism. This exploratory

Impact of individual and worksite environmental factors on water and sugar-sweetened beverage consumption among overweight employees.

Science.gov (United States)

Davy, Brenda M; You, Wen; Almeida, Fabio; Wall, Sarah; Harden, Samantha; Comber, Dana L; Estabrooks, Paul A

2014-05-01

The worksite environment may influence employees' dietary behaviors. Consumption of water and sugar-sweetened beverages (SSBs) affect weight management; however, little research has evaluated the influence of worksite factors on beverage consumption. Our purpose was to determine whether individual and worksite factors are associated with water and SSB intake among overweight and obese employees. Data were collected as part of baseline assessments for a worksite-based, weight-management intervention trial. Height and weight of participants (N = 1,482; 74% female; mean age = 47 y [standard deviation (SD) = 11 y]; mean weight = 208 lbs [SD = 46 lbs]) were assessed, and participants completed a validated beverage intake questionnaire. Environmental characteristics of worksites (N = 28) were audited. A qualitative comparative analysis (QCA) was used to identify worksite conditions that may support healthier beverage intake patterns. Most participants were white (75% of sample) with at least some college education or a college degree (approximately 82% of sample). Mean water and SSB intake were 27 fl oz (SD = 18 fl oz) and 17 fl oz (SD = 18 fl oz), respectively; SSB intake (191 kcal [SD = 218 kcal]) exceeded the recommended discretionary energy intake. Statistical models did not identify any significant predictors of water intake. Female sex and increasing level of education and household income were associated with lower SSB intake; baseline body weight and greater number of worksite water coolers and vending machines were associated with higher SSB intake. The QCA identified worksite type (ie, not manual labor) as a condition necessary for healthier beverage consumption; a worksite break policy of 2 or more per day may lead to unhealthy beverage consumption. Lower SSB consumption was noted among older participants, female participants, and among participants with higher education and income levels. Workplace factors influence beverage consumption among overweight

Prevalence and duration of social security benefits allowed to workers with asthma in Brazil in 2008.

Science.gov (United States)

Branco, Anadergh Barbosa de Abreu; Ildefonso, Simone de Andrade Goulart

2012-01-01

To determine the prevalence and duration of social security benefits (SSBs) claims to registered workers with asthma in Brazil by the Brazilian National Institute of Social Security in 2008. This was a retrospective, descriptive study, based on information obtained from the Brazilian Unified Benefit System database, on the number of SSB claims granted to registered workers with asthma in 2008. The reference population was the monthly mean number of workers registered in the Brazilian Social Registry Database in 2008. The variables studied were type of economic activity, gender, age, and type/duration of the SSB claim. The relationship between work and asthma was evaluated by the prevalence ratio (PR) between work-related and non-work-related SSB claims for asthma. In 2008, 2,483 SSB claims were granted for asthma, with a prevalence of 7.5 allowances per 100,000 registered workers. The prevalence was higher among females than among males (PR = 2.1 between the sexes). Workers > 40 years of age were 2.5 times more likely to be granted an SSB claim for asthma than were younger workers. The prevalence was highest among workers engaged in the following types of economic activity: sewage, wood and wood product manufacturing, and furniture manufacturing (78.8, 22.4, and 22.2 claims/100,000 registered workers, respectively). The median (interquartile range) duration of SSB claims for asthma was 49 (28-87) days. Asthma is a major cause of sick leave, and its etiology has a strong occupational component. This has a major impact on employers, employees, and the social security system. Being female, being > 40 years of age, and working in the areas of urban sanitation/sewage, wood and wood product manufacturing, and furniture manufacturing increase the chance of sick leave due to asthma.

Suprascapular block associated with supraclavicular block: An alternative to isolated interscalene block for analgesia in shoulder instability surgery?

Science.gov (United States)

Trabelsi, W; Ben Gabsia, A; Lebbi, A; Sammoud, W; Labbène, I; Ferjani, M

2017-02-01

Interscalene brachial plexus block (ISB) is the gold standard for postoperative pain management in shoulder surgery. However, this technique has side effects and potentially serious complications. The aim of this study was to compare the combinations of ultrasound-guided suprascapular (SSB) associated with supraclavicular nerve block (SCB) and ultrasound-guided ISB for postoperative analgesia after shoulder instability surgery. Sixty ASA physical status I-II patients scheduled to undergo shoulder instability surgery were included. Two groups: (i) the SSB+SCB group (n=30) in which the patients received a combination of US-guided SSB (15mL of bupivacaine 0.25%) and US-guided SCB (15mL of bupivacaine 0.25%) and (ii) the ISB group (n=30) in which the patients received US-guided ISB with 30mL of bupivacaine 0.25%. General anesthesia was administered to all patients. During the first 24h, the variables assessed were time to administer the anesthesia, duration of the analgesia, onset and duration of motor and sensory blockade, opioid consumption, cardiovascular stability, complications, and patient satisfaction. Anesthesia induction took more time for the SSB+SCB group than for the ISB group. However, the onset time of motor and sensory blockade was similar in the two groups. Statistical analysis of the visual analog postoperative pain scoring at H0, H6, H12, and H24 showed nonsignificant differences between the groups. Analgesia, the first request for morphine, and total morphine consumption during the first 24h was similar in both groups. No complication was recorded in the SSB+SCB group. However, phrenic nerve block occurred in all patients in the ISB group. US-guided SCB combined with US-guided SSB was as effective as ISB for postoperative analgesia after shoulder instability surgery without decreasing potential side effects. NCT identifier: NCT02397330. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

Contemporary management issues confronting fisheries science

Science.gov (United States)

Frank, Kenneth T.; Brickman, David

2001-06-01

Stock collapses have occurred worldwide. The most frequently cited cause is over-fishing, suggesting that fisheries management has been ineffective in controlling exploitation rates. The progression of a fishery from an over-exploited to a collapsed state involves impairment of the reproductive capacity of the target species, i.e. recruitment over-fishing. In many cases, this occurs by reduction of the spawning stock biomass (SSB) through the systematic elimination of spawning components within a stock complex. While operational definitions of minimum levels of SSB have been developed, they have seldom been applied and never adopted in a Canadian groundfish management context. The answer to the question of how much is enough to perpetuate a stock under exploitation has been illusive. Serebryakov [J. Cons. Int. Explor. Mer, 47 (1990) 267] has advocated definition of critical levels of SSB based on survival rates (R/SSB). We review his method and discuss the utility of the approach. An alternative approach to the problem of estimating minimum SSB is through a fundamental revision of the traditional stock and recruitment relationship. Explicit theoretical SSB thresholds below which reproduction/recruitment is severely impaired based upon density-dependent mating success (or Allee effects) is considered a superior approach to the question of how much is enough because of its ecological grounding. However, the successful application of this approach will require re-definition of the space/time scales of the management unit. Finally, support is growing for the establishment of closed areas or "no-take zones" as an alternative approach to managing the problems of fishing a stock complex by enabling sub-populations to escape fishing. While the expected benefits of areas protected from fishing are numerous, clear demonstrations of benefits of such areas in marine temperate ecosystems are lacking. In fact, unintended negative consequences may result from such actions.

Inhibition of radiation-induced DNA strand breaks by hoechst 33258: OH-radical scavenging and DNA radical quenching

International Nuclear Information System (INIS)

Adhikary, A.; Bothe, E.; Von Sonntag, C.; Adhikary, A.

1997-01-01

The minor-groove-binding dye Hoechst 33258 has been found to protect pBR322 DNA in aqueous solution against radiation-induced single-strand breaks (ssb). This protective effect has been assumed to be largely due to the scavenging of the strand-break-generating OH radicals by Hoechst. From D 37 values for ssb at different Hoechst concentrations the value of the OH radical scavenging constant of DNA-bound Hoechst has been estimated at k Ho/DNA = 2.7 * 10 11 dm 3 mol -1 . This unexpectedly high value has led us to study the reactions of OH radicals with Hoechst in the absence and in the presence of double-stranded calf thymus DNA (ds DNA) by pulse radiolysis, and the formation of radiation-induced ssb by low angle laser light scattering. The D 37 /D 37 0 values at different Hoechst concentrations agree with the values obtained by Martin and al. and demonstrate the protection. However, this protection cannot be explained on the basis of OH radical scavenging alone using the above rate constants. There must, in addition, be some quenching of DNA radicals. Hoechst radicals are formed in the later ms time range, i.e a long time after the disappearance of the OH radicals. This delayed Hoechst radical formation has been assigned to a a reaction of DNA radicals with Hoechst, thereby inhibiting strand breakage. In confirmation, pulse radiolysis of aqueous solution of nucleotides in the presence of Hoechst yields a similar delayed Hoechst radical formation. The data indicate that in DNA the cross-section of this quenching has a diameter of 3 to 4 base pairs per Hoechst molecule. (N.C.)

Decreasing sugar-sweetened beverage consumption in the rural adolescent population.

Science.gov (United States)

Delpier, Terry; Giordana, Sheri; Wedin, Bitsy M

2013-01-01

Adolescent consumption of sugar-sweetened beverages (SSBs) has increased drastically with detrimental effects such as weight gain, weakened bones, dental caries, and associated higher levels of type II diabetes in this population. While in the clinical setting, rural family nurse practitioner (FNP) students, using Kellogg-funded Smart Phones, screened adolescents aged 13 to 17 years for SSB consumption in the previous 24 hours. Adolescents initially were provided with a pamphlet and related oral teaching concerning SSBs by the FNP students, as well as a water bottle to encourage healthy fluid intake. Screening SSB information was loaded onto Smart Phones, which resulted in immediate access by the primary investigator sometimes even hundreds of miles distant. After 30 days, FNP students completed follow-up phone interviews to reassess SSB consumption in the previous 24 hours. Results concerning decreased SSB consumption were statistically significant. Additionally, Smart Phones were instrumental in high-speed data transfer. Both advantages and disadvantages were encountered when using this evolving technology. Copyright © 2013 National Association of Pediatric Nurse Practitioners. Published by Mosby, Inc. All rights reserved.

Expressing OsMPK4 Impairs Plant Growth but Enhances the Resistance of Rice to the Striped Stem Borer Chilo suppressalis

Directory of Open Access Journals (Sweden)

Xiaoli Liu

2018-04-01

Full Text Available Mitogen-activated protein kinases (MPKs play a central role not only in plant growth and development, but also in plant responses to abiotic and biotic stresses, including pathogens. Yet, their role in herbivore-induced plant defenses and their underlying mechanisms remain largely unknown. Here, we cloned a rice MPK gene, OsMPK4, whose expression was induced by mechanical wounding, infestation of the striped stem borer (SSB Chilo suppressalis, and treatment with jasmonic acid (JA, but not by treatment with salicylic acid (SA. The overexpression of OsMPK4 (oe-MPK4 enhanced constitutive and/or SSB-induced levels of JA, jasmonoyl-l-isoleucine (JA-Ile, ethylene (ET, and SA, as well as the activity of elicited trypsin proteinase inhibitors (TrypPIs, and reduced SSB performance. On the other hand, compared to wild-type plants, oe-MPK4 lines in the greenhouse showed growth retardation. These findings suggest that OsMPK4, by regulating JA-, ET-, and SA-mediated signaling pathways, functions as a positive regulator of rice resistance to the SSB and a negative regulator of rice growth.

Modeling early physical and chemical events for DNA damage induced by photons and tritium beta particles

International Nuclear Information System (INIS)

Moiseenko, V.; Waker, A.J.; Prestwich, W.V.

1998-02-01

A method has been developed to model production of single-strand breaks (SSB) and double-strand breaks (DSB) in Deoxyribo Nucleic Acid (DNA) by ionizing radiations. Modeling is carried out by Monte Carlo means and includes consideration of direct energy depositions in DNA molecules, production of chemical species following water radiolysis, diffusion of chemical species, and their interactions with each other and DNA. Computer-generated electron tracks in liquid water are used to model energy deposition and to derive the initial localization of chemical species. Atomistic representation of the DNA with a first hydration shell is used to derive direct energy depositions in DNA molecules and the resulting consequences, and to derive coordinates of reactive sites for modeling of the chemical stage of radiation damage. Diffusion of chemical species is followed in time, and the reactions of species with each other and DNA are considered to occur in an encounter-controlled manner. Time of diffusion follow-up is restricted to 10 -12 - 10 -9 s, which yields a diffusion length of hydroxyl radicals comparable to that in the cellular environment. DNA SSB are assumed to result from any direct energy depositions in the sugar/phosphate moiety, ionizations in water molecules bound to sugar/phosphate and hydroxyl attacks on deoxyribose. DSB are assumed to result from two SSB on opposite strands separated by 10 or fewer base pairs. Photon radiations in the energy range 70 keV-1 MeV and tritium beta particles are considered. It is shown that for naked DNA in B-form (the configuration thought to be most biologically relevant) the effectiveness of tritium for SSB and DSB production is, within statistical uncertainties, comparable to photon radiation with energies in the range 70 keV-1 MeV, although a tendency for increased DSB production has been observed for 70 keV photons that represent orthovoltage X-rays and for tritium beta particles. It is predicted that hydroxyl radicals react

Perceptions of Tap Water and School Water Fountains and Association with Intake of Plain Water and Sugar-Sweetened Beverages

Science.gov (United States)

Onufrak, Stephen J.; Park, Sohyun; Sharkey, Joseph R.; Merlo, Caitlin; Dean, Wesley R.; Sherry, Bettylou

2014-01-01

Background: Little is known regarding youth perceptions of tap water and school water fountains and how these relate to water and sugar-sweetened beverage (SSB) intake. Methods: We used national 2010 YouthStyles data to assess perceptions of tap water and school water fountains and associations with water and SSB intake. Results: Nearly 1 in 5…

The role of DNA repair in the realizatian of oxygen effect in bacteria ESCHERICHIA COLI irradiated with Various types of radiation (theoretical apalySis)

International Nuclear Information System (INIS)

Kozubek, S.; Krasavin, E.A.

1983-01-01

The regUlarities of the induction of basic types of DNA injuries influencing OER by the radiations of different LETs are considered. The DNA injuries arising from two, three and more acts of energy depositions are shown to increase with increasing LET. On the basis of proposed model the amount of irreparable by repair 11 single-strand breaks (Nsub(SSB1)sup(ir)) DNA in the dependence on LET is estimated. The dependence Nsub(SSB1)sup(ir) (LET) forms a slight maximum typical of multihit processes. The maximUm arises in the region of LET 200-300 keV/μm. The amoUnts of direct double-strand breaks (Nsub(dDSB)) DNA in both the presence and absence of oxygen in the dependence on LET have been estimated, too. The calculations show that in the region beyond the maximum of Nsub(dDSB) (LET) dependence constant ratio between NsUb(dDSB) in oxic and anoxic conditions is preserved. In the region of the maximum the ratio decreases. On the basis of our analysis a critical look at both the ''interacting radicals'' and ''oxygen in track'' hypotheses is given

Fast Detection of Striped Stem-Borer (Chilo suppressalis Walker Infested Rice Seedling Based on Visible/Near-Infrared Hyperspectral Imaging System

Directory of Open Access Journals (Sweden)

Yangyang Fan

2017-10-01

Full Text Available Striped stem-borer (SSB infestation is one of the most serious sources of damage to rice growth. A rapid and non-destructive method of early SSB detection is essential for rice-growth protection. In this study, hyperspectral imaging combined with chemometrics was used to detect early SSB infestation in rice and identify the degree of infestation (DI. Visible/near-infrared hyperspectral images (in the spectral range of 380 nm to 1030 nm were taken of the healthy rice plants and infested rice plants by SSB for 2, 4, 6, 8 and 10 days. A total of 17 characteristic wavelengths were selected from the spectral data extracted from the hyperspectral images by the successive projection algorithm (SPA. Principal component analysis (PCA was applied to the hyperspectral images, and 16 textural features based on the gray-level co-occurrence matrix (GLCM were extracted from the first two principal component (PC images. A back-propagation neural network (BPNN was used to establish infestation degree evaluation models based on full spectra, characteristic wavelengths, textural features and features fusion, respectively. BPNN models based on a fusion of characteristic wavelengths and textural features achieved the best performance, with classification accuracy of calibration and prediction sets over 95%. The accuracy of each infestation degree was satisfactory, and the accuracy of rice samples infested for 2 days was slightly low. In all, this study indicated the feasibility of hyperspectral imaging techniques to detect early SSB infestation and identify degrees of infestation.

COFFEE, TEA AND SUGAR-SWEETENED CARBONATED SOFT DRINK INTAKE AND PANCREATIC CANCER RISK: A POOLED ANALYSIS OF 14 COHORT STUDIES

Science.gov (United States)

Genkinger, Jeanine M.; Li, Ruifeng; Spiegelman, Donna; Anderson, Kristin E.; Albanes, Demetrius; Bergkvist, Leif; Bernstein, Leslie; Black, Amanda; van den Brandt, Piet A.; English, Dallas R.; Freudenheim, Jo L.; Fuchs, Charles S.; Giles, Graham G.; Giovannucci, Edward; Goldbohm, R. Alexandra; Horn-Ross, Pamela L.; Jacobs, Eric J.; Koushik, Anita; Männistö, Satu; Marshall, James R.; Miller, Anthony B.; Patel, Alpa V.; Robien, Kim; z, Thomas E.; Schairer, Catherine; Stolzenberg-Solomon, Rachael; Wolk, Alicja; Ziegler, Regina G.; Smith-Warner, Stephanie A.

2011-01-01

BACKGROUND Coffee has been hypothesized to have pro- and anti-carcinogenic properties, while tea may contain anti-carcinogenic compounds. Studies assessing coffee intake and pancreatic cancer risk have yielded mixed results, while findings for tea intake have mostly been null. Sugar-sweetened carbonated soft drink (abbreviated as SSB) intake has been associated with higher circulating levels of insulin, which may promote carcinogenesis. Few prospective studies have examined SSB intake and pancreatic cancer risk; results have been heterogeneous. METHODS In this pooled analysis from 14 prospective cohort studies, 2,185 incident pancreatic cancer cases were identified among 853,894 individuals during follow-up. Multivariate (MV) study-specific relative risks (RR) and 95% confidence intervals (CI) were calculated using Cox proportional hazards models and then pooled using a random effects model. RESULTS No statistically significant associations were observed between pancreatic cancer risk and intake of coffee (MVRR=1.10, 95% CI=0.81-1.48 comparing ≥900 to 0.05). These associations were consistent across levels of sex, smoking status and body mass index. When modeled as a continuous variable, a positive association was evident for SSB (MVRR=1.06, 95% CI=1.02-1.12). CONCLUSION AND IMPACT Overall, no associations were observed for intakes of coffee or tea during adulthood and pancreatic cancer risk. Although we were only able to examine modest intake of SSB, there was a suggestive, modest positive association for risk of pancreatic cancer for intakes of SSB. PMID:22194529

The association between sugar-sweetened beverages and dental caries among third-grade students in Georgia.

Science.gov (United States)

Wilder, Jocelyn R; Kaste, Linda M; Handler, Arden; Chapple-McGruder, Theresa; Rankin, Kristin M

2016-01-01

The purpose of this study is to examine the association between sugar-sweetened beverage (SSB) consumption and caries experience among Georgia third graders. The 2010-2011 Georgia Third Grade Oral Health Study provided a school-based sample for analysis. Data were weighted to be representative of the state of Georgia's third graders. Log-binomial regression was used to assess the association between SSB consumption and caries experience after adjusting for socio-demographic and maternal and child oral health characteristics. Georgia third graders consumed approximately two servings of SSB per day on average (1.7, 95% CI 1.6-1.8). Fifty-two percent of Georgia third graders had caries experience. Daily consumption of SSB and prevalence of caries experience differed significantly by demographic characteristics. After adjustment for socio-demographic and maternal oral health characteristics, caries experience increased 22 percent (adjusted PR = 1.2, 95% CI 1.1, 1.3) for every additional reported serving of SSB consumed per day. Higher consumption of SSBs is associated with higher caries prevalence among Georgia third graders after adjustment for important covariates. Consequently, health messages about SSBs from dentists, physicians, and other healthcare providers as well as policy approaches at the school, state, and national levels to limit consumption of SSBs may collectively impact both the development of dental caries and obesity, leading to overall better health for children. © 2015 American Association of Public Health Dentistry.

Changes in the Healthy Beverage Index in Response to an Intervention Targeting a Reduction in Sugar-Sweetened Beverage Consumption as Compared to an Intervention Targeting Improvements in Physical Activity: Results from the Talking Health Trial

Directory of Open Access Journals (Sweden)

Valisa E. Hedrick

2015-12-01

Full Text Available The recently developed Healthy Beverage Index (HBI was designed to evaluate overall beverage intake quality (including total fluid consumption and beverage calories, yet no known intervention studies have assessed longitudinal changes to the HBI. The objective of this investigation was to assess changes in HBI scores in response to a sugar-sweetened beverage (SSB reduction trial as compared to a physical activity comparison group. Participants were enrolled into a six-month, community-based, controlled behavioral trial and randomized into either a SSB reduction group (SIPsmartER or a physical activity group (MoveMore. Correlations and multilevel mixed-effects linear regression with intention-to-treat analyses are presented. Total HBI score significantly increased for SIPsmartER (n = 149 (mean increase = 7.5 points (5.4, 9.7, p ≤ 0.001 and MoveMore (n = 143 (mean increase = 3.4 points (1.6, 5.2, p ≤ 0.001 participants, with a significant between group effect (p ≤ 0.05, over the six-month intervention. Other significant changes in HBI components for SIPsmartER included increased SSB and total beverage calorie scores, and decreased low-fat milk and diet soda scores. Changes in total HBI scores were significantly correlated with changes in total Healthy Eating Index-2010 scores (r = 0.15, p ≤ 0.01. Our findings suggest that individual HBI component scores, beyond the SSB component, are influenced by intervention strategies that primarily focus on SSB reduction.

Changes in the Healthy Beverage Index in Response to an Intervention Targeting a Reduction in Sugar-Sweetened Beverage Consumption as Compared to an Intervention Targeting Improvements in Physical Activity: Results from the Talking Health Trial.

Science.gov (United States)

Hedrick, Valisa E; Davy, Brenda M; Myers, Emily A; You, Wen; Zoellner, Jamie M

2015-12-04

The recently developed Healthy Beverage Index (HBI) was designed to evaluate overall beverage intake quality (including total fluid consumption and beverage calories), yet no known intervention studies have assessed longitudinal changes to the HBI. The objective of this investigation was to assess changes in HBI scores in response to a sugar-sweetened beverage (SSB) reduction trial as compared to a physical activity comparison group. Participants were enrolled into a six-month, community-based, controlled behavioral trial and randomized into either a SSB reduction group (SIPsmartER) or a physical activity group (MoveMore). Correlations and multilevel mixed-effects linear regression with intention-to-treat analyses are presented. Total HBI score significantly increased for SIPsmartER (n = 149) (mean increase = 7.5 points (5.4, 9.7), p ≤ 0.001) and MoveMore (n = 143) (mean increase = 3.4 points (1.6, 5.2), p ≤ 0.001) participants, with a significant between group effect (p ≤ 0.05), over the six-month intervention. Other significant changes in HBI components for SIPsmartER included increased SSB and total beverage calorie scores, and decreased low-fat milk and diet soda scores. Changes in total HBI scores were significantly correlated with changes in total Healthy Eating Index-2010 scores (r = 0.15, p ≤ 0.01). Our findings suggest that individual HBI component scores, beyond the SSB component, are influenced by intervention strategies that primarily focus on SSB reduction.

Blind I/Q imbalance and nonlinear ISI mitigation in Nyquist-SCM direct detection system with cascaded widely linear and Volterra equalizer

Science.gov (United States)

Liu, Na; Ju, Cheng

2018-02-01

Nyquist-SCM signal after fiber transmission, direct detection (DD), and analog down-conversion suffers from linear ISI, nonlinear ISI, and I/Q imbalance, simultaneously. Theoretical analysis based on widely linear (WL) and Volterra series is given to explain the relationship and interaction of these three interferences. A blind equalization algorithm, cascaded WL and Volterra equalizer, is designed to mitigate these three interferences. Furthermore, the feasibility of the proposed cascaded algorithm is experimentally demonstrated based on a 40-Gbps data rate 16-quadrature amplitude modulation (QAM) virtual single sideband (VSSB) Nyquist-SCM DD system over 100-km standard single mode fiber (SSMF) transmission. In addition, the performances of conventional strictly linear equalizer, WL equalizer, Volterra equalizer, and cascaded WL and Volterra equalizer are experimentally evaluated, respectively.

Cascade photonic integrated circuit architecture for electro-optic in-phase quadrature/single sideband modulation or frequency conversion.

Science.gov (United States)

Hasan, Mehedi; Hall, Trevor

2015-11-01

A photonic integrated circuit architecture for implementing frequency upconversion is proposed. The circuit consists of a 1×2 splitter and 2×1 combiner interconnected by two stages of differentially driven phase modulators having 2×2 multimode interference coupler between the stages. A transfer matrix approach is used to model the operation of the architecture. The predictions of the model are validated by simulations performed using an industry standard software tool. The intrinsic conversion efficiency of the proposed design is improved by 6 dB over the alternative functionally equivalent circuit based on dual parallel Mach-Zehnder modulators known in the prior art. A two-tone analysis is presented to study the linearity of the proposed circuit, and a comparison is provided over the alternative. The proposed circuit is suitable for integration in any platform that offers linear electro-optic phase modulation such as LiNbO(3), silicon, III-V, or hybrid technology.

Controlled Release Urea as a Nitrogen Source for Spring Wheat in Western Canada: Yield, Grain N Content, and N Use Efficiency

Directory of Open Access Journals (Sweden)

Lenz Haderlein

2001-01-01

Full Text Available Controlled release nitrogen (N fertilizers have been commonly used in horticultural applications such as turf grasses and container-grown woody perennials. Agrium, a major N manufacturer in North and South America, is developing a low-cost controlled release urea (CRU product for use in field crops such as grain corn, canola, wheat, and other small grain cereals. From 1998 to 2000, 11 field trials were conducted across western Canada to determine if seed-placed CRU could maintain crop yields and increase grain N and N use efficiency when compared to the practice of side-banding of urea N fertilizer. CRU was designed to release timely and adequate, but not excessive, amounts of N to the crop. Crop uptake of N from seed-placed CRU was sufficient to provide yields similar to those of side-banded urea N. Grain N concentrations of the CRU treatments were higher, on average, than those from side-banded urea, resulting in 4.2% higher N use efficiency across the entire N application range from 25 to 100 kg ha-1. Higher levels of removal of N in grain from CRU compared to side-banded urea can result in less residual N remaining in the soil, and limit the possibility of N losses due to denitrification and leaching.

Truncation effects in the functional renormalization group study of spontaneous symmetry breaking

International Nuclear Information System (INIS)

Defenu, N.; Mati, P.; Márián, I.G.; Nándori, I.; Trombettoni, A.

2015-01-01

We study the occurrence of spontaneous symmetry breaking (SSB) for O(N) models using functional renormalization group techniques. We show that even the local potential approximation (LPA) when treated exactly is sufficient to give qualitatively correct results for systems with continuous symmetry, in agreement with the Mermin-Wagner theorem and its extension to systems with fractional dimensions. For general N (including the Ising model N=1) we study the solutions of the LPA equations for various truncations around the zero field using a finite number of terms (and different regulators), showing that SSB always occurs even where it should not. The SSB is signalled by Wilson-Fisher fixed points which for any truncation are shown to stay on the line defined by vanishing mass beta functions.

Changes in prices, sales, consumer spending, and beverage consumption one year after a tax on sugar-sweetened beverages in Berkeley, California, US: A before-and-after study

Science.gov (United States)

Ryan-Ibarra, Suzanne; Taillie, Lindsey Smith; Induni, Marta

2017-01-01

Background Taxes on sugar-sweetened beverages (SSBs) meant to improve health and raise revenue are being adopted, yet evaluation is scarce. This study examines the association of the first penny per ounce SSB excise tax in the United States, in Berkeley, California, with beverage prices, sales, store revenue/consumer spending, and usual beverage intake. Methods and findings Methods included comparison of pre-taxation (before 1 January 2015) and first-year post-taxation (1 March 2015–29 February 2016) measures of (1) beverage prices at 26 Berkeley stores; (2) point-of-sale scanner data on 15.5 million checkouts for beverage prices, sales, and store revenue for two supermarket chains covering three Berkeley and six control non-Berkeley large supermarkets in adjacent cities; and (3) a representative telephone survey (17.4% cooperation rate) of 957 adult Berkeley residents. Key hypotheses were that (1) the tax would be passed through to the prices of taxed beverages among the chain stores in which Berkeley implemented the tax in 2015; (2) sales of taxed beverages would decline, and sales of untaxed beverages would rise, in Berkeley stores more than in comparison non-Berkeley stores; (3) consumer spending per transaction (checkout episode) would not increase in Berkeley stores; and (4) self-reported consumption of taxed beverages would decline. Main outcomes and measures included changes in inflation-adjusted prices (cents/ounce), beverage sales (ounces), consumers’ spending measured as store revenue (inflation-adjusted dollars per transaction) in two large chains, and usual beverage intake (grams/day and kilocalories/day). Tax pass-through (changes in the price after imposition of the tax) for SSBs varied in degree and timing by store type and beverage type. Pass-through was complete in large chain supermarkets (+1.07¢/oz, p = 0.001) and small chain supermarkets and chain gas stations (1.31¢/oz, p = 0.004), partial in pharmacies (+0.45¢/oz, p = 0.03), and

Photon side-bands in mesoscopics

DEFF Research Database (Denmark)

Jauho, Antti-Pekka

1998-01-01

This paper reviews several applications of photonic side bands, used by Buttiker and Landauer (Phys. Rev. Lett. 49, 1739 (1982)) in their theory of traversal time in tunneling, in transport and optics of mesoscopic systems. Topics include generalizations of the transmission theory of transport...... to time-dependent situations, optics and transport of mesoscopic systems in THz electromagnetic fields, and phase-measurements of photon-assisted tunneling through a quantum dot. (C) 1998 Academic Press Limited....

DNA-binding proteins essential for protein-primed bacteriophage ø29 DNA replication

Directory of Open Access Journals (Sweden)

Margarita Salas

2016-08-01

Full Text Available Bacillus subtilis phage Φ29 has a linear, double-stranded DNA 19 kb long with an inverted terminal repeat of 6 nucleotides and a protein covalently linked to the 5’ ends of the DNA. This protein, called terminal protein (TP, is the primer for the initiation of replication, a reaction catalyzed by the viral DNA polymerase at the two DNA ends. The DNA polymerase further elongates the nascent DNA chain in a processive manner, coupling strand displacement with elongation. The viral protein p5 is a single-stranded DNA binding protein (SSB that binds to the single strands generated by strand displacement during the elongation process. Viral protein p6 is a double-stranded DNA binding protein (DBP that preferentially binds to the origins of replication at the Φ29 DNA ends and is required for the initiation of replication. Both SSB and DBP are essential for Φ29 DNA amplification. This review focuses on the role of these phage DNA-binding proteins in Φ29 DNA replication both in vitro and in vivo, as well as on the implication of several B. subtilis DNA-binding proteins in different processes of the viral cycle. We will revise the enzymatic activities of the Φ29 DNA polymerase: TP-deoxynucleotidylation, processive DNA polymerization coupled to strand displacement, 3’-5’ exonucleolysis and pyrophosphorolysis. The resolution of the Φ29 DNA polymerase structure has shed light on the translocation mechanism and the determinants responsible for processivity and strand displacement. These two properties have made Φ29 DNA polymerase one of the main enzymes used in the current DNA amplification technologies. The determination of the structure of Φ29 TP revealed the existence of three domains: the priming domain, where the primer residue Ser232, as well as Phe230, involved in the determination of the initiating nucleotide, are located, the intermediate domain, involved in DNA polymerase binding, and the N-terminal domain, responsible for DNA binding

Water fluoridation and the association of sugar-sweetened beverage consumption and dental caries in Australian children.

Science.gov (United States)

Armfield, Jason M; Spencer, A John; Roberts-Thomson, Kaye F; Plastow, Katrina

2013-03-01

We examined demographic and socioeconomic differences in the consumption of sugar-sweetened beverages (SSBs), its association with dental caries in children, and whether exposure to water fluoridation modifies this association. In a cross-sectional study, we used a stratified, clustered sampling design to obtain information on 16 508 children aged 5 to 16 years enrolled in Australian school dental services in 2002 to 2005. Dental staff assessed dental caries, and parents completed a questionnaire about their child's residential history, sources of drinking water, toothbrushing frequency, socioeconomic status (SES), and SSB consumption. Children who brushed their teeth less often and were older, male, of low SES, from rural or remote areas consumed significantly more SSBs. Caries was significantly associated with greater SSB consumption after controlling for potential confounders. Finally, greater exposure to fluoridated water significantly reduced the association between children's SSB consumption and dental caries. Consumption of SSBs should be considered a major risk factor for dental caries. However, increased exposure to fluoridated public water helped ameliorate the association between SSB consumption and dental decay. These results reconfirm the benefits of community water fluoridation for oral health.

Imaging Correlations in Heterodyne Spectra for Quantum Displacement Sensing

Science.gov (United States)

Pontin, A.; Lang, J. E.; Chowdhury, A.; Vezio, P.; Marino, F.; Morana, B.; Serra, E.; Marin, F.; Monteiro, T. S.

2018-01-01

The extraordinary sensitivity of the output field of an optical cavity to small quantum-scale displacements has led to breakthroughs such as the first detection of gravitational waves and of the motions of quantum ground-state cooled mechanical oscillators. While heterodyne detection of the output optical field of an optomechanical system exhibits asymmetries which provide a key signature that the mechanical oscillator has attained the quantum regime, important quantum correlations are lost. In turn, homodyning can detect quantum squeezing in an optical quadrature but loses the important sideband asymmetries. Here we introduce and experimentally demonstrate a new technique, subjecting the autocorrelators of the output current to filter functions, which restores the lost heterodyne correlations (whether classical or quantum), drastically augmenting the useful information accessible. The filtering even adjusts for moderate errors in the locking phase of the local oscillator. Hence we demonstrate the single-shot measurement of hundreds of different field quadratures allowing the rapid imaging of detailed features from a simple heterodyne trace. We also obtain a spectrum of hybrid homodyne-heterodyne character, with motional sidebands of combined amplitudes comparable to homodyne. Although investigated here in a thermal regime, the method's robustness and generality represents a promising new approach to sensing of quantum-scale displacements.

Nuclear-spectroscopic studies in the 132Sn region

International Nuclear Information System (INIS)

Arndt, Oliver

2007-10-01

In this work investigations on r-process nuclides around the N = 82 shell closure are done. The so far unknown half-lives and P n -values of 137-139 Sb and 139 Te and their impact to r-process theory are given. Further the results of Shergur et. al. of neutron rich tin ( 137,138 Sn) are verified and in some points improved. New data on γ-decay spectroscopy for 136 Sn from single spectra is published. To improve beam quality and solve long known problems on ISOL-facilities with isobaric contamination, new techniques are discussed. A special focus is on molecular sidebands, which is first time adapted to a target/ion source unit in a mass separation facility. It was possible to create a strong SnS + sideband and in this way to reduce isobaric background with good beam intensities. On the other hand, a target with temperature controlled transfer line was build and its characteristics are discussed. To improve selectivity of a given experiment on neutron rich nuclei a new detector system for nγ-coincidences was developed. Due to a special electronically setup of the new system it was possible to downsize the coincidence window compared to earlier attempts. (orig.)

Nuclear-spectroscopic studies in the {sup 132}Sn region; Kernspektroskopische Untersuchungen in der {sup 132}Sn-Region

Energy Technology Data Exchange (ETDEWEB)

Arndt, Oliver

2007-10-15

In this work investigations on r-process nuclides around the N = 82 shell closure are done. The so far unknown half-lives and P{sub n}-values of {sup 137-139}Sb and {sup 139}Te and their impact to r-process theory are given. Further the results of Shergur et. al. of neutron rich tin ({sup 137,138}Sn) are verified and in some points improved. New data on {gamma}-decay spectroscopy for {sup 136}Sn from single spectra is published. To improve beam quality and solve long known problems on ISOL-facilities with isobaric contamination, new techniques are discussed. A special focus is on molecular sidebands, which is first time adapted to a target/ion source unit in a mass separation facility. It was possible to create a strong SnS{sup +} sideband and in this way to reduce isobaric background with good beam intensities. On the other hand, a target with temperature controlled transfer line was build and its characteristics are discussed. To improve selectivity of a given experiment on neutron rich nuclei a new detector system for n{gamma}-coincidences was developed. Due to a special electronically setup of the new system it was possible to downsize the coincidence window compared to earlier attempts. (orig.)

Ballooning modes or Fourier modes in a toroidal plasma?

International Nuclear Information System (INIS)

Connor, J.W.; Taylor, J.B.

1987-01-01

The relationship between two different descriptions of eigenmodes in a torus is investigated. In one the eigenmodes are similar to Fourier modes in a cylinder and are highly localized near a particular rational surface. In the other they are the so-called ballooning modes that extend over many rational surfaces. Using a model that represents both drift waves and resistive interchanges the transition from one of these structures to the other is investigated. In this simplified model the transition depends on a single parameter which embodies the competition between toroidal coupling of Fourier modes (which enhances ballooning) and variation in frequency of Fourier modes from one rational surface to another (which diminishes ballooning). As the coupling is increased each Fourier mode acquires a sideband on an adjacent rational surface and these sidebands then expand across the radius to form the extended mode described by the conventional ballooning mode approximation. This analysis shows that the ballooning approximation is appropriate for drift waves in a tokamak but not for resistive interchanges in a pinch. In the latter the conventional ballooning effect is negligible but they may nevertheless show a ballooning feature. This is localized near the same rational surface as the primary Fourier mode and so does not lead to a radially extended structure

High linearity current communicating passive mixer employing a simple resistor bias

International Nuclear Information System (INIS)

Liu Rongjiang; Guo Guiliang; Yan Yuepeng

2013-01-01

A high linearity current communicating passive mixer including the mixing cell and transimpedance amplifier (TIA) is introduced. It employs the resistor in the TIA to reduce the source voltage and the gate voltage of the mixing cell. The optimum linearity and the maximum symmetric switching operation are obtained at the same time. The mixer is implemented in a 0.25 μm CMOS process. The test shows that it achieves an input third-order intercept point of 13.32 dBm, conversion gain of 5.52 dB, and a single sideband noise figure of 20 dB. (semiconductor integrated circuits)

Modulation of DNA repair capacity and mRNA expression levels of XRCC1, hOGG1 and XPC genes in styrene-exposed workers

International Nuclear Information System (INIS)

Hanova, Monika; Stetina, Rudolf; Vodickova, Ludmila; Vaclavikova, Radka; Hlavac, Pavel; Smerhovsky, Zdenek; Naccarati, Alessio; Polakova, Veronika; Soucek, Pavel; Kuricova, Miroslava; Manini, Paola; Kumar, Rajiv; Hemminki, Kari; Vodicka, Pavel

2010-01-01

Decreased levels of single-strand breaks in DNA (SSBs), reflecting DNA damage, have previously been observed with increased styrene exposure in contrast to a dose-dependent increase in the base-excision repair capacity. To clarify further the above aspects, we have investigated the associations between SSBs, micronuclei, DNA repair capacity and mRNA expression in XRCC1, hOGG1 and XPC genes on 71 styrene-exposed and 51 control individuals. Styrene concentrations at workplace and in blood characterized occupational exposure. The workers were divided into low (below 50 mg/m 3 ) and high (above 50 mg/m 3 ) styrene exposure groups. DNA damage and DNA repair capacity were analyzed in peripheral blood lymphocytes by Comet assay. The mRNA expression levels were determined by qPCR. A significant negative correlation was observed between SSBs and styrene concentration at workplace (R = - 0.38, p = 0.001); SSBs were also significantly higher in men (p = 0.001). The capacity to repair irradiation-induced DNA damage was the highest in the low exposure group (1.34 ± 1.00 SSB/10 9 Da), followed by high exposure group (0.72 ± 0.81 SSB/10 9 Da) and controls (0.65 ± 0.82 SSB/10 9 Da). The mRNA expression levels of XRCC1, hOGG1 and XPC negatively correlated with styrene concentrations in blood and at workplace (p < 0.001) and positively with SSBs (p < 0.001). Micronuclei were not affected by styrene exposure, but were higher in older persons and in women (p < 0.001). In this study, we did not confirm previous findings on an increased DNA repair response to styrene-induced genotoxicity. However, negative correlations of SSBs and mRNA expression levels of XRCC1, hOGG1 and XPC with styrene exposure warrant further highly-targeted study.

⁹⁹mTc pyrene derivative complex causes double-strand breaks in dsDNA mainly through cluster-mediated indirect effect in aqueous solution.

Directory of Open Access Journals (Sweden)

Wei-Ju Chung

Full Text Available Radiation therapy for cancer patients works by ionizing damage to nuclear DNA, primarily by creating double-strand breaks (DSB. A major shortcoming of traditional radiation therapy is the set of side effect associated with its long-range interaction with nearby tissues. Low-energy Auger electrons have the advantage of an extremely short effective range, minimizing damage to healthy tissue. Consequently, the isotope ⁹⁹mTc, an Auger electron source, is currently being studied for its beneficial potential in cancer treatment. We examined the dose effect of a pyrene derivative ⁹⁹mTc complex on plasmid DNA by using gel electrophoresis in both aqueous and methanol solutions. In aqueous solutions, the average yield per decay for double-strand breaks is 0.011±0.005 at low dose range, decreasing to 0.0005±0.0003 in the presence of 1 M dimethyl sulfoxide (DMSO. The apparent yield per decay for single-strand breaks (SSB is 0.04±0.02, decreasing to approximately a fifth with 1 M DMSO. In methanol, the average yield per decay of DSB is 0.54±0.06 and drops to undetectable levels in 2 M DMSO. The SSB yield per decay is 7.2±0.2, changing to 0.4±0.2 in the presence of 2 M DMSO. The 95% decrease in the yield of DSB in DMSO indicates that the main mechanism for DSB formation is through indirect effect, possibly by cooperative binding or clustering of intercalators. In the presence of non-radioactive ligands at a near saturation concentration, where radioactive Tc compounds do not form large clusters, the yield of SSB stays the same while the yield of DSB decreases to the value in DMSO. DSBs generated by ⁹⁹mTc conjugated to intercalators are primarily caused by indirect effects through clustering.

⁹⁹mTc pyrene derivative complex causes double-strand breaks in dsDNA mainly through cluster-mediated indirect effect in aqueous solution.

Science.gov (United States)

Chung, Wei-Ju; Cui, Yujia; Huang, Feng-Yun J; Tu, Tzu-Hui; Yang, Tzu-Sen; Lo, Jem-Mau; Chiang, Chi-Shiun; Hsu, Ian C

2014-01-01

Radiation therapy for cancer patients works by ionizing damage to nuclear DNA, primarily by creating double-strand breaks (DSB). A major shortcoming of traditional radiation therapy is the set of side effect associated with its long-range interaction with nearby tissues. Low-energy Auger electrons have the advantage of an extremely short effective range, minimizing damage to healthy tissue. Consequently, the isotope ⁹⁹mTc, an Auger electron source, is currently being studied for its beneficial potential in cancer treatment. We examined the dose effect of a pyrene derivative ⁹⁹mTc complex on plasmid DNA by using gel electrophoresis in both aqueous and methanol solutions. In aqueous solutions, the average yield per decay for double-strand breaks is 0.011±0.005 at low dose range, decreasing to 0.0005±0.0003 in the presence of 1 M dimethyl sulfoxide (DMSO). The apparent yield per decay for single-strand breaks (SSB) is 0.04±0.02, decreasing to approximately a fifth with 1 M DMSO. In methanol, the average yield per decay of DSB is 0.54±0.06 and drops to undetectable levels in 2 M DMSO. The SSB yield per decay is 7.2±0.2, changing to 0.4±0.2 in the presence of 2 M DMSO. The 95% decrease in the yield of DSB in DMSO indicates that the main mechanism for DSB formation is through indirect effect, possibly by cooperative binding or clustering of intercalators. In the presence of non-radioactive ligands at a near saturation concentration, where radioactive Tc compounds do not form large clusters, the yield of SSB stays the same while the yield of DSB decreases to the value in DMSO. DSBs generated by ⁹⁹mTc conjugated to intercalators are primarily caused by indirect effects through clustering.

mtSSB may sequester UNG1 at mitochondrial ssDNA and delay uracil processing until the dsDNA conformation is restored

DEFF Research Database (Denmark)

Wollen Steen, Kristian; Doseth, Berit; westbye, Marianne

2012-01-01

Single-strand DNA binding proteins protect DNA from nucleolytic damage, prevent formation of secondary structures and prevent premature reannealing of DNA in DNA metabolic transactions. In eukaryotes, the nuclear single-strand DNA binding protein RPA is essential for chromosomal DNA replication...

The non-linear ion trap. Part 5. Nature of non-linear resonances and resonant ion ejection

Science.gov (United States)

Franzen, J.

1994-01-01

The superposition of higher order multipole fields on the basic quadrupole field in ion traps generates a non-harmonic oscillator system for the ions. Fourier analyses of simulated secular oscillations in non-linear ion traps, therefore, not only reveal the sideband frequencies, well-known from the Mathieu theory, but additionally a commonwealth of multipole-specific overtones (or higher harmonics), and corresponding sidebands of overtones. Non-linear resonances occur when the overtone frequencies match sideband frequencies. It can be shown that in each of the resonance conditions, not just one overtone matches one sideband, instead, groups of overtones match groups of sidebands. The generation of overtones is studied by Fourier analysis of computed ion oscillations in the direction of thez axis. Even multipoles (octopole, dodecapole, etc.) generate only odd orders of higher harmonics (3, 5, etc.) of the secular frequency, explainable by the symmetry with regard to the planez = 0. In contrast, odd multipoles (hexapole, decapole, etc.) generate all orders of higher harmonics. For all multipoles, the lowest higher harmonics are found to be strongest. With multipoles of higher orders, the strength of the overtones decreases weaker with the order of the harmonics. Forz direction resonances in stationary trapping fields, the function governing the amplitude growth is investigated by computer simulations. The ejection in thez direction, as a function of timet, follows, at least in good approximation, the equation wheren is the order of multipole, andC is a constant. This equation is strictly valid for the electrically applied dipole field (n = 1), matching the secular frequency or one of its sidebands, resulting in a linear increase of the amplitude. It is valid also for the basic quadrupole field (n = 2) outside the stability area, giving an exponential increase. It is at least approximately valid for the non-linear resonances by weak superpositions of all higher odd

Design and methods for a community-based intervention to reduce sugar-sweetened beverage consumption among youth: H2GO! study

Directory of Open Access Journals (Sweden)

Monica L. Wang

2016-11-01

Full Text Available Abstract Background Reducing sugar-sweetened beverage (SSB intake is an important dietary target among underserved children at high risk for obesity and associated morbidities. Community-based approaches to reduce SSB intake are needed. The use of narrative-based approaches (presenting messages within the context of a story can facilitate connection with target health messages and empower children as behavior change agents within their families. The H2GO! program is a community-based behavioral intervention that integrates narrative-based strategies to reduce SSB consumption and promote water intake among school-age youth and parents. Methods Guided by the Social Cognitive Theory and the Social Ecological Model, the H2GO! intervention consists of 6 weekly sessions that target beverage knowledge, attitudes, and behaviors through youth-produced messages and narratives to reduce SSB intake and encourage water intake and parent–child activities. To reach underserved youth and families, we identified Boys & Girls Clubs (B&GC (youth-based community centers that serve an ethnically diverse and predominantly low socioeconomic status population as a community partner and study setting. Participants (children ages 9–12 years and their parents will be recruited from B&GC sites in Massachusetts, USA. Intervention efficacy will be assessed through a site-randomized trial (N = 2 youth-based community sites, pair-matched for size and racial/ethnic composition with 54 parent–child pairs (N = 108 enrolled per site (N = 216 total. The comparison site will carry on with usual practice. Child and parental SSB and water consumption (primary outcomes and parent and child beverage knowledge and attitudes (secondary outcomes will be measured via self-report surveys. Additional outcomes include children’s anthropometric data, additional dietary behaviors, and physical activity. Measures will be collected at baseline, 2 and 6 months follow-up. With

Advanced Technology Direction and Control Communications Systems

Science.gov (United States)

1979-07-16

Leupert amesD./Morrell ~I~ Frederick . euprJae DCPAaol-78-C-1 259] ,. IERFORMlk6 ORGANIZATION NAME AND ADDRESS %a. P ROGRAM ELEMiENT. PROJIECT. TASK AREA...without the change in communicatios LCciniLlucs b•;i,,g aipiarci-IL. A JTIDS net is organized on the principle of time division. Various elements are...sideband (DSB-AI) "* Amplitude modulation, vestigial sideband (VSB-AM) * Frequency sI Shift modulation (FSK) "* Phase shift modulation (PSK) Ti DSB

Turbine engine rotor blade fault diagnostics through casing pressure and vibration sensors

International Nuclear Information System (INIS)

Cox, J; Anusonti-Inthra, P

2014-01-01

In this study, an exact solution is provided for a previously indeterminate equation used for rotor blade fault diagnostics. The method estimates rotor blade natural frequency through turbine engine casing pressure and vibration sensors. The equation requires accurate measurements of low-amplitude sideband signals in the frequency domain. With this in mind, statistical evaluation was also completed with the goal of determining the effect of sampling time and frequency on sideband resolution in the frequency domain

Wave modulation in a nonlinear dispersive medium

International Nuclear Information System (INIS)

Kim, Y.C.; Khadra, L.; Powers, E.J.

1980-01-01

A model describing the simultaneous amplitude and phase modulation of a carrier wave propagating in a nonlinear dispersive medium is developed in terms of nonlinear wave-wave interactions between the sidebands and a low frequency wave. It is also shown that the asymmetric distribution of sidebands is determined by the wavenumber dependence of the coupling coefficient. Digital complex demodulation techniques are used to study modulated waves in a weakly ionized plasma and the experimental results support the analytical model

MD 1691: Active halo control using tune ripple at injection

CERN Document Server

Garcia Morales, Hector; Bruce, Roderik; Redaelli, Stefano; Fitterer, Miriam; Fiascaris, Maria; Nisbet, David; Thiesen, Hugues; Valentino, Gianluca; Xu, Chen; CERN. Geneva. ATS Department

2017-01-01

In this MD we performed halo excitation through tune ripple. This consists in an excitation that introduces new resonance sidebands around the existing resonance lines. In presence of sufficient detuning with amplitude, these sidebands can in principle affect only the dynamics of the halo particles at large amplitudes. Tune ripple was induced through a current modulation of the warm trim quadrupoles in IR7. This is the first time this method is experimentally tested at the LHC.

Reference-free fatigue crack detection using nonlinear ultrasonic modulation under various temperature and loading conditions

Science.gov (United States)

Lim, Hyung Jin; Sohn, Hoon; DeSimio, Martin P.; Brown, Kevin

2014-04-01

This study presents a reference-free fatigue crack detection technique using nonlinear ultrasonic modulation. When low frequency (LF) and high frequency (HF) inputs generated by two surface-mounted lead zirconate titanate (PZT) transducers are applied to a structure, the presence of a fatigue crack can provide a mechanism for nonlinear ultrasonic modulation and create spectral sidebands around the frequency of the HF signal. The crack-induced spectral sidebands are isolated using a combination of linear response subtraction (LRS), synchronous demodulation (SD) and continuous wavelet transform (CWT) filtering. Then, a sequential outlier analysis is performed on the extracted sidebands to identify the crack presence without referring any baseline data obtained from the intact condition of the structure. Finally, the robustness of the proposed technique is demonstrated using actual test data obtained from simple aluminum plate and complex aircraft fitting-lug specimens under varying temperature and loading variations.

Promoting water consumption on a Caribbean island: An intervention using children's social networks at schools

OpenAIRE

Franken, S.C.M.; Smit, C.R.; Buijzen, M.A.

2018-01-01

Sugar-sweetened beverage (SSB) consumption and the associated childhood obesity are major concerns in the Caribbean, creating a need for interventions promoting water consumption as a healthy alternative. A social network-based intervention (SNI) was tested among Aruban children to increase their water consumption and behavioral intention to do so and, consequently, to decrease SSB consumption and the associated behavioral intention. In this study, the moderating effects of descriptive and in...

Isotopically varying spectral features of silicon-vacancy in diamond

International Nuclear Information System (INIS)

Dietrich, Andreas; Jahnke, Kay D; Binder, Jan M; Rogers, Lachlan J; Jelezko, Fedor; Teraji, Tokuyuki; Isoya, Junichi

2014-01-01

The silicon-vacancy centre (SiV − ) in diamond has exceptional spectral properties for single-emitter quantum information applications. Most of the fluorescence is concentrated in a strong zero phonon line (ZPL), with a weak phonon sideband extending for 100 nm that contains several clear features. We demonstrate that the ZPL position can be used to reliably identify the silicon isotope present in a single SiV − centre. This is of interest for quantum information applications since only the 29 Si isotope has nuclear spin. In addition, we show that the sharp 64 meV phonon peak is due to a local vibrational mode of the silicon atom. The presence of a local mode suggests a plausible origin of the measured isotopic shift of the ZPL. (paper)

No benefits of ultrafractionation in two head-and-neck cancer cell lines with different inherent radiosensitivity

International Nuclear Information System (INIS)

Boehringer-Wyss, Nicole; Clarkson, Stuart G.; Allal, Abdelkarim S.

2002-01-01

Purpose: To assess if ultrafractionation is applicable in the context of an unknown hyperradiosensitivity (HRS) status, we studied the survival and repair capacity of two tumor cell lines after irradiation with two different dose/fractionation schedules that can be used in a clinical setting. Methods and Materials: Squamous cell carcinoma cell lines SCC-3 (radioresistant) and SCC-6 (radiosensitive) were used. Survival was studied by clonogenic assay after multiple fractions of 0.5 Gy (2 fractions/day, 6-h interval) and 2 Gy (1 fraction/day) for a total dose of 8 Gy of γ-rays. The capacity to repair single-strand and double-strand breaks (SSB, DSB) was assessed by comet assay. The messenger RNA (mRNA) levels of DNA-dependent protein kinase (PK) components were analyzed by RNase protection and real-time polymerase chain reaction (PCR). Results: In both cell lines, no apparent difference was noted between the two fractionation protocols. In particular for SCC-3, the mean surviving fraction tended to be lower after 2 Gy than after 0.5 Gy fractions. In SCC-3 and SCC-6 no significant difference was observed in the repair capacity of SSB and DSB after exposure to single doses of 0.5 Gy or 2 Gy. After exposure to the same single doses, the mRNA levels of DNA-PK catalytic subunit (PKcs), Ku 70, and Ku 80 were similar. Conclusions: Our data do not support the concept of ultrafractionation, at least when using fractions of 0.5 Gy in the cell lines studied. This suggests that methods for testing HRS status in individual tumors need to be developed before the relevance of ultrafractionation can be investigated in the clinic

Cells deficient in PARP-1 show an accelerated accumulation of DNA single strand breaks, but not AP sites, over the PARP-1-proficient cells exposed to MMS.

Science.gov (United States)

Pachkowski, Brian F; Tano, Keizo; Afonin, Valeriy; Elder, Rhoderick H; Takeda, Shunichi; Watanabe, Masami; Swenberg, James A; Nakamura, Jun

2009-12-01

Poly(ADP-ribose) polymerase-1 (PARP-1) is a base excision repair (BER) protein that binds to DNA single strand breaks (SSBs) and subsequently synthesizes and transfers poly(ADP-ribose) polymers to various nuclear proteins. Numerous biochemical studies have implicated PARP-1 as a modulator of BER; however, the role of PARP-1 in BER in living cells remains unclear partly due to lack of accurate quantitation of BER intermediates existing in cells. Since DT40 cells, chicken B lymphocytes, naturally lack PARP-2, DT40 cells allow for the investigation of the PARP-1 null phenotype without confounding by PARP-2. To test the hypothesis that PARP-1 is necessary for efficient BER during methylmethane sulfonate (MMS) exposure in vertebrate cells, intact DT40 cells and their isogenic PARP-1 null counterparts were challenged with different exposure scenarios for phenotypic characterization. With chronic exposure, PARP-1 null cells exhibited sensitivity to MMS but with an acute exposure did not accumulate base lesions or AP sites to a greater extent than wild-type cells. However, an increase in SSB content in PARP-1 null cell DNA, as indicated by glyoxal gel electrophoresis under neutral conditions, suggested the presence of BER intermediates. These data suggest that during exposure, PARP-1 impacts the stage of BER after excision of the deoxyribosephosphate moiety from the 5' end of DNA strand breaks by polymerase beta.

Sugar-sweetened beverage intake in relation to semen quality and reproductive hormone levels in young men.

Science.gov (United States)

Chiu, Y H; Afeiche, M C; Gaskins, A J; Williams, P L; Mendiola, J; Jørgensen, N; Swan, S H; Chavarro, J E

2014-07-01

Is consumption of sugar-sweetened beverages (SSB) associated with semen quality? Higher consumption of SSB was associated with lower sperm motility among healthy, young men. The existing literature on the potential role of SSBs on male reproductive function is scarce and primarily focused on the relation between caffeinated beverages and semen quality. However, a rodent model suggests that SSBs may hamper male fertility. The Rochester Young Men's Study; a cross-sectional study of 189 healthy young men carried out at the University of Rochester during 2009-2010. Men aged 18-22 years provided semen and blood samples, underwent a physical examination and completed a previously validated food frequency questionnaire (FFQ). Linear regression was used to analyze the association of SSBs with sperm parameters and reproductive hormone levels while adjusting for potential confounders. SSB intake was inversely related to progressive sperm motility. Men in the highest quartile of SSB intake (≥1.3 serving/day) had 9.8 (95% CI: 1.9,17.8) percentage units lower progressive sperm motility than men in the lowest quartile of intake (beverages. While our findings are in agreement with recent experimental data in rodents, more studies are required to draw conclusions on the relation of SSB with semen quality or male infertility. Supported by the European Union Seventh Framework Program (Environment), 'Developmental Effects of Environment on Reproductive Health' (DEER) grant 212844. Grant P30 DK046200 and Ruth L. Kirschstein National Research Service Award T32 DK007703-16 and T32HD060454 from the National Institutes of Health. None of the authors has any conflicts of interest to declare.

Adaptive metabolic response to 4 weeks of sugar-sweetened beverage consumption in healthy, lightly active individuals and chronic high glucose availability in primary human myotubes.

Science.gov (United States)

Sartor, Francesco; Jackson, Matthew J; Squillace, Cesare; Shepherd, Anthony; Moore, Jonathan P; Ayer, Donald E; Kubis, Hans-Peter

2013-04-01

Chronic sugar-sweetened beverage (SSB) consumption is associated with obesity and type 2 diabetes mellitus (T2DM). Hyperglycaemia contributes to metabolic alterations observed in T2DM, such as reduced oxidative capacity and elevated glycolytic and lipogenic enzyme expressions in skeletal muscle tissue. We aimed to investigate the metabolic alterations induced by SSB supplementation in healthy individuals and to compare these with the effects of chronic hyperglycaemia on primary muscle cell cultures. Lightly active, healthy, lean subjects (n = 11) with sporadic soft drink consumption underwent a 4-week SSB supplementation (140 ± 15 g/day, ~2 g glucose/kg body weight/day, glucose syrup). Before and after the intervention, body composition, respiratory exchange ratio (RER), insulin sensitivity, muscle metabolic gene and protein expression were assessed. Adaptive responses to hyperglycaemia (7 days, 15 mM) were tested in primary human myotubes. SSB supplementation increased fat mass (+1.0 kg, P < 0.05), fasting RER (+0.12, P < 0.05), fasting glucose (+0.3 mmol/L, P < 0.05) and muscle GAPDH mRNA expressions (+0.94 AU, P < 0.05). PGC1α mRNA was reduced (-0.20 AU, P < 0.05). Trends were found for insulin resistance (+0.16 mU/L, P = 0.09), and MondoA protein levels (+1.58 AU, P = 0.08). Primary myotubes showed elevations in GAPDH, ACC, MondoA and TXNIP protein expressions (P < 0.05). Four weeks of SSB supplementation in healthy individuals shifted substrate metabolism towards carbohydrates, increasing glycolytic and lipogenic gene expression and reducing mitochondrial markers. Glucose-sensing protein MondoA might contribute to this shift, although further in vivo evidence is needed to corroborate this.

The Chloroplast-Localized Phospholipases D α4 and α5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice1[C][W

Science.gov (United States)

Qi, Jinfeng; Zhou, Guoxin; Yang, Lijuan; Erb, Matthias; Lu, Yanhua; Sun, Xiaoling; Cheng, Jiaan; Lou, Yonggen

2011-01-01

The oxylipin pathway is of central importance for plant defensive responses. Yet, the first step of the pathway, the liberation of linolenic acid following induction, is poorly understood. Phospholipases D (PLDs) have been hypothesized to mediate this process, but data from Arabidopsis (Arabidopsis thaliana) regarding the role of PLDs in plant resistance have remained controversial. Here, we cloned two chloroplast-localized PLD genes from rice (Oryza sativa), OsPLDα4 and OsPLDα5, both of which were up-regulated in response to feeding by the rice striped stem borer (SSB) Chilo suppressalis, mechanical wounding, and treatment with jasmonic acid (JA). Antisense expression of OsPLDα4 and -α5 (as-pld), which resulted in a 50% reduction of the expression of the two genes, reduced elicited levels of linolenic acid, JA, green leaf volatiles, and ethylene and attenuated the SSB-induced expression of a mitogen-activated protein kinase (OsMPK3), a lipoxygenase (OsHI-LOX), a hydroperoxide lyase (OsHPL3), as well as a 1-aminocyclopropane-1-carboxylic acid synthase (OsACS2). The impaired oxylipin and ethylene signaling in as-pld plants decreased the levels of herbivore-induced trypsin protease inhibitors and volatiles, improved the performance of SSB and the rice brown planthopper Nilaparvata lugens, and reduced the attractiveness of plants to a larval parasitoid of SSB, Apanteles chilonis. The production of trypsin protease inhibitors in as-pld plants could be partially restored by JA, while the resistance to rice brown planthopper and SSB was restored by green leaf volatile application. Our results show that phospholipases function as important components of herbivore-induced direct and indirect defenses in rice. PMID:21984727

The chloroplast-localized phospholipases D α4 and α5 regulate herbivore-induced direct and indirect defenses in rice.

Science.gov (United States)

Qi, Jinfeng; Zhou, Guoxin; Yang, Lijuan; Erb, Matthias; Lu, Yanhua; Sun, Xiaoling; Cheng, Jiaan; Lou, Yonggen

2011-12-01

The oxylipin pathway is of central importance for plant defensive responses. Yet, the first step of the pathway, the liberation of linolenic acid following induction, is poorly understood. Phospholipases D (PLDs) have been hypothesized to mediate this process, but data from Arabidopsis (Arabidopsis thaliana) regarding the role of PLDs in plant resistance have remained controversial. Here, we cloned two chloroplast-localized PLD genes from rice (Oryza sativa), OsPLDα4 and OsPLDα5, both of which were up-regulated in response to feeding by the rice striped stem borer (SSB) Chilo suppressalis, mechanical wounding, and treatment with jasmonic acid (JA). Antisense expression of OsPLDα4 and -α5 (as-pld), which resulted in a 50% reduction of the expression of the two genes, reduced elicited levels of linolenic acid, JA, green leaf volatiles, and ethylene and attenuated the SSB-induced expression of a mitogen-activated protein kinase (OsMPK3), a lipoxygenase (OsHI-LOX), a hydroperoxide lyase (OsHPL3), as well as a 1-aminocyclopropane-1-carboxylic acid synthase (OsACS2). The impaired oxylipin and ethylene signaling in as-pld plants decreased the levels of herbivore-induced trypsin protease inhibitors and volatiles, improved the performance of SSB and the rice brown planthopper Nilaparvata lugens, and reduced the attractiveness of plants to a larval parasitoid of SSB, Apanteles chilonis. The production of trypsin protease inhibitors in as-pld plants could be partially restored by JA, while the resistance to rice brown planthopper and SSB was restored by green leaf volatile application. Our results show that phospholipases function as important components of herbivore-induced direct and indirect defenses in rice.

Promoting Water Consumption on a Caribbean Island: An Intervention Using Children’s Social Networks at Schools

Directory of Open Access Journals (Sweden)

Saskia C. M. Franken

2018-04-01

Full Text Available Sugar-sweetened beverage (SSB consumption and the associated childhood obesity are major concerns in the Caribbean, creating a need for interventions promoting water consumption as a healthy alternative. A social network-based intervention (SNI was tested among Aruban children to increase their water consumption and behavioral intention to do so and, consequently, to decrease SSB consumption and the associated behavioral intention. In this study, the moderating effects of descriptive and injunctive norms were tested. A cluster randomized controlled trial was completed in schools (mean age = 11 years ± SD = 0.98; 54% girls. Children were assigned to the intervention group (IG; n = 192 or control group (CG; n = 185. IG children were exposed to peer influencers promoting water consumption and CG children were not. Regression analyses showed that water consumption increased for IG children with a high injunctive norm score (p = 0.05; however, their intention to consume more water remained unchanged (p = 0.42. Moreover, IG children showed a decrease in SSB consumption (p = 0.04 and an increase in their intention to consume less SSB (p = 0.00. These findings indicate that SNIs are a promising instrument for health behavioral changes for Aruba and other islands in the Caribbean region.

The sugar-sweetened beverage wars: public health and the role of the beverage industry.

Science.gov (United States)

Welsh, Jean A; Lundeen, Elizabeth A; Stein, Aryeh D

2013-10-01

To discuss the current data on sugar-sweetened beverage (SSB) consumption trends, evidence of the health impact, and the role of industry in efforts to reduce the consumption. Previously rising SSB consumption rates have declined recently, but continue to contribute added sugars beyond the limit advised by the American Heart Association. A recent meta-analysis concluded that SSBs likely increase body weight and recent long-term studies support the previous findings of increased risk of diabetes, dyslipidemia, and hypertension. Beverage companies have played an active role in some SSB reduction efforts by reducing the sale of SSBs in schools, limiting television advertising to children, and increasing the availability of smaller portion-size options. Industry has opposed efforts to restrict the availability of large portion sizes and implement an excise tax. Current industry efforts include the promotion of alternative beverages perceived to be healthier as well as SSBs through Internet and social media. Continuing high SSB consumption and associated health risks highlight the need for further public health action. The beverage industry has supported some efforts to reduce the consumption of full sugar beverages, but has actively opposed others. The impact of industry efforts to promote beverage alternatives perceived as healthier is unknown.

SUGAR-SWEETENED BEVERAGE, SUGAR INTAKE OF INDIVIDUALS AND THEIR BLOOD PRESSURE: INTERMAP STUDY

Science.gov (United States)

Brown, Ian J.; Stamler, Jeremiah; Van Horn, Linda; Robertson, Claire E.; Chan, Queenie; Dyer, Alan R.; Huang, Chiang-Ching; Rodriguez, Beatriz L.; Zhao, Liancheng; Daviglus, Martha L.; Ueshima, Hirotsugu; Elliott, Paul

2011-01-01

The obesity epidemic has focused attention on relationships of sugars and sugar-sweetened beverages (SSB) to cardiovascular risk factors. Here we report cross-sectional associations of SSB, diet beverages, sugars with blood pressure (BP) for UK and USA participants of the International Study of Macro/Micro-nutrients and Blood Pressure (INTERMAP). Data collected includes four 24-h dietary recalls, two 24-h urine collections, eight BP readings, questionnaire data for 2,696 people ages 40-59 from 10 USA/UK population samples. Associations of SSB, diet beverages, and sugars (fructose, glucose, sucrose) with BP were assessed by multiple linear regression. Sugar-sweetened beverage intake related directly to BP, P-values 0.005 to Sugar-sweetened beverage intake higher by 1 serving/day (355 ml/24-h) was associated with systolic/diastolic BP differences of +1.6/+0.8 mm Hg (both P sugar-sodium interactions: for individuals with above-median 24-h urinary sodium excretion, fructose intake higher by 2 SD (5.6 %kcal) was associated with systolic/diastolic BP differences of +3.4/+2.2 mm Hg (both P sugar-BP differences for persons with higher sodium excretion, lend support to recommendations that intake of SSB, sugars, and salt be substantially reduced. PMID:21357284

Low Calorie Beverage Consumption Is Associated with Energy and Nutrient Intakes and Diet Quality in British Adults.

Science.gov (United States)

Gibson, Sigrid A; Horgan, Graham W; Francis, Lucy E; Gibson, Amelia A; Stephen, Alison M

2016-01-02

It is unclear whether consumption of low-calorie beverages (LCB) leads to compensatory consumption of sweet foods, thus reducing benefits for weight control or diet quality. This analysis investigated associations between beverage consumption and energy intake and diet quality of adults in the UK National Diet and Nutrition Survey (NDNS) (2008-2011; n = 1590), classified into: (a) non-consumers of soft drinks (NC); (b) LCB consumers; (c) sugar-sweetened beverage (SSB) consumers; or (d) consumers of both beverages (BB), based on 4-day dietary records. Within-person data on beverage consumption on different days assessed the impact on energy intake. LCB consumers and NC consumed less energy and non-milk extrinsic sugars than other groups. Micronutrient intakes and food choices suggested higher dietary quality in NC/LCB consumers compared with SSB/BB consumers. Within individuals on different days, consumption of SSB, milk, juice, and alcohol were all associated with increased energy intake, while LCB and tea, coffee or water were associated with no change; or reduced energy intake when substituted for caloric beverages. Results indicate that NC and LCB consumers tend to have higher quality diets compared with SSB or BB consumers and do not compensate for sugar or energy deficits by consuming more sugary foods.

Low Calorie Beverage Consumption Is Associated with Energy and Nutrient Intakes and Diet Quality in British Adults

Science.gov (United States)

Gibson, Sigrid A.; Horgan, Graham W.; Francis, Lucy E.; Gibson, Amelia A.; Stephen, Alison M.

2016-01-01

It is unclear whether consumption of low-calorie beverages (LCB) leads to compensatory consumption of sweet foods, thus reducing benefits for weight control or diet quality. This analysis investigated associations between beverage consumption and energy intake and diet quality of adults in the UK National Diet and Nutrition Survey (NDNS) (2008–2011; n = 1590), classified into: (a) non-consumers of soft drinks (NC); (b) LCB consumers; (c) sugar-sweetened beverage (SSB) consumers; or (d) consumers of both beverages (BB), based on 4-day dietary records. Within-person data on beverage consumption on different days assessed the impact on energy intake. LCB consumers and NC consumed less energy and non-milk extrinsic sugars than other groups. Micronutrient intakes and food choices suggested higher dietary quality in NC/LCB consumers compared with SSB/BB consumers. Within individuals on different days, consumption of SSB, milk, juice, and alcohol were all associated with increased energy intake, while LCB and tea, coffee or water were associated with no change; or reduced energy intake when substituted for caloric beverages. Results indicate that NC and LCB consumers tend to have higher quality diets compared with SSB or BB consumers and do not compensate for sugar or energy deficits by consuming more sugary foods. PMID:26729159

Promoting Water Consumption on a Caribbean Island: An Intervention Using Children’s Social Networks at Schools

Science.gov (United States)

Smit, Crystal R.

2018-01-01

Sugar-sweetened beverage (SSB) consumption and the associated childhood obesity are major concerns in the Caribbean, creating a need for interventions promoting water consumption as a healthy alternative. A social network-based intervention (SNI) was tested among Aruban children to increase their water consumption and behavioral intention to do so and, consequently, to decrease SSB consumption and the associated behavioral intention. In this study, the moderating effects of descriptive and injunctive norms were tested. A cluster randomized controlled trial was completed in schools (mean age = 11 years ± SD = 0.98; 54% girls). Children were assigned to the intervention group (IG; n = 192) or control group (CG; n = 185). IG children were exposed to peer influencers promoting water consumption and CG children were not. Regression analyses showed that water consumption increased for IG children with a high injunctive norm score (p = 0.05); however, their intention to consume more water remained unchanged (p = 0.42). Moreover, IG children showed a decrease in SSB consumption (p = 0.04) and an increase in their intention to consume less SSB (p = 0.00). These findings indicate that SNIs are a promising instrument for health behavioral changes for Aruba and other islands in the Caribbean region. PMID:29642628

Promoting Water Consumption on a Caribbean Island: An Intervention Using Children's Social Networks at Schools.

Science.gov (United States)

Franken, Saskia C M; Smit, Crystal R; Buijzen, Moniek

2018-04-10

Sugar-sweetened beverage (SSB) consumption and the associated childhood obesity are major concerns in the Caribbean, creating a need for interventions promoting water consumption as a healthy alternative. A social network-based intervention (SNI) was tested among Aruban children to increase their water consumption and behavioral intention to do so and, consequently, to decrease SSB consumption and the associated behavioral intention. In this study, the moderating effects of descriptive and injunctive norms were tested. A cluster randomized controlled trial was completed in schools (mean age = 11 years ± SD = 0.98; 54% girls). Children were assigned to the intervention group (IG; n = 192) or control group (CG; n = 185). IG children were exposed to peer influencers promoting water consumption and CG children were not. Regression analyses showed that water consumption increased for IG children with a high injunctive norm score ( p = 0.05); however, their intention to consume more water remained unchanged ( p = 0.42). Moreover, IG children showed a decrease in SSB consumption ( p = 0.04) and an increase in their intention to consume less SSB ( p = 0.00). These findings indicate that SNIs are a promising instrument for health behavioral changes for Aruba and other islands in the Caribbean region.

The sugar-sweetened beverage wars: public health and the role of the beverage industry

Science.gov (United States)

Welsh, Jean A.; Lundeen, Elizabeth A.; Stein, Aryeh D.

2015-01-01

Purpose of review To discuss the current data on sugar-sweetened beverage (SSB) consumption trends, evidence of the health impact, and the role of industry in efforts to reduce the consumption. Recent findings Previously rising SSB consumption rates have declined recently, but continue to contribute added sugars beyond the limit advised by the American Heart Association. A recent meta-analysis concluded that SSBs likely increase body weight and recent long-term studies support the previous findings of increased risk of diabetes, dyslipidemia, and hypertension. Beverage companies have played an active role in some SSB reduction efforts by reducing the sale of SSBs in schools, limiting television advertising to children, and increasing the availability of smaller portion-size options. Industry has opposed efforts to restrict the availability of large portion sizes and implement an excise tax. Current industry efforts include the promotion of alternative beverages perceived to be healthier as well as SSBs through Internet and social media. Summary Continuing high SSB consumption and associated health risks highlight the need for further public health action. The beverage industry has supported some efforts to reduce the consumption of full sugar beverages, but has actively opposed others. The impact of industry efforts to promote beverage alternatives perceived as healthier is unknown. PMID:23974767

Does predation by grey seals (Halichoerus grypus) affect Bothnian Sea herring stock estimates?

DEFF Research Database (Denmark)

Gårdmark, Anna; Östman, Örjan; Nielsen, Anders

2012-01-01

when accounting for seal predation, this did not change the conclusions about drivers of herring dynamics. Accounting for grey seal predation is important for abundance estimates of old herring, but currently not for SSB estimates, given the great uncertainties in the standard assessment. The grey seal...... fivefold since 1985. Its main prey, herring (Clupea harrengus), is a key species for fisheries in the region. Yet, current stock assessments assume constant natural mortality, leading to a risk of biased stock estimates with increasing predation and misleading analyses of herring population dynamics. We...... estimated grey seal predation from diet data and reanalysed herring spawning stock biomass (SSB) during 1973–2009. Accounting for predation increased the herring SSB 16% (maximum 19%), but this was within the confidence intervals when ignoring predation. Although mortality in older individuals was inflated...

Influence of the partial temporal coherence of short FEL pulses on two-colour photoionization and photoinduced Auger decay of atoms

International Nuclear Information System (INIS)

Kazansky, A K; Sazhina, I P; Kabachnik, N M

2013-01-01

The influence of the partial temporal coherence of free electron laser (FEL) radiation on the sidebands arising in the electron spectra of laser-assisted photoionization and photoinduced Auger decay of atoms is theoretically analysed. A simple model is developed which describes the inner-shell photoionization by a short (femtosecond) FEL pulse and the following Auger decay in a strong field of an infrared laser. The model is based on the time-dependent approach and uses the strong field approximation for both photo- and Auger electrons. Particular calculations have been carried out for Ne 1s photoionization and KLL Auger emission. We demonstrate that the temporal coherence of FEL pulses influences the line widths in the photoelectron spectrum. For a small coherence time the sidebands in this spectrum cannot be resolved. On the other hand, our calculations show that in the Auger electron spectrum the sidebands are practically independent of the coherence time of the ionizing pulse.

Chromatin decondensed by acetylation shows an elevated radiation response

International Nuclear Information System (INIS)

Nackerdien, Z.; Michie, J.; Boehm, L.

1989-01-01

V-79 Chinese hamster lung fibroblasts exposed to 5 mM n-sodium butyrate were irradiated with 60Co gamma rays and cell survival was determined by the cell colony assay. In a separate set of experiments the acetylated chromatin obtained from these cells was irradiated and the change of molecular weight of the DNA was evaluated by alkaline sucrose density centrifugation. At a survival level of 10(-2) to 10(-4) cells exposed to butyrate were found to be 1.3-1.4 times more radiosensitive than control cells. Exposure of isolated chromatin to 100 Gy of 60Co gamma irradiation generated 0.9 +/- 0.03 single-strand breaks (ssb) per 10 Gy per 10(8) Da and 2.0 +/- 0.3 ssb/10 Gy/10(8) Da for control and acetylated chromatin, respectively. The elevated radiation sensitivity of chromatin relaxed by acetylation is in good agreement with previous results on chromatin expanded by histone H1 depletion. Packing and accessibility of DNA in chromatin appear to be major factors which influence the radiation sensitivity. The intrinsic radiation sensitivity of chromatin in various packing states is discussed in light of the variation of radiation sensitivity of whole cells in the cell cycle which incorporates repair

Effects of a price increase on purchases of sugar sweetened beverages. Results from a randomized controlled trial.

Science.gov (United States)

Waterlander, Wilma Elzeline; Ni Mhurchu, Cliona; Steenhuis, Ingrid H M

2014-07-01

Sugar sweetened beverage (SSB) taxes are receiving increased political interest. However, there have been no experimental studies of the effects of price increases on SSBs or the effects on close substitutes such as diet drinks, alcohol or sugary snacks. Therefore, the aim of this study was to examine the effects of a price increase on SSBs on beverage and snack purchases using a randomized controlled design within a three-dimensional web-based supermarket. The trial contained two conditions: experimental condition with a 19% tax on SSBs (to reflect an increase in Dutch value added tax from 6% to 19%); and a control condition with regular prices. N = 102 participants were randomized and purchased groceries on a single occasion at a three-dimensional Virtual Supermarket. Data were analysed using independent t-tests and regression analysis. Results showed that participants in the price increase condition purchased significantly less SSBs than the control group (B = -.90; 95% CI = -1.70 to -.10 L per household per week). There were no significant effects on purchases in other beverage or snack food categories. This means that the higher VAT rate was effective in reducing SSB purchases and had no negative side-effects. Copyright © 2014. Published by Elsevier Ltd.

DNA strand breaks induced by soft X-ray pulses from a compact laser plasma source

Science.gov (United States)

Adjei, Daniel; Wiechec, Anna; Wachulak, Przemyslaw; Ayele, Mesfin Getachew; Lekki, Janusz; Kwiatek, Wojciech M.; Bartnik, Andrzej; Davídková, Marie; Vyšín, Luděk; Juha, Libor; Pina, Ladislav; Fiedorowicz, Henryk

2016-03-01

Application of a compact laser plasma source of soft X-rays in radiobiology studies is demonstrated. The source is based on a laser produced plasma as a result of irradiation of a double-stream gas puff target with nanosecond laser pulses from a commercially available Nd:YAG laser. The source allows irradiation of samples with soft X-ray pulses in the "water window" spectral range (wavelength: 2.3-4.4 nm; photon energy: 280-560 eV) in vacuum or a helium atmosphere at very high-dose rates and doses exceeding the kGy level. Single-strand breaks (SSB) and double-strand breaks (DBS) induced in DNA plasmids pBR322 and pUC19 have been measured. The different conformations of the plasmid DNA were separated by agarose gel electrophoresis. An exponential decrease in the supercoiled form with an increase in linear and relaxed forms of the plasmids has been observed as a function of increasing photon fluence. Significant difference between SSB and DSB in case of wet and dry samples was observed that is connected with the production of free radicals in the wet sample by soft X-ray photons and subsequent affecting the plasmid DNA. Therefore, the new source was validated to be useful for radiobiology experiments.

Bacillus subtilis DNA polymerases, PolC and DnaE, are required for both leading and lagging strand synthesis in SPP1 origin-dependent DNA replication

Science.gov (United States)

Seco, Elena M.

2017-01-01

Abstract Firmicutes have two distinct replicative DNA polymerases, the PolC leading strand polymerase, and PolC and DnaE synthesizing the lagging strand. We have reconstituted in vitro Bacillus subtilis bacteriophage SPP1 θ-type DNA replication, which initiates unidirectionally at oriL. With this system we show that DnaE is not only restricted to lagging strand synthesis as previously suggested. DnaG primase and DnaE polymerase are required for initiation of DNA replication on both strands. DnaE and DnaG synthesize in concert a hybrid RNA/DNA ‘initiation primer’ on both leading and lagging strands at the SPP1 oriL region, as it does the eukaryotic Pol α complex. DnaE, as a RNA-primed DNA polymerase, extends this initial primer in a reaction modulated by DnaG and one single-strand binding protein (SSB, SsbA or G36P), and hands off the initiation primer to PolC, a DNA-primed DNA polymerase. Then, PolC, stimulated by DnaG and the SSBs, performs the bulk of DNA chain elongation at both leading and lagging strands. Overall, these modulations by the SSBs and DnaG may contribute to the mechanism of polymerase switch at Firmicutes replisomes. PMID:28575448

Modeling early physical and chemical events for DNA damage induced by photons and tritium beta particles

Energy Technology Data Exchange (ETDEWEB)

Moiseenko, V [McMaster Univ., Dept. of Physics and Astronomy, Hamilton, Ontario (Canada); Waker, A J [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada); Prestwich, W V [McMaster Univ., Dept. of Physics and Astronomy, Hamilton, Ontario (Canada)

1998-02-01

A method has been developed to model production of single-strand breaks (SSB) and double-strand breaks (DSB) in Deoxyribo Nucleic Acid (DNA) by ionizing radiations. Modeling is carried out by Monte Carlo means and includes consideration of direct energy depositions in DNA molecules, production of chemical species following water radiolysis, diffusion of chemical species, and their interactions with each other and DNA. Computer-generated electron tracks in liquid water are used to model energy deposition and to derive the initial localization of chemical species. Atomistic representation of the DNA with a first hydration shell is used to derive direct energy depositions in DNA molecules and the resulting consequences, and to derive coordinates of reactive sites for modeling of the chemical stage of radiation damage. Diffusion of chemical species is followed in time, and the reactions of species with each other and DNA are considered to occur in an encounter-controlled manner. Time of diffusion follow-up is restricted to 10{sup -12}- 10{sup -9} s, which yields a diffusion length of hydroxyl radicals comparable to that in the cellular environment. DNA SSB are assumed to result from any direct energy depositions in the sugar/phosphate moiety, ionizations in water molecules bound to sugar/phosphate and hydroxyl attacks on deoxyribose. DSB are assumed to result from two SSB on opposite strands separated by 10 or fewer base pairs. Photon radiations in the energy range 70 keV-1 MeV and tritium beta particles are considered. It is shown that for naked DNA in B-form (the configuration thought to be most biologically relevant) the effectiveness of tritium for SSB and DSB production is, within statistical uncertainties, comparable to photon radiation with energies in the range 70 keV-1 MeV, although a tendency for increased DSB production has been observed for 70 keV photons that represent orthovoltage X-rays and for tritium beta particles. It is predicted that hydroxyl

儿童视屏行为和家庭相关因素与儿童体重指数的关系%Study on the relations among the screen-based sedentary behaviors, family factors and body mass index of children

Institute of Scientific and Technical Information of China (English)

韦冬梅; 吴丽晶; 高爱钰; 李钦; 程兰; 王海俊

2015-01-01

目的：：研究儿童视屏行为和家庭相关因素与儿童体重指数( body mass index,BMI)的关系,以及家庭相关因素如何通过影响儿童视屏行为而作用于儿童BMI。方法：选择北京市某城区12所小学7~11岁共1846名学生作为研究对象,对学生进行身高、体重测量,计算BMI。通过问卷调查学生的视屏行为时间及其相关的家庭因素。儿童的视屏行为时间是学生回忆过去7 d平均每天看电视/视频的时间和使用电脑/游戏机/iPad的时间。调查可能与儿童视屏行为相关的家庭因素,包括父母的文化程度、职业、视屏行为时间、父母是否告诉儿童视屏行为的不良影响、父母限制儿童视屏行为时间。由父母文化程度和职业计算得到家庭社会经济地位评分。结果：儿童视屏行为时间的中位数为1 h/d,四分位间距为1 h/d。父母限制视屏行为时间<120 min/d者与父母限制视屏行为时间≥120 min/d者相比,男生BMI降低了1.63 kg/m2(P<0.001),女生降低了0.85 kg/m2(P=0.004)。家庭经济地位评分、父母视屏行为时间、父母是否告诉儿童视屏行为的不良影响与儿童的BMI无关。男、女生视屏行为时间在父母限制儿童视屏行为时间和男、女生 BMI 关系的中介效应值分别为-0.222 kg/m2(95%CI：-0.432,-0.095)、-0.187 kg/m2(95%CI：-0.507,-0.049),中介效应占总效应的比例分别为13.67%、22.11%。结论：父母限制儿童视屏行为时间通过影响儿童视屏行为时间而作用于儿童BMI。家长对儿童的教育对儿童BMI的作用不如家长对儿童行为的监督。所以,在今后儿童肥胖的预防和控制工作中,家长参与监督儿童的行为是必不可少的。%Objective:To explore the relations among screen-based sedentary behaviors ( SSB) , family factors and body mass index ( BMI) of children, and to study how family factors have effect on BMI through influencing SSB. Methods:A total of 1 846

Changes in prices, sales, consumer spending, and beverage consumption one year after a tax on sugar-sweetened beverages in Berkeley, California, US: A before-and-after study.

Directory of Open Access Journals (Sweden)

Lynn D Silver

2017-04-01

Full Text Available Taxes on sugar-sweetened beverages (SSBs meant to improve health and raise revenue are being adopted, yet evaluation is scarce. This study examines the association of the first penny per ounce SSB excise tax in the United States, in Berkeley, California, with beverage prices, sales, store revenue/consumer spending, and usual beverage intake.Methods included comparison of pre-taxation (before 1 January 2015 and first-year post-taxation (1 March 2015-29 February 2016 measures of (1 beverage prices at 26 Berkeley stores; (2 point-of-sale scanner data on 15.5 million checkouts for beverage prices, sales, and store revenue for two supermarket chains covering three Berkeley and six control non-Berkeley large supermarkets in adjacent cities; and (3 a representative telephone survey (17.4% cooperation rate of 957 adult Berkeley residents. Key hypotheses were that (1 the tax would be passed through to the prices of taxed beverages among the chain stores in which Berkeley implemented the tax in 2015; (2 sales of taxed beverages would decline, and sales of untaxed beverages would rise, in Berkeley stores more than in comparison non-Berkeley stores; (3 consumer spending per transaction (checkout episode would not increase in Berkeley stores; and (4 self-reported consumption of taxed beverages would decline. Main outcomes and measures included changes in inflation-adjusted prices (cents/ounce, beverage sales (ounces, consumers' spending measured as store revenue (inflation-adjusted dollars per transaction in two large chains, and usual beverage intake (grams/day and kilocalories/day. Tax pass-through (changes in the price after imposition of the tax for SSBs varied in degree and timing by store type and beverage type. Pass-through was complete in large chain supermarkets (+1.07¢/oz, p = 0.001 and small chain supermarkets and chain gas stations (1.31¢/oz, p = 0.004, partial in pharmacies (+0.45¢/oz, p = 0.03, and negative in independent corner stores and

Inelastic scattering in resonant tunneling

DEFF Research Database (Denmark)

Wingreen, Ned S.; Jacobsen, Karsten Wedel; Wilkins, John W.

1989-01-01

The exact resonant-tunneling transmission probability for an electron interacting with phonons is presented in the limit that the elastic coupling to the leads is independent of energy. The phonons produce transmission sidebands but do not affect the integrated transmission probability or the esc......The exact resonant-tunneling transmission probability for an electron interacting with phonons is presented in the limit that the elastic coupling to the leads is independent of energy. The phonons produce transmission sidebands but do not affect the integrated transmission probability...

Microwave Schottky diagnostic systems for the Fermilab Tevatron, Recycler, and CERN Large Hadron Collider

Directory of Open Access Journals (Sweden)

Ralph J. Pasquinelli

2011-07-01

Full Text Available A means for noninvasive measurement of transverse and longitudinal characteristics of bunched beams in synchrotrons has been developed based on high sensitivity slotted waveguide pickups. The pickups allow for bandwidths exceeding hundreds of MHz while maintaining good beam sensitivity characteristics. Wide bandwidth is essential to allow bunch-by-bunch measurements by means of a fast gate. The Schottky detector system is installed and successfully commissioned in the Fermilab Tevatron, Recycler and CERN LHC synchrotrons. Measurement capabilities include tune, chromaticity, and momentum spread of single or multiple beam bunches in any combination. With appropriate calibrations, emittance can also be measured by integrating the area under the incoherent tune sidebands.

Orbital State Manipulation of a Diamond Nitrogen-Vacancy Center Using a Mechanical Resonator

Science.gov (United States)

Chen, H. Y.; MacQuarrie, E. R.; Fuchs, G. D.

2018-04-01

We study the resonant optical transitions of a single nitrogen-vacancy (NV) center that is coherently dressed by a strong mechanical drive. Using a gigahertz-frequency diamond mechanical resonator that is strain coupled to a NV center's orbital states, we demonstrate coherent Raman sidebands out to the ninth order and orbital-phonon interactions that mix the two excited-state orbital branches. These interactions are spectroscopically revealed through a multiphonon Rabi splitting of the orbital branches which scales as a function of resonator driving amplitude and is successfully reproduced in a quantum model. Finally, we discuss the application of mechanical driving to engineering NV-center orbital states.

Terahertz bandwidth photonic Hilbert transformers based on synthesized planar Bragg grating fabrication.

Science.gov (United States)

Sima, Chaotan; Gates, J C; Holmes, C; Mennea, P L; Zervas, M N; Smith, P G R

2013-09-01

Terahertz bandwidth photonic Hilbert transformers are proposed and experimentally demonstrated. The integrated device is fabricated via a direct UV grating writing technique in a silica-on-silicon platform. The photonic Hilbert transformer operates at bandwidths of up to 2 THz (~16 nm) in the telecom band, a 10-fold greater bandwidth than any previously reported experimental approaches. Achieving this performance requires detailed knowledge of the system transfer function of the direct UV grating writing technique; this allows improved linearity and yields terahertz bandwidth Bragg gratings with improved spectral quality. By incorporating a flat-top reflector and Hilbert grating with a waveguide coupler, an ultrawideband all-optical single-sideband filter is demonstrated.

Modeling and Optimization of a High-Tc Hot-Electron Superconducting Mixer for Terahertz Applicaitons

Science.gov (United States)

Karasik, B. S.; McGrath, W. R.; Gaidis, M. C.; Burns, M. J.; Kleinsasser, A. W.; Delin, K. A.; Vasquez, R. P.

1996-01-01

The development of a YBa(sub 2)Cu(sub 3)O(sub 7-(kronecker delta))(YBCO) hot-electron bolometer (HEB) quasioptical mixer for a 2.5 heterodyne receiver is discussed. The modeled device is a submicron bridge made from a 10 nm thick film on a high thermal conductance substrate. The mixer performance expected for this device is analyzed in the framework of a two-temperature model which includes heating both of the electrons and the lattice. Also, the contribution of heat diffusion from the film through the substrate and from the film to the normal metal contacts is evaluated....a single sideband temperature of less than 2000k is predicted.

METHOD AND MODULE FOR OPTICAL SUBCARRIER LABELLING

DEFF Research Database (Denmark)

2004-01-01

The present invention relates to optical labelling in WDM networks, in that it provides a method and a module to be used in subcarrier label generation and switching in network edge nodes and core switch nodes. The methods and modules are typically employed in Optical Subcarrier Multiplexing (OSCM......) transmitters. The payload and the label are encoded independently on optical carrier and subcarrier signals respectively, using electro-optical modulators. The invention applies single or double sideband carrier-suppressed modulation to generate subcarrier signals for encoding of the label. Thereby the payload...... encoded carrier signal and the label encoded subcarrier signal can be coupled directly without prior filtering....

Water quality assessment in the "German River of the years 2014/2015": how a case study on the impact of a storm water sedimentation basin displayed impairment of fish health in the Argen River (Southern Germany).

Science.gov (United States)

Thellmann, Paul; Kuch, Bertram; Wurm, Karl; Köhler, Heinz-R; Triebskorn, Rita

2017-01-01

The present work investigates the impact of discharges from a storm water sedimentation basin (SSB) receiving runoff from a connected motorway in southern Germany. The study lasted for almost two years and was aimed at assessing the impact of the SSB on the fauna of the Argen River, which is a tributary of Lake Constance. Two sampling sites were examined up- and downstream of the SSB effluent. A combination of different diagnostic methods (fish embryo test with the zebrafish, histopathology, micronucleus test) was applied to investigate health impairment and genotoxic effects in indigenous fish as well as embryotoxic potentials in surface water and sediment samples of the Argen River, respectively, in samples of the SSB effluent. In addition, sediment samples from the Argen River and tissues of indigenous fish were used for chemical analyses of 33 frequently occurring pollutants by means of gas chromatography. Furthermore, the integrity of the macrozoobenthos community and the fish population were examined at both investigated sampling sites. The chemical analyses revealed a toxic burden with trace substances (originating from traffic and waste water) in fish and sediments from both sampling sites. Fish embryo tests with native sediment and surface water samples resulted in various embryotoxic effects in exposed zebrafish embryos (Fig. 1). In addition, the health condition of the investigated fish species (e.g., severe alterations in the liver and kidney) provided clear evidence of water contamination at both Argen River sites (Fig. 2). At distinct points in time, some parameters (fish development, kidney and liver histopathology) indicated stronger effects at the sampling site downstream of the SSB effluent than at the upstream site. Our results clearly showed that the SSB cannot be assigned as the main source of pollutants that are released into the investigated Argen River section. Moreover, we showed that there is moderate background pollution with substances

An Experimental Investigation of the Acoustic and Fluid Dynamic Characteristics of a Circulation-Controlled Airfoil

Science.gov (United States)

2011-05-13

insight regarding these trailing edge sources, beam maps from opposite side blowing measurements ( OSB ) are compared with SSB measurements in Figures 64 to...maps (B, D, F) corresponds to OSB . To reiterate, the array is located on the same side as the blowing slot for the SSB cases. The same and opposite...slot blowing beam maps at 992 Hz, shown in Figure 64, are nearly undistinguishable, but it is interesting that the levels are slightly higher for OSB

Racial Disparities in Sugar-Sweetened Beverage Consumption Change Efficacy Among Male First-Year College Students.

Science.gov (United States)

Bruce, Marino A; Beech, Bettina M; Thorpe, Roland J; Griffith, Derek M

2016-11-01

Racial disparities in weight-related outcomes among males may be linked to differences in behavioral change efficacy; however, few studies have pursued this line of inquiry. The purpose of this study was to determine the degree to which self-efficacy associated with changing sugar-sweetened beverage (SSB) consumption intake varies by race among male first-year college students. A self-administered, cross-sectional survey was completed by a subsample of freshmen males (N = 203) at a medium-sized southern university. Key variables of interest were SSB intake and self-efficacy in reducing consumption of sugared beverages. African American and Whites had similar patterns of SSB intake (10.2 ± 2.8 vs. 10.1 ± 2.6); however, African Americans had lower proportions of individuals who were sure they could substitute sugared beverages with water (42.2% vs. 57.5%, p obesity-related diseases. © The Author(s) 2015.

District Policies and Practices Vary in Their Association With Adolescents' Consumption of Milk and 100% Fruit Juice.

Science.gov (United States)

Sliwa, Sarah A; Miller, Gabrielle F; Brener, Nancy D; Park, Sohyun; Merlo, Caitlin L

2017-05-01

Researchers previously examined the relationship between school beverage policies and sugar-sweetened beverage (SSB) consumption. This study addressed a research gap by examining cross-sectional associations between district-level policies and practices and U.S. high school students' consumption of milk and 100% fruit juice. Data from the 2012 School Health Policies and Practices Study and 2013 Youth Risk Behavior Surveillance System were linked for 12 large urban school districts. Outcome variables were daily milk consumption (≥1 glass/day) and 100% fruit juice consumption (≥1 time/day). Exposure variables were five district policies (i.e., restrict SSB sales, maintain closed campuses, offer/sell healthful alternatives, restrict promotional products, and require nutrition education). Logistic regression models estimated the odds of consuming milk or 100% fruit juice daily, conditional on the policies and adjusting for sex, race/ethnicity, grade level, weight status, and district free/reduced-price lunch eligibility (n = 23,173). Students in districts that required/recommended restricting the times of SSB sales had 55% higher (adjusted odds ratio [AOR], 1.55; 95% confidence interval [CI], 1.28-1.87) odds of consuming ≥1 glass/day of milk than students in districts without this policy. Closed campus policies were associated with lower odds of consuming milk (AOR, .72; 95% CI, .63-.82) and higher odds of consuming juice (AOR, 1.27; 95% CI, 1.07-1.50). Policies requiring/recommending that districts offer/sell healthful alternatives were associated with lower odds of consuming 100% fruit juice daily. Results suggest that restricting SSB sales may support adolescents' milk consumption. Future studies should assess whether the implementation of federal standards that further restrict SSB sales in school leads to increased milk consumption. Published by Elsevier Inc.

The relationship between sugar-sweetened beverages and liver enzymes among healthy premenopausal women: a prospective cohort study.

Science.gov (United States)

Shimony, Maya K; Schliep, Karen C; Schisterman, Enrique F; Ahrens, Katherine A; Sjaarda, Lindsey A; Rotman, Yaron; Perkins, Neil J; Pollack, Anna Z; Wactawski-Wende, Jean; Mumford, Sunni L

2016-03-01

To prospectively assess the association between sugar-sweetened beverages (SSB), added sugar, and total fructose and serum concentrations of liver enzymes among healthy, reproductive-age women. A prospective cohort of 259 premenopausal women (average age 27.3 ± 8.2 years; BMI 24.1 ± kg/m(2)) were followed up for up to two menstrual cycles, providing up to eight fasting blood specimens/cycle and four 24-h dietary recalls/cycle. Women with a history of chronic disease were excluded. Alanine and aspartate aminotransferases (ALT and AST, respectively) were measured in serum samples. Linear mixed models estimated associations between average SSB, added sugar, and total fructose intake and log-transformed liver enzymes adjusting for age, race, body mass index, total energy and alcohol intake, and Mediterranean diet score. For every 1 cup/day increase in SSB consumption and 10 g/day increase in added sugar and total fructose, log ALT increased by 0.079 U/L (95 % CI 0.022, 0.137), 0.012 U/L (95 % CI 0.002, 0.022), and 0.031 (0.012, 0.050), respectively, and log AST increased by 0.029 U/L (-0.011, 0.069), 0.007 U/L (0.000, 0.014), and 0.017 U/L (0.004, 0.030), respectively. Women who consumed ≥1.50 cups/day (12 oz can) SSB versus less had 0.127 U/L (95 % CI 0.001, 0.254) higher ALT [percent change 13.5 % (95 % CI 0.1, 28.9)] and 0.102 (95 % CI 0.015, 0.190) higher AST [percent change 10.8 % (95 % CI 1.5, 20.9)]. Sugar-sweetened beverages were associated with higher serum ALT and AST concentrations among healthy premenopausal women, indicating that habitual consumption of even moderate SSB may elicit hepatic lipogenesis.

Sweetened beverage intake in association to energy and sugar consumption and cardiometabolic markers in children.

Science.gov (United States)

Seferidi, P; Millett, C; Laverty, A A

2018-04-01

Artificially sweetened beverages (ASBs) are promoted as healthy alternatives to sugar-sweetened beverages (SSBs) in order to reduce sugar intake, but their effects on weight control and glycaemia have been debated. This study examines associations of SSBs and ASBs with energy and sugar intake and cardiometabolic measures. One thousand six hundred eighty-seven children aged 4-18 participated in the National Diet and Nutrition Survey Rolling Programme (2008/9-2011/12) in the UK. Linear regression was used to examine associations between SSBs and ASBs and energy and sugar, overall and from solid foods and beverages, and body mass index, waist-to-hip ratio and blood analytes. Fixed effects linear regression examined within-person associations with energy and sugar. Compared with non-consumption, SSB consumption was associated with higher sugar intake overall (6.1%; 4.2, 8.1) and ASB consumption with higher sugar intake from solid foods (1.7%; 0.5, 2.9) but not overall, mainly among boys. On SSB consumption days, energy and sugar intakes were higher (216 kcal; 163, 269 and 7.0%; 6.2, 7.8), and on ASB consumption days, sugar intake was lower (-1.0%; -1.8, -0.1) compared with those on non-consumption days. SSB and ASB intakes were associated with higher levels of blood glucose (SSB: 0.30 mmol L -1 ; 0.11, 0.49 and ASB: 0.24 mmol L -1 ; 0.06, 0.43) and SSB intake with higher triglycerides (0.29 mmol L -1 ; 0.13, 0.46). No associations were found with other outcomes. Sugar-sweetened beverage intake was associated with higher sugar intake and both SSBs and ASBs with a less healthy cardiometabolic profile. These findings add to evidence that health policy should discourage all sweetened beverage consumption. © 2017 World Obesity Federation.

Protective role of OH scavengers and DNA/chromatin organization in the induction of DNA breaks: mechanistic models and Monte Carlo simulations

International Nuclear Information System (INIS)

Ballarini, F.; Rossetti, M.; Scannicchio, D.; Jacob, P.; Molinelli, S.; Ottolenghi, A.; Volata, A.

2003-01-01

Radiation-induced DNA damage can be modulated by various factors, including the environment scavenging capacity (SC) and the DNA organization within the cell nucleus (chromatin compactness, DNA-binding proteins etc.). In this context the induction of ssb and dsb by photons and light ions of different energies impinging on different DNA structures (e.g. linear DNA, SV40 'minichromosomes' and cellular DNA) at different OH-radical SC values was modelled with the Monte Carlo PARTRAC code. Presently PARTRAC can transport electrons, photons, protons and alpha particles in liquid water with an 'event-by-event' approach, and can simulate the DNA content of mammalian cells with an 'atom-by-atom' description, from nucleotide pairs to chromatin fibre loops and chromosome territories. Energy depositions in the sugar-phosphate were considered as potential (direct) ssb. The production, diffusion and reaction of chemical species were explicitly simulated; reactions of OH radicals with the sugar-phosphate were assumed to lead to 'indirect' ssb with probability 65%. Two ssb on opposite strands within 10 bp were considered as a dsb. Yields of ssb and dsb/Gy/Dalton were calculated for different DNA structures as a function of the OH mean life time. By Zyuzikov, N.; Michael, B.D. (Gray Cancer Institute, (GB)); Wu, L. (Ch Zyuzdirect damage yields. In general, also depending on radiation quality, linear DNA was found to be more susceptible to strand breakage than SV40 minichromosomes, which in turn showed higher damage yields with respect to cellular DNA. The very good agreement found with available experimental data provided a validation of the model and allowed us to quantify separately the protective effect of OH scavengers and DNA/chromatin organization. Comparisons with data on nucleoids (DNA unfolded and depleted of histones) suggested that the experimental procedures used to obtain such targets might lower the environment SC, due to the loss of cellular scavenging compounds

MoS2-wrapped microfiber-based multi-wavelength soliton fiber laser

Science.gov (United States)

Lu, Feifei

2017-11-01

The single-, dual- and triple-wavelength passively mode-locked erbium-doped fiber lasers are demonstrated with MoS2 and polarization-dependent isolator (PD-ISO). The saturable absorber is fabricated by wrapping an MoS2 around a microfiber. The intracavity PD-ISO acts as a wavelength-tunable filter with a polarization controller (PC) by adjusting the linear birefringence. Single-wavelength mode-locked fiber laser can self-start with suitable pump power. With appropriate PC state, dual- and triple-wavelength operations can be observed when gains at different wavelengths reach a balance. It is noteworthy that dual-wavelength pulses exhibiting peak and dip sidebands, respectively, are demonstrated in the experiment. The proposed simple and multi-wavelength all-fiber conventional soliton lasers could possess potential applications in numerous fields, such as sensors, THz generations and optical communications.

Plain Water and Sugar-Sweetened Beverage Consumption in Relation to Energy and Nutrient Intake at Full-Service Restaurants.

Science.gov (United States)

An, Ruopeng

2016-05-04

Drinking plain water, such as tap or bottled water, provides hydration and satiety without adding calories. We examined plain water and sugar-sweetened beverage (SSB) consumption in relation to energy and nutrient intake at full-service restaurants. Data came from the 2005-2012 National Health and Nutrition Examination Survey, comprising a nationally-representative sample of 2900 adults who reported full-service restaurant consumption in 24-h dietary recalls. Linear regressions were performed to examine the differences in daily energy and nutrient intake at full-service restaurants by plain water and SSB consumption status, adjusting for individual characteristics and sampling design. Over 18% of U.S. adults had full-service restaurant consumption on any given day. Among full-service restaurant consumers, 16.7% consumed SSBs, 2.6% consumed plain water but no SSBs, and the remaining 80.7% consumed neither beverage at the restaurant. Compared to onsite SSB consumption, plain water but no SSB consumption was associated with reduced daily total energy intake at full-service restaurants by 443.4 kcal, added sugar intake by 58.2 g, saturated fat intake by 4.4 g, and sodium intake by 616.8 mg, respectively. Replacing SSBs with plain water consumption could be an effective strategy to balance energy/nutrient intake and prevent overconsumption at full-service restaurant setting.

Plain Water and Sugar-Sweetened Beverage Consumption in Relation to Energy and Nutrient Intake at Full-Service Restaurants

Directory of Open Access Journals (Sweden)

Ruopeng An

2016-05-01

Full Text Available Background: Drinking plain water, such as tap or bottled water, provides hydration and satiety without adding calories. We examined plain water and sugar-sweetened beverage (SSB consumption in relation to energy and nutrient intake at full-service restaurants. Methods: Data came from the 2005–2012 National Health and Nutrition Examination Survey, comprising a nationally-representative sample of 2900 adults who reported full-service restaurant consumption in 24-h dietary recalls. Linear regressions were performed to examine the differences in daily energy and nutrient intake at full-service restaurants by plain water and SSB consumption status, adjusting for individual characteristics and sampling design. Results: Over 18% of U.S. adults had full-service restaurant consumption on any given day. Among full-service restaurant consumers, 16.7% consumed SSBs, 2.6% consumed plain water but no SSBs, and the remaining 80.7% consumed neither beverage at the restaurant. Compared to onsite SSB consumption, plain water but no SSB consumption was associated with reduced daily total energy intake at full-service restaurants by 443.4 kcal, added sugar intake by 58.2 g, saturated fat intake by 4.4 g, and sodium intake by 616.8 mg, respectively. Conclusion: Replacing SSBs with plain water consumption could be an effective strategy to balance energy/nutrient intake and prevent overconsumption at full-service restaurant setting.

The government policy related to sugar-sweetened beverages in Indonesia

OpenAIRE

Mohamad Thahir Haning; Andi Imam Arundhana; Asry Dwi Muqni

2016-01-01

Background: There are several options to enforce reduction in the use of sugary drinks such as strengthening regulations, taxation on the products and food labeling.  Aims & Objectives: 1) Identify the policy in Indonesia that regulates the quantity and the use of sugar in a beverage product; 2) Describe the sugar content in sugar-sweetened beverages (SSB) and its impact on human health. Material & Methods: Literature search on sugar use and tax policies on SSB was conducted and 6 rel...

The government policy related to sugar-sweetened beverages In Indonesia

OpenAIRE

Arundhana, Andi Imam

2016-01-01

- There are several options that can be done to enforce lowering level of sugary drinks such as strengthening the regulation, taxation of the product and food labeling. Aims & Objectives: identify the policy in Indonesia that regulates the quantity and the use of sugar in a beverage product; 2) describe sugar content in a sugar-sweetened beverages (SSB) product and its impact on human health. Material & Methods: Literature search of sugar use and the tax policies of SSB products has been c...